Food preferences of wild house-mice (Mus musculus L.)*

Science.gov (United States)

Rowe, F. P.; Bradfield, A.; Redfern, R.

1974-01-01

The relative acceptance of various plain foods by wild house-mice (Mus musculus L.) was compared in laboratory choice tests. The palatability of glycerine and six oils, each included at 5% in pinhead oatmeal, was compared in a similar manner. The most favoured food was found to be whole canary seed (Phalaris canariensis). Pinhead oatmeal and wheat were also comparatively well accepted. Glycerine, corn oil, arachis oil and mineral oil were more palatable than either olive, linseed or cod-liver oils. The results of the choice tests are considered in relation to the use of poison baits for the control of free-living mice. PMID:4531454

Analysis of Copy Number Variation in the Abp Gene Regions of Two House Mouse Subspecies Suggests Divergence during the Gene Family Expansions.

Science.gov (United States)

Pezer, Željka; Chung, Amanda G; Karn, Robert C; Laukaitis, Christina M

2017-06-01

The Androgen-binding protein ( Abp ) gene region of the mouse genome contains 64 genes, some encoding pheromones that influence assortative mating between mice from different subspecies. Using CNVnator and quantitative PCR, we explored copy number variation in this gene family in natural populations of Mus musculus domesticus ( Mmd ) and Mus musculus musculus ( Mmm ), two subspecies of house mice that form a narrow hybrid zone in Central Europe. We found that copy number variation in the center of the Abp gene region is very common in wild Mmd , primarily representing the presence/absence of the final duplications described for the mouse genome. Clustering of Mmd individuals based on this variation did not reflect their geographical origin, suggesting no population divergence in the Abp gene cluster. However, copy number variation patterns differ substantially between Mmd and other mouse taxa. Large blocks of Abp genes are absent in Mmm , Mus musculus castaneus and an outgroup, Mus spretus , although with differences in variation and breakpoint locations. Our analysis calls into question the reliance on a reference genome for interpreting the detailed organization of genes in taxa more distant from the Mmd reference genome. The polymorphic nature of the gene family expansion in all four taxa suggests that the number of Abp genes, especially in the central gene region, is not critical to the survival and reproduction of the mouse. However, Abp haplotypes of variable length may serve as a source of raw genetic material for new signals influencing reproductive communication and thus speciation of mice. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Novel laboratory mouse papillomavirus (MusPV) infection.

Science.gov (United States)

Ingle, A; Ghim, S; Joh, J; Chepkoech, I; Bennett Jenson, A; Sundberg, J P

2011-03-01

Most papillomaviruses (PVs) are oncogenic. There are at least 100 different human PVs and 65 nonhuman vertebrate hosts, including wild rodents, which have species-specific PV infections. Florid papillomatosis arose in a colony of NMRI-Foxn1(nu)/Foxn1(nu) (nude) mice at the Advanced Centre for Treatment Research and Education in Cancer in India. Lesions appeared at the mucocutaneous junctions of the nose and mouth. Histologically, lesions were classical papillomas with epidermal hyperplasia on thin fibrovascular stalks in a verrucous pattern. Koilocytotic cells were observed in the stratum granulosum of the papillomatous lesions. Immunohistochemically, these abnormal cells were positive for PV group-specific antigens. With transmission electron microscopy, virus particles were observed in crystalline intranuclear inclusions within keratinocytes. The presence of a mouse PV, designated MusPV, was confirmed by amplification of PV DNA with degenerative primers specific for PVs. This report is the first of a PV and its related disease in laboratory mice.

A pronounced evolutionary shift of the pseudoautosomal region boundary in house mice.

Science.gov (United States)

White, Michael A; Ikeda, Akihiro; Payseur, Bret A

2012-08-01

The pseudoautosomal region (PAR) is essential for the accurate pairing and segregation of the X and Y chromosomes during meiosis. Despite its functional significance, the PAR shows substantial evolutionary divergence in structure and sequence between mammalian species. An instructive example of PAR evolution is the house mouse Mus musculus domesticus (represented by the C57BL/6J strain), which has the smallest PAR among those that have been mapped. In C57BL/6J, the PAR boundary is located just ~700 kb from the distal end of the X chromosome, whereas the boundary is found at a more proximal position in Mus spretus, a species that diverged from house mice 2-4 million years ago. In this study we used a combination of genetic and physical mapping to document a pronounced shift in the PAR boundary in a second house mouse subspecies, Mus musculus castaneus (represented by the CAST/EiJ strain), ~430 kb proximal of the M. m. domesticus boundary. We demonstrate molecular evolutionary consequences of this shift, including a marked lineage-specific increase in sequence divergence within Mid1, a gene that resides entirely within the M. m. castaneus PAR but straddles the boundary in other subspecies. Our results extend observations of structural divergence in the PAR to closely related subspecies, pointing to major evolutionary changes in this functionally important genomic region over a short time period.

Population genetic structure in a Robertsonian race of house mice: evidence from microsatellite polymorphism

NARCIS (Netherlands)

Dallas, J.F.; Bonhomme, F.; Boursot, P.; Britton-Davidian, J.; Bauchau, V.

1998-01-01

Genetic evidence was assessed for inbreeding and population subdivision in a Robertsonian fusion (Rb) race of the western European form of house mouse, Mus musculus domesticus, in central Belgium. Inbreeding, and the factors responsible for subdivision (genetic drift and extinction-recolonization)

Of mice and (Viking?) men: phylogeography of British and Irish house mice

OpenAIRE

Searle, Jeremy B.; Jones, Catherine S.; Gündüz, İslam; Scascitelli, Moira; Jones, Eleanor P.; Herman, Jeremy S.; Rambau, R. Victor; Noble, Leslie R.; Berry, R.J.; Giménez, Mabel D.; Jóhannesdóttir, Fríða

2008-01-01

The west European subspecies of house mouse (Mus musculus domesticus) has gained much of its current widespread distribution through commensalism with humans. This means that the phylogeography of M. m. domesticus should reflect patterns of human movements. We studied restriction fragment length polymorphism (RFLP) and DNA sequence variations in mouse mitochondrial (mt) DNA throughout the British Isles (328 mice from 105 localities, including previously published data). There is a major mtDNA...

The role of salivary androgen-binding protein in reproductive isolation between two subspecies of house mouse: Mus musculus musculus and Mus musculus domesticus

Czech Academy of Sciences Publication Activity Database

Bímová, Barbora; Karn, R. C.; Piálek, Jaroslav

2005-01-01

Roč. 84, č. 3 (2005), s. 349-361 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA AV ČR IAA6093201; GA AV ČR IAA6045902 Grant - others:National Research Council(US) COBASE Institutional research plan: CEZ:AV0Z6093917 Keywords : assortative mating * hybrid zone * sexual selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

Detailed ordering of markers localizing to the Xq26-Xqter region of the human X chromosome by the use of an interspecific Mus spretus mouse cross

International Nuclear Information System (INIS)

Avner, P.; Amar, L.; Arnaud, D.; Hanauer, A.; Cambrou, J.

1987-01-01

Five probes localizing to the Xq26-Xqter region of the human X chromosome have been genetically mapped on the mouse X chromosome using an interspecific cross involving Mus spretus to a contiguous region lying proximally to the Tabby (Ta) locus. Pedigree and recombinational analysis establish the marker order as being Hprt-FIX-c11-G6PD-St14-1. The size of this contiguous region is such that the X-linked muscular dystrophy (mdx) mouse mutation probably maps within this segment. This in turn suggests that it is highly improbable that the mouse mdx locus represents a model for Duchenne muscular dystrophy (DMD). It is, however, compatible with the idea that this mutation may correspond in man to Emery Dreifuss muscular dystrophy. The high frequency of restriction fragment length polymorphisms found in this interspecific system for all the human cross-reacting probes examined up until now, using only a limited number of restriction enzymes, suggests that the Mus spretus mapping system may be of great potential value for establishing the linkage relationships existing in man when conserved chromosomal regions are concerned and human/mouse cross-reacting probes are available or can be obtained

A new chromosomal race of the house mouse, Mus musculus domesticus, in the Vulcano Island-Aeolian Archipelago, Italy.

Science.gov (United States)

Solano, Emanuela; Castiglia, Riccardo; Corti, Marco

2007-07-01

In this paper we describe a new Robertsonian (Rb) race of the house mouse from Vulcano (Aeolian archipelago) through the identification of the metacentric chromosomes. We analysed fifteen mice. All the specimens were found to have the same karyotype 2n=26. This karyotype is characterized by Rb(1.2), Rb(3.9), Rb(4.13), Rb(5.14), Rb(8.12), Rb(10.16) and Rb(15.17). The differences between the race of Vulcano and the races in a neighbour island (Lipari) consist in the presence of Rb(10.16) and Rb(15.17) in the former and Rb(6.16) and Rb(10.15) in the latter. We discuss the possible hypotheses regarding the origin between these two races including the possible occurrence of a whole arm reciprocal translocation (WART) on the Vulcano island.

Mitochondrial DNA sequence variation and evolution of Old World house mice (Mus musculus)

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš; Mrkvicová Vyskočilová, Martina; Bejček, V.; Šťastný, K.

2012-01-01

Roč. 61, 3-4 (2012), s. 284-307 ISSN 0139-7893 R&D Projects: GA ČR GA206/06/0707; GA ČR GA206/08/0640 Institutional support: RVO:67985904 Keywords : Bayesian skyline plot * control region * house mouse Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

Mottled Neuherberg (Mo sup(N)), a new male-lethal coat colour mutation of the house mouse (Mus musculus)

International Nuclear Information System (INIS)

Schroeder, J.H.

1975-01-01

A new semidominant X-chromosomal mutation, Mottled Neuherberg (Mo sup(N)), which causes coat colour variegation is described. Mo sup(N) arose in the second postirradiation generation after 2 x 200 R of X-rays (24 hours apart) to oocytes of X/O mice. Heterozygous Mo sup(N) females have irregular patches of fully and lightly coloured fur over the whole coat with curly vibrissae. Their viability is reduced, about 3% of the heterozygotes dying prenatally and 6 to 28% dying postnatally before weaning. Survivors are fertile without externally visible abnormalities. Hemizygous Mo sup(N) males die in utero after implantation. The recombination frequency between Mo sup(N) and tabby (Ta) was 3.65 +- 3.16% (with 95% -confidence limits). Therefore, it is suggested that Mo sup(N) is a new allele of the mottled (Mo) locus of the house mouse. Mo sup(N)-bearing ova seem to have a lower chance of becoming fertilized by wild-type spermatozoa than by Ta-bearing spermatozoa. (orig.) [de

Subspecies-specific response to ACTH challenge test in the house mouse (Mus musculus)

Czech Academy of Sciences Publication Activity Database

Daniszová, Kristina; Mikula, O.; Macholán, M.; Pospíšilová, I.; Vošlajerová Bímová, Barbora; Hiadlovská, Z.

2017-01-01

Roč. 252, October (2017), s. 186-192 ISSN 0016-6480 R&D Projects: GA ČR GAP506/11/1792 Institutional support: RVO:68081766 Keywords : ACTH challenge * Endocrine activity * Corticosterone * Hormone metabolites * Mouse * Noninvasive monitoring Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.585, year: 2016

Subspecies-specific response to ACTH challenge test in the house mouse (Mus musculus)

Czech Academy of Sciences Publication Activity Database

Daniszová, K.; Mikula, Ondřej; Macholán, Miloš; Pospíšilová, I.; Vošlajerová Bímová, Barbora; Hiadlovská, Zuzana

2017-01-01

Roč. 252, October (2017), s. 186-192 ISSN 0016-6480 R&D Projects: GA ČR GAP506/11/1792 Institutional support: RVO:67985904 Keywords : ACTH challenge * endocrine activity * corticosterone * hormone metabolities * mouse * noninvasive monitoring Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.585, year: 2016

78 FR 64002 - South Farallon Islands Invasive House Mouse Eradication Project; Farallon National Wildlife...

Science.gov (United States)

2013-10-25

...-FF08RSFC00] South Farallon Islands Invasive House Mouse Eradication Project; Farallon National Wildlife... Statement (revised DEIS) for the South Farallon Islands Invasive House Mouse Eradication Project on the... non-native invasive house mice from the South Farallon Islands, part of the Farallon National Wildlife...

Early gene expression divergence between allopatric populations of the house mouse (Mus musculus domesticus).

Science.gov (United States)

Bryk, Jarosław; Somel, Mehmet; Lorenc, Anna; Teschke, Meike

2013-03-01

Divergence of gene expression is known to contribute to the differentiation and separation of populations and species, although the dynamics of this process in early stages of population divergence remains unclear. We analyzed gene expression differences in three organs (brain, liver, and testis) between two natural populations of Mus musculus domesticus that have been separated for at most 3000 years. We used two different microarray platforms to corroborate the results at a large scale and identified hundreds of genes with significant expression differences between the populations. We find that although the three tissues have similar number of differentially expressed genes, brain and liver have more tissue-specific genes than testis. Most genes show changes in a single tissue only, even when expressed in all tissues, supporting the notion that tissue-specific enhancers act as separable targets of evolution. In terms of functional categories, in brain and to a smaller extent in liver, we find transcription factors and their targets to be particularly variable between populations, similar to previous findings in primates. Testis, however, has a different set of differently expressed genes, both with respect to functional categories and overall correlation with the other tissues, the latter indicating that gene expression divergence of potential importance might be present in other datasets where no differences in fraction of differentially expressed genes were reported. Our results show that a significant amount of gene expression divergence quickly accumulates between allopatric populations.

Habitat use and demography of Mus musculus in a rural landscape of Argentina.

Science.gov (United States)

León, Vanina A; Fraschina, Jimena; Guidobono, Juan S; Busch, Maria

2013-04-01

The main goal of the paper was to determine the habitat distribution of the house mouse (Mus musculus) within a rural landscape of Buenos Aires province, Argentina. We also studied the seasonal variation in abundance and reproductive activity. The habitats studied were poultry farms, human houses in a small village, cropfields, pastures, cropfield and pasture edges, riparian habitats (streams), railway embankments and woodlots. We captured 817 M. musculus and 690 individuals of 5 native rodent species. M. musculus was captured in poultry farms, houses, riparian habitats, cropfield and borders, but it showed a significantly higher abundance in poultry farms compared to the other habitats. Its presence outside poultry farms was significantly related to the distance to streams and poultry farms. The mean trapping success index of M. musculus did not show significant variations between periods, but the proportion of active males was significantly higher in the spring-summer period than in the autumn-winter period. All captures of M. musculus in cropfields, borders and riparian habitats occurred in the spring-summer period. The capture of M. musculus in many types of habitats suggests that it can disperse outside poultry farms, and streams may be used as corridors. © 2012 Wiley Publishing Asia Pty Ltd, ISZS and IOZ/CAS.

A pronounced evolutionary shift of the pseudoautosomal region boundary in house mice

OpenAIRE

White, Michael A.; Ikeda, Akihiro; Payseur, Bret A.

2012-01-01

The pseudoautosomal region (PAR) is essential for the accurate pairing and segregation of the X and Y chromosomes during meiosis. Despite its functional significance, the PAR shows substantial evolutionary divergence in structure and sequence between mammalian species. An instructive example of PAR evolution is the house mouse Mus musculus domesticus (represented by the C57BL/6J strain), which has the smallest PAR among those that have been mapped. In C57BL/6J, the PAR boundary is located jus...

Nesting behavior of house mice (Mus domesticus) selected for increased wheel-running activity.

Science.gov (United States)

Carter, P A; Swallow, J G; Davis, S J; Garland, T

2000-03-01

Nest building was measured in "active" (housed with access to running wheels) and "sedentary" (without wheel access) mice (Mus domesticus) from four replicate lines selected for 10 generations for high voluntary wheel-running behavior, and from four randombred control lines. Based on previous studies of mice bidirectionally selected for thermoregulatory nest building, it was hypothesized that nest building would show a negative correlated response to selection on wheel-running. Such a response could constrain the evolution of high voluntary activity because nesting has also been shown to be positively genetically correlated with successful production of weaned pups. With wheel access, selected mice of both sexes built significantly smaller nests than did control mice. Without wheel access, selected females also built significantly smaller nests than did control females, but only when body mass was excluded from the statistical model, suggesting that body mass mediated this correlated response to selection. Total distance run and mean running speed on wheels was significantly higher in selected mice than in controls, but no differences in amount of time spent running were measured, indicating a complex cause of the response of nesting to selection for voluntary wheel running.

Comparison ecological characteristics of mound-building mouse (mus spicilegus in two natural hotbeds of tularemia at North-West coast of the Black sea

Directory of Open Access Journals (Sweden)

І. T. Rusev

2011-03-01

Full Text Available The analysis of ecology-epizootic monitoring of North-West coast of the Black sea carried out in wintering seasons of 2004, 2005 and 2011 testifies the basic role of the Mound-building mouse (Mus spicilegus Petenyi, 1882 as a carrier of Francisella tularensis. Spatial distribution of the Mound-building mouse strongly dependson a biotope, geographical region and weather conditions of a specific season. Mice nests in the storage mounds are located normally at a depth of 20–40 cm under the food storage chamber. Average number of the mice in storage mounds is 3.08 ± 1.54 in the south of investigated region and 3.88 ± 2.63 – in the NE of the region.

Tooth Morphogenesis and FGF4 Expression During Development of Molar Tooth in Three Muroid Rodents: Calomyscus elburzensis (Calomyscidae), Mesocricetus auratus (Cricetidae) and Mus musculus (Muridae).

Science.gov (United States)

Hamidi, Kordiyeh; Darvish, Jamshid; Matin, Maryam M; Javanmard, Athar Sadat; Kilpatrick, C William

2017-12-01

To date, no studies have examined the tooth formation during developmental stages of brush-tailed mice (Calomyscidae) and true hamsters (Cricetidae). Herein, we compared the timing of tooth morphogenesis and FGF4 expression pattern during development of the first lower molar in Goodwin's brush-tailed mouse, Calomyscus elburzensis with two other muroid rodents; the house mouse, Mus musculus (Muridae), model organism for tooth morphogenesis, and the golden hamster, Mesocricetus auratus which shares great similarities in cusp pattern with brush-tailed mice. All three species were bred in captivity and developing embryos were isolated at different embryonic days (E). Histological evaluation of lower molars was performed and spatiotemporal pattern of FGF4 expression was determined by immunohistochemistry. Results indicated that morphogenesis of the tooth cusps starts at the beginning of the cap stage of the first lower molar (E14 in house mouse, about E11.5 in golden hamster and E22 in Goodwin's brush-tailed mouse). During the cap to bell stage (E15 in house mouse, E12 in golden hamster and at about E24 in Goodwin's brush-tailed mouse), a decrease in the expression of FGF4 was observed in the mesenchyme, except for the cusp tips. According to our observations, the developmental process of the first lower molar formation in Goodwin's brush-tailed mouse began much later as compared with the other two species. Despite the differences in the temporal pattern of molar development between these three members of the same superfamily (Muroidea), the correlation in the expression of FGF4 with specific stages of tooth morphogenesis supported its regulatory function. Anat Rec, 300:2138-2149, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Genetic variation in house mice (Mus, Muridae, Rodentia) from the Czech and Slovak Republics

Czech Academy of Sciences Publication Activity Database

Šugerková, Monika; Munclinger, P.; Božíková, E.; Piálek, Jaroslav; Macholán, Miloš

2002-01-01

Roč. 51, č. 2 (2002), s. 81-92 ISSN 0139-7893 R&D Projects: GA AV ČR IAA6045601; GA AV ČR IAA6045902; GA ČR GA206/01/0989; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z5045916 Keywords : house mouse * genetic variation * allozymes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/2/081-092.pdf

How Random Is Social Behaviour? Disentangling Social Complexity through the Study of a Wild House Mouse Population

Science.gov (United States)

Perony, Nicolas; Tessone, Claudio J.; König, Barbara; Schweitzer, Frank

2012-01-01

Out of all the complex phenomena displayed in the behaviour of animal groups, many are thought to be emergent properties of rather simple decisions at the individual level. Some of these phenomena may also be explained by random processes only. Here we investigate to what extent the interaction dynamics of a population of wild house mice (Mus domesticus) in their natural environment can be explained by a simple stochastic model. We first introduce the notion of perceptual landscape, a novel tool used here to describe the utilisation of space by the mouse colony based on the sampling of individuals in discrete locations. We then implement the behavioural assumptions of the perceptual landscape in a multi-agent simulation to verify their accuracy in the reproduction of observed social patterns. We find that many high-level features – with the exception of territoriality – of our behavioural dataset can be accounted for at the population level through the use of this simplified representation. Our findings underline the potential importance of random factors in the apparent complexity of the mice's social structure. These results resonate in the general context of adaptive behaviour versus elementary environmental interactions. PMID:23209394

THE PATTERN OF THE AGGRESSIVE BEHAVIOR IN THE LABORATORY MOUSE (MUS MUSCULUS

Directory of Open Access Journals (Sweden)

Maria BUNEA

2010-01-01

Full Text Available Nature has found solutions for decreasing the aggressive impulse, using various inhibitory mechanisms as means of balancing the forces between two fighting individuals, thus avoiding it to lead to the destruction of their own species. These nature's “ pacifyng” solutions are mostly found in animals which are armed with various potentially lethal “weapons”, while in species that live on large territoires and thus have the possibility to avoid conflict, these mechanisms are poorly developed. The purpose of this research is to study the extent of the inhibitory mechanisms against aggression in the laboratory mouse, species in which these mechanisms of diminishing aggression and of avoiding conflicts don't work the same in artificial conditions, where individuals are forced to live in small areas, and to identify the behavioral chains that form the innate manifestations of the aggressive behavior in Mus musculus sp. The results of this study show that in the circumstance of caged individuals, which are crowded so closely together, the intensity of aggression is increasing. The dominance hierarchy is well established after their first fight, but due to the spatial constraint and the fact that there is no place where to flee, the submissive individual oftenly fights back. In every single interraction the aggressive behavior follows a fixed action pattern.

Of mice and (Viking?) men: phylogeography of British and Irish house mice.

Science.gov (United States)

Searle, Jeremy B; Jones, Catherine S; Gündüz, Islam; Scascitelli, Moira; Jones, Eleanor P; Herman, Jeremy S; Rambau, R Victor; Noble, Leslie R; Berry, R J; Giménez, Mabel D; Jóhannesdóttir, Fríoa

2009-01-22

The west European subspecies of house mouse (Mus musculus domesticus) has gained much of its current widespread distribution through commensalism with humans. This means that the phylogeography of M. m. domesticus should reflect patterns of human movements. We studied restriction fragment length polymorphism (RFLP) and DNA sequence variations in mouse mitochondrial (mt) DNA throughout the British Isles (328 mice from 105 localities, including previously published data). There is a major mtDNA lineage revealed by both RFLP and sequence analyses, which is restricted to the northern and western peripheries of the British Isles, and also occurs in Norway. This distribution of the 'Orkney' lineage fits well with the sphere of influence of the Norwegian Vikings and was probably generated through inadvertent transport by them. To form viable populations, house mice would have required large human settlements such as the Norwegian Vikings founded. The other parts of the British Isles (essentially most of mainland Britain) are characterized by house mice with different mtDNA sequences, some of which are also found in Germany, and which probably reflect both Iron Age movements of people and mice and earlier development of large human settlements. MtDNA studies on house mice have the potential to reveal novel aspects of human history.

The Recombination Landscape in Wild House Mice Inferred Using Population Genomic Data.

Science.gov (United States)

Booker, Tom R; Ness, Rob W; Keightley, Peter D

2017-09-01

Characterizing variation in the rate of recombination across the genome is important for understanding several evolutionary processes. Previous analysis of the recombination landscape in laboratory mice has revealed that the different subspecies have different suites of recombination hotspots. It is unknown, however, whether hotspots identified in laboratory strains reflect the hotspot diversity of natural populations or whether broad-scale variation in the rate of recombination is conserved between subspecies. In this study, we constructed fine-scale recombination rate maps for a natural population of the Eastern house mouse, Mus musculus castaneus We performed simulations to assess the accuracy of recombination rate inference in the presence of phase errors, and we used a novel approach to quantify phase error. The spatial distribution of recombination events is strongly positively correlated between our castaneus map, and a map constructed using inbred lines derived predominantly from M. m. domesticus Recombination hotspots in wild castaneus show little overlap, however, with the locations of double-strand breaks in wild-derived house mouse strains. Finally, we also find that genetic diversity in M. m. castaneus is positively correlated with the rate of recombination, consistent with pervasive natural selection operating in the genome. Our study suggests that recombination rate variation is conserved at broad scales between house mouse subspecies, but it is not strongly conserved at fine scales. Copyright © 2017 by the Genetics Society of America.

The Southeastern Asian house mouse (Mus musculus castaneus Linn.) as a new passenger host for Cryptococcus neoformans var. grubii molecular type VNI.

Science.gov (United States)

Singh, Karuna; Rani, Jyoti; Neelabh; Rai, Govind Kumar; Singh, Major

2017-11-01

We describe Mus musculus castaneus as a new mammalian host for Cryptococcus neoformans var. grubii (VNI). Eighteen apparently healthy adults and pups of the rodent were collected from human dwellings in Varanasi, a city of India. Both clinical and behavioral examinations of the rodents did not reveal any sign of the disease. Among visceral organs, histological examination of only liver exhibited the presence of single celled, encapsulated, Southgate's mucicarmine positive fungal structures consistent with C. neoformans. Nevertheless, culture of tissue homogenates of brain, lungs, liver, and kidneys yielded white colonies on Sabouraud's dextrose agar and brown mucoid colonies of C. neoformans on Staib's and Tobacco agar media. The pathogen was isolated from habitat soil as well as fresh faeces of the animals. All isolates were urease positive, nitrate and canavanine-glycine bromothymol blue negative, exhibited phenoloxidase activity and grew at 37°C. The isolates were identified as C. neoformans var. grubii with ITS primers and unique marker (GACA)4. The pathogen when inoculated in immunosuppressed mice showed low pathogenicity. To our knowledge, we for the first time report case cluster of Mus musculus castaneus as new passenger host for C. neoformans var. grubii (VNI). © The Author 2017. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

No evidence for punishment in communally nursing female house mice (Mus musculus domesticus).

Science.gov (United States)

Ferrari, Manuela; König, Barbara

2017-01-01

Punishment is claimed as an important mechanism to stabilise costly cooperation in humans, but its importance in social animals has been questioned recently due to both conceptual considerations and a lack of empirical evidence (only few published studies). We empirically tested whether there is evidence for punishment in communally nursing house mice (Mus musculus domesticus, direct descendants of "wild" animals). Communally breeding females pool their litters and raise all offspring together, indiscriminately caring for own and other offspring. Such a situation resembles a public good and provides scope for exploitation if females vary in their relative contributions to the joint nest (offspring number). We allowed two females to communally breed and conducted removal experiments both in the presence and absence of pups. We aimed to test whether reduced investment by one of the females (induced through separation from the partner and their combined offspring for 4 or 12 hours) leads to increased aggression by the other female after the reunion. We found no evidence for punishment, on the contrary, females increased socio-positive behaviours. The costs of losing a partner in a communally breeding species might be too high and hinder the evolution of punishment. Our findings add to a growing list of examples questioning the role of punishment in cooperating non-human animals and emphasise the importance of empirical testing of its assumptions and predictions.

Two genetic determinants acquired late in Mus evolution regulate the inclusion of exon 5, which alters mouse APOBEC3 translation efficiency.

Directory of Open Access Journals (Sweden)

Jun Li

2012-01-01

Full Text Available Mouse apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like editing complex 3 (mA3, an intracellular antiviral factor, has 2 allelic variations that are linked with different susceptibilities to beta- and gammaretrovirus infections among various mouse strains. In virus-resistant C57BL/6 (B6 mice, mA3 transcripts are more abundant than those in susceptible BALB/c mice both in the spleen and bone marrow. These strains of mice also express mA3 transcripts with different splicing patterns: B6 mice preferentially express exon 5-deficient (Δ5 mA3 mRNA, while BALB/c mice produce exon 5-containing full-length mA3 mRNA as the major transcript. Although the protein product of the Δ5 mRNA exerts stronger antiretroviral activities than the full-length protein, how exon 5 affects mA3 antiviral activity, as well as the genetic mechanisms regulating exon 5 inclusion into the mA3 transcripts, remains largely uncharacterized. Here we show that mA3 exon 5 is indeed a functional element that influences protein synthesis at a post-transcriptional level. We further employed in vitro splicing assays using genomic DNA clones to identify two critical polymorphisms affecting the inclusion of exon 5 into mA3 transcripts: the number of TCCT repeats upstream of exon 5 and the single nucleotide polymorphism within exon 5 located 12 bases upstream of the exon 5/intron 5 boundary. Distribution of the above polymorphisms among different Mus species indicates that the inclusion of exon 5 into mA3 mRNA is a relatively recent event in the evolution of mice. The widespread geographic distribution of this exon 5-including genetic variant suggests that in some Mus populations the cost of maintaining an effective but mutagenic enzyme may outweigh its antiviral function.

The screening of parasites and viral pathogens of small mammals from a farm in southern Finland, and genetic identification of the Finnish house mouse, Mus musculus

Czech Academy of Sciences Publication Activity Database

Laakkonen, J.; Kallio-Kokko, M.; Vapalahti, O.; Vaheri, A.; Vyskočilová, M.; Munclinger, P.; Macholán, Miloš; Henttonen, H.

2007-01-01

Roč. 44, - (2007), s. 202-208 ISSN 0003-455X EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus musculus Subject RIV: EG - Zoology Impact factor: 1.537, year: 2007

A role for ultrasonic vocalisation in social communication and divergence of natural populations of the house mouse (Mus musculus domesticus.

Directory of Open Access Journals (Sweden)

Sophie von Merten

Full Text Available It has long been known that rodents emit signals in the ultrasonic range, but their role in social communication and mating is still under active exploration. While inbred strains of house mice have emerged as a favourite model to study ultrasonic vocalisation (USV patterns, studies in wild animals and natural situations are still rare. We focus here on two wild derived mouse populations. We recorded them in dyadic encounters for extended periods of time to assess possible roles of USVs and their divergence between allopatric populations. We have analysed song frequency and duration, as well as spectral features of songs and syllables. We show that the populations have indeed diverged in several of these aspects and that USV patterns emitted in a mating context differ from those emitted in same sex encounters. We find that females vocalize not less, in encounters with another female even more than males. This implies that the current focus of USVs being emitted mainly by males within the mating context needs to be reconsidered. Using a statistical syntax analysis we find complex temporal sequencing patterns that could suggest that the syntax conveys meaningful information to the receivers. We conclude that wild mice use USV for complex social interactions and that USV patterns can diverge fast between populations.

Molecular heterogeneity in major urinary proteins of Mus musculus subspecies: potential candidates involved in speciation

Science.gov (United States)

Hurst, Jane L.; Beynon, Robert J.; Armstrong, Stuart D.; Davidson, Amanda J.; Roberts, Sarah A.; Gómez-Baena, Guadalupe; Smadja, Carole M.; Ganem, Guila

2017-01-01

When hybridisation carries a cost, natural selection is predicted to favour evolution of traits that allow assortative mating (reinforcement). Incipient speciation between the two European house mouse subspecies, Mus musculus domesticus and M.m.musculus, sharing a hybrid zone, provides an opportunity to understand evolution of assortative mating at a molecular level. Mouse urine odours allow subspecific mate discrimination, with assortative preferences evident in the hybrid zone but not in allopatry. Here we assess the potential of MUPs (major urinary proteins) as candidates for signal divergence by comparing MUP expression in urine samples from the Danish hybrid zone border (contact) and from allopatric populations. Mass spectrometric characterisation identified novel MUPs in both subspecies involving mostly new combinations of amino acid changes previously observed in M.m.domesticus. The subspecies expressed distinct MUP signatures, with most MUPs expressed by only one subspecies. Expression of at least eight MUPs showed significant subspecies divergence both in allopatry and contact zone. Another seven MUPs showed divergence in expression between the subspecies only in the contact zone, consistent with divergence by reinforcement. These proteins are candidates for the semiochemical barrier to hybridisation, providing an opportunity to characterise the nature and evolution of a putative species recognition signal. PMID:28337988

Isolation of three novel rat and mouse papillomaviruses and their genomic characterization.

Directory of Open Access Journals (Sweden)

Eric Schulz

Full Text Available Despite a growing knowledge about the biological diversity of papillomaviruses (PV, only little is known about non-human PV in general and about PV mice models in particular. We cloned and sequenced the complete genomes of two novel PV types from the Norway rat (Rattus norvegicus; RnPV2 and the wood mouse (Apodemus sylvaticus; AsPV1 as well as a novel variant of the recently described MmuPV1 (originally designated as MusPV from a house mouse (Mus musculus; MmuPV1 variant. In addition, we conducted phylogenetic analyses using a systematically representative set of 79 PV types, including the novel sequences. As inferred from concatenated amino acid sequences of six proteins, MmuPV1 variant and AsPV1 nested within the Beta+Xi-PV super taxon as members of the Pi-PV. RnPV2 is a member of the Iota-PV that has a distant phylogenetic position from Pi-PV. The phylogenetic results support a complex scenario of PV diversification driven by different evolutionary forces including co-divergence with hosts and adaptive radiations to new environments. PV types particularly isolated from mice and rats are the basis for new animal models, which are valuable to study PV induced tumors and new treatment options.

Allergen and Epitope Targets of Mouse-Specific T Cell Responses in Allergy and Asthma

Directory of Open Access Journals (Sweden)

Véronique Schulten

2018-02-01

Full Text Available Mouse allergy has become increasingly common, mainly affecting laboratory workers and inner-city households. To date, only one major allergen, namely Mus m 1, has been described. We sought to identify T cell targets in mouse allergic patients. PBMC from allergic donors were expanded with either murine urine or epithelial extract and subsequently screened for cytokine production (IL-5 and IFNγ in response to overlapping peptides spanning the entire Mus m 1 sequence, peptides from various Mus m 1 isoforms [major urinary proteins (MUPs], peptides from mouse orthologs of known allergens from other mammalian species and peptides from proteins identified by immunoproteomic analysis of IgE/IgG immunoblots of mouse urine and epithelial extracts. This approach let to the identification of 106 non-redundant T cell epitopes derived from 35 antigens. Three major T cell-activating regions were defined in Mus m 1 alone. Moreover, our data show that immunodominant epitopes were largely shared between Mus m 1 and other MUPs even from different species, suggesting that sequence conservation in different allergens is a determinant for immunodominance. We further identified several novel mouse T cell antigens based on their homology to known mammalian allergens. Analysis of cohort-specific T cell responses revealed that rhinitis and asthmatic patients recognized different epitope repertoires. Epitopes defined herein can be formulated into an epitope “megapool” used to diagnose mouse allergy and study mouse-specific T cell responses directly ex vivo. This analysis of T cell epitopes provides a good basis for future studies to increase our understanding of the immunopathology associated with MO-allergy and asthma.

Viral Diversity of House Mice in New York City.

Science.gov (United States)

Williams, Simon H; Che, Xiaoyu; Garcia, Joel A; Klena, John D; Lee, Bohyun; Muller, Dorothy; Ulrich, Werner; Corrigan, Robert M; Nichol, Stuart; Jain, Komal; Lipkin, W Ian

2018-04-17

The microbiome of wild Mus musculus (house mouse), a globally distributed invasive pest that resides in close contact with humans in urban centers, is largely unexplored. Here, we report analysis of the fecal virome of house mice in residential buildings in New York City, NY. Mice were collected at seven sites in Manhattan, Queens, Brooklyn, and the Bronx over a period of 1 year. Unbiased high-throughput sequencing of feces revealed 36 viruses from 18 families and 21 genera, including at least 6 novel viruses and 3 novel genera. A representative screen of 15 viruses by PCR confirmed the presence of 13 of these viruses in liver. We identified an uneven distribution of diversity, with several viruses being associated with specific locations. Higher mouse weight was associated with an increase in the number of viruses detected per mouse, after adjusting for site, sex, and length. We found neither genetic footprints to known human viral pathogens nor antibodies to lymphocytic choriomeningitis virus. IMPORTANCE Mice carry a wide range of infectious agents with zoonotic potential. Their proximity to humans in the built environment is therefore a concern for public health. Laboratory mice are also the most common experimental model for investigating the pathobiology of infectious diseases. In this survey of mice trapped in multiple locations within New York City over a period of 1 year, we found a diverse collection of viruses that includes some previously not associated with house mice and others that appear to be novel. Although we found no known human pathogens, our findings provide insights into viral ecology and may yield models that have utility for clinical microbiology. Copyright © 2018 Williams et al.

Helminth Infections of House Mouse (Mus musulus and Wood Mouse (Apodemus sylvaticus from the Suburban Areas of Hamadan City, Western Iran.

Directory of Open Access Journals (Sweden)

Ali Yousefi

2014-12-01

Full Text Available To determine the prevalence and intensity of helminths and their zoonotic importance in small rodents inhabiting in the suburban areas of Hamadan City, Iran.The present survey was conducted on the helminth infections of two species of rodents Apodemus sylvaticus (n=60 and Mus musculus(n=72 in the suburban areas of Hamadan City during 2010-2012. Rodents were collected and examined for helminth in the different organs. The nematodes were collected in 5% formalin solution and cleared in lactophenol, cestodes and trematodes collected from intestine fixed in AFA solution and stained by acetocarmine, cleared in xylol for identification.Helminths found in A. sylvaticus and M. musculus and their prevalence for the first time in suburban areas of Hamadan City were as follows; In A. sylvaticus: Cysticercus fasciolaris(3.33%, Syphacia fredrici(26.67%, S. stroma(8.33%, Anoplocephalidae sp. (1.67%, Skrjabinotaenia lobata(5%, Plagiorchis muris(1.67% and in M. musculus:Hymenolepis nana (16.67%, H.diminuta (5.55%, S. obvelata(30.56%, S. ohtarom (9.72%, Rodentolepis crassa (1.39%, C. fasciolaris (1.39%. Among 11 species in two rodents 4 species including S. obvelata, H. nana, H.diminuta,and P. muris have zoonotic importance. Statistically the relation between gender and their helminth infections was not significant in either M. musculus or A. sylvaticus (P>0.05.This study reports 11 species of helminths and on the other hand 3 species were identified for the first time in Iran and 5 species of them have potential health importance for public health and cat.

XY females do better than the XX in the African pygmy mouse, Mus minutoides.

Science.gov (United States)

Saunders, Paul A; Perez, Julie; Rahmoun, Massilva; Ronce, Ophélie; Crochet, Pierre-André; Veyrunes, Frédéric

2014-07-01

All therian mammals have a similar XY/XX sex-determination system except for a dozen species. The African pygmy mouse, Mus minutoides, harbors an unconventional system in which all males are XY, and there are three types of females: the usual XX but also XX* and X*Y ones (the asterisk designates a sex-reversal mutation on the X chromosome). The long-term evolution of such a system is a paradox, because X*Y females are expected to face high reproductive costs (e.g., meiotic disruption and loss of unviable YY embryos), which should prevent invasion and maintenance of a sex-reversal mutation. Hence, mechanisms for compensating for the costs could have evolved in M. minutoides. Data gathered from our laboratory colony revealed that X*Y females do compensate and even show enhanced reproductive performance in comparison to the XX and XX*; they produce significantly more offspring due to (i) a higher probability of breeding, (ii) an earlier first litter, and (iii) a larger litter size, linked to (iv) a greater ovulation rate. These findings confirm that rare conditions are needed for an atypical sex-determination mechanism to evolve in mammals, and provide valuable insight into understanding modifications of systems with highly heteromorphic sex chromosomes. © 2014 The Author(s). Evolution © 2014 The Society for the Study of Evolution.

Is water really a barrier for the house mouse? A comparative study of two mouse subspecies

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Strnadová, Markéta; Macholán, Miloš; Vošlajerová Bímová, Barbora

2012-01-01

Roč. 61, 3-4 (2012), s. 319-329 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersal * Mus musculus domesticus * Mus musculus musculus * swimming * water barrier Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

Male meiosis and gametogenesis in wild house mice (Mus musculus domesticus) from a chromosomal hybrid zone; a comparison between "simple" Robertsonian heterozygotes and homozygotes.

Science.gov (United States)

Wallace, B M; Searle, J B; Everett, C A

1992-01-01

Wild male house mice Mus musculus domesticus were collected from the hybrid zone between the John o'Groats race (2n = 32) and the standard race (2n = 40) in northern Scotland. Meiosis in both homozygotes (2n = 32, 36, and 40) and single Robertsonian heterozygotes (2n = 33, 35, and 37) was found to be orderly. At prophase/metaphase I in heterozygotes, a trivalent was formed from the metacentric and two homologous acrocentrics. At pachytene, this trivalent usually had a single side arm at the position of the centromeres, as a result of nonhomologous pairing of the acrocentrics. This side arm persisted into diplotene. Generally only a single chiasma was formed between each acrocentric and the metacentric. Anaphase I nondisjunction frequencies were estimated as 1.5% for the homozygotes and 2.7% for the heterozygotes. The extent of germ cell death between the pachytene and round spermatid stages was 18% greater in heterozygotes than in homozygotes. Our results concur with previous studies which indicate that single Robertsonian heterozygotes in wild house mice have near-normal fertility.

Chromosomal variation in the house mouse

Czech Academy of Sciences Publication Activity Database

Piálek, Jaroslav; Hauffe, H. C.; Searle, J. B.

2005-01-01

Roč. 84, č. 3 (2005), s. 535-563 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA AV ČR IAA6045601 Institutional research plan: CEZ:AV0Z6093917 Keywords : chromosomal evolution * hybrid zone * Robertsonian fusions Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

Testing parasite 'intimacy': the whipworm Trichuris muris in the European house mouse hybrid zone.

Science.gov (United States)

Wasimuddin; Bryja, Josef; Ribas, Alexis; Baird, Stuart J E; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

2016-05-01

Host-parasite interaction studies across hybrid zones often focus on host genetic variation, treating parasites as homogeneous. 'Intimately' associated hosts and parasites might be expected to show similar patterns of genetic structure. In the literature, factors such as no intermediate host and no free-living stage have been proposed as 'intimacy' factors likely constraining parasites to closely follow the evolutionary history of their hosts. To test whether the whipworm, Trichuris muris, is intimately associated with its house mouse host, we studied its population genetics across the European house mouse hybrid zone (HMHZ) which has a strong central barrier to gene flow between mouse taxa. T. muris has a direct life cycle and nonmobile free stage: if these traits constrain the parasite to an intimate association with its host we expect a geographic break in the parasite genetic structure across the HMHZ. We genotyped 205 worms from 56 localities across the HMHZ and additionally T. muris collected from sympatric woodmice (Apodemus spp.) and allopatric murine species, using mt-COX1, ITS1-5.8S-ITS2 rDNA and 10 microsatellites. We show four haplogroups of mt-COX1 and three clear ITS1-5.8S-ITS2 clades in the HMHZ suggesting a complex demographic/phylogeographic history. Microsatellites show strong structure between groups of localities. However, no marker type shows a break across the HMHZ. Whipworms from Apodemus in the HMHZ cluster, and share mitochondrial haplotypes, with those from house mice. We conclude Trichuris should not be regarded as an 'intimate' parasite of the house mouse: while its life history might suggest intimacy, passage through alternate hosts is sufficiently common to erase signal of genetic structure associated with any particular host taxon.

Fellow travellers

DEFF Research Database (Denmark)

Jones, E. P.; Skirnisson, K.; McGovern, T. H.

2012-01-01

Background: House mice (Mus musculus) are commensals of humans and therefore their phylogeography can reflect human colonization and settlement patterns. Previous studies have linked the distribution of house mouse mitochondrial (mt) DNA clades to areas formerly occupied by the Norwegian Vikings ...

Genetics and evolution of hybrid male sterility in house mice.

Science.gov (United States)

White, Michael A; Stubbings, Maria; Dumont, Beth L; Payseur, Bret A

2012-07-01

Comparative genetic mapping provides insights into the evolution of the reproductive barriers that separate closely related species. This approach has been used to document the accumulation of reproductive incompatibilities over time, but has only been applied to a few taxa. House mice offer a powerful system to reconstruct the evolution of reproductive isolation between multiple subspecies pairs. However, studies of the primary reproductive barrier in house mice-hybrid male sterility-have been restricted to a single subspecies pair: Mus musculus musculus and Mus musculus domesticus. To provide a more complete characterization of reproductive isolation in house mice, we conducted an F(2) intercross between wild-derived inbred strains from Mus musculus castaneus and M. m. domesticus. We identified autosomal and X-linked QTL associated with a range of hybrid male sterility phenotypes, including testis weight, sperm density, and sperm morphology. The pseudoautosomal region (PAR) was strongly associated with hybrid sterility phenotypes when heterozygous. We compared QTL found in this cross with QTL identified in a previous F(2) intercross between M. m. musculus and M. m. domesticus and found three shared autosomal QTL. Most QTL were not shared, demonstrating that the genetic basis of hybrid male sterility largely differs between these closely related subspecies pairs. These results lay the groundwork for identifying genes responsible for the early stages of speciation in house mice.

Laboratory mouse housing conditions can be improved using common environmental enrichment without compromising data

DEFF Research Database (Denmark)

André, Viola; Gau, Christine; Scheideler, Angelika

2018-01-01

Animal welfare requires the adequate housing of animals to ensure health and well-being. The application of environmental enrichment is a way to improve the well-being of laboratory animals. However, it is important to know whether these enrichment items can be incorporated in experimental mouse...... material and shelters may be used to improve animal welfare without impairment of experimental outcome or loss of comparability to previous data collected under barren housing conditions....

Mutations at the mei-41, mus(1)101, mus(1)103, mus(2)205 and mus(3)310 loci of Drosophila exhibit differential UDS responses with different DNA-damaging agents

International Nuclear Information System (INIS)

Dusenbery, R.L.

1987-01-01

5 mutagen-sensitive mutants of Drosophila melanogaster, reported to perform normal or only slightly reduced excision repair of UV damage, were examined by an unscheduled DNA synthesis (UDS) assay. 2 mutants, classified as completely or partially proficient for both excision and postreplication repair of UV damage, mus(1)103 and mus(2)205, were found to give positive UDS responses only for UV damage. These mutants exhibit no measurable UDS activity following DNA damage by several different alkylating agents and X-rays. 3 mutants, classified as having no defect in excision repair, but measurable defects in postreplication repair of UV damage, exhibit 3 different response patterns. The mutant mei-41 exhibits a highly positive UDS response following damage by all agents, consistent with its prior classification as excision-repair-proficient, but postreplication-repair-deficient for UV damage. The mutant mus(1)101, however, exhibits a strong positive UDS response following only UV damage and appears to be blocked in the excision repair of damage produced by both alkylating agents and X-irradiation. Finally, mus(3)310 exhibits no UDS response to alkylation, X-ray or UV damage. This is not consistent with its previous classification. Results obtained w0272the qualitative in vitro UDS assay are entirely consistent with the results from two separate in vivo measures of excision repair deficiency followign DNA damage, larval hypersensitivity to killing and hypermutability in the sex-linked recessive lethal test. (Auth.)

Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes

Science.gov (United States)

Thybert, David; Roller, Maša; Navarro, Fábio C.P.; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C.; Laukaitis, Christina M.; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A.; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J.; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M.; Odom, Duncan T.; Flicek, Paul

2018-01-01

Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli, which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. PMID:29563166

Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes.

Science.gov (United States)

Thybert, David; Roller, Maša; Navarro, Fábio C P; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C; Laukaitis, Christina M; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M; Odom, Duncan T; Flicek, Paul

2018-04-01

Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli , which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. © 2018 Thybert et al.; Published by Cold Spring Harbor Laboratory Press.

Effects of mutagen-sensitive mus mutations on spontaneous mitotic recombination in Aspergillus.

Science.gov (United States)

Zhao, P; Kafer, E

1992-04-01

Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus+ controls in both tests. Two mutations, musK and musL, reduced recombination, while musN and musQ caused increases. In contrast, musO diploids produced significantly higher levels only for intragenic recombination. Effects were relatively small, but averages between hypo- and hyperrec mus differed 15-20-fold. In musL diploids, most of the rare color segregants resulted from mitotic malsegregation rather than intergenic crossing over. This indicates that the musL gene product is required for recombination and that DNA lesions lead to chromosome loss when it is deficient. In addition, analysis of the genotypes of intragenic (ad+) recombinants showed that the musL mutation specifically reduced single allele conversion but increased complex conversion types (especially recombinants homozygous for ad+). Similar analysis revealed differences between the effects of two hyperrec mutations; musN apparently caused high levels solely of mitotic crossing over, while musQ increased various conversion types but not reciprocal crossovers. These results suggest that mitotic gene conversion and crossing over, while generally associated, are affected differentially in some of the mus strains of Aspergillus nidulans.

Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

Directory of Open Access Journals (Sweden)

Dufková Petra

2008-10-01

Full Text Available Abstract Background The Mus musculus musculus/M. m. domesticus contact zone in Europe is characterised by sharp frequency discontinuities for sex chromosome markers at the centre of wider clines in allozyme frequencies. Results We identify a triangular area (approximately 330 km2 where the musculus Y chromosome introgresses across this front for up to 22 km into domesticus territory. Introgression of the Y chromosome is accompanied by a perturbation of the census sex ratio: the sex ratio is significantly female biased in musculus localities and domesticus localities lacking Y chromosome introgression. In contrast, where the musculus Y is detected in domesticus localities, the sex ratio is close to parity, and significantly different from both classes of female biased localities. The geographic position of an abrupt cline in an X chromosome marker, and autosomal clines centred on the same position, seem unaffected by the musculus Y introgression. Conclusion We conclude that sex ratio distortion is playing a role in the geographic separation of speciation genes in this section of the mouse hybrid zone. We suggest that clines for genes involved in sex-ratio distortion have escaped from the centre of the mouse hybrid zone, causing a decay in the barrier to gene flow between the two house mouse taxa.

Altered behavior and neural activity in conspecific cagemates co-housed with mouse models of brain disorders.

Science.gov (United States)

Yang, Hyunwoo; Jung, Seungmoon; Seo, Jinsoo; Khalid, Arshi; Yoo, Jung-Seok; Park, Jihyun; Kim, Soyun; Moon, Jangsup; Lee, Soon-Tae; Jung, Keun-Hwa; Chu, Kon; Lee, Sang Kun; Jeon, Daejong

2016-09-01

The psychosocial environment is one of the major contributors of social stress. Family members or caregivers who consistently communicate with individuals with brain disorders are considered at risk for physical and mental health deterioration, possibly leading to mental disorders. However, the underlying neural mechanisms of this phenomenon remain poorly understood. To address this, we developed a social stress paradigm in which a mouse model of epilepsy or depression was housed long-term (>4weeks) with normal conspecifics. We characterized the behavioral phenotypes and electrophysiologically investigated the neural activity of conspecific cagemate mice. The cagemates exhibited deficits in behavioral tasks assessing anxiety, locomotion, learning/memory, and depression-like behavior. Furthermore, they showed severe social impairment in social behavioral tasks involving social interaction or aggression. Strikingly, behavioral dysfunction remained in the cagemates 4weeks following co-housing cessation with the mouse models. In an electrophysiological study, the cagemates showed an increased number of spikes in medial prefrontal cortex (mPFC) neurons. Our results demonstrate that conspecifics co-housed with mouse models of brain disorders develop chronic behavioral dysfunctions, and suggest a possible association between abnormal mPFC neural activity and their behavioral pathogenesis. These findings contribute to the understanding of the psychosocial and psychiatric symptoms frequently present in families or caregivers of patients with brain disorders. Copyright © 2016 Elsevier Inc. All rights reserved.

Generation of competent bone marrow-derived antigen presenting cells from the deer mouse (Peromyscus maniculatus

Directory of Open Access Journals (Sweden)

Farrell Regina M

2004-09-01

Full Text Available Abstract Background Human infections with Sin Nombre virus (SNV and related New World hantaviruses often lead to hantavirus cardiopulmonary syndrome (HCPS, a sometimes fatal illness. Lungs of patients who die from HCPS exhibit cytokine-producing mononuclear infiltrates and pronounced pulmonary inflammation. Deer mice (Peromyscus maniculatus are the principal natural hosts of SNV, in which the virus establishes life-long persistence without conspicuous pathology. Little is known about the mechanisms SNV employs to evade the immune response of deer mice, and experimental examination of this question has been difficult because of a lack of methodologies for examining such responses during infection. One such deficiency is our inability to characterize T cell responses because susceptible syngeneic deer mice are not available. Results To solve this problem, we have developed an in vitro method of expanding and generating competent antigen presenting cells (APC from deer mouse bone marrow using commercially-available house mouse (Mus musculus granulocyte-macrophage colony stimulating factor. These cells are capable of processing and presenting soluble protein to antigen-specific autologous helper T cells in vitro. Inclusion of antigen-specific deer mouse antibody augments T cell stimulation, presumably through Fc receptor-mediated endocytosis. Conclusions The use of these APC has allowed us to dramatically expand deer mouse helper T cells in culture and should permit extensive characterization of T cell epitopes. Considering the evolutionary divergence between deer mice and house mice, it is probable that this method will be useful to other investigators using unconventional models of rodent-borne diseases.

Effects of Mutagen-Sensitive Mus Mutations on Spontaneous Mitotic Recombination in Aspergillus

OpenAIRE

Zhao, P.; Kafer, E.

1992-01-01

Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus(+) controls in both tests. Two mutations, musK and musL, reduced reco...

Cross-experimental analysis of coat color variations and morphological characteristics of the japanese wild mouse, Mus musculus.

Science.gov (United States)

Suzuki, Taichi A; Iwasa, Masahiro A

2013-01-01

There are many coat colors in the laboratory mouse, Mus musculus. On the basis of traditional genetics, there are four loci, A-D, related to coat color expressions. As shown by previous studies, Japanese wild mice have gray backs and white bellies and are assumed to carry the A(w) allele at the A (agouti) locus, which is dominant over any other alleles. However, we collected Japanese wild mice from central Honshu with black coats. To understand this black coat expression, we performed cross experiments concerning the four loci using wild-caught mice and DBA/2 laboratory mice from the standpoint of traditional genetics. The offspring of the current crosses showed the wild type, the blackish type, and the intermediate type from some combinations of parents. Considering the coat colors of the offspring, we did not obtain any evidence that the Japanese wild mice always carry the A(w) allele at the A locus. Furthermore, we were not able to explain the current coat color expressions using the traditional logic with regard to the A-D loci and concluded that it is possible for another locus (loci) to be related to the coat color expressions. On the other hand, skull characteristics and external body measurements of the captured wild mice were fundamentally different from those of DBA/2 and offspring from captured wild mice and DBA/2 combinations. Thus, we concluded that the Japanese wild mice had original criteria from a morphological viewpoint.

Molecular analyses of the agouti allele in the Japanese house mouse identify a novel variant of the agouti gene.

Science.gov (United States)

Iwasa, Masahiro A; Kawamura, Sayaka; Myoshu, Hikari; Suzuki, Taichi A

2018-03-01

It has been thought that the Japanese house mouse carries the A w allele at the agouti locus causing light-colored bellies, but they do not always show this coloration. Thus, the presence of the A w allele seems to be doubtful in them. To ascertain whether the A w allele is present, a two-pronged approach was used. First, we compared lengths of DNA fragments obtained from three PCRs conducted on them to the known fragment sizes generated from mouse strains exhibiting homozygosities of either a/a, A/A, or A w /A w . PCR I, PCR II, and PCR III amplify only in the A and A w alleles, the a and A w alleles, and the a allele, respectively, and we detected amplifications in strains with A/A and A w /A w by PCR I, in those with a/a and the Japanese house mouse by PCR II, and in those with a/a by PCR III. Second, we sequenced the exon 1A region of the agouti gene and obtained sequences corresponding to the above strains and the Japanese house mouse, but their sequences were similar to those of the a allele. We concluded that their agouti allele is not identical to the A w allele and seems to be a novel type similar to the a allele.

KOLONISASI Mus musculus albino DI LABORATORIUM LOKA LITBANG P2B2 BANJARNEGARA

Directory of Open Access Journals (Sweden)

Dewi Marbawati

2012-11-01

Full Text Available The improvement and development of science and technologycal in health area must be followed with improvement of requirement of test animal would especially white mouse (Mus musculus albino/mencit. Usage of white mouse (mencit because of relatively easy in handling, the size relatively small, the price relatively cheap, once birth can reach 16- 18, have similiarity in circulation system of human and doesn't have ability to vomit because having spillway in bouncing up, that is why white mouse used for drug trial research. This research expected to obtain stable white mouse colony in laboratory to fulfill requirement of white mouse as subject for research.Research was started in March-November 2008 in Loka Litbang P2B2 Banjarnegara. This research was elementary research with observational design. Data were collected from white mouse growth observation. Result of observation showed reproduction of white mouse after 5 month, from 6 white mouse increased become 17 (increased 2 times more, with number of deaths 11,76%. This white mouse survive until 12 months, but the average was 6 month. Oldest mencit until research ends (November 2008 ranges from 8 months. Daily observation data showed that white mouse can bear children until 6/pregnance. According to literature study mouse can bear children average 68/pregnance. Generaly baby mouse was around 1 gram, heavily horns depend on type (strain of white mouse. Result of white mouse weight showed increase of white mouse's body weight every 2 weeks was 8,6 grams. Observation data of development white mouse showed after 4 days the white mouse hair was seen, specially moustache that was clearly seen, on 5 day whole body was white. At the age of 10 days ear opened, part of other body like external mamilla and genitals become explains looked to be. At the age of 12 days eye started opens and active walking.

Recombinant major urinary proteins of the mouse in specific IgE and IgG testing

NARCIS (Netherlands)

Krop, Esmeralda J. M.; Matsui, Elizabeth C.; Sharrow, Scott D.; Stone, Martin J.; Gerber, Peter; van der Zee, Jaring S.; Chapman, Martin D.; Aalberse, Rob C.

2007-01-01

BACKGROUND: Recombinant allergens are preferred over natural allergen extracts in measuring antibodies. We tested the use of recombinant variants of the major mouse allergen Mus m 1 in detection of mouse-specific antibodies in sera of laboratory animal workers and children. METHODS: Six recombinant

The effect of electron beam radiations on testicular damage in mice, Mus musculus

International Nuclear Information System (INIS)

Vikram, S.; Nair, Vijay Mala Grover

2013-01-01

Adult male Swiss albino mice, Mus musculus (8-10 weeks old) weighing 28±2.5 gm were exposed to varying doses (2-12 Gy) of electron beam radiations and maintained in animal house at 26-28 C. The animals were sacrificed following 35 and 60 days following exposure to electron beam radiations. The LD-50 value, change in the weight and histological details of the testis, sperm count, sperm shape abnormalities and sperm motility were recorded. The data suggests that electron beam radiations is a potential inducer to cause reproductive system dysfunctions which probably may be responsible leading to infertility. (author)

A Comparison of mucosal surface area and villous histology in small intestines of the Brazilian free-tailed bat (Tadarida brasiliensis) and the mouse (Mus musculus).

Science.gov (United States)

Zhang, Zhi-Qiang; Brun, Antonio; Price, Edwin R; Cruz-Neto, Ariovaldo P; Karasov, William H; Caviedes-Vidal, Enrique

2015-01-01

Studies on birds have led to the hypothesis that increased intestinal absorption between enterocytes (paracellular) evolved as a compensation for smaller intestinal size in fliers, which was perhaps selected to minimize the mass of digesta carried. This hypothesis predicts that bats will also exhibit relatively reduced intestinal size and high paracellular absorption, compared with nonflying mammals. Published studies on three bat species indicate relatively high paracellular absorption. One mechanism for increasing paracellular absorption per cm2 small intestine (SI) is increased number of tight junctions (TJs) across which paracellular absorption occurs. To our knowledge, we provide the first comparative analysis of enterocyte size and number in flying and nonflying mammals. Intestines of insectivorous bats Tadarida brasiliensis were compared with Mus musculus using hematoxylin and eosin staining method. Bats had shorter and narrower SIs than mice, and after correction for body size difference by normalizing to mass3/4, the bats had 40% less nominal surface area than the mouse, as predicted. Villous enhancement of surface area was 90% greater in the bat than in the mouse, mainly because of longer villi and a greater density of villi in bat intestines. Bat and mouse were similar in enterocyte diameter. Bats exceeded mice by 54.4% in villous area per cm length SI and by 95% in number of enterocytes per cm2 of the nominal surface area of the SI. Therefore, an increased density of TJs per cm2 SI may be a mechanistic explanation that helps to understand the high paracellular absorption observed in bats compared to nonflying mammals. © 2014 Wiley Periodicals, Inc.

Phenotypic and epistatic grouping of hypo- and hyper-rec mus mutants in Aspergillus.

Science.gov (United States)

Kafer, E; Chae, S K

1994-03-01

The mutants musK to musS of Aspergillus nidulans are sensitive to methyl-methanesulfonate (MMS) and several of them are meiotic-defective and alter mitotic recombination frequencies. All were found to be cross-sensitive to 4-nitro-quinoline-N-oxide (4-NQO) but unexpectedly none of them was hypersensitive to gamma-rays and few to UV light. Double mus; uvs mutants were constructed to test for interactions with uvs mutations of the four epistatic groups of Aspergillus, "UvsF", "UvsC", "UvsI", and "UvsB". All meiotic-defective mus mutations caused some lethal interactions, usually with uvsF. None of them showed epistasis with UvsF or UvsB group mutants and one, musO, may represent a new group. Three mus mutations that affect recombination were assigned to the UvsC group, namely musN and K, and also musL which is recombination-defective and closely resembles uvsC. While uvsC mutants are mutators and lack UV-mutagenesis, most mus mutants had no effects on mutation. Only musR, which appeared epistatic with uvsI, showed reduced UV-reversion frequencies similar to uvsI. The recombination-proficient mus mutants appeared to be epistatic with more than one group, but in several cases sensitivities were slight and overlaps insufficient to obtain corroborating results with MMS and 4-NQO.

New Metacentric Populations and Phylogenetic Hypotheses Involving Whole-Arm Reciprocal Translocation in Mus musculus domesticus from Sicily, Southern Italy.

Science.gov (United States)

Castiglia, Riccardo; Capanna, Ernesto; Bezerra, Alexandra M R; Bizzoco, Domenico; Zambigli, Emanuela; Solano, Emanuela

2015-01-01

The house mouse Mus musculus domesticus is characterized by more than 100 metacentric populations, due to the occurrence of Robertsonian (Rb) fusions, together with the standard all-telocentric karyotype (2n = 40). We examined G-banded karyotypes of 18 mice from 10 localities in Sicily and describe 3 new metacentric populations: 'Ragusa Ibla' (IRAG), 2n = 33-36, Rb(2.4), Rb(5.6), Rb(9.16), Rb(13.17); 'Piana degli Albanesi' (IPIA), 2n = 23, Rb(1.18), Rb(2.15), Rb(3.5), Rb(4.12), Rb(6.11), Rb(7.8), Rb(9.16), Rb(10.14), Rb(13.17); 'Trapani' (ITRA), 2n = 22, Rb(1.18), Rb(2.15), Rb(3.7), Rb(4.12), Rb(5.9), Rb(6.11), Rb(8.16), Rb(10.14), Rb(13.17). Three mice belonged to the previously reported 'Castelbuono' race (ICAS), 2n = 24, which is very similar to the nearby 'Palermo' (IPAL) race, 2n = 26. Three Rb fusions not yet observed in wild mouse populations were identified: Rb(3.5), Rb(3.7) and Rb(5.9). Rb fusions shared among 4 races (IPIA, IRAG, ICAS, and IPAL) allowed us to describe their potential phylogenetic relationships. We obtained 2 alternative phylogenetic trees. The differences between them are mainly due to various modes of formation of IPIA and ITRA. In the first hypothesis, the specific Rb fusions occurred independently. In the second, those of IRAG originated from those of IPIA via whole-arm reciprocal translocations. © 2015 S. Karger AG, Basel.

Measures of linkage disequilibrium among neighbouring SNPs indicate asymmetries across the house mouse hybrid zone

Czech Academy of Sciences Publication Activity Database

Wang, L.; Luzynski, K.; Pool, J. E.; Janoušek, V.; Dufková, Petra; Vyskočilová, Martina; Teeter, K. C.; Nachman, M. W.; Munclinger, P.; Macholán, Miloš; Piálek, Jaroslav; Tucker, P. K.

2011-01-01

Roč. 20, č. 14 (2011), s. 2985-3000 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Grant - others:NSF(US) DEB0746560 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z50450515 Keywords : house mouse * hybrid zones * linkage disequilibrium * SNP markers Subject RIV: EG - Zoology Impact factor: 5.522, year: 2011

Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

Directory of Open Access Journals (Sweden)

Maria Balcova

2016-04-01

Full Text Available Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm and Mus m. domesticus (Mmd, it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2 genomic locus on Chromosome X (Chr X by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s responsible for variation in the global recombination rate between closely related mouse subspecies.

Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

Science.gov (United States)

Balcova, Maria; Faltusova, Barbora; Gergelits, Vaclav; Bhattacharyya, Tanmoy; Mihola, Ondrej; Trachtulec, Zdenek; Knopf, Corinna; Fotopulosova, Vladana; Chvatalova, Irena; Gregorova, Sona; Forejt, Jiri

2016-04-01

Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm) and Mus m. domesticus (Mmd), it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2) genomic locus on Chromosome X (Chr X) by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s) responsible for variation in the global recombination rate between closely related mouse subspecies.

Aspects of the life history of Muspicea borreli (Nematoda: Muspiceidae, parasite of the house mouse (Mus domesticus in Australia

Directory of Open Access Journals (Sweden)

Spratt D.M.

2002-09-01

Full Text Available Prevalence of Muspicea borreli (Nematoda infection in wild populations of Mus domesticus in forests in southeastern New South Wales and in rural Canberra, Australia was variable, relatively low and the parasite occurred predominantly in male mice. Experimental infection of BALB/c mice occurred only via subcutaneous inoculation but was achieved using i adults containing embryonating eggs, ii adults containing active larvae and iii active larvae dissected from the uterus of female worms. Experimental infection was not established using adults containing unembryonated eggs and was not established via intraperitoneal, percutaneous nor oral routes. Evidence indicates that larvae develop to the infective stage in the uterus of the adult worm, suggests that an obligate developmental phase on the host skin does not occur and that autoinfection is possible. Experimental infection predominated in males; females rarely became infected. When male BALB/c mice were inoculated subcutaneously with M. borreli, immediately paired with an uninoculated female and permitted to breed for 90 days, infection was found in male and female offspring only of the second and subsequent litters or in the breeding female partner. Transmission to the young occurred within 21 days of birth and fifth-stage M. borreli were found in offspring of the second and subsequent litters only after 35 or more days. However, when a male was inoculated but mating delayed for 23 days, infection was found in progeny of the first and second litters. The life cycle is direct and the prepatent period in BALB/c mice is estimated at 50-60 days. The precise mode of transmission of the parasite in breeding pairs of mice was not determined but larvae remained active for approximately an hour in balanced saline solutions (pH = 7.2 and in human saliva but died under conditions emulating free-living (tap water pH = 7.1 and stomach (pepsin solution pH = 2 environments. Transmission was not effected by

Evolutionary and functional properties of a two-locus β-globin polymorphism in Indian house mice

DEFF Research Database (Denmark)

Runck, Amy M; Weber, Roy E.; Fago, Angela

2010-01-01

exceeded neutral expectations, and reconstructed haplotype networks for both β-globin paralogs revealed extensive allele sharing with several other closely related species of Mus. However, despite this suggestive evidence for balancing selection, O2-equilibrium curves revealed no discernible functional......Electrophoretic surveys of hemoglobin (Hb) polymorphism in house mice from South Asia and the Middle East have revealed that two alternative β-globin haplotypes, Hbbd and Hbbp, are often present at intermediate frequencies in geographically disparate populations. Both haplotypes harbor two......) are distinguished by two amino acid substitutions. To investigate the possible adaptive significance of the Hbbd/Hbbp polymorphism we conducted a population genetic analysis of the duplicated β-globin genes of Indian house mice (Mus castaneus) in conjunction with experimental studies of Hb function in inbred...

Geographic phenetic variation of two eastern-Mediterranean non-commensal mouse species, Mus macedonicus and M. cypriacus (Rodentia: Muridae) based on traditional and geometric approaches to morphometrics

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš; Mikula, Ondřej; Vohralík, V.

2008-01-01

Roč. 247, - (2008), s. 67-80 ISSN 0044-5231 R&D Projects: GA AV ČR IAA6045307; GA ČR GA206/06/0707 Grant - others:GA ČR(CZ) GA206/05/2334 Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus macedonicus * Mus cypriacus * phenotypic variation Subject RIV: EG - Zoology Impact factor: 1.319, year: 2008

Vitamin K epoxide reductase complex subunit 1 (Vkorc1 haplotype diversity in mouse priority strains

Directory of Open Access Journals (Sweden)

Kohn Michael H

2008-12-01

Full Text Available Abstract Background Polymorphisms in the vitamin K-epoxide reductase complex subunit 1 gene, Vkorc1, could affect blood coagulation and other vitamin K-dependent proteins, such as osteocalcin (bone Gla protein, BGP. Here we sequenced the Vkorc1 gene in 40 mouse priority strains. We analyzed Vkorc1 haplotypes with respect to prothrombin time (PT and bone mineral density and composition (BMD and BMC; phenotypes expected to be vitamin K-dependent and represented by data in the Mouse Phenome Database (MPD. Findings In the commonly used laboratory strains of Mus musculus domesticus we identified only four haplotypes differing in the intron or 5' region sequence of the Vkorc1. Six haplotypes differing by coding and non-coding polymorphisms were identified in the other subspecies of Mus. We detected no significant association of Vkorc1 haplotypes with PT, BMD and BMC within each subspecies of Mus. Vkorc1 haplotype sequences divergence between subspecies was associated with PT, BMD and BMC. Conclusion Phenotypic variation in PT, BMD and BMC within subspecies of Mus, while substantial, appears to be dominated by genetic variation in genes other than the Vkorc1. This was particularly evident for M. m. domesticus, where a single haplotype was observed in conjunction with virtually the entire range of PT, BMD and BMC values of all 5 subspecies of Mus included in this study. Differences in these phenotypes between subspecies also should not be attributed to Vkorc1 variants, but should be viewed as a result of genome wide genetic divergence.

Meiotic synapsis of homogeneously staining regions (HSRs) in chromosome 1 of Mus musculus.

Science.gov (United States)

Winking, H; Reuter, C; Traut, W

1993-05-01

About 50 copies of a long-range repeat DNA family with a repeat size of roughly 100 kb and with sequence homology to mRNAs are clustered in the G-light band D of chromosome 1 of the house mouse, Mus musculus. We studied amplified versions of the cluster which are found in many wild populations of M. musculus. They are cytogenetically conspicuous as one or two C-band positive homogeneously staining regions (single- and double band HSRs) which increase the mitotic length of chromosome 1. The double band HSR was phylogenetically derived from a single band HSR by a paracentric inversion. In homozygous condition, such HSRs contribute, albeit not as much as expected from their mitotic length, to the synaptonemal complex (SC) length of chromosome 1. In HSR heterozygous animals an elongation of the SCs was not noticeable. In single band HSR heterozygous males, synapsis proceeds regularly and continuously from the distal telomere towards the centromeric end without forming buckles. Thus, the single band HSR has no adverse effect on pairing. The same straight pairing behaviour was found in the majority of double band HSR heterozygous spermatocytes. This shows that extensive nonhomologous pairing can take place in the earliest phase of synapsis. Synapsis was discontinuous, leaving the central part of the bivalent 1 asynapsed, in only 14.3% of double band HSR heterozygous cells. In such cells the chromosome 1 SC is completed at a later stage of meiosis. The delay is presumably an effect of the inversion that includes one HSR band and the segment between the two HSR bands.

Laju peningkatan konsentrasi timbal Pb dalam darah hewan uji mencit Mus musculus di bengkel otomotif

Directory of Open Access Journals (Sweden)

Mohammad Razif Sukatma

2012-02-01

Full Text Available This research was conducted in automotive workshop of VEDC Malang and the samples were taken at the automotive machineand automotive electric workshops. The parameters which examined were the Pb concentration in the mouse blood (Mus musculus in2 and 3 months years old. The measurement was run for 5 times every 10 days, and the result was mean value of the increasing rate ofPb concentration in the mouse blood. The aim of this research was to determine the increasing rate of Pb concentration in the mouseblood which has the relation with different working area, different age, and also duration of exposure. Based on the data of laboratorytest, research continued by T-test analysis, Simple regression test, and correlation, and also General Linear Model. By doing statisticanalysis with the different working area, duration of explanation, and different age.Result of this research showed that there were the differences of rapid increasing of Pb concentration in both workshop. Generallythe age which influence so much for that (in the mouse body and have the relation with the body stamina. If the mouse body absorbamount of Pb constantly, so the Pb concentration in it will increase more and more and it cause the decreasing of the body height.

MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

Energy Technology Data Exchange (ETDEWEB)

Xie, Suhong; Zheng, Hui [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Wen, Xuemei [Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Lu, Renquan, E-mail: lurenquan@126.com [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China)

2016-08-05

The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

International Nuclear Information System (INIS)

Xie, Suhong; Zheng, Hui; Wen, Xuemei; Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin; Lu, Renquan

2016-01-01

The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

Characterization of two forms of mouse salivary androgen-binding protein (ABP): implications for evolutionary relationships and ligand-binding function.

Science.gov (United States)

Karn, Robert C; Laukaitis, Christina M

2003-06-17

Mouse salivary androgen-binding protein (ABP) is a member of the secretoglobin family produced in the submaxillary glands of house mice (Mus musculus). We report the cDNA sequences and amino acid sequences of the beta and gamma subunits of ABP from a mouse cDNA library, identifying the two subunits by their pIs and molecular weights. An anomalously high molecular weight of the alpha subunit is likely due to glycosylation at a single site. A phylogenetic comparison of the three subunits of ABP with the chains of other mammalian secretoglobins shows that ABP is most closely related to mouse lachrymal protein and to the major cat allergen Fel dI. An evaluation of the most conserved residues in ABP and the other secretoglobins, in light of structural data reported by others [Callebaut, I., Poupon, A., Bally, R., Demaret, J.-P., Housset, D., Delettre, J., Hossenlopp, P., and Mornon, J.-P. (2000) Ann. N.Y. Acad. Sci. 923, 90-112; Pattabiraman, N., Matthews, J., Ward, K., Mantile-Selvaggi, G., Miele, L., and Mukherjee, A. (2000) Ann. N.Y. Acad. Sci. 923, 113-127], allows us to draw conclusions about the critical residues important in ligand binding by the two different ABP dimers and to assess the importance of ligand binding in the function of the molecule. In addition to the cDNAs, which represent those of the musculus subspecies of Mus musculus, we also report the coding regions of the beta and gamma subunit cDNAs from two other mouse inbred strains which represent the other two subspecies: M. musculus domesticus and M. musculus castaneus. The high nonsynonymous/synonymous substitution rate ratios (K(a)/K(s)) for both the beta and gamma subunits suggest that these two proteins are evolving under strong directional selection, as has been reported for the alpha subunit [Hwang, J., Hofstetter, J., Bonhomme, F., and Karn, R. (1997) J. Hered. 88, 93-97; Karn, R., and Clements, M. (1999) Biochem. Genet. 37, 187-199].

Transgressive segregation in a behavioural trait? Explorative strategies in two house mouse subspecies and their hybrids

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Vošlajerová Bímová, Barbora; Mikula, Ondřej; Piálek, Jaroslav; Macholán, Miloš

2013-01-01

Roč. 108, č. 1 (2013), s. 225-235 ISSN 0024-4066 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792; GA AV ČR KJB600930701 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersion * exploration * hybridization * Mus musculus domesticus * Mus musculus musculus * open field test Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 2.535, year: 2013

Charles River altered Schaedler flora (CRASF) remained stable for four years in a mouse colony housed in individually ventilated cages.

Science.gov (United States)

Stehr, Matthias; Greweling, Marina C; Tischer, Sabine; Singh, Mahavir; Blöcker, Helmut; Monner, David A; Müller, Werner

2009-10-01

As recommendations for specific pathogen-free housing change, mouse facilities need to re-derive their colonies repeatedly in order to eliminate specified bacteria or viruses. This paper describes the establishment of a new mouse facility using as starting point a small colony of CD-1 mice colonized with the Charles River altered Schaedler flora (CRASF) housed in individually ventilated cages (IVCs). The import of new strains was performed exclusively via embryo transfer using CD-1 mice as recipients. The integrity of the CRASF in caecum samples of the original CD-1 colony and of three inbred mouse lines imported into the colony was proven by a quantitative realtime polymerase chain reaction approach. Furthermore, we searched for bacterial contaminants in the gut flora using non-specific 16S rRNA primers. The bacterial sequences found were closely related to but not exclusively sequences of altered Schaedler flora (ASF) members, suggesting that the ASF is heterogeneous rather than restricted to the eight defined bacteria. Moreover, no pathogens were found, neither using the non-specific 16S rRNA primers nor in routine quarterly health monitoring. As one effect of this defined gut flora, interleukin-10 knockout mice are devoid of colitis in our facility. In conclusion, our approach building up a mouse facility using foster mothers and embryo transfer as well as a strict barrier system and IVCs is suitable to maintain a colony free from contaminating bacteria over the long term. CRASF remained stable for seven mouse generations and was efficiently transferred to the imported mouse strains.

Transcriptomic and Proteomic Profiling Revealed High Proportions of Odorant Binding and Antimicrobial Defense Proteins in Olfactory Tissues of the House Mouse

Directory of Open Access Journals (Sweden)

Barbora Kuntová

2018-02-01

Full Text Available Mammalian olfaction depends on chemosensory neurons of the main olfactory epithelia (MOE, and/or of the accessory olfactory epithelia in the vomeronasal organ (VNO. Thus, we have generated the VNO and MOE transcriptomes and the nasal cavity proteome of the house mouse, Mus musculus musculus. Both transcriptomes had low levels of sexual dimorphisms, while the soluble proteome of the nasal cavity revealed high levels of sexual dimorphism similar to that previously reported in tears and saliva. Due to low levels of sexual dimorphism in the olfactory receptors in MOE and VNO, the sex-specific sensing seems less likely to be dependent on receptor repertoires. However, olfaction may also depend on a continuous removal of background compounds from the sites of detection. Odorant binding proteins (OBPs are thought to be involved in this process and in our study Obp transcripts were most expressed along other lipocalins (e.g., Lcn13, Lcn14 and antimicrobial proteins. At the level of proteome, OBPs were highly abundant with only few being sexually dimorphic. We have, however, detected the major urinary proteins MUP4 and MUP5 in males and females and the male-biased central/group-B MUPs that were thought to be abundant mainly in the urine. The exocrine gland-secreted peptides ESP1 and ESP22 were male-biased but not male-specific in the nose. For the first time, we demonstrate that the expression of nasal lipocalins correlates with antimicrobial proteins thus suggesting that their individual variation may be linked to evolvable mechanisms that regulate natural microbiota and pathogens that regularly enter the body along the ‘eyes-nose-oral cavity’ axis.

Phosphorylation by CK2 regulates MUS81/EME1 in mitosis and after replication stress.

Science.gov (United States)

Palma, Anita; Pugliese, Giusj Monia; Murfuni, Ivana; Marabitti, Veronica; Malacaria, Eva; Rinalducci, Sara; Minoprio, Anna; Sanchez, Massimo; Mazzei, Filomena; Zolla, Lello; Franchitto, Annapaola; Pichierri, Pietro

2018-06-01

The MUS81 complex is crucial for preserving genome stability through the resolution of branched DNA intermediates in mitosis. However, untimely activation of the MUS81 complex in S-phase is dangerous. Little is known about the regulation of the human MUS81 complex and how deregulated activation affects chromosome integrity. Here, we show that the CK2 kinase phosphorylates MUS81 at Serine 87 in late-G2/mitosis, and upon mild replication stress. Phosphorylated MUS81 interacts with SLX4, and this association promotes the function of the MUS81 complex. In line with a role in mitosis, phosphorylation at Serine 87 is suppressed in S-phase and is mainly detected in the MUS81 molecules associated with EME1. Loss of CK2-dependent MUS81 phosphorylation contributes modestly to chromosome integrity, however, expression of the phosphomimic form induces DSBs accumulation in S-phase, because of unscheduled targeting of HJ-like DNA intermediates, and generates a wide chromosome instability phenotype. Collectively, our findings describe a novel regulatory mechanism controlling the MUS81 complex function in human cells. Furthermore, they indicate that, genome stability depends mainly on the ability of cells to counteract targeting of branched intermediates by the MUS81/EME1 complex in S-phase, rather than on a correct MUS81 function in mitosis.

Laboratory mouse housing conditions can be improved using common environmental enrichment without compromising data

Science.gov (United States)

Gau, Christine; Scheideler, Angelika; Aguilar-Pimentel, Juan A.; Amarie, Oana V.; Becker, Lore; Garrett, Lillian; Hans, Wolfgang; Hölter, Sabine M.; Janik, Dirk; Moreth, Kristin; Neff, Frauke; Östereicher, Manuela; Racz, Ildiko; Rathkolb, Birgit; Rozman, Jan; Bekeredjian, Raffi; Graw, Jochen; Klingenspor, Martin; Klopstock, Thomas; Ollert, Markus; Schmidt-Weber, Carsten; Wolf, Eckhard; Wurst, Wolfgang; Gailus-Durner, Valérie; Brielmeier, Markus; Fuchs, Helmut; Hrabé de Angelis, Martin

2018-01-01

Animal welfare requires the adequate housing of animals to ensure health and well-being. The application of environmental enrichment is a way to improve the well-being of laboratory animals. However, it is important to know whether these enrichment items can be incorporated in experimental mouse husbandry without creating a divide between past and future experimental results. Previous small-scale studies have been inconsistent throughout the literature, and it is not yet completely understood whether and how enrichment might endanger comparability of results of scientific experiments. Here, we measured the effect on means and variability of 164 physiological parameters in 3 conditions: with nesting material with or without a shelter, comparing these 2 conditions to a “barren” regime without any enrichments. We studied a total of 360 mice from each of 2 mouse strains (C57BL/6NTac and DBA/2NCrl) and both sexes for each of the 3 conditions. Our study indicates that enrichment affects the mean values of some of the 164 parameters with no consistent effects on variability. However, the influence of enrichment appears negligible compared to the effects of other influencing factors. Therefore, nesting material and shelters may be used to improve animal welfare without impairment of experimental outcome or loss of comparability to previous data collected under barren housing conditions. PMID:29659570

Laboratory mouse housing conditions can be improved using common environmental enrichment without compromising data.

Directory of Open Access Journals (Sweden)

Viola André

2018-04-01

Full Text Available Animal welfare requires the adequate housing of animals to ensure health and well-being. The application of environmental enrichment is a way to improve the well-being of laboratory animals. However, it is important to know whether these enrichment items can be incorporated in experimental mouse husbandry without creating a divide between past and future experimental results. Previous small-scale studies have been inconsistent throughout the literature, and it is not yet completely understood whether and how enrichment might endanger comparability of results of scientific experiments. Here, we measured the effect on means and variability of 164 physiological parameters in 3 conditions: with nesting material with or without a shelter, comparing these 2 conditions to a "barren" regime without any enrichments. We studied a total of 360 mice from each of 2 mouse strains (C57BL/6NTac and DBA/2NCrl and both sexes for each of the 3 conditions. Our study indicates that enrichment affects the mean values of some of the 164 parameters with no consistent effects on variability. However, the influence of enrichment appears negligible compared to the effects of other influencing factors. Therefore, nesting material and shelters may be used to improve animal welfare without impairment of experimental outcome or loss of comparability to previous data collected under barren housing conditions.

Where are the wormy mice? A re-examination of hybrid parasitism in the European house mouse hybrid zone

Czech Academy of Sciences Publication Activity Database

Baird, Stuart J. E.; Ribas, Alexis; Macholán, Miloš; Albrecht, Tomáš; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

2012-01-01

Roč. 66, č. 9 (2012), s. 2757-2772 ISSN 0014-3820 R&D Projects: GA ČR GA206/08/0640 Institutional support : RVO:68081766 ; RVO:67985904 Keywords : helminths * Mus musculus domesticus * Mus musculus musculus * resistance * immune gene transitive compatibility Subject RIV: EG - Zoology Impact factor: 4.864, year: 2012

Genetic structure and contrasting selection pattern at two major histocompatibility complex genes in wild house mouse populations

Czech Academy of Sciences Publication Activity Database

Čížková, Dagmar; Goüy de Bellocq, J.; Baird, S. J. E.; Piálek, Jaroslav; Bryja, Josef

2011-01-01

Roč. 106, č. 5 (2011), s. 727-740 ISSN 0018-067X R&D Projects: GA AV ČR IAA600930608; GA ČR GA206/08/0640 Institutional research plan: CEZ:AV0Z60930519 Keywords : MHC * house mouse * selection * population structure * trans-species polymorphism Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.597, year: 2011

On the determination of Toxoplasma gondii virulence in mice

Science.gov (United States)

Toxoplasma gondii is one of the most successful pathogens on earth, capable of infecting mammals and birds. Numerous papers and reports are published on isolation of T .gondii from various natural sources worldwide. The house mouse (Mus musculus) has been used as the laboratory animal model to deter...

Dissecting the genetic architecture of F1 hybrid sterility in house mice.

Science.gov (United States)

Dzur-Gejdosova, Maria; Simecek, Petr; Gregorova, Sona; Bhattacharyya, Tanmoy; Forejt, Jiri

2012-11-01

Hybrid sterility as a postzygotic reproductive isolation mechanism has been studied for over 80 years, yet the first identifications of hybrid sterility genes in Drosophila and mouse are quite recent. To study the genetic architecture of F(1) hybrid sterility between young subspecies of house mouse Mus m. domesticus and M. m. musculus, we conducted QTL analysis of a backcross between inbred strains representing these two subspecies and probed the role of individual chromosomes in hybrid sterility using the intersubspecific chromosome substitution strains. We provide direct evidence that the asymmetry in male infertility between reciprocal crosses is conferred by the middle region of M. m. musculus Chr X, thus excluding other potential candidates such as Y, imprinted genes, and mitochondrial DNA. QTL analysis identified strong hybrid sterility loci on Chr 17 and Chr X and predicted a set of interchangeable autosomal loci, a subset of which is sufficient to activate the Dobzhansky-Muller incompatibility of the strong loci. Overall, our results indicate the oligogenic nature of F(1) hybrid sterility, which should be amenable to reconstruction by proper combination of chromosome substitution strains. Such a prefabricated model system should help to uncover the gene networks and molecular mechanisms underlying hybrid sterility. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

Density, body size, and reproduction of feral house mice on Gough ...

African Journals Online (AJOL)

Feral house mice Mus musailus have occurred on Gough Island, South Atlantic Ocean, for about 180 years. The population was sampled during the austral spring of 1990. Estimated density on a live-trapping grid in dense cover (woody plants, ferns, grass) near the coast was 224 mice/ha. Snap-trapping at high altitude, ...

Environmental Impact Statement. Disposal and Reuse of Wurtsmith Air Force Base, Michigan

Science.gov (United States)

1993-09-01

Mephitis mephitis Meadow vole Microtus pennsy/vanicus House mouse Mus musculus Long-tailed weasel Mustela frenata Mink Mustela vison Little brown bat...fuels, such as coal and oil, are burned. SO2 is the main pollutant involved in the formation of acid rain. SO also can irritate the upper respiratory

X-ray structure of a soluble Rieske-type ferredoxin from Mus musculus

International Nuclear Information System (INIS)

Levin, Elena J.; Elsen, Nathaniel L.; Seder, Kory D.; McCoy, Jason G.; Fox, Brian G.; Phillips Jr, George N.

2008-01-01

The X-ray crystal structure of a soluble Rieske ferredoxin from M. musculus was solved at 2.07 Å resolution, revealing an iron–sulfur cluster-binding domain with similar architecture to the Rieske-type domains of bacterial aromatic dioxygenases. The ferredoxin was also shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases. The 2.07 Å resolution X-ray crystal structure of a soluble Rieske-type ferredoxin from Mus musculus encoded by the gene Mm.266515 is reported. Although they are present as covalent domains in eukaryotic membrane oxidase complexes, soluble Rieske-type ferredoxins have not previously been observed in eukaryotes. The overall structure of the mouse Rieske-type ferredoxin is typical of this class of iron–sulfur proteins and consists of a larger partial β-barrel domain and a smaller domain containing Cys57, His59, Cys80 and His83 that binds the [2Fe–2S] cluster. The S atoms of the cluster are hydrogen-bonded by six backbone amide N atoms in a pattern typical of membrane-bound high-potential eukaryotic respiratory Rieske ferredoxins. However, phylogenetic analysis suggested that the mouse Rieske-type ferredoxin was more closely related to bacterial Rieske-type ferredoxins. Correspondingly, the structure revealed an extended loop most similar to that seen in Rieske-type ferredoxin subunits of bacterial aromatic dioxygenases, including the positioning of an aromatic side chain (Tyr85) between this loop and the [2Fe–2S] cluster. The mouse Rieske-type ferredoxin was shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases, although it was unable to serve as an electron donor for a bacterial monooxygenase complex. The human homolog of mouse Rieske-type ferredoxin was also cloned and purified. It behaved identically to mouse Rieske-type ferredoxin in all biochemical characterizations but did not crystallize. Based on its high sequence identity, the structure of the

Are ribosomal DNA clusters rearrangement hotspots? A case study in the genus Mus (Rodentia, Muridae

Directory of Open Access Journals (Sweden)

Douzery Emmanuel JP

2011-05-01

Full Text Available Abstract Background Recent advances in comparative genomics have considerably improved our knowledge of the evolution of mammalian karyotype architecture. One of the breakthroughs was the preferential localization of evolutionary breakpoints in regions enriched in repetitive sequences (segmental duplications, telomeres and centromeres. In this context, we investigated the contribution of ribosomal genes to genome reshuffling since they are generally located in pericentromeric or subtelomeric regions, and form repeat clusters on different chromosomes. The target model was the genus Mus which exhibits a high rate of karyotypic change, a large fraction of which involves centromeres. Results The chromosomal distribution of rDNA clusters was determined by in situ hybridization of mouse probes in 19 species. Using a molecular-based reference tree, the phylogenetic distribution of clusters within the genus was reconstructed, and the temporal association between rDNA clusters, breakpoints and centromeres was tested by maximum likelihood analyses. Our results highlighted the following features of rDNA cluster dynamics in the genus Mus: i rDNA clusters showed extensive diversity in number between species and an almost exclusive pericentromeric location, ii a strong association between rDNA sites and centromeres was retrieved which may be related to their shared constraint of concerted evolution, iii 24% of the observed breakpoints mapped near an rDNA cluster, and iv a substantial rate of rDNA cluster change (insertion, deletion also occurred in the absence of chromosomal rearrangements. Conclusions This study on the dynamics of rDNA clusters within the genus Mus has revealed a strong evolutionary relationship between rDNA clusters and centromeres. Both of these genomic structures coincide with breakpoints in the genus Mus, suggesting that the accumulation of a large number of repeats in the centromeric region may contribute to the high level of chromosome

Comparative analysis of Homo sapiens and Mus musculus cyclin-dependent kinase (CDK) inhibitor genes p16 (MTS1) and p15 (MTS2).

Science.gov (United States)

Jiang, P; Stone, S; Wagner, R; Wang, S; Dayananth, P; Kozak, C A; Wold, B; Kamb, A

1995-12-01

Cyclin-dependent kinase inhibitors are a growing family of molecules that regulate important transitions in the cell cycle. At least one of these molecules, p16, has been implicated in human tumorigenesis while its close homolog, p15, is induced by cell contact and transforming growth factor-beta (TGF-beta). To investigate the evolutionary and functional features of p15 and p16, we have isolated mouse (Mus musculus) homologs of each gene. Comparative analysis of these sequences provides evidence that the genes have similar functions in mouse and human. In addition, the comparison suggests that a gene conversion event is part of the evolution of the human p15 and p16 genes.

Genetic dissection of a key reproductive barrier between nascent species of house mice.

Science.gov (United States)

White, Michael A; Steffy, Brian; Wiltshire, Tim; Payseur, Bret A

2011-09-01

Reproductive isolation between species is often caused by deleterious interactions among loci in hybrids. Finding the genes involved in these incompatibilities provides insight into the mechanisms of speciation. With recently diverged subspecies, house mice provide a powerful system for understanding the genetics of reproductive isolation early in the speciation process. Although previous studies have yielded important clues about the genetics of hybrid male sterility in house mice, they have been restricted to F1 sterility or incompatibilities involving the X chromosome. To provide a more complete characterization of this key reproductive barrier, we conducted an F2 intercross between wild-derived inbred strains from two subspecies of house mice, Mus musculus musculus and Mus musculus domesticus. We identified a suite of autosomal and X-linked QTL that underlie measures of hybrid male sterility, including testis weight, sperm density, and sperm morphology. In many cases, the autosomal loci were unique to a specific sterility trait and exhibited an effect only when homozygous, underscoring the importance of examining reproductive barriers beyond the F1 generation. We also found novel two-locus incompatibilities between the M. m. musculus X chromosome and M. m. domesticus autosomal alleles. Our results reveal a complex genetic architecture for hybrid male sterility and suggest a prominent role for reproductive barriers in advanced generations in maintaining subspecies integrity in house mice.

Genetic Dissection of a Key Reproductive Barrier Between Nascent Species of House Mice

Science.gov (United States)

White, Michael A.; Steffy, Brian; Wiltshire, Tim; Payseur, Bret A.

2011-01-01

Reproductive isolation between species is often caused by deleterious interactions among loci in hybrids. Finding the genes involved in these incompatibilities provides insight into the mechanisms of speciation. With recently diverged subspecies, house mice provide a powerful system for understanding the genetics of reproductive isolation early in the speciation process. Although previous studies have yielded important clues about the genetics of hybrid male sterility in house mice, they have been restricted to F1 sterility or incompatibilities involving the X chromosome. To provide a more complete characterization of this key reproductive barrier, we conducted an F2 intercross between wild-derived inbred strains from two subspecies of house mice, Mus musculus musculus and Mus musculus domesticus. We identified a suite of autosomal and X-linked QTL that underlie measures of hybrid male sterility, including testis weight, sperm density, and sperm morphology. In many cases, the autosomal loci were unique to a specific sterility trait and exhibited an effect only when homozygous, underscoring the importance of examining reproductive barriers beyond the F1 generation. We also found novel two-locus incompatibilities between the M. m. musculus X chromosome and M. m. domesticus autosomal alleles. Our results reveal a complex genetic architecture for hybrid male sterility and suggest a prominent role for reproductive barriers in advanced generations in maintaining subspecies integrity in house mice. PMID:21750261

Rad54 and Mus81 cooperation promotes DNA damage repair and restrains chromosome missegregation

DEFF Research Database (Denmark)

Ghamrasni, S El; Cardoso, R; Li, L

2016-01-01

. The inefficient repair of DNA double-strand breaks (DSBs) in Rad54(-/-)Mus81(-/-) cells was accompanied by elevated levels of chromosome missegregation and cell death. Perhaps as a consequence, tumor incidence in Rad54(-/-)Mus81(-/-) mice remained comparable to that in Mus81(-/-) mice. Our study highlights...

One normal void and residual following MUS surgery is all that is necessary in most patients.

Science.gov (United States)

Ballard, Paul; Shawer, Sami; Anderson, Colette; Khunda, Aethele

2018-04-01

There is considerable variation worldwide on how the assessment of voiding function is performed following midurethral sling (MUS) surgery. There is potentially a financial cost, and reduction in efficiency when patient discharge is delayed. Using our current practice of two normal void and residual (V&R) readings before discharge, the aim of this retrospective study was to evaluate the likelihood of an abnormal second V&R test if the first V&R test was normal in order to determine if a policy of discharge after only one satisfactory V&R test is reasonable. Data from 400 patients who had had MUS surgery with or without other procedures were collected. Our unit protocol included two consecutive voids of greater than 200 ml with residuals less than 150 ml before discharge. The patients were divided into the following groups: MUS only, MUS plus anterior colporrhaphy (AR) plus any other procedures (MUS/AR), and MUS with any non-AR procedures (MUS+). Complete datasets were available for 335 patients. Once inadequate tests (low volume voids <200 ml) had been excluded (28% overall), the likelihood of an abnormal second V&R test if the first test was normal was 7.1% overall, but 3.6% for MUS, 11.5% for MUS/AR and 8.6% for MUS+. The findings in the MUS-only group indicate that it is probably safe to discharge patients after one satisfactory V&R test, as long as safety measures such as 'open access' are available so that patients have unhindered readmission if problems arise.

Predictive validity of a non-induced mouse model of compulsive-like behavior

NARCIS (Netherlands)

Greene-Schloesser, D. M.; Van der Zee, E. A.; Sheppard, D. K.; Castillo, M. R.; Gregg, K. A.; Burrow, T.; Foltz, H.; Slater, M.; Bult-Ito, A.

2011-01-01

A key to advancing the understanding of obsessive-compulsive disorder (OCD)-like symptoms is the development of spontaneous animal models. Over 55 generations of bidirectional selection for nest-building behavior in house mice, Mus musculus, resulted in a 40-fold difference in the amount of cotton

X chromosome control of meiotic chromosome synapsis in mouse inter-subspecific hybrids.

Directory of Open Access Journals (Sweden)

Tanmoy Bhattacharyya

2014-02-01

Full Text Available Hybrid sterility (HS belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2(Mmm allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes.

X chromosome control of meiotic chromosome synapsis in mouse inter-subspecific hybrids.

Science.gov (United States)

Bhattacharyya, Tanmoy; Reifova, Radka; Gregorova, Sona; Simecek, Petr; Gergelits, Vaclav; Mistrik, Martin; Martincova, Iva; Pialek, Jaroslav; Forejt, Jiri

2014-02-01

Hybrid sterility (HS) belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X) harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2(Mmm) allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes.

X Chromosome Control of Meiotic Chromosome Synapsis in Mouse Inter-Subspecific Hybrids

Science.gov (United States)

Bhattacharyya, Tanmoy; Reifova, Radka; Gregorova, Sona; Simecek, Petr; Gergelits, Vaclav; Mistrik, Martin; Martincova, Iva; Pialek, Jaroslav; Forejt, Jiri

2014-01-01

Hybrid sterility (HS) belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X) harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2Mmm allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes. PMID:24516397

Le MusVerre, Sars-Poteries, Hauts-de-France

OpenAIRE

Schmitt , Daniel

2017-01-01

Le MusVerre, inauguré en 2016, présente une collection patrimoniale et contemporaine d'art verrier. Le scénario de la visite propose un parcours en deux temps avec une séquence historique : de l’histoire des « bousillés » à la création du musée avec une galerie technique qui donne un aperçu des gestes de l’art verrier. Puis une séquence contemporaine développe un panorama des collections d’art verrier d’aujourd’hui, dans leur grande richesse et originalité.

INTEGRAL/JEM-X detection of fading emission from GT Mus

DEFF Research Database (Denmark)

Fiocchi, M.; Chenevez, J.; Sguera, V.

2015-01-01

On November 15th 2015 the MAXI/GSC detected a big flare from the RS CVn star GT Mus with a flux of ~100 mCrab in the 2-20 keV energy band. (ATel #8285). During recent INTEGRAL observations of the Musca region performed between 17 Nov 16:08 and 18 Nov 00:05 (UTC) the source GT Mus was within the f...

Comparison of in-house biotin-avidin tetanus IgG enzyme-linked-immunosorbent assay (ELISA) with gold standard in vivo mouse neutralization test for the detection of low level antibodies.

Science.gov (United States)

Sonmez, Cemile; Coplu, Nilay; Gozalan, Aysegul; Akin, Lutfu; Esen, Berrin

2017-06-01

Detection of anti-tetanus antibody levels is necessary for both determination of the immune status of individuals and also for planning preventive measures. ELISA is the preferred test among in vitro tests however it can be affected by the cross reacting antibodies. A previously developed in-house ELISA test was found not reliable for the antibody levels ≤1.0IU/ml. A new method was developed to detect low antibody levels correctly. The aim of the present study was to compare the results of the newly developed in-house biotin-avidin tetanus IgG ELISA test with the in vivo mouse neutralization test, for the antibody levels ≤1.0IU/ml. A total of 54 serum samples with the antibody levels of three different levels, =0.01IU/ml, 0.01-0.1IU/ml, 0.1-1IU/ml, which were detected by in vivo mouse neutralization test were studied by the newly developed in-house biotin-avidin tetanus IgG ELISA test. Test was validated by using five different concentrations (0.01IU/ml, 0.06IU/ml, 0.2IU/ml, 0.5IU/ml, 1.0IU/ml). A statistically significant correlation (r 2 =0.9967 p=0,001) between in vivo mouse neutralization test and in-house biotin-avidin tetanus IgG ELISA test, was observed. For the tested concentrations intra-assay, inter-assay, accuracy, sensitivity, specificity and coefficients of variations were determined as ≤15%. In-house biotin-avidin tetanus IgG ELISA test can be an alternative method to in vivo mouse neutralization method for the detection of levels ≤1.0IU/ml. By using in-house biotin-avidin tetanus IgG ELISA test, individuals with non protective levels, will be reliably detected. Copyright © 2017. Published by Elsevier B.V.

Curcumin Is Efective In Improving Folliculogenesis Profile And Oo-cytes Quality In Vitro In Ectopic Endometriosis Mouse (Mus muscu-lus Models

Directory of Open Access Journals (Sweden)

Aulia Firmawati

2018-02-01

Full Text Available Endometriosis is the presence of ectopic endometrial tissue, such as that outside the uter-ine cavity, which can cause chronic inflammatory reactions. Curcumin is one of traditional herbal med-icines that is widely used. Some experiments have managed to find a mechanism to treat an ectopic endometriosis through the mechanism of suppression of several cytokines such as TNF-alpha, NF-kB and COX-2, this study was an experimental laboratory study, with five treatments and six replications, using female mice (Mus musculus that had reached puberty. The study consisted of three phases: the first phase was the microscopic examination of in vitro oocytes quality, and the second was histopatho-logical examination of folliculogenesis profile using Hematoxillin eosin staining, the results of this study showed significant difference between positive control group (P0 with treatment and negative control (KN groups in folliculogenesis profile (p <0.05. Examination of in vitro oocytes quality showed sig-nificant difference between positive control group with treatment group and negative control group (p <0.05. Curcumin has several roles in cytokines modulation in ectopic endometriosis mouse models. Curcumin may reduce the occurrence of apoptosis of granulosa cells so that it may directly improve oocyte quality and folliculogenesis profile, in conclusion, curcumin effectively overcomes fertility prob-lems through the mechanism of cytokines modulation that plays a role in some cases of endometriosis such as: TNF-alpha, NF-kB and COX-2. Curcumin may improve folliculogenesis profile and in vitro oocytes quality.

Acute MUS81 depletion leads to replication fork slowing and a constitutive DNA damage response

DEFF Research Database (Denmark)

Xing, Meichun; Wang, Xiaohui; Palmai-Pallag, Timea

2015-01-01

have investigated the role of MUS81 in human cells by acutely depleting the protein using shRNAs. We found that MUS81 depletion from human fibroblasts leads to accumulation of ssDNA and a constitutive DNA damage response that ultimately activates cellular senescence. Moreover, we show that MUS81...

A Survey of Toxoplasma gondii and Neospora caninum Infecting House Mice from a Hybrid Zone

Czech Academy of Sciences Publication Activity Database

Hůrková-Hofmannová, L.; Qablan, M. A.; Juránková, J.; Modrý, David; Piálek, Jaroslav

2014-01-01

Roč. 100, č. 1 (2014), s. 139-141 ISSN 0022-3395 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:60077344 ; RVO:68081766 Keywords : mouse Mus musculus * feral rodents * wild rodents Subject RIV: EB - Genetics ; Molecular Biology; EB - Genetics ; Molecular Biology (UBO-W) Impact factor: 1.227, year: 2014

Comparative glycopattern analysis of mucins in the Brunner's glands of the guinea-pig and the house mouse (Rodentia).

Science.gov (United States)

Scillitani, Giovanni; Mentino, Donatella

2015-09-01

The mucins secreted by the Brunner's glands and the duodenal goblet cells of the Guinea-pig and the house mouse were compared by conventional and FITC-conjugated lectin histochemistry. Methylation/saponification and sialidase digestion were performed prior to lectin binding to detect the residues subterminal to sulfated groups and sialic acid, respectively. In the Guinea-pig the Brunner's glands produce class-III stable sulfosialomucins. Sialic acid is mostly 2,6-linked to galactose or to N-acetylgalactosamine and is in part O-acetylated in C7, C8, and C9. Sulfated groups are probably linked to sialic acid and N-acetylgalactosamine. Terminal residuals of N-acetylglucosamine, galactose, N-acetylgalactosamine and fucose linked in α1,2, α1,3, and α1,4 are also present. Duodenal goblet cells of the Guinea-pig present a lower number of residuals in respect to the Brunner's glandular ones, with sialic acid and N-acetylgalactosamine subterminal to sulfated groups. In the house mouse the Brunner's glands produce class-III stable neutral mucins, binding to same lectins as in the Guinea-pig except for those specific to sialic acid. A diversity of fucosylated residuals higher than in the Guinea-pig is observed. The mouse duodenal goblet cells lack stable class-III mucins, have little sialic acid and present a lower number of residuals in respect to the correspondent Brunner's glands. Regulation of the acidic intestinal microenvironment, prevention of pathologies and hosting of microflora can explain the observed results and the differences observed between the two rodents. Copyright © 2015 Elsevier GmbH. All rights reserved.

Joint molecule resolution requires the redundant activities of MUS-81 and XPF-1 during Caenorhabditis elegans meiosis.

Directory of Open Access Journals (Sweden)

Nigel J O'Neil

Full Text Available The generation and resolution of joint molecule recombination intermediates is required to ensure bipolar chromosome segregation during meiosis. During wild type meiosis in Caenorhabditis elegans, SPO-11-generated double stranded breaks are resolved to generate a single crossover per bivalent and the remaining recombination intermediates are resolved as noncrossovers. We discovered that early recombination intermediates are limited by the C. elegans BLM ortholog, HIM-6, and in the absence of HIM-6 by the structure specific endonuclease MUS-81. In the absence of both MUS-81 and HIM-6, recombination intermediates persist, leading to chromosome breakage at diakinesis and inviable embryos. MUS-81 has an additional role in resolving late recombination intermediates in C. elegans. mus-81 mutants exhibited reduced crossover recombination frequencies suggesting that MUS-81 is required to generate a subset of meiotic crossovers. Similarly, the Mus81-related endonuclease XPF-1 is also required for a subset of meiotic crossovers. Although C. elegans gen-1 mutants have no detectable meiotic defect either alone or in combination with him-6, mus-81 or xpf-1 mutations, mus-81;xpf-1 double mutants are synthetic lethal. While mus-81;xpf-1 double mutants are proficient for the processing of early recombination intermediates, they exhibit defects in the post-pachytene chromosome reorganization and the asymmetric disassembly of the synaptonemal complex, presumably triggered by crossovers or crossover precursors. Consistent with a defect in resolving late recombination intermediates, mus-81; xpf-1 diakinetic bivalents are aberrant with fine DNA bridges visible between two distinct DAPI staining bodies. We were able to suppress the aberrant bivalent phenotype by microinjection of activated human GEN1 protein, which can cleave Holliday junctions, suggesting that the DNA bridges in mus-81; xpf-1 diakinetic oocytes are unresolved Holliday junctions. We propose that the

A Comparison Between House Mouse Lines Selected for Attack Latency or Nest-Building : Evidence for a Genetic Basis of Alternative Behavioral Strategies

NARCIS (Netherlands)

Sluyter, Frans; Bult, Abel; Lynch, Carol B.; Oortmerssen, Geert A. van; Koolhaas, Jaap M.

House mouse lines bidirectionally selected for either nest-building behavior or attack latency were tested for both attack latency and nest-building behavior under identical conditions. Male mice selected for high nest-building behavior had shorter attack latencies, i.e., were more aggressive, than

Glutamate Oxaloacetate Transaminase (Got) Genetics in the Mouse: Polymorphism of Got-1

Science.gov (United States)

Chapman, Verne M.; Ruddle, Frank H.

1972-01-01

We have examined a polymorphism for the soluble glutamate oxaloacetate (GOT-1) isozyme system which was found in the Asian mouse Mus castaneus. Variants of GOT-1 segregate as though they are controlled by codominant alleles for a single autosomal locus which we have designated Got-1. No close linkage of genes for soluble and mitochondrial forms of the enzyme, GOT-1 and GOT-2 respectively, was observed. Furthermore, no close linkage of Got-1 and the loci c, Gpi-1, Mod-2, Mod-1, Ld-1, Gpd-1, Pgm-1 or Gpo-1 was observed. Our results demonstrate the utility of sampling Mus from diverse populations to extend the repertoire of polymorphic loci and the genetic linkage map. PMID:17248564

POSSuMUS: a position sensitive scintillating muon SiPM detector

CERN Document Server

Ruschke, Alexander

The development of a modular designed large scale scintillation detector with a two-dimensional position sensitivity is presented in this thesis. This novel POsition Sensitive Scintillating MUon SiPM Detector is named POSSuMUS. The POSSuMUS detector is capable to determine the particle’s position in two space dimensions with a fast trigger capability. Each module is constructed from two trapezoidal shaped plastic scintillators to form one rectangular shaped detector module. Both trapezoids are optically insulated against each other. In both trapezoids the scintillation light is collected by plastic fibers and guided towards silicon photomultipliers (SiPMs). SiPMs are light sensors which are capable to detect even smallest amounts of light. By combining several detector modules, position sensitive areas from 100 cm2 to few m2 are achievable with few readout channels. Therefore, POSSuMUS provides a cost effective detector concept. The position sensitivity along the trapezoidal geometry of one detector module ...

76 FR 20706 - South Farallon Islands Nonnative Mouse Eradication Project; Farallon National Wildlife Refuge...

Science.gov (United States)

2011-04-13

... Noonday Rock. In 1969 the Refuge was expanded to include the South Farallon Islands and is still managed... eradicate nonnative mice from the South Farallon Islands, part of the Farallon National Wildlife Refuge off... eradicate nonnative house mice (Mus musculus) from the South Farallon Islands. The purpose of this project...

Effect of Pasak Bumi (Eurycoma longifolia Jack) Root In Precopulation Stage to the Fertility of Female Mouse (Mus musculus L.)

OpenAIRE

Marlinza, Rosa

2012-01-01

Pasak Bumi (Eurycoma longifolia Jack) have potency to be used to increase bodyendurance, to cure malaria drug, and to act as afrodisiak. However, the effect of pasak bumi onwomen fertility, especially at pre-copulation stage was not widely known. This research seeks toreveal the effect pasak bumi extract treated at pre-copulation phase on fertility. This experimentemploy mice (Mus Musculus L.) and was undertaken at Biology and Cemistry laboratories PMIPA, andVeterinary laboratory of Jambi Uni...

Polymorphism in hybrid male sterility in wild-derived Mus musculus musculus strains on proximal chromosome 17.

Science.gov (United States)

Vyskocilová, Martina; Prazanová, Gabriela; Piálek, Jaroslav

2009-02-01

The hybrid sterility-1 (Hst1) locus at Chr 17 causes male sterility in crosses between the house mouse subspecies Mus musculus domesticus (Mmd) and M. m. musculus (Mmm). This locus has been defined by its polymorphic variants in two laboratory strains (Mmd genome) when mated to PWD/Ph mice (Mmm genome): C57BL/10 (carrying the sterile allele) and C3H (fertile allele). The occurrence of sterile and/or fertile (wild Mmm x C57BL)F1 males is evidence that polymorphism for this trait also exists in natural populations of Mmm; however, the nature of this polymorphism remains unclear. Therefore, we derived two wild-origin Mmm strains, STUS and STUF, that produce sterile and fertile males, respectively, in crosses with C57BL mice. To determine the genetic basis underlying male fertility, the (STUS x STUF)F1 females were mated to C57BL/10 J males. About one-third of resulting hybrid males (33.8%) had a significantly smaller epididymis and testes than parental animals and lacked spermatozoa due to meiotic arrest. A further one-fifth of males (20.3%) also had anomalous reproductive traits but produced some spermatozoa. The remaining fertile males (45.9%) displayed no deviation from values found in parental individuals. QTL analysis of the progeny revealed strong associations of male fitness components with the proximal end of Chr 17, and a significant effect of the central section of Chr X on testes mass. The data suggest that genetic incompatibilities associated with male sterility have evolved independently at the proximal end of Chr 17 and are polymorphic within both Mmd and Mmm genomes.

Context dependence of acorn handling by the Algerian mouse (Mus spretus)

Science.gov (United States)

Gallego, D.; Morán-López, T.; Torre, I.; Navarro-Castilla, Á.; Barja, I.; Díaz, M.

2017-10-01

Perceived predation risk and competition for acorns are expected to affect scatter-hoarding decisions by Algerian mice (Mus spretus). We manipulated both factors by means of predator fecal scents and ungulate exclosures. We hypothesized that high-risk perception and ungulate presence would promote acorn dispersal. In the former case, it would stimulate acorn mobilization to safe microhabitats rather than in situ consumption. In the latter, increased competition for acorns would promote their storage for later consumption. We also expected that mice would adapt their foraging behavior to previous experience modulating the strength of these effects. In the presence of ungulates, mice focused their foraging activities on food acquisition at the expenses of vigilant behaviors. However, a more efficient foraging did not entail enhanced dispersal services. Lack of anti-predatory cover in tree surroundings may have deterred mice from transporting seeds outside canopies. Increased risk interacted with previous experience. In control trees (no predator odor), mice confidence increased throughout the night resulting in decreased vigilance and enhanced acorn mobilization rates. In contrast, in risky conditions (trees with predator odor) mice maintained a base-line vigilant behavior. Contrary to our expectations, increased risk did not result in higher acorn mobilization, but the opposite. Again, the scarcity of safe microhabitats for mobilization may have been the underlying cause of this behavior. Our results show that successful acorn dispersal depends, at least partly, on plant-animal relationships that are beyond the oak-rodent mutualism. Thus, any conservation policy aimed at restoring natural regeneration of oaks should take into account the interaction network in which oak-rodent encounters are embedded. In addition, they suggest that mice incorporate direct and indirect cues of risks (habitat structure) through recent experience. A better understanding of this process

Les sens du musée

Directory of Open Access Journals (Sweden)

Laurent Grison

1999-09-01

Full Text Available Cet article, fondé sur l'exemple de la National Gallery de Londres, porte sur l'intégration dans le cadre urbain, l'aménagement et les dynamiques spatiales du lieu muséal. Sur le même thème, nous relatons un exercice réalisé avec des lycéens.

Potential of MuS1 Transgenic Tobacco for Phytoremediation of the Urban Soils Contaminated with Cadmium

Science.gov (United States)

Kim, K. H.; Kim, Y. N.; Kim, S. H.

2010-05-01

Urban soils are prone to contamination by trace elements such as Cd, Cu, Pb and Zn. Phytoremediation is one of the attractive remediation methods for soils contaminated with trace elements due to its non-destructive and environmentally-friendly characteristic. Scientists have tried to find hyper-accumulator plants in nature or to develop transgenic plant through genetic engineering. This study was carried out to identify a potential of MuS1 transgenic tobacco for phytoremediation of the urban soils contaminated with Cd. MuS1 is known as a multiple stress related gene with several lines. The previous study using RT-PCR showed that the expression of MuS1 gene in tobacco plant induced tolerance to Cd stress. For this study, MuS1 transgenic tobacco and wild-type tobacco (control) were cultivated in a hydroponic system treated with Cd (0, 50, 100 and 200μM Cd) for 3 weeks. At harvest, both tobacco and nutrient solution were collected and were analyzed for Cd. Effect of Cd treatment on morphological change of the tobacco leaves was also observed by variable-pressure scanning electron microscopy (VP-SEM). The tolerance of MuS1 transgenic tobacco to Cd stress was better than that of wild-type tobacco at all Cd levels. Especially, wild-type tobacco showed chlorosis and withering with 200μM Cd treatment, whereas MuS1 transgenic tobacco gradually recovered from Cd damage. Wild-type tobacco accumulated more Cd (4.65mg per plant) than MuS1 transgenic tobacco (2.37mg per plant) with 200μM Cd treatment. Cd translocation rate from root to leaves was 81.8 % for wild-type tobacco compared to 37.1 % for MuS1 transgenic tobacco. Result of VP-SEM showed that the number of trichome in the leaves for wild-type tobacco increased in comparison with that for untreated samples after 3 weeks, while that for MuS1 transgenic tobacco was not changed by Cd treatment. Results showed that the mechanism of the recovery of the MuS1 tobacco plant was not by high level of Cd uptake and accumulation

X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

Energy Technology Data Exchange (ETDEWEB)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden Street, Cambridge, MA 02138 (United States); Guinan, Edward; Engle, Scott [Department of Astronomy and Astrophysics, Villanova University, 800 Lancaster Avenue, Villanova, PA 19085 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H., E-mail: nevans@cfa.harvard.edu [The CHARA Array of Georgia State University, Mount Wilson, CA 91023 (United States)

2014-04-20

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

X-Ray Detection of the Cluster Containing the Cepheid S Mus

Science.gov (United States)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan

2014-04-01

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J - K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

International Nuclear Information System (INIS)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.

2014-01-01

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator

X-y interactions underlie sperm head abnormality in hybrid male house mice.

Science.gov (United States)

Campbell, Polly; Nachman, Michael W

2014-04-01

The genetic basis of hybrid male sterility in house mice is complex, highly polygenic, and strongly X linked. Previous work suggested that there might be interactions between the Mus musculus musculus X and the M. m. domesticus Y with a large negative effect on sperm head morphology in hybrid males with an F1 autosomal background. To test this, we introgressed the M. m. domesticus Y onto a M. m. musculus background and measured the change in sperm morphology, testis weight, and sperm count across early backcross generations and in 11th generation backcross males in which the opportunity for X-autosome incompatibilities is effectively eliminated. We found that abnormality in sperm morphology persists in M. m. domesticus Y introgression males, and that this phenotype is rescued by M. m. domesticus introgressions on the X chromosome. In contrast, the severe reductions in testis weight and sperm count that characterize F1 males were eliminated after one generation of backcrossing. These results indicate that X-Y incompatibilities contribute specifically to sperm morphology. In contrast, X-autosome incompatibilities contribute to low testis weight, low sperm count, and sperm morphology. Restoration of normal testis weight and sperm count in first generation backcross males suggests that a small number of complex incompatibilities between loci on the M. m. musculus X and the M. m. domesticus autosomes underlie F1 male sterility. Together, these results provide insight into the genetic architecture of F1 male sterility and help to explain genome-wide patterns of introgression across the house mouse hybrid zone.

Dbf4-dependent kinase and the Rtt107 scaffold promote Mus81-Mms4 resolvase activation during mitosis.

Science.gov (United States)

Princz, Lissa N; Wild, Philipp; Bittmann, Julia; Aguado, F Javier; Blanco, Miguel G; Matos, Joao; Pfander, Boris

2017-03-01

DNA repair by homologous recombination is under stringent cell cycle control. This includes the last step of the reaction, disentanglement of DNA joint molecules (JMs). Previous work has established that JM resolving nucleases are activated specifically at the onset of mitosis. In case of budding yeast Mus81-Mms4, this cell cycle stage-specific activation is known to depend on phosphorylation by CDK and Cdc5 kinases. Here, we show that a third cell cycle kinase, Cdc7-Dbf4 (DDK), targets Mus81-Mms4 in conjunction with Cdc5-both kinases bind to as well as phosphorylate Mus81-Mms4 in an interdependent manner. Moreover, DDK-mediated phosphorylation of Mms4 is strictly required for Mus81 activation in mitosis, establishing DDK as a novel regulator of homologous recombination. The scaffold protein Rtt107, which binds the Mus81-Mms4 complex, interacts with Cdc7 and thereby targets DDK and Cdc5 to the complex enabling full Mus81 activation. Therefore, Mus81 activation in mitosis involves at least three cell cycle kinases, CDK, Cdc5 and DDK Furthermore, tethering of the kinases in a stable complex with Mus81 is critical for efficient JM resolution. © 2017 The Authors. Published under the terms of the CC BY NC ND 4.0 license.

Trends and tactics of mouse predation on Tristan Albatross Diomedea dabbenena chicks at Gough Island, South Atlantic Ocean

Directory of Open Access Journals (Sweden)

Delia Davies

2015-06-01

Full Text Available The critically endangered Tristan Albatross Diomedea dabbenena breeds almost exclusively on Gough Island, in the central South Atlantic, where breeding success is much lower than other great albatrosses (Diomedea spp. worldwide. Most breeding failures occur during the chick-rearing stage, when other great albatrosses suffer few failures. This unusual pattern of breeding failure is assumed to be largely due to predation by introduced house mice Mus musculus, but there have been few direct observations of mouse attacks. We closely monitored the fates of 20 chicks in the Gonydale study colony (123 chicks in 2014 using motion-activated cameras to determine the causes of chick mortality. Only 5 of 20 chicks survived to fledge, and of the 15 failures, 14 (93% were due to mouse predation. One mouse-wounded chick was killed by a Southern Giant Petrel Macronectes giganteus; the rest died outright from their wounds within 3.9 ± 1.2 days of the first attack. Despite this high impact, most chicks were attacked by only 1-2 mice at once (maximum 9. The remaining 103 chicks in the study colony were checked less frequently, but the timing of failures was broadly similar to the 20 closely monitored nests, and the presence of mouse wounds on other chicks strongly suggests that mice were responsible for most chick deaths. Breeding success in the Gonydale study colony averages 28% from 2001 to 2014; far lower than the normal range of breeding success of Diomedea species occurring on islands free from introduced predators. Island-wide breeding success fell below 10% for the first time in 2014, making it even more urgent to eradicate mice from Gough Island.

Mus musculus bone fluoride concentration as a useful biomarker for risk assessment of skeletal fluorosis in volcanic areas.

Science.gov (United States)

Linhares, Diana; Camarinho, Ricardo; Garcia, Patrícia Ventura; Rodrigues, Armindo Dos Santos

2018-08-01

Fluoride is often found in elevated concentrations in volcanic areas due to the release of magmatic fluorine as hydrogen fluorine through volcanic degassing. The exposure to high levels of fluoride can affect the processes of bone formation and resorption causing skeletal fluorosis, a pathology that can easily be mistaken for other skeletal diseases. In this study, we aimed to determine if fluoride concentration in the femoral bone of wild populations of the house mouse (Mus musculus) is a good biomarker of exposure to active volcanic environments naturally enriched in fluoride, allowing their use in biomonitoring programs. The fluoride concentration of the whole femoral bone of 9 mice from Furnas (5 males and 4 females) and 33 mice from Rabo de Peixe (16 males and 17 females) was measured by the potentiometric method with a fluoride ion selective electrode. Fluoride in bones was significantly higher in the mice from Furnas when compared with the mice from Rabo de Peixe (616.5 ± 129.3 μg F/g vs. 253.8 ± 10.5 μg F/g). Accumulation rates were also significantly higher in the mice collected in Furnas when compared with Rabo de Peixe individuals (3.84 ± 0.52 μg F/day vs. 1.22 ± 0.06 μg F/day). The results demonstrate a significant association between exposure to fluoride in the active volcanic environment and fluoride content in bone, revealing that bone fluoride concentration is a suitable biomarker of chronic environmental exposure to fluoride. Copyright © 2018 Elsevier Ltd. All rights reserved.

Synaptic vesicles isolated from the electric organ of Torpedo californica and from the central nervous system of Mus musculus contain small ribonucleic acids (sRNAs

Directory of Open Access Journals (Sweden)

Huinan Li

2017-06-01

Full Text Available Synaptic vesicles (SVs are presynaptic organelles that load and release small molecule neurotransmitters at chemical synapses. In addition to classic neurotransmitters, we have demonstrated that SVs isolated from the Peripheral Nervous Systems (PNS of the electric organ of Torpedo californica, a model cholinergic synapse, and SVs isolated from the Central Nervous System (CNS of Mus musculus (mouse contain small ribonucleic acids (sRNAs; ≤50 nucleotides (Scientific Reports, 5:1–14(14918 Li et al. (2015 [1]. Our previous publication provided the five most abundant sequences associated with the T. californica SVs, and the ten most abundant sequences associated with the mouse SVs, representing 59% and 39% of the total sRNA reads sequenced, respectively. We provide here a full repository of the SV sRNAs sequenced from T. californica and the mouse deposited in the NCBI as biosamples. Three data studies are included: SVs isolated from the electric organ of T. californica using standard techniques, SVs isolated from the electric organ of T. californica using standard techniques with an additional affinity purification step, and finally, SVs isolated from the CNS of mouse. The three biosamples are available at https://www.ncbi.nlm.nih.gov/biosample/ SRS1523467, SRS1523466, and SRS1523472 respectively.

Testing parasite "intimacy": the whipworm Trichuris muris in the European house mouse hybrid zone

Czech Academy of Sciences Publication Activity Database

Wasimuddin, Wasimuddin; Bryja, Josef; Ribas, A.; Baird, Stuart J. E.; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

2016-01-01

Roč. 6, č. 9 (2016), s. 2688-2701 ISSN 2045-7758 R&D Projects: GA ČR GA206/08/0640; GA MŠk EE2.3.35.0026; GA MŠk EE2.3.20.0303; GA ČR(CZ) GA16-20049S Institutional support: RVO:68081766 Keywords : Hybrid zones * Mus musculus * parasite life history traits * phylogeography * population structure Subject RIV: EG - Zoology OBOR OECD: Ecology Impact factor: 2.440, year: 2016

Climate-based models for pulsed resources improve predictability of consumer population dynamics: outbreaks of house mice in forest ecosystems.

Directory of Open Access Journals (Sweden)

E Penelope Holland

Full Text Available Accurate predictions of the timing and magnitude of consumer responses to episodic seeding events (masts are important for understanding ecosystem dynamics and for managing outbreaks of invasive species generated by masts. While models relating consumer populations to resource fluctuations have been developed successfully for a range of natural and modified ecosystems, a critical gap that needs addressing is better prediction of resource pulses. A recent model used change in summer temperature from one year to the next (ΔT for predicting masts for forest and grassland plants in New Zealand. We extend this climate-based method in the framework of a model for consumer-resource dynamics to predict invasive house mouse (Mus musculus outbreaks in forest ecosystems. Compared with previous mast models based on absolute temperature, the ΔT method for predicting masts resulted in an improved model for mouse population dynamics. There was also a threshold effect of ΔT on the likelihood of an outbreak occurring. The improved climate-based method for predicting resource pulses and consumer responses provides a straightforward rule of thumb for determining, with one year's advance warning, whether management intervention might be required in invaded ecosystems. The approach could be applied to consumer-resource systems worldwide where climatic variables are used to model the size and duration of resource pulses, and may have particular relevance for ecosystems where global change scenarios predict increased variability in climatic events.

Recombinational hotspot specific to female meiosis in the mouse major histocompatibility complex.

Science.gov (United States)

Shiroishi, T; Hanzawa, N; Sagai, T; Ishiura, M; Gojobori, T; Steinmetz, M; Moriwaki, K

1990-01-01

The wm7 haplotype of the major histocompatibility complex (MHC), derived from the Japanese wild mouse Mus musculus molossinus, enhances recombination specific to female meiosis in the K/A beta interval of the MHC. We have mapped crossover points of fifteen independent recombinants from genetic crosses of the wm7 and laboratory haplotypes. Most of them were confined to a short segment of approximately 1 kilobase (kb) of DNA between the A beta 3 and A beta 2 genes, indicating the presence of a female-specific recombinational hotspot. Its location overlaps with a sex-independent hotspot previously identified in the Mus musculus castaneus CAS3 haplotype. We have cloned and sequenced DNA fragments surrounding the hotspot from the wm7 haplotype and the corresponding regions from the hotspot-negative B10.A and C57BL/10 strains. There is no significant difference between the sequences of these three strains, or between these and the published sequences of the CAS3 and C57BL/6 strains. However, a comparison of this A beta 3/A beta 2 hotspot with a previously characterized hotspot in the E beta gene revealed that they have a very similar molecular organization. Each hotspot consists of two elements, the consensus sequence of the mouse middle repetitive MT family and the tetrameric repeated sequences, which are separated by 1 kb of DNA.

POSSuMUS. A position sensitive scintillating muon SiPM detector

International Nuclear Information System (INIS)

Ruschke, Alexander

2014-01-01

The development of a modular designed large scale scintillation detector with a two-dimensional position sensitivity is presented in this thesis. This novel POsition Sensitive Scintillating MUon SiPM Detector is named POSSuMUS. The POSSuMUS detector is capable to determine the particle's position in two space dimensions with a fast trigger capability. Each module is constructed from two trapezoidal shaped plastic scintillators to form one rectangular shaped detector module. Both trapezoids are optically insulated against each other. In both trapezoids the scintillation light is collected by plastic fibers and guided towards silicon photomultipliers (SiPMs). SiPMs are light sensors which are capable to detect even smallest amounts of light. By combining several detector modules, position sensitive areas from 100 cm 2 to few m 2 are achievable with few readout channels. Therefore, POSSuMUS provides a cost effective detector concept. The position sensitivity along the trapezoidal geometry of one detector module is achieved by the path length dependent amount of detected light for crossing particles. The ratio of the light yields in both trapezoids is calculated. This value corresponds to the position of the particle traversing the detector. A spatial resolution in the order of several mm is foreseen. The position sensitivity along the scintillator module is determined by the propagation time of light to the SiPMs located on opposite sides of the detector. A spatial resolution of few cm is expected for this direction. The POSSuMUS detector is applicable as large area trigger detector with a two dimensional position information of crossing particles. This is suitable in detector tests of large area precesion detectors or for measuring the small angle scattering of cosmic muons. At the beginning of this thesis, the determination of important SiPM characteristics like the breakdown voltage is presented. In the course of this work the detector principle is proven by

STRUKTUR HISTOLOGI HATI MENCIT(Mus musculus L. SETELAH PEMBERIAN EKSTRAK DAUN EKOR NAGA (Rhapidhophora pinnata Schott

Directory of Open Access Journals (Sweden)

Ni Komang Tia Pramesti

2017-09-01

Full Text Available ABSTRACT Rhapidhophora pinnata, Schott is a traditional medical plant that has been use remedy for treatment of hypertension, stroke. Aims of  this research is to determine the effect of Rhapidhophora pinnata Schott leaf extract toward  mouse (Mus musculus L liverhistological structure. This research used completely randomized  design with 28 female mice that were divide into 4 groups of  P0 (control received 0,9% NaCl, group P1, P2, and P3 received 50, 100 and 150 mg/kg bw respectively by oral administration. The treatment were given daily for 14 days. All of the mice were sacrificed by ether after 15 days. The liver were examined for their histopathological changes, namely fatty degeneration, hydropic degenaration and necrosis. Results were statistically analised by Kruskal-Wallis method. Treatment groups showed no significant differences with regard of liver histopatological changes, however hemorrhage, sinusoid congestion and inflamatory cell infiltration were found in liver.   Keyword : Rhapidhophora pinnata Schott, liver, mice

A complex genetic basis to X-linked hybrid male sterility between two species of house mice.

Science.gov (United States)

Good, Jeffrey M; Dean, Matthew D; Nachman, Michael W

2008-08-01

The X chromosome plays a central role in the evolution of reproductive isolation, but few studies have examined the genetic basis of X-linked incompatibilities during the early stages of speciation. We report the results of a large experiment focused on the reciprocal introgression of the X chromosome between two species of house mice, Mus musculus and M. domesticus. Introgression of the M. musculus X chromosome into a wild-derived M. domesticus genetic background produced male-limited sterility, qualitatively consistent with previous experiments using classic inbred strains to represent M. domesticus. The genetic basis of sterility involved a minimum of four X-linked factors. The phenotypic effects of major sterility QTL were largely additive and resulted in complete sterility when combined. No sterility factors were uncovered on the M. domesticus X chromosome. Overall, these results revealed a complex and asymmetric genetic basis to X-linked hybrid male sterility during the early stages of speciation in mice. Combined with data from previous studies, we identify one relatively narrow interval on the M. musculus X chromosome involved in hybrid male sterility. Only a handful of spermatogenic genes are within this region, including one of the most rapidly evolving genes on the mouse X chromosome.

Female nursing partner choice in a population of wild house mice (Mus musculus domesticus).

Science.gov (United States)

Harrison, Nicola; Lindholm, Anna K; Dobay, Akos; Halloran, Olivia; Manser, Andri; König, Barbara

2018-01-01

Communal nursing in house mice is an example of cooperation where females pool litters in the same nest and indiscriminately nurse own and other offspring despite potential exploitation. The direct fitness benefits associated with communal nursing shown in laboratory studies suggest it to be a selected component of female house mice reproductive behaviour. However, past studies on communal nursing in free-living populations have debated whether it is a consequence of sharing the same nest or an active choice. Here using data from a long-term study of free-living, wild house mice we investigated individual nursing decisions and determined what factors influenced a female's decision to nurse communally. Females chose to nurse solitarily more often than expected by chance, but the likelihood of nursing solitarily decreased when females had more partners available. While finding no influence of pairwise relatedness on partner choice, we observed that females shared their social environment with genetically similar individuals, suggesting a female's home area consisted of related females, possibly facilitating the evolution of cooperation. Within such a home area females were more likely to nest communally when the general relatedness of her available options was relatively high. Females formed communal nests with females that were familiar through previous associations and had young pups of usually less than 5 days old. Our findings suggest that communal nursing was not a by-product of sharing the same nesting sites, but females choose communal nursing partners from a group of genetically similar females, and ultimately the decision may then depend on the pool of options available. Social partner choice proved to be an integrated part of cooperation among females, and might allow females to reduce the conflict over number of offspring in a communal nest and milk investment towards own and other offspring. We suggest that social partner choice may be a general

Nova Mus 2018 (PNV J11261220-6531086) Is Forming Dust

Science.gov (United States)

Walter, Frederick M.

2018-02-01

Nova Mus 2018 (PNV J11261220-6531086) was discovered by R Kaufman on 2018 Jan 14.486, and reported by P. Schmeer in vsnet-alert 21772. The first detection was 2018 Jan 3.24 (ASAS-SN, reported in the TOCP).

Gastrointestinal microbiota of wild and inbred individuals of two house mouse subspecies assessed using high-throughput parallel pyrosequencing

Czech Academy of Sciences Publication Activity Database

Kreisinger, Jakub; Čížková, Dagmar; Vohánka, J.; Piálek, Jaroslav

2014-01-01

Roč. 23, č. 20 (2014), s. 5048-5060 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : domestication * hybrid zone * metagenomics * microbiome * Mus musculus * symbiosis Subject RIV: EG - Zoology Impact factor: 6.494, year: 2014

The Evolution of Polymorphic Hybrid Incompatibilities in House Mice.

Science.gov (United States)

Larson, Erica L; Vanderpool, Dan; Sarver, Brice A J; Callahan, Colin; Keeble, Sara; Provencio, Lorraine P; Kessler, Michael D; Stewart, Vanessa; Nordquist, Erin; Dean, Matthew D; Good, Jeffrey M

2018-04-24

Resolving the mechanistic and genetic bases of reproductive barriers between species is essential to understanding the evolutionary forces that shape speciation. Intrinsic hybrid incompatibilities are often treated as fixed between species, yet there can be considerable variation in the strength of reproductive isolation between populations. The extent and causes of this variation remain poorly understood in most systems. We investigated the genetic basis of variable hybrid male sterility (HMS) between two recently diverged subspecies of house mice, Mus musculus domesticus and M. m. musculus We found that polymorphic HMS has a surprisingly complex genetic basis, with contributions from at least five autosomal loci segregating between two closely related wild-derived strains of M. m. musculus One of the HMS-linked regions on Chromosome 4 also showed extensive introgression among inbred laboratory strains and transmission ratio distortion (TRD) in hybrid crosses. Using additional crosses and whole genome sequencing of sperm pools, we showed that TRD was limited to hybrid crosses and was not due to differences in sperm motility between M. m. musculus strains. Based on these results, we argue that TRD likely reflects additional incompatibilities that reduce hybrid embryonic viability. In some common inbred strains of mice, selection against deleterious interactions appears to have unexpectedly driven introgression at loci involved in epistatic hybrid incompatibilities. The highly variable genetic basis to F1 hybrid incompatibilities between closely related mouse lineages argues that a thorough dissection of reproductive isolation will require much more extensive sampling of natural variation than has been commonly utilized in mice and other model systems. Copyright © 2018, Genetics.

AcEST: DK962031 [AcEST

Lifescience Database Archive (English)

Full Text Available VSFLTGLGCPNCIECFTSQGLQ 392 >tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus musculus GN=Trp7...tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus ... 37 1.5 tr|B7Q4E7|B7Q4E7_IXOSC Putative u...rized protein OS=Mus m... 37 1.5 tr|Q9CU77|Q9CU77_MOUSE Putative uncharacterized protein (Fragmen... 37 1.5

Stop Stalling: Mus81 Required for Efficient Replication | Center for Cancer Research

Science.gov (United States)

DNA replication is precisely controlled to ensure that daughter cells receive intact, accurate genetic information. Each segment of DNA must be copied only once, and the rate of replication coordinated genome-wide. Mild replication stress slows DNA synthesis and activates a pathway involving the Mus81 endonuclease, which generates a series of DNA breaks that are rapidly repaired, allowing the cell to avoid activating the S-phase checkpoint and its potentially damaging outcomes of apoptosis or error-prone repair. Mirit Aladjem, Ph.D., of CCR’s Developmental Therapeutics Branch, and her colleagues wondered whether Mus81 also plays a role in regulating the replication rate during growth in the absence of stress.

Increased survivorship of testosterone-treated female house mice (Mus musculus) in high-density field conditions

Science.gov (United States)

W.J. Zielinski; J.G. Vandenbergh

1991-01-01

Differences in hormone levels influence sexual differences in aggression. survival, home-range size and dispcrsal in rodents. The role oftestosterone in establishing some of these differences in wild house mice was examined. Females treated with either 0·5 mg of testosterone enanthate (TE-treated) or oil (control), and an...

RECQ5 Helicase Cooperates with MUS81 Endonuclease in Processing Stalled Replication Forks at Common Fragile Sites during Mitosis

DEFF Research Database (Denmark)

Di Marco, Stefano; Hasanova, Zdenka; Kanagaraj, Radhakrishnan

2017-01-01

The MUS81-EME1 endonuclease cleaves late replication intermediates at common fragile sites (CFSs) during early mitosis to trigger DNA-repair synthesis that ensures faithful chromosome segregation. Here, we show that these DNA transactions are promoted by RECQ5 DNA helicase in a manner dependent...... on its Ser727 phosphorylation by CDK1. Upon replication stress, RECQ5 associates with CFSs in early mitosis through its physical interaction with MUS81 and promotes MUS81-dependent mitotic DNA synthesis. RECQ5 depletion or mutational inactivation of its ATP-binding site, RAD51-interacting domain...

Murine cytomegalovirus is not restricted to the house mouse Mus musculus domesticus: prevalence and genetic diversity in the European house mouse hybrid zone

Czech Academy of Sciences Publication Activity Database

Goüy de Bellocq, Joëlle; Baird, Stuart J. E.; Albrechtová, Jana; Sobeková, Karolina; Piálek, Jaroslav

2015-01-01

Roč. 89, č. 1 (2015), s. 406-414 ISSN 0022-538X R&D Projects: GA ČR GA206/08/0640; GA ČR(CZ) GA14-35009S Institutional support: RVO:68081766 Keywords : maximum likelihood * viral antibodies * wild mice * strains * recombination * mitochondrial * Australia * evolution * virus * model Subject RIV: EG - Zoology Impact factor: 4.606, year: 2015

Imaging of Chromosome Dynamics in Mouse Testis Tissue by Immuno-FISH.

Science.gov (United States)

Scherthan, Harry

2017-01-01

The mouse (Mus musculus) represents the central mammalian genetic model system for biomedical and developmental research. Mutant mouse models have provided important insights into chromosome dynamics during the complex meiotic differentiation program that compensates for the genome doubling at fertilization. Homologous chromosomes (homologues) undergo dynamic pairing and recombine during first meiotic prophase before they become partitioned into four haploid sets by two consecutive meiotic divisions that lack an intervening S-phase. Fluorescence in situ hybridization (FISH) has been instrumental in the visualization and imaging of the dynamic reshaping of chromosome territories and mobility during prophase I, in which meiotic telomeres were found to act as pacemakers for the chromosome pairing dance. FISH combined with immunofluorescence (IF) co-staining of nuclear proteins has been instrumental for the visualization and imaging of mammalian meiotic chromosome behavior. This chapter describes FISH and IF methods for the analysis of chromosome dynamics in nuclei of paraffin-embedded mouse testes. The techniques have proven useful for fresh and archived paraffin testis material of several mammalian species.

Identification of an active ID-like group of SINEs in the mouse.

Science.gov (United States)

Kass, David H; Jamison, Nicole

2007-09-01

The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.

Genome-wide mapping in a house mouse hybrid zone reveals hybrid sterility loci and Dobzhansky-Muller interactions.

Science.gov (United States)

Turner, Leslie M; Harr, Bettina

2014-12-09

Mapping hybrid defects in contact zones between incipient species can identify genomic regions contributing to reproductive isolation and reveal genetic mechanisms of speciation. The house mouse features a rare combination of sophisticated genetic tools and natural hybrid zones between subspecies. Male hybrids often show reduced fertility, a common reproductive barrier between incipient species. Laboratory crosses have identified sterility loci, but each encompasses hundreds of genes. We map genetic determinants of testis weight and testis gene expression using offspring of mice captured in a hybrid zone between M. musculus musculus and M. m. domesticus. Many generations of admixture enables high-resolution mapping of loci contributing to these sterility-related phenotypes. We identify complex interactions among sterility loci, suggesting multiple, non-independent genetic incompatibilities contribute to barriers to gene flow in the hybrid zone.

The Mouse House: a brief history of the ORNL mouse-genetics program, 1947-2009.

Science.gov (United States)

Russell, Liane B

2013-01-01

The large mouse genetics program at the Oak Ridge National Laboratory (ORNL) is often remembered chiefly for the germ-cell mutation-rate data it generated and their uses in estimating the risk of heritable radiation damage. In fact, it soon became a multi-faceted research effort that, over a period of almost 60 years, generated a wealth of information in the areas of mammalian mutagenesis, basic genetics (later enriched by molecular techniques), cytogenetics, reproductive biology, biochemistry of germ cells, and teratology. Research in the area of germ-cell mutagenesis explored the important physical and biological factors that affect the frequency and nature of induced mutations and made several unexpected discoveries, such as the major importance of the perigametic interval (the zygote stage) for the origin of spontaneous mutations and for the sensitivity to induced genetic change. Of practical value was the discovery that ethylnitrosourea was a supermutagen for point mutations, making high-efficiency mutagenesis in the mouse feasible worldwide. Teratogenesis findings resulted in recommendations still generally accepted in radiological practice. Studies supporting the mutagenesis research added whole bodies of information about mammalian germ-cell development and about molecular targets in germ cells. The early decision to not merely count but propagate genetic variants of all sorts made possible further discoveries, such as the Y-chromosome's importance in mammalian sex determination and the identification of rare X-autosome translocations, which, in turn, led to the formulation of the single-active-X hypothesis and provided tools for studies of functional mosaicism for autosomal genes, male sterility, and chromosome-pairing mechanism. Extensive genetic and then molecular analyses of large numbers of induced specific-locus mutants resulted in fine-structure physical and correlated functional mapping of significant portions of the mouse genome and constituted a

X-ray and UV observations of Nova Mus 2018 with Swift

Science.gov (United States)

Nelson, Thomas; Mukai, Koji; Chomiuk, Laura; Li, Kwan-Kok; Kawash, Adam; Sokoloski, J. L.; Rupen, Michael; Linford, Justin; Mioduszewski, Amy

2018-01-01

We observed Nova Mus 2018 (PNV J11261220-6531086) with the Neil Gehrels Swift Observatory on 2018 January 21, 18 days after the initial rapid rise to V=8.8 on 2018 January 3.24 (see link below for more details).

Sperm morphology in two house mouse subspecies: Do wild-derived strains and wild mice tell the same story?

Czech Academy of Sciences Publication Activity Database

Albrechtová, Jana; Albrecht, Tomáš; Ďureje, Ľudovít; Pallazola, V. A.; Piálek, Jaroslav

2014-01-01

Roč. 9, č. 12 (2014), e115669 E-ISSN 1932-6203 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : Mus musculus musculus * hybrid zone * multiple paternity * Passerine birds * Swimming velocity * Central Europe * Competition * Speciation * Common * Size Subject RIV: EG - Zoology Impact factor: 3.234, year: 2014

Toxicological Evaluation of Essential Oil From the Leaves of Croton argyrophyllus (Euphorbiaceae) on Aedes aegypti (Diptera: Culicidae) and Mus musculus (Rodentia: Muridae).

Science.gov (United States)

Cruz, R C D; Silva, S L C E; Souza, I A; Gualberto, S A; Carvalho, K S; Santos, F R; Carvalho, M G

2017-07-01

Plant-derived essential oils can be used as insecticides for vector control. However, to establish their safety, it is necessary to perform toxicological studies. Herein, we evaluated the chemical composition and insecticidal activity of the essential oil from the leaves of Croton argyrophyllus on the third- and fourth-instar larvae and adult Aedes aegypti (L., 1762). We also evaluated the acute toxicity of the essential oil in adult female Mus musculus. The lethal concentration 50 (LC50) and 90 (LC90) of C. argyrophyllus essential oil on larvae of Ae. aegypti were 0.31 and 0.70 mg ml-1, respectively, and 5.92 and 8.94 mg ml-1, respectively, on Ae. aegypti adults. The major components of the essential oil were spathulenol (22.80%), (E)-caryophyllene (15.41%), α-pinene (14.07%), and bicyclogermacrene (10.43%). It also displayed acute toxicity in adults of Mus musculus; the intraperitoneal and oral lethal dose 50 (LD50) were 2,000 mg kg-1 and 2,500 mg kg-1, respectively. The results showed that the essential oil from C. argyrophyllus leaves has insecticidal activity on Ae. aegypti larvae and adults at an average lethal concentration below the median lethal dose needed to cause acute toxicity in the common mouse. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Characterization of a male reproductive transcriptome for Peromyscus eremicus (Cactus mouse

Directory of Open Access Journals (Sweden)

Lauren L. Kordonowy

2016-10-01

Full Text Available Rodents of the genus Peromyscus have become increasingly utilized models for investigations into adaptive biology. This genus is particularly powerful for research linking genetics with adaptive physiology or behaviors, and recent research has capitalized on the unique opportunities afforded by the ecological diversity of these rodents. Well characterized genomic and transcriptomic data is intrinsic to explorations of the genetic architecture responsible for ecological adaptations. Therefore, this study characterizes the transcriptome of three male reproductive tissues (testes, epididymis and vas deferens of Peromyscus eremicus (Cactus mouse, a desert specialist. The transcriptome assembly process was optimized in order to produce a high quality and substantially complete annotated transcriptome. This composite transcriptome was generated to characterize the expressed transcripts in the male reproductive tract of P. eremicus, which will serve as a crucial resource for future research investigating our hypothesis that the male Cactus mouse possesses an adaptive reproductive phenotype to mitigate water-loss from ejaculate. This study reports genes under positive selection in the male Cactus mouse reproductive transcriptome relative to transcriptomes from Peromyscus maniculatus (deer mouse and Mus musculus. Thus, this study expands upon existing genetic research in this species, and we provide a high quality transcriptome to enable further explorations of our proposed hypothesis for male Cactus mouse reproductive adaptations to minimize seminal fluid loss.

Meiosis and speciation: a study in a speciating Mus terricolor complex

Indian Academy of Sciences (India)

Unknown

2000-12-27

Dec 27, 2000 ... (see reviews by White 1978; King 1981) or would lead to reduced viability of ... Indian pygmy field mice Mus terricolor, vis-à-vis the fixa- tion of autosomal ... plexes (SCs) were prepared and stained with silver nitrate. (Fletcher ...

The MusIC method: a fast and quasi-optimal solution to the muscle forces estimation problem

OpenAIRE

Muller , Antoine; Pontonnier , Charles; Dumont , Georges

2018-01-01

International audience; The present paper aims at presenting a fast and quasi-optimal method of muscle forces estimation: the MusIC method. It consists in interpolating a first estimation in a database generated offline thanks to a classical optimization problem, and then correcting it to respect the motion dynamics. Three different cost functions – two polynomial criteria and a min/max criterion – were tested on a planar musculoskeletal model. The MusIC method provides a computation frequenc...

Contrasting patterns of polymorphism and selection in bacterial-sensing toll-like receptor 4 in two house mouse subspecies

Czech Academy of Sciences Publication Activity Database

Fornůsková, Alena; Bryja, Josef; Vinkler, M.; Macholán, Miloš; Piálek, Jaroslav

2014-01-01

Roč. 4, č. 14 (2014), s. 2931-2944 ISSN 2045-7758 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : adaptive evolution * arms race * directional selection * host–pathogen interaction * MAMPs * Mus musculus * parasite-mediated selection * pattern-recognition receptors Subject RIV: EG - Zoology Impact factor: 2.320, year: 2014

Colonization, mouse-style

Directory of Open Access Journals (Sweden)

Searle Jeremy B

2010-10-01

Full Text Available Abstract Several recent papers, including one in BMC Evolutionary Biology, examine the colonization history of house mice. As well as background for the analysis of mouse adaptation, such studies offer a perspective on the history of movements of the humans that accidentally transported the mice. See research article: http://www.biomedcentral.com/1471-2148/10/325

A disparity between locomotor economy and territory-holding ability in male house mice.

Science.gov (United States)

Morris, Jeremy S; Ruff, James S; Potts, Wayne K; Carrier, David R

2017-07-15

Both economical locomotion and physical fighting are important performance traits to many species because of their direct influence on components of Darwinian fitness. Locomotion represents a substantial portion of the total daily energy budget of many animals. Fighting performance often determines individual reproductive fitness through the means of resource control, social dominance and access to mates. However, phenotypic traits that improve either locomotor economy or fighting ability may diminish performance in the other. Here, we tested for a predicted disparity between locomotor economy and competitive ability in wild-derived house mice ( Mus musculus ). We used 8 week social competition trials in semi-natural enclosures to directly measure male competitive ability through territorial control and female occupancy within territories. We also measured oxygen consumption during locomotion for each mouse using running trials in an enclosed treadmill and open-flow respirometry. Our results show that territory-holding males have higher absolute and mass-specific oxygen consumption when running (i.e. reduced locomotor economy) compared with males that do not control territories. This relationship was present both before and after 8 week competition trials in semi-natural enclosures. This disparity between physical competitive ability and economical locomotion may impose viability costs on males in species for which competition over mates is common and may constrain the evolution of behavioral and phenotypic diversity, particularly in natural settings with environmental and resource variability. © 2017. Published by The Company of Biologists Ltd.

Musée ideale : unistused täiuslikust muuseumist / Mariann Raisma

Index Scriptorium Estoniae

Raisma, Mariann, 1974-

2008-01-01

18.-19. sajandi unistusi täiuslikust muuseumist kolmel tasandil: vormi ehk arhitektuuri, muuseumikogu terviklikkuse ning pärandi kättesaadavuse kaudu. Pikemalt Napoleon Bonaparte'ile pühendatud Musée Napoleoni kogudest, kontseptsioonist ja koopiamuuseumidest Lääne-Euroopas ning Tartus

Dynamics of a Tularemia Outbreak in a Closely Monitored Free-Roaming Population of Wild House Mice.

Science.gov (United States)

Dobay, Akos; Pilo, Paola; Lindholm, Anna K; Origgi, Francesco; Bagheri, Homayoun C; König, Barbara

2015-01-01

Infectious disease outbreaks can be devastating because of their sudden occurrence, as well as the complexity of monitoring and controlling them. Outbreaks in wildlife are even more challenging to observe and describe, especially when small animals or secretive species are involved. Modeling such infectious disease events is relevant to investigating their dynamics and is critical for decision makers to accomplish outbreak management. Tularemia, caused by the bacterium Francisella tularensis, is a potentially lethal zoonosis. Of the few animal outbreaks that have been reported in the literature, only those affecting zoo animals have been closely monitored. Here, we report the first estimation of the basic reproduction number R0 of an outbreak in wildlife caused by F. tularensis using quantitative modeling based on a susceptible-infected-recovered framework. We applied that model to data collected during an extensive investigation of an outbreak of tularemia caused by F. tularensis subsp. holarctica (also designated as type B) in a closely monitored, free-roaming house mouse (Mus musculus domesticus) population in Switzerland. Based on our model and assumptions, the best estimated basic reproduction number R0 of the current outbreak is 1.33. Our results suggest that tularemia can cause severe outbreaks in small rodents. We also concluded that the outbreak self-exhausted in approximately three months without administrating antibiotics.

Dynamics of a Tularemia Outbreak in a Closely Monitored Free-Roaming Population of Wild House Mice.

Directory of Open Access Journals (Sweden)

Akos Dobay

Full Text Available Infectious disease outbreaks can be devastating because of their sudden occurrence, as well as the complexity of monitoring and controlling them. Outbreaks in wildlife are even more challenging to observe and describe, especially when small animals or secretive species are involved. Modeling such infectious disease events is relevant to investigating their dynamics and is critical for decision makers to accomplish outbreak management. Tularemia, caused by the bacterium Francisella tularensis, is a potentially lethal zoonosis. Of the few animal outbreaks that have been reported in the literature, only those affecting zoo animals have been closely monitored. Here, we report the first estimation of the basic reproduction number R0 of an outbreak in wildlife caused by F. tularensis using quantitative modeling based on a susceptible-infected-recovered framework. We applied that model to data collected during an extensive investigation of an outbreak of tularemia caused by F. tularensis subsp. holarctica (also designated as type B in a closely monitored, free-roaming house mouse (Mus musculus domesticus population in Switzerland. Based on our model and assumptions, the best estimated basic reproduction number R0 of the current outbreak is 1.33. Our results suggest that tularemia can cause severe outbreaks in small rodents. We also concluded that the outbreak self-exhausted in approximately three months without administrating antibiotics.

Time-dependent distinct roles of Toll-like receptor 4 in a house dust mite-induced asthma mouse model.

Science.gov (United States)

Ishii, T; Niikura, Y; Kurata, K; Muroi, M; Tanamoto, K; Nagase, T; Sakaguchi, M; Yamashita, N

2018-03-01

House dust mites (HDMs) are a common source of allergens that trigger both allergen-specific and innate immune responses in humans. Here, we examined the effect of allergen concentration and the involvement of Toll-like receptor 4 (TLR4) in the process of sensitization to house dust mite allergens in an HDM extract-induced asthma mouse model.　Intranasal administration of HDM extract induced an immunoglobulin E response and eosinophilic inflammation in a dose-dependent manner from 2.5 to 30 μg/dose. In TLR4-knockout mice, the infiltration of eosinophils and neutrophils into the lung was decreased compared with that in wild-type mice in the early phase of inflammation (total of three doses). However, in the late phase of inflammation (total of seven doses), eosinophil infiltration was significantly greater in TLR4-knockout mice than in wild-type mice. This suggests that the roles of TLR4 signaling are different between the early phase and the later phase of HDM allergen-induced inflammation. Thus, innate immune response through TLR4 regulated the response to HDM allergens, and the regulation was altered during the phase of inflammation. © 2018 The Foundation for the Scandinavian Journal of Immunology.

Serine/threonine-protein phosphatase 1 α levels are paralleling olfactory memory formation in the CD1 mouse.

Science.gov (United States)

Winding, Christiana; Sun, Yanwei; Höger, Harald; Bubna-Littitz, Hermann; Pollak, Arnold; Schmidt, Peter; Lubec, Gert

2011-06-01

Although olfactory discrimination has already been studied in several mouse strains, data on protein levels linked to olfactory memory are limited. Wild mouse strains Mus musculus musculus, Mus musculus domesticus and CD1 laboratory outbred mice were tested in a conditioned odor preference task and trained to discriminate between two odors, Rose and Lemon, by pairing one odor with a sugar reward. Six hours following the final test, mice were sacrificed and olfactory bulbs (OB) were taken for gel-based proteomics analyses and immunoblotting. OB proteins were extracted, separated by 2-DE and quantified using specific software (Proteomweaver). Odor-trained mice showed a preference for the previously rewarded odor suggesting that conditioned odor preference occurred. In CD1 mice levels, one out of 482 protein spots was significantly increased in odor-trained mice as compared with the control group; it was in-gel digested by trypsin and chymotrypsin and analyzed by tandem mass spectrometry (nano-ESI-LC-MS/MS). The spot was unambiguously identified as serine/threonine-protein phosphatase PP1-α catalytic subunit (PP-1A) and differential levels observed in gel-based proteomic studies were verified by immunoblotting. PP-1A is a key signalling element in synaptic plasticity and memory processes and is herein shown to be paralleling olfactory discrimination representing olfactory memory. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Infrared and optical observations of Nova Mus 1983

International Nuclear Information System (INIS)

Whitelock, P.A.; Carter, B.S.; Feast, M.W.; Glass, I.S.; Laney, D.; Menzies, J.W.

1984-01-01

Extensive optical (UBVRI) and infrared (JHKL) photometry of Nova Mus 1983 obtained over a period of 300 days is tabulated. Infrared and optical spectra are described. Although by classical definition this was a fast nova its later development was slower than for typical objects of this class. Surprisingly the development of infrared thermal dust emission did not occur. Throughout the period covered, the infrared emission was characteristic of a bound-free plus free-free plasma continuum with emission lines. (author)

Morphofunctional evaluation of the testis, duration of spermatogenesis and spermatogenic efficiency in the Japanese fancy mouse (Mus musculus molossinus).

Science.gov (United States)

Costa, Guilherme M J; Leal, Marcelo C; França, Luiz R

2017-08-01

Japanese fancy mouse, mini mouse or pet mouse are common names used to refer to strains of mice that present with different colour varieties and coat types. Although many genetic studies that involve spotting phenotype based on the coat have been performed in these mice, there are no reports of quantitative data in the literature regarding testis structure and spermatogenic efficiency. Hence, in this study we researched testis function and spermatogenesis in the adult Japanese fancy mouse. The following values of 68 ± 6 mg and 0.94 ± 0.1% were obtained as mean testis weight and gonadosomatic index, respectively. In comparison with other investigated mice strains, the fancy mouse Leydig cell individual size was much smaller, resulting in higher numbers of these cells per gram of testis. As found for laboratory mice strains, as a result of the development of the acrosomic system, 12 stages of the seminiferous epithelium cycle have been described in this study. The combined frequencies of pre-meiotic and post-meiotic stages were respectively 24% and 64% and very similar to the laboratory mice. The more differentiated germ cell types marked at 1 h or 9 days after tritiated thymidine administration were preleptotene/leptotene and pachytene spermatocytes at the same stage (VIII). The mean duration of one spermatogenic cycle was 8.8 ± 0.01 days and the total length of spermatogenesis lasted 37.8 ± 0.01 days (4.5 cycles). A high number of germ cell apoptosis was evident during meiosis, resulting in lower Sertoli cell and spermatogenic efficiencies, when compared with laboratory mice strains.

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_031715.1| chondroadherin [Mus musculus] sp|O55226|CHAD_MOUSE Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAC39963.1| chondroadherin [Mus musculus] gb|AAH12672.1| Chondroad...herin [Mus musculus] emb|CAI25589.1| chondroadherin [Mus musculus] dbj|BAE34451.1| unn...amed protein product [Mus musculus] gb|EDL15934.1| chondroadherin [Mus musculus] NP_031715.1 5e-85 57% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-1133 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1133 ref|NP_068677.2| hairless protein [Mus musculus] sp|Q61645|HAIR_MOUSE Protein hair...less gb|AAH49182.1| Hairless [Mus musculus] gb|EDL35888.1| hairless, isoform CRA_a [Mus musculus] gb|EDL35889.1| hai...rless, isoform CRA_a [Mus musculus] gb|EDL35890.1| hairless, isoform CRA_a [Mus musculus] NP_068677.2 5.1 44% ...

The Mouse House: A brief history of the ORNL mouse-genetics program, 1947–2009

Energy Technology Data Exchange (ETDEWEB)

Russell, Liane B.

2013-10-01

The large mouse genetics program at the Oak Ridge National Lab is often re-membered chiefly for the germ-cell mutation-rate data it generated and their uses in estimating the risk of heritable radiation damage. In fact, it soon became a multi-faceted research effort that, over a period of almost 60 years, generated a wealth of information in the areas of mammalian mutagenesis, basic genetics (later enriched by molecular techniques), cytogenetics, reproductive biology, biochemistry of germ cells, and teratology. Research in the area of germ-cell mutagenesis explored the important physical and biological factors that affect the frequency and nature of induced mutations and made several unexpected discoveries, such as the major importance of the perigametic interval (the zygote stage) for the origin of spontaneous mutations and for the sensitivity to induced genetic change. Of practical value was the discovery that ethylnitrosourea was a supermutagen for point mutations, making high-efficiency mutagenesis in the mouse feasible worldwide. Teratogenesis findings resulted in recommendations still generally accepted in radiological practice. Studies supporting the mutagenesis research added whole bodies of information about mammalian germ-cell development and about molecular targets in germ cells. The early decision to not merely count but propagate genetic variants of all sorts made possible further discoveries, such as the Y-Chromosome s importance in mammalian sex determination and the identification of rare X-autosome translocations, which, in turn, led to the formulation of the single-active-X hypothesis and provided tools for studies of functional mosaicism for autosomal genes, male sterility, and chromosome-pairing mechanism. Extensive genetic and then molecular analyses of large numbers of induced specific-locus mutants resulted in fine-structure physical and correlated functional mapping of significant portions of the mouse genome and constituted a valuable

Dicty_cDB: Contig-U03991-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 32 5.2 2 ( AZ306413 ) 1M0007B05R Mouse 10kb plasmid UUGC1M library Mus ... 38 5.2 2 ( BJ824535 ) Misgurnus anguillicaudatu...us visual cortex cDNA, RIKEN full-lengt... 32 6.7 2 ( AZ500970 ) 1M0339B10R Mouse 10kb plasmid UUGC1M library...7 2 ( AZ845402 ) 2M0145M09F Mouse 10kb plasmid UUGC1M library Mus ... 32 1.7 2 ( AZ990102 ) 2M0273L11R Mouse 10kb plasmid UUGC2M libr...07.... 44 2.5 1 ( AP009510 ) Uncultured Termite group 1 bacterium phylotype Rs...... cl... 32 6.5 2 ( AZ364702 ) 1M0110P21R Mouse 10kb plasmid UUGC1M library Mus ... 32 6.5 2 ( BH053767 ) R

The MusIC method: a fast and quasi-optimal solution to the muscle forces estimation problem.

Science.gov (United States)

Muller, A; Pontonnier, C; Dumont, G

2018-02-01

The present paper aims at presenting a fast and quasi-optimal method of muscle forces estimation: the MusIC method. It consists in interpolating a first estimation in a database generated offline thanks to a classical optimization problem, and then correcting it to respect the motion dynamics. Three different cost functions - two polynomial criteria and a min/max criterion - were tested on a planar musculoskeletal model. The MusIC method provides a computation frequency approximately 10 times higher compared to a classical optimization problem with a relative mean error of 4% on cost function evaluation.

Effects of environmental enrichment on the amyotrophic lateral sclerosis mouse model.

Science.gov (United States)

Sorrells, A D; Corcoran-Gomez, K; Eckert, K A; Fahey, A G; Hoots, B L; Charleston, L B; Charleston, J S; Roberts, C R; Markowitz, H

2009-04-01

The manner in which an animal's environment is furnished may have significant implications for animal welfare as well as research outcomes. We evaluated four different housing conditions to determine the effects of what has been considered standard rodent enrichment and the exercise opportunities those environments allow on disease progression in the amyotrophic lateral sclerosis mouse model. Forty-eight copper/zinc superoxide dismutase mice (strain: B6SJL-TgN [SOD1-G931]1Gur) (SOD1) and 48 control (C) (strain: B6SJL-TgN[SOD1]2Gur) male mice were randomly assigned to four different conditions where 12 SOD1 and 12 C animals were allotted to each condition (n = 96). Conditions tested the effects of standard housing, a forced exercise regime, access to a mouse house and opportunity for ad libitum exercise on a running wheel. In addition to the daily all-occurrence behavioural sampling, mice were weighed and tested twice per week on gait and Rotor-Rod performance until the mice reached the age of 150 days (C) or met the criteria for our humane endpoint (SOD1). The SOD1 mice exposed to the forced exercise regime and wheel access did better in average lifespan and Rotor-Rod performance, than SOD1 mice exposed to the standard cage and mouse house conditions. In SOD1 mice, stride length remained longest throughout the progression of the disease in mice exposed to the forced exercise regime compared with other SOD1 conditions. Within the control group, mice in the standard cage and forced exercise regime conditions performed significantly less than the mice with the mouse house and wheels on the Rotor-Rod. Alpha motor neuron counts were highest in mice with wheels and in mice exposed to forced exercise regime in both mouse strains. All SOD1 mice had significantly lower alpha neuron counts than controls (P model, and may have implications for the effects of these strategies on experimental outcomes.

Fellow travellers: a concordance of colonization patterns between mice and men in the North Atlantic region

Directory of Open Access Journals (Sweden)

Jones EP

2012-03-01

Full Text Available Abstract Background House mice (Mus musculus are commensals of humans and therefore their phylogeography can reflect human colonization and settlement patterns. Previous studies have linked the distribution of house mouse mitochondrial (mt DNA clades to areas formerly occupied by the Norwegian Vikings in Norway and the British Isles. Norwegian Viking activity also extended further westwards in the North Atlantic with the settlement of Iceland, short-lived colonies in Greenland and a fleeting colony in Newfoundland in 1000 AD. Here we investigate whether house mouse mtDNA sequences reflect human history in these other regions as well. Results House mice samples from Iceland, whether from archaeological Viking Age material or from modern-day specimens, had an identical mtDNA haplotype to the clade previously linked with Norwegian Vikings. From mtDNA and microsatellite data, the modern-day Icelandic mice also share the low genetic diversity shown by their human hosts on Iceland. Viking Age mice from Greenland had an mtDNA haplotype deriving from the Icelandic haplotype, but the modern-day Greenlandic mice belong to an entirely different mtDNA clade. We found no genetic association between modern Newfoundland mice and the Icelandic/ancient Greenlandic mice (no ancient Newfoundland mice were available. The modern day Icelandic and Newfoundland mice belong to the subspecies M. m. domesticus, the Greenlandic mice to M. m. musculus. Conclusions In the North Atlantic region, human settlement history over a thousand years is reflected remarkably by the mtDNA phylogeny of house mice. In Iceland, the mtDNA data show the arrival and continuity of the house mouse population to the present day, while in Greenland the data suggest the arrival, subsequent extinction and recolonization of house mice - in both places mirroring the history of the European human host populations. If house mice arrived in Newfoundland with the Viking settlers at all, then, like the

Effects of social stress and intrauterine position on sexual phenotype in wild-type house mice (Mus musculus)

Science.gov (United States)

William J. Zielinski; John G. Vandenbergh; Monica M. Montano

1991-01-01

Wild-type house mice were used to test the effect of intrauterine position on anogenital distance (AGD) and to verify whether crowding stress would masculinize female pups, developing at all intrauterine positions, as has been demonstrated in CF-1 mice stressed by restraint, heat, and...

STRAIN-SPECIFIC BEHAVIORAL-RESPONSE TO ENVIRONMENTAL ENRICHMENT IN THE MOUSE

NARCIS (Netherlands)

VANDEWEERD, HA; BAUMANS, [No Value; KOOLHAAS, JM; VANZUTPHEN, LFM

The influence of environmental enrichment on the behaviour of the mouse has been studied in two inbred strains (C57BL and BALB/c). Male mice of each of the two strains were subjected to behavioural tests after being housed for two months either under standard housing conditions or in an enriched

Detection of Mouse Mammary Tumour Virus in house mice

DEFF Research Database (Denmark)

Steffensen, Lise K; Leirs, Herwig; Heiberg, Ann-Charlotte

The prevalence of human breast cancer (HBC) is affected by several parameters. For the past decades MMTV, Mouse Mammary Tumor Virus, known to cause breast cancer in mice, has been hypothesized to affect the frequency of hormone dependent HBC. Though conclusive evidence has not been produced, still...

Genetically engineered Lactococcus lactis protect against house dust mite allergy in a BALB/c mouse model.

Directory of Open Access Journals (Sweden)

Chunqing Ai

Full Text Available Mucosal vaccine based on lactic acid bacteria is an attractive concept for the prevention and treatment of allergic diseases, but their mechanisms of action in vivo are poorly understood. Therefore, we sought to investigate how recombinant major dust mite allergen Der p2-expressing Lactococcus lactis as a mucosal vaccine induced the immune tolerance against house dust mite allergy in a mouse model.Three strains of recombinant L. lactis producing Der p2 in different cell components (extracellular, intracellular and cell wall were firstly constructed. Their prophylactic potential was evaluated in a Der p2-sensitised mouse model, and immunomodulation properties at the cellular level were determined by measuring cytokine production in vitro.Der p2 expressed in the different recombinant L. lactis strains was recognized by a polyclonal anti-Der p2 antibody. Oral treatment with the recombinant L. lactis prior sensitization significantly prevented the development of airway inflammation in the Der p2-sensitized mice, as determined by the attenuation of inflammatory cells infiltration in the lung tissues and decrease of Th2 cytokines IL-4 and IL-5 levels in bronchoalveolar lavage. In addition, the serum allergen-specific IgE levels were significantly reduced, and the levels of IL-4 in the spleen and mesenteric lymph nodes cell cultures were also markedly decreased upon allergen stimulation in the mice fed with the recombinant L. lactis strains. These protective effects correlated with a significant up-regulation of regulatory T cells in the mesenteric lymph nodes.Oral pretreatment with live recombinant L. lactis prevented the development of allergen-induced airway inflammation primarily by the induction of specific mucosal immune tolerance.

PEMANFAATAN Spirulina platensis SEBAGAI SUPLEMEN PROTEIN SEL TUNGGAL (PST MENCIT (Mus musculus

Directory of Open Access Journals (Sweden)

Haryo Kuntoro Adi

2007-06-01

Full Text Available The using of Spirulina platensis as Supplement of Single-Celled Protein (SCP to Mice. High protein in Spirulina platensis can be used as a source of Single-Celled Protein. By using mice (Mus musculus as a animal laboratory, the objective of this research is to know the influence of Biomass S. platensis to the increase of body weight of mice. The name of species is Mus musculus, strain is Swiss derivate. Utilized mice were male, 30-50 weighing gram, and 5-7 weeks of age. Treatment group was given by palette and given by biomass of S. Platensis, while control also fed palette but did not give biomass of S. platensis. Yielded biomass was used as food mixed with palette with composition of dry biomass S. platensis with palette was 0%, 10%, 20%, 30%, 40%, and 50%. Data analysis was conducted by using t-tes and analysis of variance. The results showed that by giving of dry biomass of S. platensis affected to the increasement of body weight from the first day until twelfth day of observation, and decrease on the thirteenth and fourteenth day. Pursuant to result of statistic, there is a significant difference (p < 0,05 between before giving and after giving of dry biomass S. platensis during 17 day. By giving dry biomass of S. platensis to mice (Mus musculus at first and second week, it was found the difference of average mice body weight among six concentrations of biomass but did not at the third week. It means that not all concentration of biomass have same effect to the increase of mice body weight as a Single-Celled Protein.

Corrected placement of Mus-Rattus fossil calibration forces precision in the molecular tree of rodents.

Science.gov (United States)

Kimura, Yuri; Hawkins, Melissa T R; McDonough, Molly M; Jacobs, Louis L; Flynn, Lawrence J

2015-09-28

Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly recognized characters that demonstrate lineage separation in the fossil record of Siwalik murines and examines the most reasonable nodal placement of the diverging lineages in a molecular phylogenetic tree by ancestral state reconstruction. Our specimen-based approach strongly indicates that Siwalik murines of the Karnimata clade are fossil members of the Arvicanthini-Otomyini-Millardini clade, which excludes Rattus and its relatives. Combining the new interpretation with the widely accepted hypothesis that the Progonomys clade includes Mus, the lineage separation event in the Siwalik fossil record represents the Mus/Arvicanthis split. Our test analysis on Bayesian age estimates shows that this new calibration point provides more accurate estimates of murine divergence than previous applications. Thus, we define this fossil calibration point and refine two other fossil-based points for molecular dating.

Detection of Highly-Absorbed X-rays from Nova Mus 2018 with Swift

Science.gov (United States)

Nelson, Thomas; Kuin, Paul; Mukai, Koji; Page, Kim; Chomiuk, Laura; Kawash, Adam; Sokoloski, J. L.; Linford, Justin; Rupen, Michael P.; Mioduszewski, Amy

2018-03-01

We report the detection of X-rays from Nova Mus 2018 with the Swift XRT instrument. We have been carrying out weekly monitoring of the nova with Swift since its discovery on 2018 Jan 15 (see ATel #11220), and observations up to 2018 Feb 24 yielded X-ray non-detections.

AcEST: BP921475 [AcEST

Lifescience Database Archive (English)

Full Text Available BlastX Result : Swiss-Prot sp_hit_id O35902 Definition sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus Al...gnificant alignments: (bits) Value sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 31 2....2 sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosop... 30 4.8 >sp|O35902|DSG3_MOUSE Desmog

Comparative mapping in the beige-satin region of mouse chromosome 13

Energy Technology Data Exchange (ETDEWEB)

Perou, C.M.; Pryor, R.; Kaplan, J. [Univ. of Utah School of Medicine, Salt Lake City, UT (United States)] [and others

1997-01-15

The proximal end of mouse chromosome (Chr) 13 contains regions conserved on human chromosomes 1q42-q44, 6p23-p21, and 7p22-p13. This region also contains mutations that may be models for human disease, including beige (human Chediak-Higashi syndrome). An interspecific backcross of SB/Le and Mus spretus mice was used to generate a molecular genetic linkage map of mouse chromosome 13 with an emphasis on the proximal region including beige (bg) and satin (sa). This map provides the gene order of the two phenotypic markers bg and sa relative to restriction fragment length polymorphisms and simple sequence length polymorphisms in 131 backcross animals. In parallel, we have created a physical map of the region using Nidogen (Nid) as a molecular starting point for cloning a YAC contig that was used to identify the beige gene. The physical map provides the fine-structure order of genes and anonymous DNA fragments that was not resolved by the genetic linkage mapping. The results show that the bg region of mouse Chr 13 is highly conserved on human Chr 1q42-q44 and provide a starting point for a complete functional analysis of the entire bg-sa interval. 37 refs., 4 figs., 1 tab.

AcEST: DK950322 [AcEST

Lifescience Database Archive (English)

Full Text Available 19 OS=Mus mus... 34 0.62 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms...ith multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 87.0 bits (214), Expect = 8

Development of a step-down method for altering male C57BL/6 mouse housing density and hierarchical structure: Preparations for spaceflight studies

Science.gov (United States)

Scofield, David C.; Rytlewski, Jeffrey D.; Childress, Paul; Shah, Kishan; Tucker, Aamir; Khan, Faisal; Peveler, Jessica; Li, Ding; McKinley, Todd O.; Chu, Tien-Min G.; Hickman, Debra L.; Kacena, Melissa A.

2018-05-01

This study was initiated as a component of a larger undertaking designed to study bone healing in microgravity aboard the International Space Station (ISS). Spaceflight experimentation introduces multiple challenges not seen in ground studies, especially with regard to physical space, limited resources, and inability to easily reproduce results. Together, these can lead to diminished statistical power and increased risk of failure. It is because of the limited space, and need for improved statistical power by increasing sample size over historical numbers, NASA studies involving mice require housing mice at densities higher than recommended in the Guide for the Care and Use of Laboratory Animals (National Research Council, 2011). All previous NASA missions in which mice were co-housed, involved female mice; however, in our spaceflight studies examining bone healing, male mice are required for optimal experimentation. Additionally, the logistics associated with spaceflight hardware and our study design necessitated variation of density and cohort make up during the experiment. This required the development of a new method to successfully co-house male mice while varying mouse density and hierarchical structure. For this experiment, male mice in an experimental housing schematic of variable density (Spaceflight Correlate) analogous to previously established NASA spaceflight studies was compared to a standard ground based housing schematic (Normal Density Controls) throughout the experimental timeline. We hypothesized that mice in the Spaceflight Correlate group would show no significant difference in activity, aggression, or stress when compared to Normal Density Controls. Activity and aggression were assessed using a novel activity scoring system (based on prior literature, validated in-house) and stress was assessed via body weights, organ weights, and veterinary assessment. No significant differences were detected between the Spaceflight Correlate group and the

Investigation of the presence and antinociceptive function of muscarinic acetylcholine receptors in the African naked mole-rat (Heterocephalus glaber)

DEFF Research Database (Denmark)

Jørgensen, Kristine B.; Krogh-Jensen, Karen; Pickering, Darryl S

2016-01-01

The present study investigated the cholinergic system in the African naked mole-rat (Heterocephalus glaber) with focus on the muscarinic acetylcholine receptor subtypes M1 and M4. The protein sequences for the subtypes m 1–5 of the naked mole-rat were compared to that of the house mouse (Mus...... musculus) using basic local alignment search tool (BLAST). The presence and function of M1 and M4 was investigated in vivo, using the formalin test with the muscarinic receptor agonists xanomeline and VU0152100. Spinal cord tissue from the naked mole-rat was used for receptor saturation binding studies...

H2S induces a suspended animation-like state in mice.

Science.gov (United States)

Blackstone, Eric; Morrison, Mike; Roth, Mark B

2005-04-22

Mammals normally maintain their core body temperature (CBT) despite changes in environmental temperature. Exceptions to this norm include suspended animation-like states such as hibernation, torpor, and estivation. These states are all characterized by marked decreases in metabolic rate, followed by a loss of homeothermic control in which the animal's CBT approaches that of the environment. We report that hydrogen sulfide can induce a suspended animation-like state in a nonhibernating species, the house mouse (Mus musculus). This state is readily reversible and does not appear to harm the animal. This suggests the possibility of inducing suspended animation-like states for medical applications.

Teratogenic effect of yogurt in mice fetus (Mus musculus)

OpenAIRE

Dwisari Dillasamola; Almahdy A; Amirah Desri; Skunda Diliarosta

2018-01-01

Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus) has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control), 0.52 yogurt (D1), 1.04  yogurt (D2), and 2.08 g yogurt (D3). Data were analyzed using one-way ANO...

A new sodium channel {alpha}-subunit gene (Scn9a) from Schwann cells maps to the Scn1a, Scn2a, Scn3a cluster of mouse chromosome 2

Energy Technology Data Exchange (ETDEWEB)

Beckers, M.C.; Ernst, E.; Gros, P. [McGill Univ., Montreal (Canada)

1996-08-15

We have used a total of 27 AXB/BXA recombinant inbred mouse strains to determine the chromosomal location of a newly identified gene encoding an {alpha}-subunit isoform of the sodium channel from Schwann cells, Scn9a. Linkage analysis established that Scn9a mapped to the proximal segment of mouse chromosome 2. The segregation of restriction fragment length polymorphisms in 145 progeny from a Mus spretus x C57BL/6J backcross indicates that Scn9a is very tightly linked to Scn1a (gene encoding the type I sodium channel {alpha}-subunit of the brain) and forms part of a cluster of four Scna genes located on mouse chromosome 2. 17 refs., 1 fig., 3 tabs.

FRAKSI ETANOL 96% BIJI KORO BENGUK (Mucuna pruriens L. SEBAGAI PENINGKAT KUALITAS SPERMATOZOA MENCIT (Mus musculus

Directory of Open Access Journals (Sweden)

Sri Winarni

2012-11-01

Full Text Available Background: The examination of sperm quality is the main priority for infertility diagnosis. Based on previous study with mice, active ingredient of Mucuna pruriens L. or koro benguk (Papilionaceae, the L-dopa, may affect the quality of spermatozoa.Objective: Research was to study the effect of 96% ethanol fraction Mucuna pruriens seed on spermatozoaquality of mice exposed to 2-Methoxy ethanol. L-dopa in 96% ethanol fraction of M. pruriens seed was 14.7%.Methode: This was an experimental study using complete randomized design. Subjects were BALB/C mice (Mus musculus. Five groups served as control, 3 groups received subcutaneos injection of 2-ME as muchas 100 mg/kg.bw/day for 12 days, followed with 96% ethanol fraction Mucuna pruriens seed starting from14 mg/kg.bw/day, 28 mg/kg.bw/day, and 56 mg/kg.bw/day for 51 days.Result: The 96% ethanol fraction of Mucuna pruriens seeds are significant increase motility (p<0,01 andthe percentage of normal spermatozoa morphology (p= 0,042.Conclusion: 96% ethanol fraction of Mucuna pruriens seeds are able to increase motility and the percentage of normal spermatozoa morphology in mice exposed to 2-ME. Keywords: Mucuna pruriens L., L-dopa, mouse spermatozoa

Metabolic profiles in serum of mouse after chronic exposure to drinking water.

Science.gov (United States)

Zhang, Yan; Wu, Bing; Zhang, Xuxiang; Li, Aimin; Cheng, Shupei

2011-08-01

The toxicity of Nanjing drinking water on mouse (Mus musculus) was detected by (1)H nuclear magnetic resonance (NMR)-based metabonomic method. Three groups of mice were fed with drinking water (produced by Nanjing BHK Water Plant), 3.8 μg/L benzo(a)pyrene as contrast, and clean water as control, respectively, for 90 days. It was observed that the levels of lactate, alanine, and creatinine in the mice fed with drinking water were increased and that of valine was decreased. The mice of drinking water group were successfully separated from control. The total concentrations of polycyclic aromatic hydrocarbons (PAHs), phthalates (PAEs), and other organic pollutants in the drinking water were 0.23 μg/L, 4.57 μg/L, and 0.34 μg/L, respectively. In this study, Nanjing drinking water was found to induce distinct perturbations of metabolic profiles on mouse including disorders of glucose-alanine cycle, branched-chain amino acid and energy metabolism, and dysfunction of kidney. This study suggests that metabonomic method is feasible and sensitive to evaluate potential toxic effects of drinking water.

Early-Life Social Isolation Influences Mouse Ultrasonic Vocalizations during Male-Male Social Encounters.

Science.gov (United States)

Keesom, Sarah M; Finton, Caitlyn J; Sell, Gabrielle L; Hurley, Laura M

2017-01-01

Early-life social isolation has profound effects on adult social competence. This is often expressed as increased aggression or inappropriate displays of courtship-related behaviors. The social incompetence exhibited by isolated animals could be in part due to an altered ability to participate in communicatory exchanges. House mice (Mus musculus) present an excellent model for exploring this idea, because social isolation has a well-established influence on their social behavior, and mice engage in communication via multiple sensory modalities. Here, we tested the prediction that social isolation during early life would influence ultrasonic vocalizations (USVs) emitted by adult male mice during same-sex social encounters. Starting at three weeks of age, male mice were housed individually or in social groups of four males for five weeks, after which they were placed in one of three types of paired social encounters. Pair types consisted of: two individually housed males, two socially housed males, or an individually housed and a socially housed male ("mixed" pairs). Vocal behavior (USVs) and non-vocal behaviors were recorded from these 15-minute social interactions. Pairs of mice consisting of at least one individually housed male emitted more and longer USVs, with a greater proportional use of USVs containing frequency jumps and 50-kHz components. Individually housed males in the mixed social pairs exhibited increased levels of mounting behavior towards the socially housed males. Mounting in these pairs was positively correlated with increased number and duration of USVs as well as increased proportional use of spectrally more complex USVs. These findings demonstrate that USVs are part of the suite of social behaviors influenced by early-life social isolation, and suggest that altered vocal communication following isolation reflects reduced social competence.

The effect of multiple simple Robertsonian heterozygosity on chromosome pairing and fertility of wild-stock house mice (Mus musculus domesticus).

Science.gov (United States)

Wallace, B M N; Searle, J B; Everett, C A

2002-01-01

The influence of Robertsonian (Rb) heterozygosity on fertility has been the subject of much study in the house mouse. However, these studies have been largely directed at single simple heterozygotes (heterozygous for a single Rb metacentric) or complex heterozygotes (heterozygous for several to many metacentrics which share common chromosome arms). In this paper we describe studies on male multiple simple heterozygotes, specifically the F(1) products of crosses between wild-stock mice homozygous for four or seven metacentrics and wild-stock mice with a standard all-acrocentric karyotype; these F(1) products were characterized by four and seven trivalents at meiosis I, respectively. Mice with the same karyotype, but two different genetic backgrounds were examined. Although a range of meiotic and fertility studies were conducted, particular emphasis was paid to analysis of chromosome pairing, previously not well-described in multiple simple heterozygous mice. The progression of spermatocytes through prophase I was followed by electron microscopy of surface spread material. As previously shown for single simple Rb heterozygotes, the trivalents that characterize multiple simple heterozygotes initially showed delayed pairing of the centromeric region and later showed side arm formation, resulting from non-homologous pairing by the centromeric ends of the acrocentric chromosomes. In the four trivalent groups of mice, 15 and 32% of trivalents showed unpairing in the centromeric region at mid pachytene; equivalent values were 29 and 39% for the seven trivalent groups. Pairing abnormalities (largely attachments and interlocks between trivalents and between a trivalent and the XY configuration) were observed in 18 and 23% of mid pachytene cells in the four trivalent groups and 36 and 49% of cells in the seven trivalent groups. The greater level of pachytene irregularity (unpairing and pairing abnormalities) in seven versus four trivalent heterozygotes was mirrored in terms

A catalog of the mouse gut metagenome

DEFF Research Database (Denmark)

Xiao, Liang; Feng, Qiang; Liang, Suisha

2015-01-01

laboratories and fed either a low-fat or high-fat diet. Similar to the human gut microbiome, >99% of the cataloged genes are bacterial. We identified 541 metagenomic species and defined a core set of 26 metagenomic species found in 95% of the mice. The mouse gut microbiome is functionally similar to its human......We established a catalog of the mouse gut metagenome comprising ∼2.6 million nonredundant genes by sequencing DNA from fecal samples of 184 mice. To secure high microbiome diversity, we used mouse strains of diverse genetic backgrounds, from different providers, kept in different housing...... counterpart, with 95.2% of its Kyoto Encyclopedia of Genes and Genomes (KEGG) orthologous groups in common. However, only 4.0% of the mouse gut microbial genes were shared (95% identity, 90% coverage) with those of the human gut microbiome. This catalog provides a useful reference for future studies....

NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1368 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1594 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MLUC-01-1112 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1112 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0982 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1554 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1494 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-TTRU-01-0117 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0117 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1297 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-CINT-01-0186 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0186 ref|NP_083045.3| synovial apoptosis inhibitor 1, synoviolin [Mus ...musculus] sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin precursor (Synovial apoptosis inhibit...or 1) gb|AAH42199.1| Synovial apoptosis inhibitor 1, synoviolin [Mus musculus] gb|AAH57917.1| Synovial apoptosis inhibitor 1, synovio...lin [Mus musculus] gb|AAH80722.1| Synovial apoptosis inhibitor 1, synoviolin... [Mus musculus] gb|EDL33195.1| synovial apoptosis inhibitor 1, synoviolin, isoform CRA_b [Mus musculus] NP_083045.3 1e-167 51% ...

Hold your horSSEs: controlling structure-selective endonucleases MUS81 and Yen1/GEN1.

Science.gov (United States)

Blanco, Miguel G; Matos, Joao

2015-01-01

Repair of DNA lesions through homologous recombination promotes the establishment of stable chromosomal interactions. Multiple helicases, topoisomerases and structure-selective endonucleases (SSEs) act upon recombining joint molecules (JMs) to disengage chromosomal connections and safeguard chromosome segregation. Recent studies on two conserved SSEs - MUS81 and Yen1/GEN1- uncovered multiple layers of regulation that operate to carefully tailor JM-processing according to specific cellular needs. Temporal restriction of SSE function imposes a hierarchy in pathway usage that ensures efficient JM-processing while minimizing reciprocal exchanges between the recombining DNAs. Whereas a conserved strategy of fine-tuning SSE functions exists in different model systems, the precise molecular mechanisms to implement it appear to be significantly different. Here, we summarize the current knowledge on the cellular switches that are in place to control MUS81 and Yen1/GEN1 functions.

Adaptive evolution and effective population size in wild house mice

Czech Academy of Sciences Publication Activity Database

Phifer-Rixey, M.; Bonhomme, F.; Boursot, P.; Churchill, G. A.; Piálek, Jaroslav; Tucker, P.; Nachman, M.

2012-01-01

Roč. 29, č. 10 (2012), s. 2949-2955 ISSN 0737-4038 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : substitution * adaptation * evolution * effective population size * house mouse Subject RIV: EG - Zoology Impact factor: 10.353, year: 2012

MUS81 promotes common fragile site expression

DEFF Research Database (Denmark)

Ying, Songmin; Minocherhomji, Sheroy; Chan, Kok Lung

2013-01-01

Fragile sites are chromosomal loci with a propensity to form gaps or breaks during early mitosis, and their instability is implicated as being causative in certain neurological disorders and cancers. Recent work has demonstrated that the so-called common fragile sites (CFSs) often impair the fait......Fragile sites are chromosomal loci with a propensity to form gaps or breaks during early mitosis, and their instability is implicated as being causative in certain neurological disorders and cancers. Recent work has demonstrated that the so-called common fragile sites (CFSs) often impair...... the faithful disjunction of sister chromatids in mitosis. However, the mechanisms by which CFSs express their fragility, and the cellular factors required to suppress CFS instability, remain largely undefined. Here, we report that the DNA structure-specific nuclease MUS81-EME1 localizes to CFS loci in early...

ORF Alignment: NC_003103 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s] ref|NP_766317.1| caspase recruitment domain 4 ... [Mus musculus] gb|AAH42670.1| Caspase recruitment... domain ... 4 [Mus musculus] sp|Q8BHB0|CARD4_MOUSE Caspase ... recruitment domain protein 4 d

Reproduction Does Not Adversely Affect Liver Mitochondrial Respiratory Function but Results in Lipid Peroxidation and Increased Antioxidants in House Mice.

Science.gov (United States)

Mowry, Annelise V; Kavazis, Andreas N; Sirman, Aubrey E; Potts, Wayne K; Hood, Wendy R

2016-01-01

Reproduction is thought to come at a cost to longevity. Based on the assumption that increased energy expenditure during reproduction is associated with increased free-radical production by mitochondria, oxidative damage has been suggested to drive this trade-off. We examined the impact of reproduction on liver mitochondrial function by utilizing post-reproductive and non-reproductive house mice (Mus musculus) living under semi-natural conditions. The age-matched post-reproductive and non-reproductive groups were compared after the reproductive females returned to a non-reproductive state, so that both groups were in the same physiological state at the time the liver was collected. Despite increased oxidative damage (p = 0.05) and elevated CuZnSOD (p = 0.002) and catalase (p = 0.04) protein levels, reproduction had no negative impacts on the respiratory function of liver mitochondria. Specifically, in a post-reproductive, maintenance state the mitochondrial coupling (i.e., respiratory control ratio) of mouse livers show no negative impacts of reproduction. In fact, there was a trend (p = 0.059) to suggest increased maximal oxygen consumption by liver mitochondria during the ADP stimulated state (i.e., state 3) in post-reproduction. These findings suggest that oxidative damage may not impair mitochondrial respiratory function and question the role of mitochondria in the trade-off between reproduction and longevity. In addition, the findings highlight the importance of quantifying the respiratory function of mitochondria in addition to measuring oxidative damage.

Srs2 and Mus81-Mms4 Prevent Accumulation of Toxic Inter-Homolog Recombination Intermediates.

Directory of Open Access Journals (Sweden)

Kenji Keyamura

2016-07-01

Full Text Available Homologous recombination is an evolutionally conserved mechanism that promotes genome stability through the faithful repair of double-strand breaks and single-strand gaps in DNA, and the recovery of stalled or collapsed replication forks. Saccharomyces cerevisiae ATP-dependent DNA helicase Srs2 (a member of the highly conserved UvrD family of helicases has multiple roles in regulating homologous recombination. A mutation (srs2K41A resulting in a helicase-dead mutant of Srs2 was found to be lethal in diploid, but not in haploid, cells. In diploid cells, Srs2K41A caused the accumulation of inter-homolog joint molecule intermediates, increased the levels of spontaneous Rad52 foci, and induced gross chromosomal rearrangements. Srs2K41A lethality and accumulation of joint molecules were suppressed by inactivating Rad51 or deleting the Rad51-interaction domain of Srs2, whereas phosphorylation and sumoylation of Srs2 and its interaction with sumoylated proliferating cell nuclear antigen (PCNA were not required for lethality. The structure-specific complex of crossover junction endonucleases Mus81 and Mms4 was also required for viability of diploid, but not haploid, SRS2 deletion mutants (srs2Δ, and diploid srs2Δ mus81Δ mutants accumulated joint molecule intermediates. Our data suggest that Srs2 and Mus81-Mms4 have critical roles in preventing the formation of (or in resolving toxic inter-homolog joint molecules, which could otherwise interfere with chromosome segregation and lead to genetic instability.

Sex reversal in the mouse (Mus musculus) is caused by a recurrent nonreciprocal crossover involving the x and an aberrant y chromosome.

Science.gov (United States)

Singh, L; Jones, K W

1982-02-01

Satellite DNA (Bkm) from the W sex-determining chromosome of snakes, which is related to sequences on the mouse Y chromosome, has been used to analyze the DNA and chromosomes of sex-reversed (Sxr) XXSxr male mice. Such mice exhibit a male-specific Southern blot Bkm hybridization pattern, consistent with the presence of Y-chromosome DNA. In situ hybridization of Bkm to chromosomes of XXSxr mice shows an aberrant concentration of related sequences on the distal terminus of a large mouse chromosome. The XYSxr carrier male, however, shows a pair of small chromosomes, which are presumed to be aberrant Y derivatives. Meiosis in the XYSxr mouse involves transfer of chromatin rich in Bkm-related DNA from the Y-Y1 complex to the X distal terminus. We suggest that this event is responsible for the transmission of the Sxr trait.

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-139 80% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0136 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_076136.2| non-imprinted in Prader-Willi/Angelman syndrome ...2 [Mus musculus] sp|Q9JJC8|NIPA2_MOUSE RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprinte...tein product [Mus musculus] tpg|DAA01178.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 2 [Mus ...musculus] dbj|BAE32806.1| unnamed protein product [Mus musculus] gb|EDL21872.1| non imprint...ed in Prader-Willi/Angelman syndrome 2 homolog (human), isoform CRA_a [Mus musculus] gb|EDL21874.1| non imprint

NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0645 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 3e-46 53% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0141 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-135 78% ...

Retinal cone photoreceptors of the deer mouse Peromyscus maniculatus: development, topography, opsin expression and spectral tuning.

Directory of Open Access Journals (Sweden)

Patrick Arbogast

Full Text Available A quantitative analysis of photoreceptor properties was performed in the retina of the nocturnal deer mouse, Peromyscus maniculatus, using pigmented (wildtype and albino animals. The aim was to establish whether the deer mouse is a more suitable model species than the house mouse for photoreceptor studies, and whether oculocutaneous albinism affects its photoreceptor properties. In retinal flatmounts, cone photoreceptors were identified by opsin immunostaining, and their numbers, spectral types, and distributions across the retina were determined. Rod photoreceptors were counted using differential interference contrast microscopy. Pigmented P. maniculatus have a rod-dominated retina with rod densities of about 450.000/mm(2 and cone densities of 3000-6500/mm(2. Two cone opsins, shortwave sensitive (S and middle-to-longwave sensitive (M, are present and expressed in distinct cone types. Partial sequencing of the S opsin gene strongly supports UV sensitivity of the S cone visual pigment. The S cones constitute a 5-15% minority of the cones. Different from house mouse, S and M cone distributions do not have dorsoventral gradients, and coexpression of both opsins in single cones is exceptional (<2% of the cones. In albino P. maniculatus, rod densities are reduced by approximately 40% (270.000/mm(2. Overall, cone density and the density of cones exclusively expressing S opsin are not significantly different from pigmented P. maniculatus. However, in albino retinas S opsin is coexpressed with M opsin in 60-90% of the cones and therefore the population of cones expressing only M opsin is significantly reduced to 5-25%. In conclusion, deer mouse cone properties largely conform to the general mammalian pattern, hence the deer mouse may be better suited than the house mouse for the study of certain basic cone properties, including the effects of albinism on cone opsin expression.

AcEST: DK962347 [AcEST

Lifescience Database Archive (English)

Full Text Available ... 33 1.1 sp|Q7TSF1|DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus GN=Dsg1b... 31... 30 7.4 sp|Q61495|DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus GN=Dsg1... 30 7.4 sp|Q9SIB4|WOX3_ARATH WUSC...hia co... 30 9.6 sp|Q01550|TANA_XENLA Tanabin OS=Xenopus laevis PE=2 SV=1 30 9.6 sp|Q7TSF0|DSG1C_MOUSE Desmog...VAEYVTH 428 IVG WDE LP D V E+ E+V+H Sbjct: 322 IVGGNWDEVLPVDVRVPEEIQEFVSH 347 >sp|Q7TSF1|DSG1B_MOUSE Desmogl

Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/
Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

OpenAIRE

Silvia Gonzalez Monteiro; Régis Adriel Zanette; Camila Belmonte Oliveira; Marcos Kipper da Silva; Aleksandro Schafer da Silva

2008-01-01

This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples w...

Disruption of SLX4-MUS81 Function Increases the Relative Biological Effectiveness of Proton Radiation

Energy Technology Data Exchange (ETDEWEB)

Liu, Qi [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Underwood, Tracy S.A.; Kung, Jong [Division of Radiation Physics, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Wang, Meng [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Lu, Hsiao-Ming; Paganetti, Harald [Division of Radiation Physics, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Held, Kathryn D.; Hong, Theodore S.; Efstathiou, Jason A. [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Willers, Henning, E-mail: hwillers@mgh.harvard.edu [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States)

2016-05-01

Purpose: Clinical proton beam therapy has been based on the use of a generic relative biological effectiveness (RBE) of ∼1.1. However, emerging data have suggested that Fanconi anemia (FA) and homologous recombination pathway defects can lead to a variable RBE, at least in vitro. We investigated the role of SLX4 (FANCP), which acts as a docking platform for the assembly of multiple structure-specific endonucleases, in the response to proton irradiation. Methods and Materials: Isogenic cell pairs for the study of SLX4, XPF/ERCC1, MUS81, and SLX1 were irradiated at the mid-spread-out Bragg peak of a clinical proton beam (linear energy transfer 2.5 keV/μm) or with 250 kVp x-rays, and the clonogenic survival fractions were determined. To estimate the RBE of the protons relative to cobalt-60 photons (Co60Eq), we assigned a RBE(Co60Eq) of 1.1 to x-rays to correct the physical dose measured. Standard DNA repair foci assays were used to monitor the damage responses, and the cell cycle distributions were assessed by flow cytometry. The poly(ADP-ribose) polymerase inhibitor olaparib was used for comparison. Results: Loss of SLX4 function resulted in an enhanced proton RBE(Co60Eq) of 1.42 compared with 1.11 for wild-type cells (at a survival fraction of 0.1; P<.05), which correlated with increased persistent DNA double-strand breaks in cells in the S/G{sub 2} phase. Genetic analysis identified the SLX4-binding partner MUS81 as a mediator of resistance to proton radiation. Both proton irradiation and olaparib treatment resulted in a similar prolonged accumulation of RAD51 foci in SLX4/MUS81-deficient cells, suggesting a common defect in the repair of DNA replication fork-associated damage. Conclusions: A defect in the FA pathway at the level of SLX4 results in hypersensitivity to proton radiation, which is, at least in part, due to impaired MUS81-mediated processing of replication forks that stall at clustered DNA damage. In vivo and clinical studies are needed to

Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

OpenAIRE

Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

1984-01-01

The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic...

Asymmetry and polymorphism of hybrid male sterility during the early stages of speciation in house mice.

Science.gov (United States)

Good, Jeffrey M; Handel, Mary Ann; Nachman, Michael W

2008-01-01

House mice offer a powerful system for dissecting the genetic basis of phenotypes that isolate species in the early stages of speciation. We used a series of reciprocal crosses between wild-derived strains of Mus musculus and M. domesticus to examine F(1) hybrid male sterility, one of the primary phenotypes thought to isolate these species. We report four main results. First, we found significantly smaller testes and fewer sperm in hybrid male progeny of most crosses. Second, in some crosses hybrid male sterility was asymmetric and depended on the species origin of the X chromosome. These observations confirm and extend previous findings, underscoring the central role that the M. musculus X chromosome plays in reproductive isolation. Third, comparisons among reciprocal crosses revealed polymorphism at one or more hybrid incompatibilities within M. musculus. Fourth, the spermatogenic phenotype of this polymorphic interaction appears distinct from previously described hybrid incompatibilities between these species. These data build on previous studies of speciation in house mice and show that the genetic basis of hybrid male sterility is fairly complex, even at this early stage of divergence.

NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

Elevated expression of H19 and Igf2 in the female mouse eye.

Directory of Open Access Journals (Sweden)

Björn Reinius

Full Text Available The catalogue of genes expressed at different levels in the two sexes is growing, and the mechanisms underlying sex differences in regulation of the mammalian transcriptomes are being explored. Here we report that the expression of the imprinted non-protein-coding maternally expressed gene H19 was female-biased specifically in the female mouse eye (1.9-fold, p = 3.0E-6 while not being sex-biased in other somatic tissues. The female-to-male expression fold-change of H19 fell in the range expected from an effect of biallelic versus monoallelic expression. Recently, the possibility of sex-specific parent-of-origin allelic expression has been debated. This led us to hypothesize that H19 might express biallelically in the female mouse eye, thus escape its silencing imprint on the paternal allele specifically in this tissue. We therefore performed a sex-specific imprinting assay of H19 in female and male eye derived from a cross between Mus musculus and Mus spretus. However, this analysis demonstrated that H19 was exclusively expressed from the maternal gene copy, disproving the escape hypothesis. Instead, this supports that the female-biased expression of H19 is the result of upregulation of the single maternal. Furthermore, if H19 would have been expressed from both gene copies in the female eye, an associated downregulation of Insulin-like growth factor 2 (Igf2 was expected, since H19 and Igf2 compete for a common enhancer element located in the H19/Igf2 imprinted domain. On the contrary we found that also Igf2 was significantly upregulated in its expression in the female eye (1.2-fold, p = 6.1E-3, in further agreement with the conclusion that H19 is monoallelically elevated in females. The female-biased expression of H19 and Igf2 specifically in the eye may contribute to our understanding of sex differences in normal as well as abnormal eye physiology and processes.

78 FR 50082 - South Farallon Islands Invasive House Mouse Eradication Project; Farallon National Wildlife...

Science.gov (United States)

2013-08-16

... Farallon Islands and Noonday Rock. In 1969 the Refuge was expanded to include the South Farallon Islands... to eradicate non-native, invasive house mice from the South Farallon Islands, part of the Farallon... the problem of invasive house mice on the South Farallon Islands. DATES: We will accept comments...

AcEST: BP917594 [AcEST

Lifescience Database Archive (English)

Full Text Available I11|MDTH_CITK8 Multidrug resistance protein mdtH OS=Citrob... 30 9.4 >sp|Q80W93|HYDIN_MOUSE Hydrocephalus-in.........done Score E Sequences producing significant alignments: (bits) Value sp|Q80W93|HYDIN_MOUSE Hydrocep...(release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q80W93 Definition sp|Q80W93|HYDIN_MOUSE Hydroc...ephalus-inducing protein OS=Mus musculus Align length 89 Score (bit) 35.4 E-value 0...halus-inducing protein OS=Mus musc... 35 0.17 sp|Q726E5|Y3208_DESVH UPF0078 membran

Life history dictates fluorosis risk in a small mammal community

International Nuclear Information System (INIS)

Rafferty, D.P.; Faulkner, B.; Lochmiller, R.L.; Qualls, C.W. Jr.; McBee, K.

1995-01-01

Dental lesions, due to fluorosis, previously have been reported in wild, male cotton rats (Sigmodon hispidus) on an abandoned oil refinery located at the Oklahoma Refining Company in Cyril, Oklahoma. This study was expanded to include examinations of the fulvous harvest mouse (Reithrodontomys fulvescens), house mouse (Mus musculus), prairie vole (Microtus ochrogaster), plains pocket gopher (Geomys bursarius), least shrew (Cryptotis parva), shorttailed shrew (Blarina brevicauda), and deer mouse (Peromyscus spp.) at this same site. A sample of each species was collected form the contaminated refining site and a reference site with no known contamination. The authors grossly scored dentition of lower and upper incisors, microscopically examined cellular aberrations in ameloblasts and ondontoblasts, and quantified femur fluoride levels. Alterations in the lower and upper incisors were common in prairie voles, whose incisors possessed striations and erosion of the enamel and appeared chalky white. Incisors of animals taken from the reference site were normal. Patterns in occurrence of fluorosis and degree of enamel erosion was examined relative to the life history characteristics of the species

Hyperelastic Material Properties of Mouse Skin under Compression.

Directory of Open Access Journals (Sweden)

Yuxiang Wang

Full Text Available The skin is a dynamic organ whose complex material properties are capable of withstanding continuous mechanical stress while accommodating insults and organism growth. Moreover, synchronized hair cycles, comprising waves of hair growth, regression and rest, are accompanied by dramatic fluctuations in skin thickness in mice. Whether such structural changes alter skin mechanics is unknown. Mouse models are extensively used to study skin biology and pathophysiology, including aging, UV-induced skin damage and somatosensory signaling. As the skin serves a pivotal role in the transfer function from sensory stimuli to neuronal signaling, we sought to define the mechanical properties of mouse skin over a range of normal physiological states. Skin thickness, stiffness and modulus were quantitatively surveyed in adult, female mice (Mus musculus. These measures were analyzed under uniaxial compression, which is relevant for touch reception and compression injuries, rather than tension, which is typically used to analyze skin mechanics. Compression tests were performed with 105 full-thickness, freshly isolated specimens from the hairy skin of the hind limb. Physiological variables included body weight, hair-cycle stage, maturity level, skin site and individual animal differences. Skin thickness and stiffness were dominated by hair-cycle stage at young (6-10 weeks and intermediate (13-19 weeks adult ages but by body weight in mature mice (26-34 weeks. Interestingly, stiffness varied inversely with thickness so that hyperelastic modulus was consistent across hair-cycle stages and body weights. By contrast, the mechanics of hairy skin differs markedly with anatomical location. In particular, skin containing fascial structures such as nerves and blood vessels showed significantly greater modulus than adjacent sites. Collectively, this systematic survey indicates that, although its structure changes dramatically throughout adult life, mouse skin at a given

NCBI nr-aa BLAST: CBRC-STRI-01-2305 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2305 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 8e-64 55% ...

NCBI nr-aa BLAST: CBRC-STRI-01-1937 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1937 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-25 41% ...

Sperm-related phenotypes implicated in both maintenance and breakdown of a natural species barrier in the house mouse

Science.gov (United States)

Albrechtová, Jana; Albrecht, Tomáš; Baird, Stuart J. E.; Macholán, Miloš; Rudolfsen, Geir; Munclinger, Pavel; Tucker, Priscilla K.; Piálek, Jaroslav

2012-01-01

The house mouse hybrid zone (HMHZ) is a species barrier thought to be maintained by a balance between dispersal and natural selection against hybrids. While the HMHZ is characterized by frequency discontinuities for some sex chromosome markers, there is an unexpected large-scale regional introgression of a Y chromosome across the barrier, in defiance of Haldane's rule. Recent work suggests that a major force maintaining the species barrier acts through sperm traits. Here, we test whether the Y chromosome penetration of the species barrier acts through sperm traits by assessing sperm characteristics of wild-caught males directly in a field laboratory set up in a Y introgression region of the HMHZ, later calculating the hybrid index of each male using 1401 diagnostic single nucleotide polymorphisms (SNPs). We found that both sperm count (SC) and sperm velocity were significantly reduced across the natural spectrum of hybrids. However, SC was more than rescued in the presence of the invading Y. Our results imply an asymmetric advantage for Y chromosome introgression consistent with the observed large-scale introgression. We suggest that selection on sperm-related traits probably explains a large component of patterns observed in the natural hybrid zone, including the Y chromosome penetration. PMID:23055063

Mouse housing system using pressurized cages intraventilated by direct-current microfans.

Science.gov (United States)

Martinewski, Alexandre; Correia, Caio S C; de Souza, Nívea L; Merusse, José L B

2012-03-01

We performed the initial assessment of an alternative pressurized intraventilated (PIV) caging system for laboratory mice that uses direct-current microfans to achieve cage pressurization and ventilation. Twenty-nine pairs of female SPF BALB/c mice were used, with 19 experimental pairs kept in PIV cages and 10 control pairs kept in regular filter-top (FT) cages. Both groups were housed in a standard housing room with a conventional atmospheric control system. For both systems, intracage temperatures were in equilibrium with ambient room temperature. PIV cages showed a significant difference in pressure between days 1 and 8. Air speed (and consequently airflow rate) and the number of air changes hourly in the PIV cages showed decreasing trends. In both systems, ammonia concentrations increased with time, with significant differences between groups starting on day 1. Overall, the data revealed that intracage pressurization and ventilation by using microfans is a simple, reliable system, with low cost, maintenance requirements, and incidence of failures. Further experiments are needed to determine the potential influence of this system on the reproductive performance and pulmonary integrity in mice.

Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/ Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

Directory of Open Access Journals (Sweden)

Silvia Gonzalez Monteiro

2008-08-01

Full Text Available This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples were analyzed by the centrifugal-flotation method with zinc sulfate. Efficacy of 97,05% for metronidazole, 98,30% for fenbendazole and 100% for secnidazole were observed in the study. According to the results it was concluded that the tested drugs were effective for the treatment of mice parasitized by Giardia muris.Este estudo visou avaliar a eficácia do metronidazol, fenbendazole e secnidazol contra Giardia muris em camundongos naturalmente infectados. Foram utilizados 40 camundongos da espécie Mus musculus divididos em quatro grupos de 10 animais cada, sendo grupo A, grupo controle, não tratados, e grupos B, C e D tratados com 4mg/ml de metronidazol, fenbendazole e secnidazol, respectivamente. Para avaliar a eficácia dos medicamentos foram realizadas duas coletas de fezes uma no dia zero e outra 10 dias após tratamento. As amostras foram processadas e analisadas a partir do método de centrífugo-flutuação com sulfato de zinco. No estudo observou-se eficácia de 97,05% para metronidazol, 98,30% para fenbendazole e 100% para secnidazol no tratamento de giardiase murina. Com base nos resultados concluí-se que as drogas testadas apresentaram eficácia no tratamento de camundongos parasitados por Giardia muris.

NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0131 ref|NP_444459.1| vomeronasal 1 receptor, B8 [Mus musculus] sp|Q9EQ45|VN1B8_MOUSE Vomeronas...al type-1 receptor B8 (Vomeronasal type-1 receptor A13) gb|AAG42088.1|AF291494_1 vomeronasa...l receptor V1RB8 [Mus musculus] dbj|BAB79220.1| vomeronasal receptor 1 A13 [Mus musculus] gb|AAI40252.1| Vomeronasa...l 1 receptor, B8 [synthetic construct] gb|EDK99274.1| vomeronasal ...1 receptor, B8 [Mus musculus] gb|AAI46525.1| Vomeronasal 1 receptor, B8 [synthetic construct] NP_444459.1 1e-175 100% ...

PENGARUH PEMBERIAN “KOMBUCHA” TEH ROSELLA TERHADAP PROFIL DARAH MENCIT (Mus musculus L)

OpenAIRE

Mukhani Dwi Hidayanti; Sussi Astuti; Maria Erna Kustyawati

2015-01-01

“Kombucha” rosella tea is a functional fermented beverage product solution from the petals of rosella tea and sugar using a microbial starter “Kombucha” (Acetobacter xylinum and several kind of yeast). The objective of the experiment was to determine the effect of “Kombucha” rosella tea on the blood profile of mice (Mus musculus L). The experiment compiled in a completely randomized design with 4 treatments dose “Kombucha” rosella tea was 0,73 ml/20 g BB mice (distilled water) (K), 0,36 ml...

The Pace of Hybrid Incompatibility Evolution in House Mice.

Science.gov (United States)

Wang, Richard J; White, Michael A; Payseur, Bret A

2015-09-01

Hybrids between species are often sterile or inviable. This form of reproductive isolation is thought to evolve via the accumulation of mutations that interact to reduce fitness when combined in hybrids. Mathematical formulations of this "Dobzhansky-Muller model" predict an accelerating buildup of hybrid incompatibilities with divergence time (the "snowball effect"). Although the Dobzhansky-Muller model is widely accepted, the snowball effect has only been tested in two species groups. We evaluated evidence for the snowball effect in the evolution of hybrid male sterility among subspecies of house mice, a recently diverged group that shows partial reproductive isolation. We compared the history of subspecies divergence with patterns of quantitative trait loci (QTL) detected in F2 intercrosses between two pairs of subspecies (Mus musculus domesticus with M. m. musculus and M. m. domesticus with M. m. castaneus). We used a recently developed phylogenetic comparative method to statistically measure the fit of these data to the snowball prediction. To apply this method, QTL were partitioned as either shared or unshared in the two crosses. A heuristic partitioning based on the overlap of QTL confidence intervals produced unambiguous support for the snowball effect. An alternative approach combining data among crosses favored the snowball effect for the autosomes, but a linear accumulation of incompatibilities for the X chromosome. Reasoning that the X chromosome analyses are complicated by low mapping resolution, we conclude that hybrid male sterility loci have snowballed in house mice. Our study illustrates the power of comparative genetic mapping for understanding mechanisms of speciation. Copyright © 2015 by the Genetics Society of America.

The genomic ancestry, landscape genetics and invasion history of introduced mice in New Zealand.

Science.gov (United States)

Veale, Andrew J; Russell, James C; King, Carolyn M

2018-01-01

The house mouse ( Mus musculus ) provides a fascinating system for studying both the genomic basis of reproductive isolation, and the patterns of human-mediated dispersal. New Zealand has a complex history of mouse invasions, and the living descendants of these invaders have genetic ancestry from all three subspecies, although most are primarily descended from M. m. domesticus . We used the GigaMUGA genotyping array (approximately 135 000 loci) to describe the genomic ancestry of 161 mice, sampled from 34 locations from across New Zealand (and one Australian city-Sydney). Of these, two populations, one in the south of the South Island, and one on Chatham Island, showed complete mitochondrial lineage capture, featuring two different lineages of M. m. castaneus mitochondrial DNA but with only M. m. domesticus nuclear ancestry detectable. Mice in the northern and southern parts of the North Island had small traces (approx. 2-3%) of M. m. castaneus nuclear ancestry, and mice in the upper South Island had approximately 7-8% M. m. musculus nuclear ancestry including some Y-chromosomal ancestry-though no detectable M. m. musculus mitochondrial ancestry. This is the most thorough genomic study of introduced populations of house mice yet conducted, and will have relevance to studies of the isolation mechanisms separating subspecies of mice.

Genetic recombination variation in wild Robertsonian mice: on the role of chromosomal fusions and Prdm9 allelic background.

Science.gov (United States)

Capilla, Laia; Medarde, Nuria; Alemany-Schmidt, Alexandra; Oliver-Bonet, Maria; Ventura, Jacint; Ruiz-Herrera, Aurora

2014-07-07

Despite the existence of formal models to explain how chromosomal rearrangements can be fixed in a population in the presence of gene flow, few empirical data are available regarding the mechanisms by which genome shuffling contributes to speciation, especially in mammals. In order to shed light on this intriguing evolutionary process, here we present a detailed empirical study that shows how Robertsonian (Rb) fusions alter the chromosomal distribution of recombination events during the formation of the germline in a Rb system of the western house mouse (Mus musculus domesticus). Our results indicate that both the total number of meiotic crossovers and the chromosomal distribution of recombination events are reduced in mice with Rb fusions and that this can be related to alterations in epigenetic signatures for heterochromatinization. Furthermore, we detected novel house mouse Prdm9 allelic variants in the Rb system. Remarkably, mean recombination rates were positively correlated with a decrease in the number of ZnF domains in the Prdm9 gene. The suggestion that recombination can be modulated by both chromosomal reorganizations and genetic determinants that control the formation of double-stranded breaks during meiosis opens new avenues for understanding the role of recombination in chromosomal speciation. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0256 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0238 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0122 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0122 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-OCUN-01-1141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1141 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0259 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

Transgene mus som sygdomsmodeller

DEFF Research Database (Denmark)

Schuster, Mikkel Bruhn; Porse, Bo Torben

2003-01-01

Transgenic animal models have proven to be useful tools in understanding both basic biology and the events associated with disease. Recent technical advances in the area of genomic manipulation in combination with the availability of the human and murine genomic sequences now allow the precise...... tailoring of the mouse genome. In this review we describe a few systems in which transgenic animal models have been employed for the purpose of studying the etiology of human diseases. Udgivelsesdato: 2003-Feb-17...

Re-evaluation of the holotype of Mus ruber Jentink, 1880 (Rodentia: Muridae) from western New Guinea (Irian Jaya)

NARCIS (Netherlands)

Calaby, J.H.; Mary Taylor, J.

1980-01-01

INTRODUCTION The first rodent from the New Guinea region, now included in the genus Rattus, to be formally named, was Mus ruber Jentink, 1880. The name R. ruber is currently in widespread use (Lidicker, 1968, 1973; Lidicker & Ziegler, 1968; Misonne, 1969; Ziegler, 1971; Bulmer & Menzies, 1972, 1973;

Quelques espèces nouvelles d’hispides de Sumatra appartenant au Musée de Leyde

NARCIS (Netherlands)

Gestro, R.

1897-01-01

Sur le point d’entreprendre l’étude des Hispides recueillies à Sumatra par M. le Doct. E. Modigliani, j’ai demandé à M. Ritsema, le savant conservateur de la collection d’insectes du Musée de Leyde, la communication de quelques espèces dans le but de faciliter mon travail. Mon aimable collègue a

The genomic landscape shaped by selection on transposable elements across 18 mouse strains.

Science.gov (United States)

Nellåker, Christoffer; Keane, Thomas M; Yalcin, Binnaz; Wong, Kim; Agam, Avigail; Belgard, T Grant; Flint, Jonathan; Adams, David J; Frankel, Wayne N; Ponting, Chris P

2012-06-15

Transposable element (TE)-derived sequence dominates the landscape of mammalian genomes and can modulate gene function by dysregulating transcription and translation. Our current knowledge of TEs in laboratory mouse strains is limited primarily to those present in the C57BL/6J reference genome, with most mouse TEs being drawn from three distinct classes, namely short interspersed nuclear elements (SINEs), long interspersed nuclear elements (LINEs) and the endogenous retrovirus (ERV) superfamily. Despite their high prevalence, the different genomic and gene properties controlling whether TEs are preferentially purged from, or are retained by, genetic drift or positive selection in mammalian genomes remain poorly defined. Using whole genome sequencing data from 13 classical laboratory and 4 wild-derived mouse inbred strains, we developed a comprehensive catalogue of 103,798 polymorphic TE variants. We employ this extensive data set to characterize TE variants across the Mus lineage, and to infer neutral and selective processes that have acted over 2 million years. Our results indicate that the majority of TE variants are introduced though the male germline and that only a minority of TE variants exert detectable changes in gene expression. However, among genes with differential expression across the strains there are twice as many TE variants identified as being putative causal variants as expected. Most TE variants that cause gene expression changes appear to be purged rapidly by purifying selection. Our findings demonstrate that past TE insertions have often been highly deleterious, and help to prioritize TE variants according to their likely contribution to gene expression or phenotype variation.

The mouse hybrid zone in Central Europe: from morphology to molecules

Czech Academy of Sciences Publication Activity Database

Ďureje, Ľudovít; Macholán, Miloš; Baird, Stuart J. E.; Piálek, Jaroslav

2012-01-01

Roč. 61, 3-4 (2012), s. 308-318 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : geography * introgression * mtDNA * Mus musculus musculus * Mus musculus domesticus * X chromosome * Y chromosome Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

Burrow characteristics of the co-existing sibling species Mus booduga and Mus terricolor and the genetic basis of adaptation to hypoxic/hypercapnic stress

Directory of Open Access Journals (Sweden)

Narayan Gopeshwar

2009-04-01

Full Text Available Abstract Background The co-existing, sibling species Mus booduga and Mus terricolor show a difference in site-preference for burrows. The former build them in flat portion of the fields while the latter make burrows in earthen mounds raised for holding water in cultivated fields. In northern India which experiences great variation in climatic condition between summer and winter, M. booduga burrows have an average depth of 41 cm, as against 30 cm in southern India with less climatic fluctuation. M. terricolor burrows are about 20 cm deep everywhere. The three chromosomal species M. terricolor I, II and III have identical burrows, including location of the nest which is situated at the highest position. In contrast, in M. booduga burrows, the nest is at the lowest position. Results The nest chamber of M. booduga is located at greater depth than the nest chamber of M. terricolor. Also, in the burrows of M. booduga the exchange of air takes place only from one side (top surface in contrast to the burrows of M. terricolor where air exchange is through three sides. Hence, M. booduga lives in relatively more hypoxic and hypercapnic conditions than M. terricolor. We observed the fixation of alternative alleles in M. booduga and M. terricolor at Superoxide dismutase-1 (Sod-1, Transferrin (Trf and Hemoglobin beta chain (Hbb loci. All the three are directly or indirectly dependent on oxygen concentration for function. In addition to these, there are differences in burrow patterns and site-preference for burrows suggesting difference in probable adaptive strategy in these co-existing sibling species. Conclusion The burrow structure and depth of nest of the chromosomal species M. terricolor I, II and III are same everywhere probably due to the recency of their evolutionary divergence. Moreover, there is lack of competition for the well-adapted 'microhabitats' since they are non-overlapping in distribution. However, the co-existing sibling species M. booduga

EFEK ANTIFERTILITAS EKSTRAK AKAR SOM JAWA (Talinum paniculatum Gaertn. PADA MENCIT (Mus musculus L. JANTAN

Directory of Open Access Journals (Sweden)

Tetri Widiyani

2012-10-01

Full Text Available Talinum paniculatum Gaertn commonly is used as aphrodisiac herb. Phytosterol, saponin, flavonoid and tannin of the herb have a certain bioactivity and may affect to the body system. The objective of this research was to examine the antifertility effects of sam jawa (Talinum paniculatum Gaertn. root extract (SJRE on male mice (Mus musculus L.. Twenty male mice were divided into 4 groups randomly with 5 replications. SJRE was dissolved in aquadest and given orally everyday for 34 days. The treatment dosages were 0 (control, 100,200, and 300 mg/kg BW. At 35th day mice were sacrificed and sectioned to remove testes and epididymis spermatozoas. Testes were sectioned using paraffin method and stained using Haematoxyllin-Eosin. Spermatogenic cells in each seminiferous tubule were counted to investigated spermatogenesis activity of testes. Epididymis sperm suspension was used to investigate sperm quality i.e: morphology, velocity and motility. Quantitatives data were analized using ANOVA and continued DMRT on 5% significance level. The result showed SJRE had antifertility effects on male mice (Mus musculus L. could inhibit spermatogenesis (decrease the spermatogenic cells count and decrease the sperm quality (increase percentage of abnormal sperm, decrease sperm motility and also decrease sperm velocity.

No postnatal maternal effect on male aggressiveness in wild-derived strains of house mice

Czech Academy of Sciences Publication Activity Database

Ďureje, Ľudovít; Vošlajerová Bímová, Barbora; Piálek, Jaroslav

2011-01-01

Roč. 37, č. 1 (2011), s. 48-55 ISSN 0096-140X R&D Projects: GA AV ČR KJB600930701 Institutional research plan: CEZ:AV0Z60930519 Keywords : aggression * cross-fostering * wild-derived inbred strains * house mouse Subject RIV: EG - Zoology Impact factor: 2.630, year: 2011

Pan-African phylogeny of Mus (subgenus Nannomys) reveals one of the most successful mammal radiations in Africa

Czech Academy of Sciences Publication Activity Database

Bryja, Josef; Mikula, Ondřej; Šumbera, R.; Meheretu, Y.; Aghová, Tatiana; Lavrenchenko, L. A.; Mazoch, Vladimír; Oguge, N.; Mbau, J. S.; Welegerima, K.; Amundala, N.; Colyn, M.; Leirs, H.; Verheyen, E.

2014-01-01

Roč. 14, č. 256 (2014), s. 256 ISSN 1471-2148 R&D Projects: GA ČR GAP506/10/0983 Institutional support: RVO:68081766 Keywords : Biogeography * Tropical Africa * Molecular phylogeny * Pygmy mice * Plio-Pleistocene climatic fluctuations * Divergence timing * Muridae (Murinae) * Mus minutoides * Phylogeography * DNA barcoding Subject RIV: EG - Zoology Impact factor: 3.368, year: 2014

NCBI nr-aa BLAST: CBRC-STRI-01-1973 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1973 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9E...Q46|VN1B7_MOUSE RecName: Full=Vomeronasal type-1 receptor B7; AltName: Full=Vomeronasal type-1 receptor A11 ...gb|AAG42087.1|AF291493_1 vomeronasal receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A1...1 [Mus musculus] gb|AAI41627.1| Vomeronasal 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-1277 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1277 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2495 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2495 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2240 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2627 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2627 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

AcEST: DK959903 [AcEST

Lifescience Database Archive (English)

Full Text Available 5|Q8K2E5_MOUSE Budding uninhibited by benzimidazoles 1 h... 102 3e-20 tr|Q3UZD6|Q...3UZD6_MOUSE Putative uncharacterized protein OS=Mus m... 102 3e-20 tr|A2ARS1|A2ARS1_MOUSE Budding uninhibited by benzimidazoles

GAMBARAN HEMATOLOGI MENCIT (Mus musculus MODEL TOKSISITAS SUBKRONIS

Directory of Open Access Journals (Sweden)

Ita Nur Eka Pujiastuti

2017-06-01

Full Text Available Garlic commonly is consumed as medicine to prevent or heal illness or to maintain someone's health. Many societies prefer garlic (Allium sativum among other herbal remedies for cholesterol treatment. It consists of several types, and one of them is single bulb garlic used to treat hypertension. There has been, however, no published research reporting the toxicological properties of single bulb garlic. The purpose of this study was to determine subchronic toxic effects of single bulb garlic administered to mice using hematological parameters. The experiment parameters were hemoglobin and hematocrit levels, the number of erythrocytes and leukocytes. Male mice (Mus musculus strain Balb-C were treated with single bulb garlic extract for 28 days with dosage levels of 0% (N , 0.25% (P1 , 0.5% (P2 , 1% (P3 , and 2% (P4 . Single bulb garlic showed no effect on hemoglobin and hematocrit levels but increased the number of erythrocyte and leucocyte. We concluded that single bulb garlic did not cause subchronic toxic effects.

Respiratory allergen from house dust mite is present in human milk and primes for allergic sensitization in a mouse model of asthma.

Science.gov (United States)

Macchiaverni, P; Rekima, A; Turfkruyer, M; Mascarell, L; Airouche, S; Moingeon, P; Adel-Patient, K; Condino-Neto, A; Annesi-Maesano, I; Prescott, S L; Tulic, M K; Verhasselt, V

2014-03-01

There is an urgent need to identify environmental risk and protective factors in early life for the prevention of allergy. Our study demonstrates the presence of respiratory allergen from house dust mite, Der p 1, in human breast milk. Der p 1 in milk is immunoreactive, present in similar amounts as dietary egg antigen, and can be found in breast milk from diverse regions of the world. In a mouse model of asthma, oral exposure to Der p through breast milk strongly promotes sensitization rather than protect the progeny as we reported with egg antigen. These data highlight that antigen administration to the neonate through the oral route may contribute to child allergic sensitization and have important implications for the design of studies assessing early oral antigen exposure for allergic disease prevention. The up-to-now unknown worldwide presence of respiratory allergen in maternal milk allows new interpretation and design of environmental control epidemiological studies for allergic disease prevention. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

NCBI nr-aa BLAST: CBRC-PABE-21-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-21-0006 sp|P97714|ADA1D_MOUSE Alpha-1D adrenergic receptor (Alpha 1D-adre...noceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic receptor) gb|AAB47042.1| alpha 1d-adrenergic recept...or [Mus sp.] dbj|BAA90312.1| alpha 1D adrenergic receptor [Mus musculus] P97714 0.0 78% ...

AcEST: DK955384 [AcEST

Lifescience Database Archive (English)

Full Text Available >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...OUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 5...XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score = 5

AcEST: DK953370 [AcEST

Lifescience Database Archive (English)

Full Text Available PS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Scor...NA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Leng...FDPEIPQTLRLEFAKANTK 104 >sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms

AcEST: BP913064 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE Experimental autoimmune prostatitis antige... 31 5.2 sp|Q9NVV0|TM38B_HUMAN...|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antigen 2 OS=Mus musculus GN=Eapa2 PE=2 SV=1 Length

Transformative Poetry : A Case Study of W.H. Auden's Musée des Beaux Arts And General Conclusions

NARCIS (Netherlands)

Sarot, Marcel

2016-01-01

This article situates Auden’s poem Musée des Beaux Arts in the process of his conversion to Christianity. The author argues for the layered intertextuality of the poem, in which allusions to Bruegel’s Landscape with the Fall of Icarus, The Census at Jerusalem, and The Massacre of the Innocents can

La stratégie numérique du musée de la Civilisation

OpenAIRE

Baz, Ana-Laura

2016-01-01

Après une description des orientations déployées dans la mise en œuvre de la stratégie numérique du musée de la Civilisation à Québec, l’auteur dresse un premier bilan de l’opération, de ses succès et de ses échecs, constatant que beaucoup reste à faire pour mesurer les retombées de cette stratégie sur la participation citoyenne et le comportement des internautes.

Corrected placement of Mus-Rattus fossil calibration forces precision in the molecular tree of rodents

OpenAIRE

Kimura, Yuri; Hawkins, Melissa T. R.; McDonough, Molly M.; Jacobs, Louis L.; Flynn, Lawrence J.

2015-01-01

Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly reco...

Astonishing advances in mouse genetic tools for biomedical research.

Science.gov (United States)

Kaczmarczyk, Lech; Jackson, Walker S

2015-01-01

The humble house mouse has long been a workhorse model system in biomedical research. The technology for introducing site-specific genome modifications led to Nobel Prizes for its pioneers and opened a new era of mouse genetics. However, this technology was very time-consuming and technically demanding. As a result, many investigators continued to employ easier genome manipulation methods, though resulting models can suffer from overlooked or underestimated consequences. Another breakthrough, invaluable for the molecular dissection of disease mechanisms, was the invention of high-throughput methods to measure the expression of a plethora of genes in parallel. However, the use of samples containing material from multiple cell types could obfuscate data, and thus interpretations. In this review we highlight some important issues in experimental approaches using mouse models for biomedical research. We then discuss recent technological advances in mouse genetics that are revolutionising human disease research. Mouse genomes are now easily manipulated at precise locations thanks to guided endonucleases, such as transcription activator-like effector nucleases (TALENs) or the CRISPR/Cas9 system, both also having the potential to turn the dream of human gene therapy into reality. Newly developed methods of cell type-specific isolation of transcriptomes from crude tissue homogenates, followed by detection with next generation sequencing (NGS), are vastly improving gene regulation studies. Taken together, these amazing tools simplify the creation of much more accurate mouse models of human disease, and enable the extraction of hitherto unobtainable data.

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

International Nuclear Information System (INIS)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E.

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied (α=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

Energy Technology Data Exchange (ETDEWEB)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied ({alpha}=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

Several classical mouse inbred strains, including DBA/2, NOD/Lt, FVB/N, and SJL/J, carry a putative loss-of-function allele of Gpr84.

Science.gov (United States)

Perez, Carlos J; Dumas, Aline; Vallières, Luc; Guénet, Jean-Louis; Benavides, Fernando

2013-01-01

G protein-coupled receptor 84 (GPR84) is a 7-transmembrane protein expressed on myeloid cells that can bind to medium-chain free fatty acids in vitro. Here, we report the discovery of a 2-bp frameshift deletion in the second exon of the Gpr84 gene in several classical mouse inbred strains. This deletion generates a premature stop codon predicted to result in a truncated protein lacking the transmembrane domains 4-7. We sequenced Gpr84 exon 2 from 58 strains representing different groups in the mouse family tree and found that 14 strains are homozygous for the deletion. Some of these strains are DBA/1J, DBA/2J, FVB/NJ, LG/J, MRL/MpJ, NOD/LtJ, and SJL/J. However, the deletion was not found in any of the wild-derived inbred strains analyzed. Haplotype analysis suggested that the deletion originates from a unique mutation event that occurred more than 100 years ago, preceding the development of the first inbred strain (DBA), from a Mus musculus domesticus source. As GPR84 ostensibly plays a role in the biology of myeloid cells, it could be relevant 1) to consider the existence of this Gpr84 nonsense mutation in several mouse strains when choosing a mouse model to study immune processes and 2) to consider reevaluating data obtained using such strains.

Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

Science.gov (United States)

Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

1984-03-26

The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic DNA methylation between sperm and oocyte DNA. The methylation levels of the minor satellite sequences did not change during spermiogenesis, and were not associated with the onset of meiosis or a specific stage in sperm development.

NCBI nr-aa BLAST: CBRC-OCUN-01-0928 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0928 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 1e-81 52% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0428 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 2e-82 51% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 7e-78 52% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0143 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0143 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 4e-85 55% ...

75 FR 4100 - Affirmative Fair Housing, Marketing (AFHM) Plan-Multifamily Housing, Affirmative Fair Housing...

Science.gov (United States)

2010-01-26

... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-01] Affirmative Fair Housing, Marketing (AFHM) Plan-Multifamily Housing, Affirmative Fair Housing Marketing (AFHM) Plan-Single Family Housing and Affirmative Fair Housing Marketing (AFHM) Plan- Cooperatives/Condominiums AGENCY: Office of...

Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš; Baird, S. J. E.; Munclinger, P.; Dufková, Petra; Bímová, Barbora; Piálek, Jaroslav

2008-01-01

Roč. 8, - (2008), s. 271-284 ISSN 1471-2148 R&D Projects: GA ČR GA206/06/0707; GA ČR GA206/06/0955; GA AV ČR IAA600930506; GA ČR GA206/08/0640 Grant - others:GA ČR(CZ) GP206/03/D148 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z60930519 Keywords : Mus musculus musculus * Mus musculus domesticus Subject RIV: EG - Zoology Impact factor: 4.050, year: 2008

A selfish genetic element influencing longevity correlates with reactive behavioural traits in female house mice (Mus domesticus.

Directory of Open Access Journals (Sweden)

Yannick Auclair

Full Text Available According to theory in life-history and animal personality, individuals with high fitness expectations should be risk-averse, while individuals with low fitness expectations should be more bold. In female house mice, a selfish genetic element, the t haplotype, is associated with increased longevity under natural conditions, representing an appropriate case study to investigate this recent theory empirically. Following theory, females heterozygous for the t haplotype (+/t are hypothesised to express more reactive personality traits and be more shy, less explorative and less active compared to the shorter-lived homozygous wildtype females (+/+. As males of different haplotype do not differ in survival, no similar pattern is expected. We tested these predictions by quantifying boldness, exploration, activity, and energetic intake in both +/t and +/+ mice. +/t females, unlike +/+ ones, expressed some reactive-like personality traits: +/t females were less active, less prone to form an exploratory routine and tended to ingest less food. Taken together these results suggest that differences in animal personality may contribute to the survival advantage observed in +/t females but fail to provide full empirical support for recent theory.

A geometric morphometric analysis of the shape of the first upper molar in mice of the genus Mus (Muridae, Rodentia)

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš

2006-01-01

Roč. 270, č. 4 (2006), s. 672-681 ISSN 0952-8369 R&D Projects: GA AV ČR IAA6045307 Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus * geometric morphometrics * thin-plate spline Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.413, year: 2006

NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa

AcEST: DK950692 [AcEST

Lifescience Database Archive (English)

Full Text Available |Q8VC52|RBPS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length ...ultiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Length = 197 Score = 77.0 bits (188), Expect = 8e-14 Ide...S_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score =

AcEST: DK958175 [AcEST

Lifescience Database Archive (English)

Full Text Available USE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 36...>sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Lengt... EEVRTLFVSGLPIDIKPRELYLLFRPFKGYE 47 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms

Functional organization of the genome may shape the species boundary in the house mouse

Czech Academy of Sciences Publication Activity Database

Janoušek, Václav; Munclinger, P.; Wang, L.; Teeter, K. C.; Tucker, P. K.

2015-01-01

Roč. 32, č. 5 (2015), s. 1208-1220 ISSN 0737-4038 R&D Projects: GA MŠk EE2.3.20.0303 Institutional support: RVO:68081766 Keywords : hybrid zone * mouse genome * speciation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 13.649, year: 2015

The genomic ancestry, landscape genetics and invasion history of introduced mice in New Zealand

Science.gov (United States)

Russell, James C.; King, Carolyn M.

2018-01-01

The house mouse (Mus musculus) provides a fascinating system for studying both the genomic basis of reproductive isolation, and the patterns of human-mediated dispersal. New Zealand has a complex history of mouse invasions, and the living descendants of these invaders have genetic ancestry from all three subspecies, although most are primarily descended from M. m. domesticus. We used the GigaMUGA genotyping array (approximately 135 000 loci) to describe the genomic ancestry of 161 mice, sampled from 34 locations from across New Zealand (and one Australian city—Sydney). Of these, two populations, one in the south of the South Island, and one on Chatham Island, showed complete mitochondrial lineage capture, featuring two different lineages of M. m. castaneus mitochondrial DNA but with only M. m. domesticus nuclear ancestry detectable. Mice in the northern and southern parts of the North Island had small traces (approx. 2–3%) of M. m. castaneus nuclear ancestry, and mice in the upper South Island had approximately 7–8% M. m. musculus nuclear ancestry including some Y-chromosomal ancestry—though no detectable M. m. musculus mitochondrial ancestry. This is the most thorough genomic study of introduced populations of house mice yet conducted, and will have relevance to studies of the isolation mechanisms separating subspecies of mice. PMID:29410804

Autonomous houses. Autonomous house

Energy Technology Data Exchange (ETDEWEB)

Tanaka, S. (Tokai University, Tokyo (Japan). Faculty of Engineering)

1991-09-30

Self-sufficiency type houses are outlined. On condition that people gain a certain amount of income in relation with the society, they self-suffice under the given environment, allowing themselves to accept a minimum of industrial products with small environmental load. Ordinary supply from outside of fossil energy and materials which depend on it is minimized. Types are classified into three: energy, energy materials and perfect self-sufficiency. A study project for environment symbiotic houses is progressing which is planned by the Ministry of Construction and Institute of Building Energy Conservation and is invested by a private company. Its target is making a house for halving an environmental load by CO{sub 2}, for the purpose of creating the environment symbiotic house which is nice to and in harmony with the global environment and human beings. As a part of the studies on energy-saving and resource conservation on houses, introduced is a plan of an autonomous house at Izu-Atagawa. The passive method and high thermal-insulation are used for air conditioning, and hot spring water for hot water supply. Electric power is generated by hydroelectric power generation using mountain streams and by solar cells. Staple food is purchased, while subsidiary food is sufficed. 17 refs., 4 figs., 1 tab.

Teratogenic effect of yogurt in mice fetus (Mus musculus

Directory of Open Access Journals (Sweden)

Dwisari Dillasamola

2018-04-01

Full Text Available Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control, 0.52 yogurt (D1, 1.04  yogurt (D2, and 2.08 g yogurt (D3. Data were analyzed using one-way ANOVA followed by Duncan multiple range test. Results showed that administration of yogurt during pregnancy could affect mother body weight of mice (P 0,05. Observations with Alizarin solution did not show skeletal defects in comparison to the control group. Observations with Bouin’s solution showed defective visceral cleft palate in fetal mice yogurt group D3. This study conclude that yogurt is safe to consume in groups D1 and D2. Yogurt has the potential to cause fetal teratogenic in group D3

SCORHE: a novel and practical approach to video monitoring of laboratory mice housed in vivarium cage racks.

Science.gov (United States)

Salem, Ghadi H; Dennis, John U; Krynitsky, Jonathan; Garmendia-Cedillos, Marcial; Swaroop, Kanchan; Malley, James D; Pajevic, Sinisa; Abuhatzira, Liron; Bustin, Michael; Gillet, Jean-Pierre; Gottesman, Michael M; Mitchell, James B; Pohida, Thomas J

2015-03-01

The System for Continuous Observation of Rodents in Home-cage Environment (SCORHE) was developed to demonstrate the viability of compact and scalable designs for quantifying activity levels and behavior patterns for mice housed within a commercial ventilated cage rack. The SCORHE in-rack design provides day- and night-time monitoring with the consistency and convenience of the home-cage environment. The dual-video camera custom hardware design makes efficient use of space, does not require home-cage modification, and is animal-facility user-friendly. Given the system's low cost and suitability for use in existing vivariums without modification to the animal husbandry procedures or housing setup, SCORHE opens up the potential for the wider use of automated video monitoring in animal facilities. SCORHE's potential uses include day-to-day health monitoring, as well as advanced behavioral screening and ethology experiments, ranging from the assessment of the short- and long-term effects of experimental cancer treatments to the evaluation of mouse models. When used for phenotyping and animal model studies, SCORHE aims to eliminate the concerns often associated with many mouse-monitoring methods, such as circadian rhythm disruption, acclimation periods, lack of night-time measurements, and short monitoring periods. Custom software integrates two video streams to extract several mouse activity and behavior measures. Studies comparing the activity levels of ABCB5 knockout and HMGN1 overexpresser mice with their respective C57BL parental strains demonstrate SCORHE's efficacy in characterizing the activity profiles for singly- and doubly-housed mice. Another study was conducted to demonstrate the ability of SCORHE to detect a change in activity resulting from administering a sedative.

[Effect of heterozygosity for insertions of homogeneously stained regions in chromosome 1 of the house mouse on synapsis in meiotic prophase].

Science.gov (United States)

Borodin, P M; Ladygina, T Iu; Gorlov, I P

1989-02-01

Electron microscope analysis of surface-spread synaptonemal complexes (SC) in oocytes and spermatocytes from double cis heterozygotes for Is(HSR; 1C5)1Icg and Is(HSR; 1E3)2Icg was carried out. Aberrant chromosomes were isolated from the feral population of Mus musculus musculus of Novosibirsk. They contain homogeneously stained regions of total length of about 30% of Chr 1 mitotic metaphase. Heteromorphic bivalents of Chr1 with different lengths of the lateral elements of SC and the loop in the intermedial position were revealed in 4.4% spermatocytes and 20% oocytes of heterozygous animals. The loop size depends on the stage of meiosis: it is maximal at late zygotene and decreases up to disappearance during pachytene.

AcEST: BP916012 [AcEST

Lifescience Database Archive (English)

Full Text Available ne... 29 6.4 sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus G... 29 6.4 sp|Q04447|KCRB_MOUSE Creatine... kinase B-type OS=Mus musculus GN=C... 29 6.4 sp|P05122|KCRB_CHICK Creatine kinase B-type OS=Gallu...N=ARSH... 29 6.4 sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Sch... 29 8.3 sp|P24722|KCRT_ONCMY Creatine...6 LESGFDAQSRTKLSDLS 36 +ES +D +++ D+S Sbjct: 119 IESKYDVHTKSVTVDVS 135 >sp|P07335|KCRB_RAT Creatine...DGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPV 198 >sp|Q04447|KCRB_MOUSE Creatine kinase B-type OS=Mus musculus GN=Ckb PE

Le corps numérique des données The Digital Body of Data: the Transfer of Artefact Fact Sheets from the Museum of Man to the Musée du quai Branly

Directory of Open Access Journals (Sweden)

Tiziana Nicoletta Beltrame

2012-05-01

Full Text Available Le transfert des collections extra-européennes du musée de l’Homme au musée du quai Branly implique le déplacement des informations documentaires sur les objets. Des différentes fiches en papier (de collection ou d’inventaire, descriptive de l’objet, méthodique créées et classées au sein des départements du musée de l’Homme, on passe à la fiche informatique « TMS objets » au musée du quai Branly. L’information ne change pas simplement de place et de matière, elle est reconfigurée dans de nouvelles articulations du savoir sur les collections. L’inventaire muséal est ici conçu comme le système qui matérialise un savoir structuré. Pour pouvoir analyser ce système, il faut mettre en relation les propriétés des documents et les modalités de leur classement dans un espace créé ad hoc. La matérialité des supports, les multiples possibilités de rangements et de création de liens (la mise en relations entre rubriques de la fiche informatique agissent sur le contenu des données et ouvrent ainsi de nouvelles voies pour la construction du savoir.The transfer of extra-European collections from the Museum of Man to the Musée du quai Branly involves the displacement of documentary information on the artefacts. The various paper files (on collections or inventory, descriptive of the object, methodological created and classified within different departments of the Museum of Man are being replaced by digital files, or “TMS objects”, at the Musée du quai Branly. The information is not simply changing its location and material, it is being reconfigured within new interconnections of knowledge on the collections. The museum inventory is here conceived as the system that materialises a structured knowledge. To be able to analyse this system, it is necessary to link the documents’ properties to the methods used to classify them in an ad hoc space. The materiality of the media, the multiple possibilities for

Innova House - Ottawa`s advanced house

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-01-31

A pilot program was developed to provide the housing industry with a means to field test innovative technologies, products and building systems, and to evaluate their overall performance. Under Canada`s Advanced House Program, ten demonstration houses were designed, built and monitored. Ottawa`s Innova House, was one of the ten houses built for this program. The innovative energy saving features of the house included (1) air distribution with small diameter ducts and an electronically commutated motor, a 2.6 kW grid-connected photovoltaic system, (3) an energy recovery ventilator (ERV) with free-cooling mode, (4) a 94 per cent efficient integrated gas heating and hot water system, (5) airtight drywall construction, (6) CFC-free exterior insulation, (7) a natural-gas-engine heat pump for air conditioning, (8) a prototype sealed combustion gas range and clothes dryer, and (9) a manifold plumbing system to conserve water. It was designed to consume one half of the energy consumed in an R-2000 home and one third of the energy of a conventional house. Several of the mechanical elements did not perform at expected levels, (lower than expected efficiencies from the heating and cooling systems and a malfunctioning ERV), nevertheless, overall performance of the house was still very close to the targets. The construction and operation of the house was described. tabs., figs.

Test of Fruit Extract Pare (Momordica charantia L.) to Quality of Ejaculated Spermatozoa Mice (Mus musculus L.)

Science.gov (United States)

Fifendy, M.; Indriati, G.

2018-04-01

Pare (Momordica charantia L.) can be used in the treatment of various diseases, such as influenza, cancer, anti-inflammatory, anti-HIV, antimitotic and antifertilitas. This study aimed to determine the effect of the herbal bitter (Momordica charantia L.) to ejaculated sperm quality mice (Mus musculus L.). This research was conducted using Completely Randomized Design (CRD) with 4 treatments and 6 replications, water and fed adlibitum. First treatment is given solvent extract. Second treatments extract were given 0.2 gram, third treatment were given 0.4 gram of extracts and fourth treatment were treated exstrac 0.6 gram were orally for 30 days. After the mice decapitated, dissected and take sperm from vas deferens. Then, the sperm preparation determined using the improved Neubauer. Data were analyzed by ANOVA (Analysis of Varians). The results shoured at doses of 0,2 gram, the average sperm count was 19.89. decrease significant when compared with the control in which the average number of sperm 29.13. So with this research the effective doses to decrease sperm count and can be used as a contraception medication dosage was 0,2 gram. It can be conclude that the extract of bitter (Momordica charantia L.) can decrease the quality of the ejaculated sperm of mice (Mus musculus L.)

Transcriptional signatures of BALB/c mouse macrophages housing multiplying Leishmania amazonensis amastigotes

Directory of Open Access Journals (Sweden)

Lang Thierry

2009-03-01

Full Text Available Abstract Background Mammal macrophages (MΦ display a wide range of functions which contribute to surveying and maintaining tissue integrity. One such function is phagocytosis, a process known to be subverted by parasites like Leishmania (L. Indeed, the intracellular development of L. amazonensis amastigote relies on the biogenesis and dynamic remodelling of a phagolysosome, termed the parasitophorous vacuole, primarily within dermal MΦ. Results Using BALB/c mouse bone marrow-derived MΦ loaded or not with amastigotes, we analyzed the transcriptional signatures of MΦ 24 h later, when the amastigote population was growing. Total RNA from MΦ cultures were processed and hybridized onto Affymetrix Mouse430_2 GeneChips®, and some transcripts were also analyzed by Real-Time quantitative PCR (RTQPCR. A total of 1,248 probe-sets showed significant differential expression. Comparable fold-change values were obtained between the Affymetrix technology and the RTQPCR method. Ingenuity Pathway Analysis software® pinpointed the up-regulation of the sterol biosynthesis pathway (p-value = 1.31e-02 involving several genes (1.95 to 4.30 fold change values, and the modulation of various genes involved in polyamine synthesis and in pro/counter-inflammatory signalling. Conclusion Our findings suggest that the amastigote growth relies on early coordinated gene expression of the MΦ lipid and polyamine pathways. Moreover, these MΦ hosting multiplying L. amazonensis amastigotes display a transcriptional profile biased towards parasite-and host tissue-protective processes.

Housing markets and housing policies in India

OpenAIRE

Tiwari, Piyush; Rao, Jyoti

2016-01-01

Issues of housing in India are synonymous with ignorance of housing in active government involvement at the policy and program formulation levels. They are also due to the problems that unplanned urbanization, income disparity, poverty, illiteracy, and unemployment brought. These issues extenuated the housing problem, causing a housing shortage of 51 million in 2011. Though India has a long history of establishing policies, programs, and institutions to cater to housing, without allocating ad...

AcEST: DK950341 [AcEST

Lifescience Database Archive (English)

Full Text Available FSCB_MOUSE Fibrous sheath CABYR-binding protein OS=Mus... 33 1.3 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin... OS=... 33 1.7 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.7 s

AcEST: DK944957 [AcEST

Lifescience Database Archive (English)

Full Text Available ant alignments: (bits) Value sp|Q82Y15|ORN_NITEU Oligoribonuclease OS=Nitrosomonas europaea G... 31 1.7 sp|Q9JLC8|SACS_MOUSE Sacsi...LVVTDAQLNTLAEAPVLVVHQPDDI 54 >sp|Q9JLC8|SACS_MOUSE Sacsin OS=Mus musculus GN=Sacs PE=1 SV=2 Length = 4582 Sc

24 CFR 982.608 - Congregate housing: Voucher housing assistance payment.

Science.gov (United States)

2010-04-01

... Housing Types Congregate Housing § 982.608 Congregate housing: Voucher housing assistance payment. (a... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Congregate housing: Voucher housing assistance payment. 982.608 Section 982.608 Housing and Urban Development Regulations Relating to Housing and...

Housing and Health: The relationship between housing conditions ...

African Journals Online (AJOL)

okanlawon

2011-10-22

Oct 22, 2011 ... Housing and Health: The relationship between housing ... The authors in chapter one, deal extensively with historical context of housing and health chronologically ... Housing and Health: Time Again for Public Health Action.

Transformative Poetry. A Case Study of W. H. Auden’s Musée Des Beaux Arts and General Conclusions

Directory of Open Access Journals (Sweden)

Sarot Marcel

2016-10-01

Full Text Available This article situates Auden’s poem Musée des Beaux Arts in the process of his conversion to Christianity. The author argues for the layered intertextuality of the poem, in which allusions to Bruegel’s Landscape with the Fall of Icarus, The Census at Jerusalem, and The Massacre of the Innocents can be recognised. Moreover, Philippe de Champaigne’s Presentation in the Temple and Peter Paul Rubens’s The Martyrdom of St Livinus (in the same museum in Brussels seem also to have influenced the poem. Finally, there is reason to suppose that John Singer Sargent’s Crashed Aeroplane influenced Auden. In an analysis of the structure of the poem, the author argues that there is a clear structure hidden under the surface of day-to-day language. He connects this hidden structure with Auden’s poem The Hidden Law, and suggests that Auden wished to claim that even though we cannot understand suffering, it has a hidden meaning known only to God. This hidden meaning connects our suffering with the self-emptying of Christ, a connection which the author demonstrates is in fact also made in Musée des Beaux Arts.

AcEST: DK956743 [AcEST

Lifescience Database Archive (English)

Full Text Available p|A1EGX6|FSCB_MOUSE Fibrous sheath CABYR-binding protein OS=Mus... 33 1.0 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synovioli...n OS=... 33 1.3 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=...

AcEST: DK957523 [AcEST

Lifescience Database Archive (English)

Full Text Available th CABYR-binding protein OS=Mus... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=...... 33 1.4 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Den

UniProt search blastx result: AK288448 [KOME

Lifescience Database Archive (English)

Full Text Available AK288448 J090034N14 P48545|IRK5_MOUSE G protein-activated inward rectifier potassiu...m channel 4 (GIRK4) (Potassium channel, inwardly rectifying subfamily J member 5) (Inward rectifier K(+) cha...nnel Kir3.4) (Heart KATP channel) (KATP-1) (Cardiac inward rectifier) (CIR) - Mus musculus (Mouse) 0 ...

City of Ljubljana: Its housing, population and housing conditions

Directory of Open Access Journals (Sweden)

Maša Filipovič

2007-01-01

Full Text Available The article gives an overview of key aspect of housing in Municipality of Ljubljana. The characteristics of households, of housing and their relation influence the housing situation in the city. Characteristic of housing refer mainly to quality of the dwellings, affordability and correspondence to the wishes of the inhabitants. The second important dimensions are households and their characteristics. In Europe and Slovenia increase in number of household can be observed, which in turn are becoming smaller. The housing policy has a role in establishing a balance between households and housing, i.e. ensuring that housing corresponds to the needs of individual households and to their number. For achieving this, knowledge and appropriate data are of vital importance. In the article we present the results of the Housing survey 2005. We observe housing conditions in a comparative perspective (Ljubljana in comparison to Maribor, Slovenia and selected European cities and according to three dimensions: housing fund, households and housing conditions.

No evidence of conpopulation sperm precedence between allopatric populations of house mice.

Directory of Open Access Journals (Sweden)

Renée C Firman

Full Text Available Investigations into the evolution of reproductive barriers have traditionally focused on closely related species, and the prevalence of conspecific sperm precedence. The effectiveness of conspecific sperm precedence at limiting gene exchange between species suggests that gametic isolation is an important component of reproductive isolation. However, there is a paucity of tests for evidence of sperm precedence during the earlier stages of divergence, for example among isolated populations. Here, we sourced individuals from two allopatric populations of house mice (Mus domesticus and performed competitive in vitro fertilisation assays to test for conpopulation sperm precedence specifically at the gametic level. We found that ova population origin did not influence the outcome of the sperm competitions, and thus provide no evidence of conpopulation or heteropopulation sperm precedence. Instead, we found that males from a population that had evolved under a high level of postcopulatory sexual selection consistently outcompeted males from a population that had evolved under a relatively lower level of postcopulatory sexual selection. We standardised the number of motile sperm of each competitor across the replicate assays. Our data therefore show that competitive fertilizing success was directly attributable to differences in sperm fertilizing competence.

No evidence of conpopulation sperm precedence between allopatric populations of house mice.

Science.gov (United States)

Firman, Renée C; Simmons, Leigh W

2014-01-01

Investigations into the evolution of reproductive barriers have traditionally focused on closely related species, and the prevalence of conspecific sperm precedence. The effectiveness of conspecific sperm precedence at limiting gene exchange between species suggests that gametic isolation is an important component of reproductive isolation. However, there is a paucity of tests for evidence of sperm precedence during the earlier stages of divergence, for example among isolated populations. Here, we sourced individuals from two allopatric populations of house mice (Mus domesticus) and performed competitive in vitro fertilisation assays to test for conpopulation sperm precedence specifically at the gametic level. We found that ova population origin did not influence the outcome of the sperm competitions, and thus provide no evidence of conpopulation or heteropopulation sperm precedence. Instead, we found that males from a population that had evolved under a high level of postcopulatory sexual selection consistently outcompeted males from a population that had evolved under a relatively lower level of postcopulatory sexual selection. We standardised the number of motile sperm of each competitor across the replicate assays. Our data therefore show that competitive fertilizing success was directly attributable to differences in sperm fertilizing competence.

Energy house - dream house

Energy Technology Data Exchange (ETDEWEB)

1981-07-01

An energy house a prefabricated house with an extensive minimization of heat losses, is air-conditioned by means of a combined heating system consisting of hot water cycle and recirculating heating. The energy system is trivalent: wind power, solar energy with heat pumps and normal oil heating.

Female partner preferences enhance offspring ability to survive an infection.

Science.gov (United States)

Raveh, Shirley; Sutalo, Sanja; Thonhauser, Kerstin E; Thoß, Michaela; Hettyey, Attila; Winkelser, Friederike; Penn, Dustin J

2014-01-23

It is often suggested that mate choice enhances offspring immune resistance to infectious diseases. To test this hypothesis, we conducted a study with wild-derived house mice (Mus musculus musculus) in which females were experimentally mated either with their preferred or non-preferred male, and their offspring were infected with a mouse pathogen, Salmonella enterica (serovar Typhimurium). We found that offspring sired by preferred males were significantly more likely to survive the experimental infection compared to those sired by non-preferred males. We found no significant differences in the pathogen clearance or infection dynamics between the infected mice, suggesting that offspring from preferred males were better able to cope with infection and had improved tolerance rather than immune resistance. Our results provide the first direct experimental evidence within a single study that partner preferences enhance offspring resistance to infectious diseases.

Lack of evidence that the XqYq pairing tips at meiosis in the mouse show hypersensitivity to DNAse I.

Science.gov (United States)

Separovic, E R; Chandley, A C

1987-01-01

In situ nick translation procedures have been applied to meiotic metaphase I divisions of the normal and XY, Sxr mouse. Unlike in man, where the pairing tips of the XY bivalent show a special sensitivity to DNAse I nicking, no such sensitivity can be detected for either of these types of mouse. Hypersensitivity in the D-band equivalent region of the X chromosome does, however, exist, this site being early replicating in somatic cells and housing the X inactivation centre (Xce).

Embryo quality of mice (“Mus musculus” fed royal jelly Qualidade embrionária de camundongos ("Mus musculus" suplementados com geléia real

Directory of Open Access Journals (Sweden)

Bruno Edésio dos Santos Melo

2009-03-01

Full Text Available The study was carried out to verify the effect of feeding royal jelly associated to follicle growth induction on number and quality of mice (Mus musculus embryos. Sixty Swiss females ageing from eight to ten weeks were distributed into three treatments: the first one, composed by animals fed 0.2 mL of physiological solution intraperitoneal (control group, n=20; the second and third ones, composed by females fed 0.5 and 1.0 mg of royal jelly diluted in 0.2 mL of physiological solution (n=20, respectively. Royal jelly was administered during 15 days, followed by the follicular growth induction process. Embryos were collected 68 hours after mating, by uterine flushing. No treatment effects on the number of females that answered to superovulatory process, the number of total recovery structures, the number of viable and non viable structures and the morphological quality of viable embryos (P>0.05 were observed. Therefore, royal jelly doses used were not efficient to increase the number of embryos and to improve the quality recovery from superovulated mice.Objetivou-se verificar a influência da geléia real, associada ao tratamento de indução de crescimento folicular, no número e na qualidade de embriões de camundongos (Mus musculus. Foram utilizadas 60 fêmeas da linhagem Suíço albino com idade entre oito e dez semanas, distribuídas em três tratamentos: o primeiro, composto por animais que receberam 0,2 mL de solução fisiológica, via intraperitonial (grupo controle, n=20; o segundo e terceiro, compostos de fêmeas que receberam 0,5 e 1 mg de geléia real diluídos em 0,2 mL de solução fisiológica via intraperitonial (n=20, respectivamente. Foi administrada geléia real por um período de 15 dias, segundo o processo de indução do crescimento folicular. As coletas dos embriões ocorreram 68 horas após a cobertura, utilizando-se o método da lavagem uterina. Não houve diferença no número de fêmeas que responderam ao tratamento

AcEST: DK951433 [AcEST

Lifescience Database Archive (English)

Full Text Available 6e-22 sp|Q9LM18|FB303_ARATH F-box protein At1g22220 OS=Arabidopsis tha... 100 1e-20 sp|O35902|DSG3_MOUSE Desmog...VGDCMYGEAVVALLKCKKNALEMNSF 314 >sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 Length =

denV gene of bacteriophage T4 restores DNA excision repair to mei-9 and mus201 mutants of Drosophila melanogaster

International Nuclear Information System (INIS)

Banga, S.S.; Boyd, J.B.; Valerie, K.; Harris, P.V.; Kurz, E.M.; de Riel, J.K.

1989-01-01

The denV gene of bacteriophage T4 was fused to a Drosophila hsp70 (70-kDa heat shock protein) promoter and introduced into the germ line of Drosophila by P-element-mediated transformation. The protein product of that gene (endonuclease V) was detected in extracts of heat-shocked transformants with both enzymological and immunoblotting procedures. That protein restores both excision repair and UV resistance to mei-9 and mus201 mutants of this organism. These results reveal that the denV gene can compensate for excision-repair defects in two very different eukayotic mutants, in that the mus201 mutants are typical of excision-deficient mutants in other organisms, whereas the mei-9 mutants exhibit a broad pleiotropism that includes a strong meiotic deficiency. This study permits an extension of the molecular analysis of DNA repair to the germ line of higher eukaryotes. It also provides a model system for future investigations of other well-characterized microbial repair genes on DNA damage in the germ line of this metazoan organism

[Musical Inactivity - A Risk Factor? A Short Questionnaire to Assess Musical Activity (MusA)].

Science.gov (United States)

Fernholz, Isabel; Menzel, Juliane; Jabusch, Hans-Christian; Gembris, Heiner; Fischer, Felix; Kendel, Friederike; Kreutz, Gunter; Schmidt, Alexander; Willich, Stefan N; Weikert, Cornelia

2018-02-27

There is only a limited number of studies on associations between musical activity and health issues. It seems that musical activity has physiological and psychological benefits, as well as effects on the mental capacity, but this has been studied only in a few clinical and epidemiological studies. One reason might be that no appropriate survey instrument assessing musical activity is available. Here we provide an overview of survey instruments that assess musicality and musical activity. One focus is the presentation of a newly developed German questionnaire (MusA), which assesses musical activity (active music making and music reception) and was specifically developed for the "German National Cohort", a German health study. Through literature research, questionnaires were identified that assess musicality and / or musical activity. A new German questionnaire was developed from a panel of experts and tested in a small study (n=121, women and men age 18-70 years). In the literature research, 3 questionnaires were identified which focus on musicality and musical activity with different aspects (Gold-MSI, MUSE, MEQ). All 3 instruments may be characterized as large psychometric scales, which especially assess aspects of musicality in the English language. The Gold-MSI is additionally available in German. None of the existing questionnaires covers musical activities in detail. A new short German questionnaire consisting of 9 questions with a maximum filling time of 3-5 min has been developed. There are few questionnaires available for assessing musicality and musical activity with different aspects. The newly developed MusA in the German language focuses on the assessment of musical activity and is intended to be used in larger, population-based as well as clinical studies, to examine music activities and listening to music as independent factors in connection with prevention and therapy of chronic diseases. © Georg Thieme Verlag KG Stuttgart · New York.

Mouse consomic strains: Exploiting genetic divergence between Mus m. musculus and Mus m. domesticus subspecies

Czech Academy of Sciences Publication Activity Database

Gregorová, Soňa; Divina, Petr; Storchová, Radka; Trachtulec, Zdeněk; Fotopulosová, Vladana; Svenson, K.L.; Donahue, K.L.; Paigen, B.; Forejt, Jiří

2008-01-01

Roč. 18, č. 3 (2008), s. 509-515 ISSN 1088-9051 R&D Projects: GA MŠk(CZ) 1M0520; GA ČR(CZ) GA301/07/1264 Grant - others:HHMI(US) HHMI55000306; NIH(US) 1R01HG00318; EC(XE) AnEUploidy 037627 Institutional research plan: CEZ:AV0Z50520514 Keywords : complex trait loci (QTLs) * chromosome substitution strains * PWD/Ph Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 10.176, year: 2008

NCBI nr-aa BLAST: CBRC-STRI-01-2691 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2691 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-74 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2568 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2568 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-49 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2291 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2291 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-79 50% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0474 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-81 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0722 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0722 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-65 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2741 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2741 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-83 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2574 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2574 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 2e-85 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0161 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0161 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 3e-84 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2502 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2502 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-70 49% ...

The loss of imprinted DNA methylation in mouse blastocysts is inflicted to a similar extent by in vitro follicle culture and ovulation induction.

Science.gov (United States)

Saenz-de-Juano, M D; Billooye, K; Smitz, J; Anckaert, E

2016-06-01

Does in vitro follicle culture (IFC) have an effect on maintenance of imprinted DNA methylation in preimplantation mouse embryos? We report similar alterations in the methylation pattern of H19 imprinted maternally expressed transcript (H19), small nuclear ribonucleoprotein polypeptide N (Snrpn) and mesoderm specific transcript (Mest) imprinted genes in mouse blastocysts obtained after ovulation induction and IFC. Furthermore, we observed no differences in the gene expression of maternal effect proteins related with imprinting maintenance between superovulated in vivo grown or IFC oocytes. Assisted reproductive technology is associated with adverse post-natal outcomes such as increased risk of premature birth, altered birthweight, congenital anomalies and genomic imprinting syndromes in human and in animal models. Previous studies have shown that ovulation induction allowed normal imprinting establishment in mouse oocytes, but interfered with imprinting maintenance during preimplantation . Normal imprinting establishment was also observed in mouse oocytes derived from a standardized IFC from the early pre-antral follicle stage. The methylation profiles of differentially methylated regions (DMRs) of three key imprinted genes (H19, Snrpn and Mest) were compared at hatched blastocyst stage between embryos obtained from IFC or superovulated oocytes, each subjected to IVF and preimplantation in vitro culture (IVC); in non-manipulated in vivo produced late blastocyst (control) and in in vivo produced 2-cell embryos that were in vitro cultured until the hatched blastocyst stage (to assess the effect of IVC). Two different mice strains (Mus musculus C57BL/6J X CBA/Ca and Mus musculus B6 (CAST7)) were used to discriminate between maternal and paternal alleles of imprinted genes. Additionally, a limiting-dilution bisulfite-sequencing technique was carried out on individual embryos in order to avoid amplification bias. To assess whether IFC and ovulation induction

Two Predicted Transmembrane Domains Exclude Very Long Chain Fatty acyl-CoAs from the Active Site of Mouse Wax Synthase.

Directory of Open Access Journals (Sweden)

Steffen Kawelke

Full Text Available Wax esters are used as coatings or storage lipids in all kingdoms of life. They are synthesized from a fatty alcohol and an acyl-CoA by wax synthases. In order to get insights into the structure-function relationships of a wax synthase from Mus musculus, a domain swap experiment between the mouse acyl-CoA:wax alcohol acyltransferase (AWAT2 and the homologous mouse acyl-CoA:diacylglycerol O-acyltransferase 2 (DGAT2 was performed. This showed that the substrate specificity of AWAT2 is partially determined by two predicted transmembrane domains near the amino terminus of AWAT2. Upon exchange of the two domains for the respective part of DGAT2, the resulting chimeric enzyme was capable of incorporating up to 20% of very long acyl chains in the wax esters upon expression in S. cerevisiae strain H1246. The amount of very long acyl chains in wax esters synthesized by wild type AWAT2 was negligible. The effect was narrowed down to a single amino acid position within one of the predicted membrane domains, the AWAT2 N36R variant. Taken together, we provide first evidence that two predicted transmembrane domains in AWAT2 are involved in determining its acyl chain length specificity.

Chronic Co-species Housing Mice and Rats Increased the Competitiveness of Male Mice.

Science.gov (United States)

Liu, Ying-Juan; Li, Lai-Fu; Zhang, Yao-Hua; Guo, Hui-Fen; Xia, Min; Zhang, Meng-Wei; Jing, Xiao-Yuan; Zhang, Jing-Hua; Zhang, Jian-Xu

2017-03-01

Rats are predators of mice in nature. Nevertheless, it is a common practice to house mice and rats in a same room in some laboratories. In this study, we investigated the behavioral and physiological responsively of mice in long-term co-species housing conditions. Twenty-four male mice were randomly assigned to their original raising room (control) or a rat room (co-species-housed) for more than 6 weeks. In the open-field and light-dark box tests, the behaviors of the co-species-housed mice and controls were not different. In a 2-choice test of paired urine odors [rabbit urine (as a novel odor) vs. rat urine, cat urine (as a natural predator-scent) vs. rabbit urine, and cat urine vs. rat urine], the co-species-housed mice were more ready to investigate the rat urine odor compared with the controls and may have adapted to it. In an encounter test, the rat-room-exposed mice exhibited increased aggression levels, and their urines were more attractive to females. Correspondingly, the levels of major urinary proteins were increased in the co-species-housed mouse urine, along with some volatile pheromones. The serum testosterone levels were also enhanced in the co-species-housed mice, whereas the corticosterone levels were not different. The norepinephrine, dopamine, and 5-HT levels in the right hippocampus and striatum were not different between the 2. Our findings indicate that chronic co-species housing results in adaptation in male mice; furthermore, it appears that long-term rat-odor stimuli enhance the competitiveness of mice, which suggests that appropriate predator-odor stimuli may be important to the fitness of prey animals. © The Author 2017. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

INFRARED SPECTROSCOPY OF SYMBIOTIC STARS. XI. ORBITS FOR SOUTHERN S-TYPE SYSTEMS: HEN 3-461, SY MUS, HEN 3-828, AND AR PAV

International Nuclear Information System (INIS)

Fekel, Francis C.; Hinkle, Kenneth H.; Joyce, Richard R.; Wood, Peter R.

2017-01-01

Employing new infrared radial velocities, we have computed spectroscopic orbits of the cool giants in four southern S-type symbiotic systems. The orbits for two of the systems, Hen 3-461 and Hen 3-828, have been determined for the first time, while orbits of the other two, SY Mus and AR Pav, have previously been determined. For the latter two systems, we compare our results with those in the literature. The low mass of the secondary of SY Mus suggests that it has gone through a common envelope phase. Hen 3-461 has an orbital period of 2271 days, one of the longest currently known for S-type symbiotic systems. That period is very different from the orbital period proposed previously from its photometric variations. The other three binaries have periods between 600 and 700 day, values that are typical for S-type symbiotic orbits. Basic properties of the M giant components and the distance to each system are determined.

NCBI nr-aa BLAST: CBRC-RNOR-08-0336 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-08-0336 ref|NP_666341.1| dynein cytoplasmic 1 light intermediate chain 1 ...[Mus musculus] sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 (Dynein light intermedia...te chain 1, cytosolic) (Dynein light chain A) (DLC-A) gb|AAH23347.1| Dynein cytoplasmic 1 light intermediat...b|EDL09299.1| dynein cytoplasmic 1 light intermediate chain 1 [Mus musculus] NP_666341.1 1e-137 63% ...

Open-field behavior of house mice selectively bred for high voluntary wheel-running.

Science.gov (United States)

Bronikowski, A M; Carter, P A; Swallow, J G; Girard, I A; Rhodes, J S; Garland, T

2001-05-01

Open-field behavioral assays are commonly used to test both locomotor activity and emotionality in rodents. We performed open-field tests on house mice (Mus domesticus) from four replicate lines genetically selected for high voluntary wheel-running for 22 generations and from four replicate random-bred control lines. Individual mice were recorded by video camera for 3 min in a 1-m2 open-field arena on 2 consecutive days. Mice from selected lines showed no statistical differences from control mice with respect to distance traveled, defecation, time spent in the interior, or average distance from the center of the arena during the trial. Thus, we found little evidence that open-field behavior, as traditionally defined, is genetically correlated with wheel-running behavior. This result is a useful converse test of classical studies that report no increased wheel-running in mice selected for increased open-field activity. However, mice from selected lines turned less in their travel paths than did control-line mice, and females from selected lines had slower travel times (longer latencies) to reach the wall. We discuss these results in the context of the historical open-field test and newly defined measures of open-field activity.

7 CFR 1944.664 - Housing preservation and replacement housing assistance.

Science.gov (United States)

2010-01-01

... 7 Agriculture 13 2010-01-01 2009-01-01 true Housing preservation and replacement housing...) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE (CONTINUED) PROGRAM REGULATIONS (CONTINUED) HOUSING Housing...

The Effect of Curry Leaves (Murayya Koenigii L. on Blood Glucose Levels In Alloxan Diabetic Mice (Mus Musculus

Directory of Open Access Journals (Sweden)

Fauziah Fauziah

2014-07-01

Full Text Available This study was conducted to determine the effect of ethanol extract of curry leaves (Murraya koenigii L. on blood glucose levels in alloxan diabetic mice (Mus musculus. The diabetic conditions were made by giving alloxan 75 mg/kg body weight (BW and the hypoglycemic effects of extract of curry leaves given with various doses.   This study used 24 male mice strain Balb/c in four groups of treatment with six replications, namely the negative control group, the ethanol extract of curry leaf tree 50% mL/10g body weight group, 70% mL/10g body weight group and 90% mL/10g body weight group. The treatment was given orally by using a gastric sonde for 14 days. Blood samples were taken through the sinus caudalis using a scissors. Blood glucose level was measured at 1st , the 8th and the 24th of treatment using blood glucose test strips and Nesco® Multicheck apparatus. Blood glucose data were analyzed by one way ANOVA (Analysis of Variants and followed by Tuckey test at significance level of 5%. The result showed that treatment of ethanol extract of curry leaves (Murraya koenigii at various doses significantly affected the decrease on blood glucose levels of mice (Mus musculus alloxan diabetic.

PRDM9 drives evolutionary erosion of hotspots in Mus musculus through haplotype-specific initiation of meiotic recombination.

Science.gov (United States)

Baker, Christopher L; Kajita, Shimpei; Walker, Michael; Saxl, Ruth L; Raghupathy, Narayanan; Choi, Kwangbom; Petkov, Petko M; Paigen, Kenneth

2015-01-01

Meiotic recombination generates new genetic variation and assures the proper segregation of chromosomes in gametes. PRDM9, a zinc finger protein with histone methyltransferase activity, initiates meiotic recombination by binding DNA at recombination hotspots and directing the position of DNA double-strand breaks (DSB). The DSB repair mechanism suggests that hotspots should eventually self-destruct, yet genome-wide recombination levels remain constant, a conundrum known as the hotspot paradox. To test if PRDM9 drives this evolutionary erosion, we measured activity of the Prdm9Cst allele in two Mus musculus subspecies, M.m. castaneus, in which Prdm9Cst arose, and M.m. domesticus, into which Prdm9Cst was introduced experimentally. Comparing these two strains, we find that haplotype differences at hotspots lead to qualitative and quantitative changes in PRDM9 binding and activity. Using Mus spretus as an outlier, we found most variants affecting PRDM9Cst binding arose and were fixed in M.m. castaneus, suppressing hotspot activity. Furthermore, M.m. castaneus×M.m. domesticus F1 hybrids exhibit novel hotspots, with large haplotype biases in both PRDM9 binding and chromatin modification. These novel hotspots represent sites of historic evolutionary erosion that become activated in hybrids due to crosstalk between one parent's Prdm9 allele and the opposite parent's chromosome. Together these data support a model where haplotype-specific PRDM9 binding directs biased gene conversion at hotspots, ultimately leading to hotspot erosion.

Automated MicroSPECT/MicroCT Image Analysis of the Mouse Thyroid Gland.

Science.gov (United States)

Cheng, Peng; Hollingsworth, Brynn; Scarberry, Daniel; Shen, Daniel H; Powell, Kimerly; Smart, Sean C; Beech, John; Sheng, Xiaochao; Kirschner, Lawrence S; Menq, Chia-Hsiang; Jhiang, Sissy M

2017-11-01

The ability of thyroid follicular cells to take up iodine enables the use of radioactive iodine (RAI) for imaging and targeted killing of RAI-avid thyroid cancer following thyroidectomy. To facilitate identifying novel strategies to improve 131 I therapeutic efficacy for patients with RAI refractory disease, it is desired to optimize image acquisition and analysis for preclinical mouse models of thyroid cancer. A customized mouse cradle was designed and used for microSPECT/CT image acquisition at 1 hour (t1) and 24 hours (t24) post injection of 123 I, which mainly reflect RAI influx/efflux equilibrium and RAI retention in the thyroid, respectively. FVB/N mice with normal thyroid glands and TgBRAF V600E mice with thyroid tumors were imaged. In-house CTViewer software was developed to streamline image analysis with new capabilities, along with display of 3D voxel-based 123 I gamma photon intensity in MATLAB. The customized mouse cradle facilitates consistent tissue configuration among image acquisitions such that rigid body registration can be applied to align serial images of the same mouse via the in-house CTViewer software. CTViewer is designed specifically to streamline SPECT/CT image analysis with functions tailored to quantify thyroid radioiodine uptake. Automatic segmentation of thyroid volumes of interest (VOI) from adjacent salivary glands in t1 images is enabled by superimposing the thyroid VOI from the t24 image onto the corresponding aligned t1 image. The extent of heterogeneity in 123 I accumulation within thyroid VOIs can be visualized by 3D display of voxel-based 123 I gamma photon intensity. MicroSPECT/CT image acquisition and analysis for thyroidal RAI uptake is greatly improved by the cradle and the CTViewer software, respectively. Furthermore, the approach of superimposing thyroid VOIs from t24 images to select thyroid VOIs on corresponding aligned t1 images can be applied to studies in which the target tissue has differential radiotracer retention

Understanding Housing Delays and Relocations Within the Housing First Model.

Science.gov (United States)

Zerger, Suzanne; Pridham, Katherine Francombe; Jeyaratnam, Jeyagobi; Hwang, Stephen W; O'Campo, Patricia; Kohli, Jaipreet; Stergiopoulos, Vicky

2016-01-01

This study explores factors contributing to delays and relocations during the implementation of the Housing First model in Toronto, Ontario. While interruptions in housing tenure are expected en route to recovery and housing stability, consumer and service provider views on finding and keeping housing remain largely unknown. In-person interviews and focus groups were conducted with 48 study participants, including 23 case managers or housing workers and 25 consumers. The following three factors contributed to housing delays and transfers: (1) the effectiveness of communication and collaboration among consumers and service providers, (2) consumer-driven preferences and ambivalence, and (3) provider prioritization of consumer choice over immediate housing access. Two strategies--targeted communications and consumer engagement in housing searches--supported the housing process. Several factors affect the timing and stability of housing. Communication between and among providers and consumers, and a shared understanding of consumer choice, can further support choice and recovery.

Experiment list: SRX655691 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblast || ge...notype/variation=MED23 knockout || chip antibody=H2Bub http://dbarchive.bioscienc

Experiment list: SRX191071 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Mus musculus; ChIP-Seq source_name=Kdm2b knockdown mouse ES cells || chip antibody=Flag || antibody manufact... || cell type=embryonbic stem cells || genotype=Kdm2b knockdown http://dbarchive.

Housing management and maintenance practise of Dutch housing associations

NARCIS (Netherlands)

Straub, A.

This paper summarises the state-of-the-art in housing management and maintenance practise of Dutch housing associations based on a survey conducted among almost all housing associations. We address the question what the current developments are in housing management and maintenance practice in the

24 CFR 92.252 - Qualification as affordable housing: Rental housing.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Qualification as affordable housing: Rental housing. 92.252 Section 92.252 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development HOME INVESTMENT PARTNERSHIPS PROGRAM Project Requirements § 92.252...

24 CFR 8.28 - Housing certificate and housing voucher programs.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Housing certificate and housing voucher programs. 8.28 Section 8.28 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION BASED ON HANDICAP IN FEDERALLY ASSISTED PROGRAMS AND...

The Sycp1 loci of the mouse genome: successive retropositions of a meiotic gene during the recent evolution of the genus.

Science.gov (United States)

Sage, J; Yuan, L; Martin, L; Mattei, M G; Guénet, J L; Liu, J G; Hoög, C; Rassoulzadegan, M; Cuzin, F

1997-08-15

The murine Sycp1 gene is expressed at the early stages of meiosis. We show that it is composed of a number of small exons and localized on mouse chromosome 3. In the laboratory strains, two retrogenes were also identified. The first one (Sycp1-ps1), on chromosome 7, has accumulated point mutations and deletions and is not transcribed. A second retrogene (Sycp1-ps2), on chromosome 8, is inserted within the continuity of a moderately repeated element, in an intron of another gene (Cad11). The two retroposition events can be dated to distinct periods in the evolution of the Muridae. Sycp1-ps2 has kept features indicative of a relatively recent origin, namely a nearly intact coding region, a poly(A) tail, and 14-bp terminal repeats. Its recent origin was confirmed by the fact that it is found in all the laboratory strains of mice, but neither in a recent isolate from Mus musculus domesticus wild stocks nor in the closely related subspecies M. musculus musculus, M. m. molossinus, M. m. castaneus, and M. m. bactrianus. Appearance of the more ancient Sycp1-ps1 retrogene is concomitant with the radiation of the genus. It is present in various Mus species (M. spretus, M. spicilegus, M. macedonicus, and M. cookii), but neither in the rat nor in the more closely related Pyromis genus. Transposition of retrotranscripts during meiosis and their hereditary establishment thus appear to occur relatively frequently. They may, therefore, play a significant role in the evolutionary process.

White House Office of the Vice President Announces New Memorandum of Understanding in Clinical Proteogenomics Between the United States and Australia | Office of Cancer Clinical Proteomics Research

Science.gov (United States)

The White House Office of the Vice President has announced the signing of three Memoranda of Understanding (MOUs) that will make available an unprecedented international dataset to advance cancer research and care.

Experiment list: SRX655693 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ut KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fib...roblast || genotype/variation=MED23 knockout http://dbarchive.biosciencedbc.jp/ky

Combinatorial regulation of meiotic holliday junction resolution in C. elegans by HIM-6 (BLM) helicase, SLX-4, and the SLX-1, MUS-81 and XPF-1 nucleases.

Science.gov (United States)

Agostinho, Ana; Meier, Bettina; Sonneville, Remi; Jagut, Marlène; Woglar, Alexander; Blow, Julian; Jantsch, Verena; Gartner, Anton

2013-01-01

Holliday junctions (HJs) are cruciform DNA structures that are created during recombination events. It is a matter of considerable importance to determine the resolvase(s) that promote resolution of these structures. We previously reported that C. elegans GEN-1 is a symmetrically cleaving HJ resolving enzyme required for recombinational repair, but we could not find an overt role in meiotic recombination. Here we identify C. elegans proteins involved in resolving meiotic HJs. We found no evidence for a redundant meiotic function of GEN-1. In contrast, we discovered two redundant HJ resolution pathways likely coordinated by the SLX-4 scaffold protein and also involving the HIM-6/BLM helicase. SLX-4 associates with the SLX-1, MUS-81 and XPF-1 nucleases and has been implicated in meiotic recombination in C. elegans. We found that C. elegans [mus-81; xpf-1], [slx-1; xpf-1], [mus-81; him-6] and [slx-1; him-6] double mutants showed a similar reduction in survival rates as slx-4. Analysis of meiotic diakinesis chromosomes revealed a distinct phenotype in these double mutants. Instead of wild-type bivalent chromosomes, pairs of "univalents" linked by chromatin bridges occur. These linkages depend on the conserved meiosis-specific transesterase SPO-11 and can be restored by ionizing radiation, suggesting that they represent unresolved meiotic HJs. This suggests the existence of two major resolvase activities, one provided by XPF-1 and HIM-6, the other by SLX-1 and MUS-81. In all double mutants crossover (CO) recombination is reduced but not abolished, indicative of further redundancy in meiotic HJ resolution. Real time imaging revealed extensive chromatin bridges during the first meiotic division that appear to be eventually resolved in meiosis II, suggesting back-up resolution activities acting at or after anaphase I. We also show that in HJ resolution mutants, the restructuring of chromosome arms distal and proximal to the CO still occurs, suggesting that CO initiation

24 CFR 982.617 - Shared housing: Rent and voucher housing assistance payment.

Science.gov (United States)

2010-04-01

... Special Housing Types Shared Housing § 982.617 Shared housing: Rent and voucher housing assistance payment... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Shared housing: Rent and voucher housing assistance payment. 982.617 Section 982.617 Housing and Urban Development Regulations Relating to...

Assisted Housing - Public Housing Authorities - National Geospatial Data Asset (NGDA)

Data.gov (United States)

Department of Housing and Urban Development — Public Housing was established to provide decent and safe rental housing for eligible low-income families, the elderly, and persons with disabilities. Public housing...

Model of chromosome associations in Mus domesticus spermatocytes

Directory of Open Access Journals (Sweden)

Soledad Berríos

2010-01-01

Full Text Available Understanding the spatial organization of the chromosomes in meiotic nuclei is crucial to our knowledge of the genome's functional regulation, stability and evolution. This study examined the nuclear architecture of Mus domesticus 2n=40 pachytene spermatocytes, analyzing the associations among autosomal bivalents via their Centromere Telomere Complexes (CTC. The study developed a nuclear model in which each CTC was represented as a 3D computer object. The probability of a given combination of associations among CTC was estimated by simulating a random distribution of 19 indistinguishable CTC over n indistinguishable "cells" on the nuclear envelope. The estimated association frequencies resulting from this numerical approach were similar to those obtained by quantifying actual associations in pachytene spermatocyte spreads. The nuclear localization and associations of CTC through the meiotic prophase in well-preserved nuclei were also analyzed. We concluded that throughout the meiotic prophase: 1 the CTC of autosomal bivalents are not randomly distributed in the nuclear space; 2 the CTC associate amongst themselves, probably at random, over a small surface of the nuclear envelope, at the beginning of the meiotic prophase; 3 the initial aggregation of centromere regions occurring in lepto-zygotene likely resolves into several smaller aggregates according to patterns of preferential partitioning; 4 these smaller aggregates spread over the inner face of the nuclear envelope, remaining stable until advanced stages of the meiotic prophase or even until the first meiotic division.

Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

Science.gov (United States)

Flachs, Petr; Bhattacharyya, Tanmoy; Mihola, Ondřej; Piálek, Jaroslav; Forejt, Jiří; Trachtulec, Zdenek

2014-01-01

PR-domain 9 (Prdm9) is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain) and the Hstx2 region of chromosome (Chr) X from M. m. musculus (Mmm; the PWD strain) participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6)F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6)F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6)F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6)F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

Directory of Open Access Journals (Sweden)

Petr Flachs

Full Text Available PR-domain 9 (Prdm9 is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain and the Hstx2 region of chromosome (Chr X from M. m. musculus (Mmm; the PWD strain participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

Housing culture

DEFF Research Database (Denmark)

Roesdahl, Else; Scholkmann, Barbara

2007-01-01

On houses and their furniture and fittings, and on the study of this - with a comparison of rural, urban, monastic and aristocratic housing, and a special section on heating technologies.......On houses and their furniture and fittings, and on the study of this - with a comparison of rural, urban, monastic and aristocratic housing, and a special section on heating technologies....

NCBI nr-aa BLAST: CBRC-STRI-01-2626 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2626 sp|Q8VBS7|VN1A6_MOUSE RecName: Full=Vomeronasal type-1 receptor A...6; AltName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A1; AltName: Full=Vomeronasa...l type-1 receptor A10 dbj|BAB79209.1| vomeronasal receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasa...l receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasal receptor V1RA10

Aggression and commensalism in house mouse: a comparative study across Europe and the Near East

Czech Academy of Sciences Publication Activity Database

Frynta, D.; Slábová, M.; Váchová, H.; Volfová, R.; Munclinger, Pavel

2005-01-01

Roč. 31, - (2005), s. 283-293 ISSN 0096-140X R&D Projects: GA ČR GA206/01/0989; GA ČR GP206/03/D148; GA AV ČR IAA6111410 Institutional research plan: CEZ:AV0Z50450515 Keywords : agonistic behaviour * wild mouse * hybrid zone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.112, year: 2005

Age-associated metabolic and morphologic changes in mitochondria of individual mouse and hamster oocytes.

Directory of Open Access Journals (Sweden)

Fatma Simsek-Duran

Full Text Available BACKGROUND: In human oocytes, as in other mammalian ova, there is a significant variation in the pregnancy potential, with approximately 20% of oocyte-sperm meetings resulting in pregnancies. This frequency of successful fertilization decreases as the oocytes age. This low proportion of fruitful couplings appears to be influenced by changes in mitochondrial structure and function. In this study, we have examined mitochondrial biogenesis in both hamster (Mesocricetus auratus and mouse (Mus musculus ova as models for understanding the effects of aging on mitochondrial structure and energy production within the mammalian oocyte. METHODOLOGY/PRINCIPAL FINDINGS: Individual metaphase II oocytes from a total of 25 young and old mice and hamsters were collected from ovarian follicles after hormone stimulation and prepared for biochemical or structural analysis. Adenosine triphosphate levels and mitochondrial DNA number were determined within individual oocytes from young and old animals. In aged hamsters, oocyte adenosine triphosphate levels and mitochondrial DNA molecules were reduced 35.4% and 51.8%, respectively. Reductions of 38.4% and 44% in adenosine triphosphate and mitochondrial genomes, respectively, were also seen in aged mouse oocytes. Transmission electron microscopic (TEM analysis showed that aged rodent oocytes had significant alterations in mitochondrial and cytoplasmic lamellae structure. CONCLUSIONS/SIGNIFICANCE: In both mice and hamsters, decreased adenosine triphosphate in aged oocytes is correlated with a similar decrease in mtDNA molecules and number of mitochondria. Mitochondria in mice and hamsters undergo significant morphological change with aging including mitochondrial vacuolization, cristae alterations, and changes in cytoplasmic lamellae.

Pembentukan Pronukleus Jantan dan Betina pada Mencit (Mus musculus setelah Terjadinya Fertilisasi

Directory of Open Access Journals (Sweden)

SYAHRUDDIN SAID

2005-11-01

Full Text Available Pronuclei are nuclei from male or female before syngami. The information about time of fertilization in vivo in animals was limited, especially in formation of pronuclei. This study have purpose to know the timing of sperm and egg nuclei changes at the time in vivo fertilization until formed male and female pronuclei. The female mouse DDY age 6-8 weeks were super ovulated through injection 5 IU PMSG and hCG (48 h after PMSG per mouse intraperitoneally. The female mouse was mated with male from same species in proportion male: female = 1:1. The eggs were collected on 4, 6, 8, and 10 h after fertilization with 0 h is 12 h after hCG injection with shallow cut of fertilization bladder of female mouse tuba Fallopian. The shallow cut was treated in PBS media supplemented by 3% BSA and 0.1% hyaluronidase; the eggs were washed in same media without hyaluronidase. The eggs were fixed with glutaraldehyde 2.5% in PBS, the eggs were drawn in neutral formalin 10%, dehydration with ethanol 95% and stained with lacmoid 0.25% in acetic acid 45%, the eggs were washed with using acetoglycerol and then observation about development of sperm and egg nuclei morphology. Development of mouse egg nuclei achieve to female pronuclei phase 185 (95%+6 was occur on 8 h after in vivo fertilization, development of mouse sperm nuclei achieve to male pronuclei phase 185 (96%+4 was occur on 8 h after in vivo fertilization. In the present study, we found some of eggs like unfertile eggs, polysperm, and parthenogenesis at the fertilization in vivo.

Parâmetros morfofisiológicos testiculares de camundongos (Mus musculus suplementados com geleia real Morphophysiological parameters of mice (Mus musculus testicles supplemented with royal jelly

Directory of Open Access Journals (Sweden)

A.C.T. Morais

2009-02-01

Full Text Available Avaliaram-se os efeitos da geleia real sobre os parâmetros morfofisiológicos testiculares de camundongos (Mus musculus. Utilizaram-se 57 machos Swiss, com quatro meses de idade, distribuídos aleatoriamente em seis tratamentos: T1: solução fisiológica, via intraperitoneal; T2: 0,1mg de geleia real, via intraperitoneal; T3: 0,2mg de geleia real, via intraperitoneal; T4: água destilada, via oral; T5: 0,1mg de geleia real, via oral; e T6: 0,2mg de geleia real, via oral. Após 45 dias de suplementação com geleia real, os animais sacrificados e pesados tiveram seus testículos coletados, incluídos em parafina e corados com hematoxilina/eosina. Não houve diferença entre os tratamentos quanto aos: pesos corporal e testicular, índice gonadossomático, diâmetro tubular, altura do epitélio, comprimento total dos túbulos seminíferos, comprimento tubular por grama de testículo, índices tubulossomático e leydigossomático e valores de proporção volumétrica referentes à túnica própria, epitélio seminífero, vaso sanguíneo e vaso linfático. Foi encontrada diferença entre T1 e T3 em relação aos túbulos seminíferos e ao espaço intertubular.The effects of royal jelly on the morphophysiological parameters of mice (Mus musculus testicles were studied. Fifty-eight male Swiss mice were evaluated. They were four-month old and were randomly distributed in six treatments: T1: physiological solution, intraperitonial route; T2: 0.1mg of royal jelly, intraperitonial route; T3: 0.2mg of royal jelly, intraperitonial route; T4: distilled water, orally; T5: 0.1mg of royal jelly, orally; and T6: 0.2mg of royal jelly, orally. After 45 days of supplementation with royal jelly, the animals were weighted, slaughtered, and the testicles collected, included in paraffin, and stained with haematoxylin-eosin. No differences among treatments were observed for: body and testicular weights, gonadossomatic index, tubular diameter, epithelial height, total

24 CFR 982.606 - Congregate housing: Who may reside in congregate housing.

Science.gov (United States)

2010-04-01

... Special Housing Types Congregate Housing § 982.606 Congregate housing: Who may reside in congregate housing. (a) An elderly person or a person with disabilities may reside in a congregate housing unit. (b... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Congregate housing: Who may reside...

Experiment list: SRX655689 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 8698: pol2 KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embry...onic fibroblast || genotype/variation=MED23 knockout || chip antibody=Pol II http

Mass Housing and Changings in Housing Demand, Case of Diyarbakir, Turkey

OpenAIRE

M. Oguz Sinemillioglu; Can Tuncay Akın; Havva Özyılmaz

2005-01-01

The aim of this study is to analyze changings in housing demand, especially in term of house size in Diyarbakır case, in Turkey. Though Housing in Turkey is in a free market system, there is a Mass Housing Administration (TOKÃ ) has been doing mass houses for, relatively, middle class income people. Diyarbakır, one of the cities that TOKÃ has done two thousand houses, has taken too much migration, so that the demand in housing form and structure has different alterations. This process should ...

CDBG Housing Activity

Data.gov (United States)

Department of Housing and Urban Development — CDBG activity related to housing, including multifamily rehab, housing services, code enforcement, operation and repair of foreclosed property and public housing...

Assessment of housing design decisions in informal housing ...

African Journals Online (AJOL)

The rapid urbanisation of cities in developing countries has witnessed a growth in the volume of housing construction in the urban areas. The demand for housing and the inability of government to meet this demand has encouraged the growth of informal housing. The concept of healthy buildings is of great importance, ...

Situation-Based Housing

DEFF Research Database (Denmark)

Duelund Mortensen, Peder

2011-01-01

Presentation of urban housing research on flexible housing types in the Copenhagen Region: Theoretical background, methodology, analyse of spatial organization, interviews and results. Cases: Pærehaven in Ølby, Køge and M-house in Ørestad, Copenhagen......Presentation of urban housing research on flexible housing types in the Copenhagen Region: Theoretical background, methodology, analyse of spatial organization, interviews and results. Cases: Pærehaven in Ølby, Køge and M-house in Ørestad, Copenhagen...

24 CFR 8.25 - Public housing and multi-family Indian housing.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Public housing and multi-family Indian housing. 8.25 Section 8.25 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION BASED ON HANDICAP IN FEDERALLY ASSISTED PROGRAMS AND...

Sustained housing-type social buffering following social housing in male rats.

Science.gov (United States)

Kiyokawa, Yasushi; Ishida, Aya; Takeuchi, Yukari; Mori, Yuji

2016-05-01

In social animals, recovery from the adverse effects of distressing stimuli is promoted by subsequent cohousing with a conspecific animal(s). This phenomenon has been termed housing-type social buffering. We previously found that social housing induced housing-type social buffering in fear-conditioned male rats. This buffering took the form of attenuated conditioned hyperthermia in response to an auditory conditioned stimulus (CS). Here, we assessed whether this social buffering is sustained even if the subject is housed alone after a period of social housing. When fear-conditioned subjects were housed alone during a 48-h period between conditioning and re-exposure to the auditory CS, they exhibited conditioned hyperthermia in response to the CS. However, conditioned hyperthermia was not observed when the 12-h period of social housing began 24 and 36h after conditioning during the 48-h period. This was not the case when the 12-h period of social housing began 0 and 12h after the conditioning. These results suggest that housing-type social buffering is sustained for 12h after the 12-h period of social housing. We next considered whether increasing the duration of social housing would extend the period of social buffering. We observed social buffering of conditioned hyperthermia 24 and 48, but not 96h after a 24-h period of social housing. These results suggest that social buffering was extended when the duration of social housing was increased. Taken together, our findings indicate that housing-type social buffering is sustained after a period of social housing. Copyright © 2016 Elsevier Inc. All rights reserved.

Active house concept versus passive House

NARCIS (Netherlands)

Zeiler, W.; Boxem, G.; Vehler, R.; Verhoeven, M.; Fremouw, M.

2009-01-01

The passive house concept is the present trend in energy efficient sustainable dwellings. Within the passive house concept every effort is made to minimize the energy use. Substantial savings can be achieved by passive energy systems, especially natural ventilation, summer shading and winter solar

Experiment list: SRX1121725 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblas...t || genotype/variation=MED23 knockout || chip antibody=H3K4me3 http://dbarchive.

Satisfaction with housing and housing support for people with psychiatric disabilities.

Science.gov (United States)

Brolin, Rosita; Rask, Mikael; Syrén, Susanne; Baigi, Amir; Brunt, David Arthur

2015-01-01

The aim of this study was to investigate the degree of satisfaction with housing and housing support for people with psychiatric disabilities in Sweden. A total of 370 residents, in supported housing and in ordinary housing with housing support, completed a new questionnaire and reported a high degree of overall satisfaction, but many of them wanted to move somewhere else. Differences were found between the two different types of housing concerning satisfaction with housing support, social life and available choices. Security and privacy, as well as other's influence on the choice of residential area and dwelling proved to be important predictors for satisfaction.

AcEST: DK954018 [AcEST

Lifescience Database Archive (English)

Full Text Available I8 Definition sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus Align length 152 Score (b...ignments: (bits) Value sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musc... 142 1e-33 sp|A4FV84|MRT4_BOVIN mRNA turnov...er protein 4 homolog OS=Bos taur... 142 1e-33 sp|Q9UKD2|MRT4_HUMAN mRNA turnover... protein 4 homolog OS=Homo sap... 140 5e-33 sp|Q86HD3|MRT4_DICDI mRNA turnover prote...in 4 homolog OS=Dictyost... 127 3e-29 sp|Q9USZ6|MRT4_SCHPO mRNA turnover protein 4 homolog OS=Schizosa... 10

NCBI nr-aa BLAST: CBRC-CPOR-01-1147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1147 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0130 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0130 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-PABE-04-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-04-0003 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-OCUN-01-1001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1001 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0137 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0137 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-04-0241 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0241 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-1167 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1167 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0138 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0138 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0124 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0124 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

Novel arenavirus sequences in Hylomyscus sp. and Mus (Nannomys setulosus from Côte d'Ivoire: implications for evolution of arenaviruses in Africa.

Directory of Open Access Journals (Sweden)

David Coulibaly-N'Golo

Full Text Available This study aimed to identify new arenaviruses and gather insights in the evolution of arenaviruses in Africa. During 2003 through 2005, 1,228 small mammals representing 14 different genera were trapped in 9 villages in south, east, and middle west of Côte d'Ivoire. Specimens were screened by pan-Old World arenavirus RT-PCRs targeting S and L RNA segments as well as immunofluorescence assay. Sequences of two novel tentative species of the family Arenaviridae, Menekre and Gbagroube virus, were detected in Hylomyscus sp. and Mus (Nannomys setulosus, respectively. Arenavirus infection of Mus (Nannomys setulosus was also demonstrated by serological testing. Lassa virus was not found, although 60% of the captured animals were Mastomys natalensis. Complete S RNA and partial L RNA sequences of the novel viruses were recovered from the rodent specimens and subjected to phylogenetic analysis. Gbagroube virus is a closely related sister taxon of Lassa virus, while Menekre virus clusters with the Ippy/Mobala/Mopeia virus complex. Reconstruction of possible virus-host co-phylogeny scenarios suggests that, within the African continent, signatures of co-evolution might have been obliterated by multiple host-switching events.

Reflexões sobre a arte "primitiva": o caso do Musée Branly

Directory of Open Access Journals (Sweden)

Ilana Goldstein

2008-06-01

Full Text Available Na época das descobertas ultramarinas, os europeus acumulavam fragmentos das novas realidades que encontravam em suas viagens, nos chamados gabinetes de curiosidades. Os colecionadores se especializaram e, a partir do século XVIII, surgiram os primeiros museus científicos. No final do século XIX, as exposições universais expunham a "barbárie" dos povos colonizados. Já as vanguardas do século XX redescobriram a arte "primitiva" enquanto fonte de renovação. Este artigo recupera tais formas de apreensão da cultura material de sociedades tradicionais ao longo do tempo, para chegar à inauguração do Musée Branly, em 2006. A partir desse museu, podem-se repensar algumas questões fundamentais acerca da arte "primitiva", como a dicotomia entre tratar os artefatos como testemunhos etnográficos ou como criações estéticas; as relações de poder envolvidas na aquisição dos objetos; o problema da autenticidade, numa era em que se multiplicam os souvenirs étnicos "neotradicionais".In the epoch of overseas discoveries, Europeans accumulated fragments of the realities they found in cabinets of curiosities. The private collectors specialized in different branches of "natural history" and this led to the emergence of scientific museums in the 18th century. At the end of the 19th century, universal exhibitions displayed "primitive" artifacts side by side with Western technologies, suggesting the "barbarism" of colonized peoples. But, at the beginning of the 20th century, the avant-gardes rediscovered the art nègre, using it as a source of artistic renovation. This article begins by describing these various forms of dealing with the cultural expressions of others, in order to understand the meaning of the recently opened Musée Branly. The French museum, devoted to non-occidental societies, provides an opportunity to reconsider some fundamental issues. Should we exhibit these artifacts as ethnographic testimonies or works of art? Can we

Development of a Measure of Housing and Housing Services.

Science.gov (United States)

Clark, Colleen; Young, M Scott; Teague, Gregory; Rynearson-Moody, Sarah

2016-01-01

The Housing Program Measure (HPM) was designed to document critical elements of a range of housing program types and associated services. Qualitative methods, including literature review and open-ended interviews, were used to determine pertinent HPM domains and to develop the pool of items. The measure was pre-tested, and reliability and validity analyses were applied to revise and strengthen the measure. The resulting measure furthers homelessness research by providing a tool that can be used to define housing and housing services interventions across diverse projects and disciplines, to facilitate program management by matching housing resources to the needs of homeless individuals, and to support model development by measuring progress to goals.

Acclimation and Institutionalization of the Mouse Microbiota Following Transportation

Directory of Open Access Journals (Sweden)

Dan R. Montonye

2018-05-01

Full Text Available Using animal models, the gut microbiota has been shown to play a critical role in the health and disease of many organ systems. Unfortunately, animal model studies often lack reproducibility when performed at different institutions. Previous studies in our laboratory have shown that the gut microbiota of mice can vary with a number of husbandry factors leading us to speculate that differing environments may alter gut microbiota, which in turn may influence animal model phenotypes. As an extension of these studies, we hypothesized that the shipping of mice from a mouse producer to an institution will result in changes in the type, relative abundance, and functional composition of the gut microbiota. Furthermore, we hypothesized that mice will develop a microbiota unique to the institution and facility in which they are housed. To test these hypotheses, mice of two strains (C57BL/6J and BALB/cJ, two age groups (4 week and 8 week old, and originating from two types of housing (research animal facility under conventional housing and production facilities under maximum barrier housing were obtained from The Jackson Laboratory. Fecal samples were collected the day prior to shipping, immediately upon arrival, and then on days 2, 5, 7, and weeks 2, 4, and 9 post-arrival. Following the first post-arrival fecal collection, mice were separated into 2 groups and housed at different facilities at our institution while keeping their caging, diet, and husbandry practices the same. DNA was extracted from the collected fecal pellets and 16S rRNA amplicons were sequenced in order to characterize the type and relative abundance of gut bacteria. Principal component analysis (PCA and permutational multivariate analysis of variance (PERMANOVA demonstrated that both the shipping and the institution and facility in which mice were housed altered the gut microbiota. Phylogenetic investigation of communities by reconstruction of unobserved states (PICRUSt predicted

Acclimation and Institutionalization of the Mouse Microbiota Following Transportation.

Science.gov (United States)

Montonye, Dan R; Ericsson, Aaron C; Busi, Susheel B; Lutz, Cathleen; Wardwell, Keegan; Franklin, Craig L

2018-01-01

Using animal models, the gut microbiota has been shown to play a critical role in the health and disease of many organ systems. Unfortunately, animal model studies often lack reproducibility when performed at different institutions. Previous studies in our laboratory have shown that the gut microbiota of mice can vary with a number of husbandry factors leading us to speculate that differing environments may alter gut microbiota, which in turn may influence animal model phenotypes. As an extension of these studies, we hypothesized that the shipping of mice from a mouse producer to an institution will result in changes in the type, relative abundance, and functional composition of the gut microbiota. Furthermore, we hypothesized that mice will develop a microbiota unique to the institution and facility in which they are housed. To test these hypotheses, mice of two strains (C57BL/6J and BALB/cJ), two age groups (4 week and 8 week old), and originating from two types of housing (research animal facility under conventional housing and production facilities under maximum barrier housing) were obtained from The Jackson Laboratory. Fecal samples were collected the day prior to shipping, immediately upon arrival, and then on days 2, 5, 7, and weeks 2, 4, and 9 post-arrival. Following the first post-arrival fecal collection, mice were separated into 2 groups and housed at different facilities at our institution while keeping their caging, diet, and husbandry practices the same. DNA was extracted from the collected fecal pellets and 16S rRNA amplicons were sequenced in order to characterize the type and relative abundance of gut bacteria. Principal component analysis (PCA) and permutational multivariate analysis of variance (PERMANOVA) demonstrated that both the shipping and the institution and facility in which mice were housed altered the gut microbiota. Phylogenetic investigation of communities by reconstruction of unobserved states (PICRUSt) predicted differences in

The uncharacterized gene 1700093K21Rik and flanking regions are correlated with reproductive isolation in the house mouse, Mus musculus

Czech Academy of Sciences Publication Activity Database

Kass, D. H.; Janoušek, Václav; Wang, L.; Tucker, P. K.

2014-01-01

Roč. 25, 5-6 (2014), s. 223-234 ISSN 0938-8990 R&D Projects: GA MŠk EE2.3.20.0303 Institutional support: RVO:68081766 Keywords : hybrid male-sterility * X-chromosome * placental development * sex chromosomes * zone * mice * speciation * differentiation * protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.068, year: 2014

Dicty_cDB: Contig-U05216-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 064701 ) WNEL14b1 Wheat EST endosperm library Triticum aes... 40 0.032 2 ( AC200123 ) Zea mays chromosome 4 ... CF-24-HW fat cDNA... 36 0.055 2 ( EG551033 ) MM04K05_RP Sugar Beet germination cDNA library Be... 36 0.055 2 ( AG332587 ) Mus muscul...7 2 ( AZ506962 ) 1M0348D20F Mouse 10kb plasmid UUGC1M library Mus ... 40 0.057 2 ( BB898919 ) Macaca fascicul...V968176 ) GC06167 Gracilaria changii cDNA library Gracilari... 46 0.014 2 ( AG430324 ) Mus musculus molossin..._IpSto_12_p10 Stomach cDNA library Ictalurus p... 32 0.76 2 ( DX535456 ) GH_MBb0065G22f GH_MBb Gossypium hirsutum genomic

Sydney Opera House Rise

DEFF Research Database (Denmark)

2013-01-01

Sydney Opera House Exhibition (2013) A CITA research and exhibition project, for Sydney Opera House exhibition "Danish Design at the House".......Sydney Opera House Exhibition (2013) A CITA research and exhibition project, for Sydney Opera House exhibition "Danish Design at the House"....

PENGARUH TRITERPEN TOTAL PEGAGAN (Centella asiatica (L Urban TERHADAP FUNGSI KOGNITIF BELAJAR DAN MENGINGAT PADA MENCIT JANTAN ALBINO (Mus musculus YANG DIHAMBAT DENGAN SKOPOLAMIN

Directory of Open Access Journals (Sweden)

Herlina

2010-11-01

Full Text Available Pegagan (Centella asiatica (L Urban has been described to posses CNS effects such as improving cognitive function, learning and memory. The aim of the research was to evaluate the effects of total triterpen’s pegagan extract on cognitive functions as the learning and memory performance in male albino mice (Mus musculus inhibited by scopolamine. The research design was Complete Randomized Design (RAL – factorial on thirty six mice divided into 4 groups. One control group received only aquabidest (negative control. Three treatment groups received total triterpen 16 mg/kg BW, 32 mg/kg BW orally and piracetam 500 mg/kg BW by intra peritoneally (positive control for 21 days. Data indicating learning and memory process of all subjects were obtained from one-trial passive avoidance test. Data were analyzed by two way ANOVA and BNT (p0,05. In conclusion, total triterpen from pegagan (Centella asiatica (L Urban improved learning ability and memory of male albino mice (Mus musculus even though, it was inhibited by scopolamine.

The contribution of the Y chromosome to hybrid male sterility in house mice.

Science.gov (United States)

Campbell, Polly; Good, Jeffrey M; Dean, Matthew D; Tucker, Priscilla K; Nachman, Michael W

2012-08-01

Hybrid sterility in the heterogametic sex is a common feature of speciation in animals. In house mice, the contribution of the Mus musculus musculus X chromosome to hybrid male sterility is large. It is not known, however, whether F1 male sterility is caused by X-Y or X-autosome incompatibilities or a combination of both. We investigated the contribution of the M. musculus domesticus Y chromosome to hybrid male sterility in a cross between wild-derived strains in which males with a M. m. musculus X chromosome and M. m. domesticus Y chromosome are partially sterile, while males from the reciprocal cross are reproductively normal. We used eight X introgression lines to combine different X chromosome genotypes with different Y chromosomes on an F1 autosomal background, and we measured a suite of male reproductive traits. Reproductive deficits were observed in most F1 males, regardless of Y chromosome genotype. Nonetheless, we found evidence for a negative interaction between the M. m. domesticus Y and an interval on the M. m. musculus X that resulted in abnormal sperm morphology. Therefore, although F1 male sterility appears to be caused mainly by X-autosome incompatibilities, X-Y incompatibilities contribute to some aspects of sterility.

Economic analysis of passive houses and low-energy houses compared with standard houses

International Nuclear Information System (INIS)

Audenaert, A.; Cleyn, S.H. de; Vankerckhove, B.

2008-01-01

As the energy demand used for space heating accounts for 78% of EU15 household delivered energy consumption, significant reductions in energy demand can be achieved by promoting low-energy buildings. Our study investigates three building types: the standard house, the low-energy house and the passive house. As more far-reaching measures concerning energy savings usually lead to higher investments, the aim of our study is to perform an economic analysis in order to determine the economic viability of the three building types

Assisted Housing - Public Housing Developments - National Geospatial Data Asset (NGDA)

Data.gov (United States)

Department of Housing and Urban Development — The general location of an entire Public Housing Development. A distinct address is chosen to represent the general location of an entire Public Housing Development,...

The impact of housing policies and housing markets on ethnic spatial segregation

DEFF Research Database (Denmark)

Andersen, Hans Skifter; Andersson, Roger; Wessel, Terje

2015-01-01

This paper examines how ethnic segregation is connected to an ethnic division of the housing market and a spatial separation of different housing tenures in four Nordic cities. Explanations for the differences across the cities are found by comparing housing markets and housing policies....... The housing markets are in all four cities ethnically segmented with high concentrations of immigrants in some forms of tenures (especially social/public housing) and low concentrations in others. We further discuss the reasons for the observed pattern. The paper shows that the spatial distribution...... housing, while co-operative housing is crucial in the fourth. It is also shown that a policy of neighbourhood tenure mix in one of the cities has resulted in a relatively low degree of segregation in spite of high concentrations of immigrants in social/public housing....

Regulation by commensal bacteria of neurogenesis in the subventricular zone of adult mouse brain.

Science.gov (United States)

Sawada, Naoki; Kotani, Takenori; Konno, Tasuku; Setiawan, Jajar; Nishigaito, Yuka; Saito, Yasuyuki; Murata, Yoji; Nibu, Ken-Ichi; Matozaki, Takashi

2018-04-15

In the mouse olfactory bulb (OB), interneurons such as granule cells and periglomerular cells are continuously replaced by adult-born neurons, which are generated in the subventricular zone (SVZ) of the brain. We have now investigated the role of commensal bacteria in regulation of such neuronal cell turnover in the adult mouse brain. Administration of mixture of antibiotics to specific pathogen-free (SPF) mice markedly attenuated the incorporation of bromodeoxyuridine (BrdU) into the SVZ cells. The treatment with antibiotics also reduced newly generated BrdU-positive neurons in the mouse OB. In addition, the incorporation of BrdU into the SVZ cells of germ-free (GF) mice was markedly reduced compared to that apparent for SPF mice. In contrast, the reduced incorporation of BrdU into the SVZ cells of GF mice was recovered by their co-housing with SPF mice, suggesting that commensal bacteria promote the incorporation of BrdU into the SVZ cells. Finally, we found that administration of ampicillin markedly attenuated the incorporation of BrdU into the SVZ cells of SPF mice. Our results thus suggest that ampicillin-sensitive commensal bacteria regulate the neurogenesis in the SVZ of adult mouse brain. Copyright © 2018 Elsevier Inc. All rights reserved.

Understanding of Danish passive houses based on pilot project Comfort Houses

Energy Technology Data Exchange (ETDEWEB)

Brunsgaard, C.

2010-12-15

The aim of the research is to investigate the notion of passive houses in Denmark. When this PhD thesis was initiated, the Danish building industry has just started to become interested in the passive house concept, but the knowledge was very limited. To be able to speed up the process of constructing Danish passive houses or other low energy concepts Saint-Gobain Isover Scandinavia took the initiative to the pilot project of the Comfort Houses, ten single-family houses constructed as passive houses, and wanted to share the knowledge with the building industry and other interested. This PhD thesis was a part of the strategy. If the concept of passive houses should be successfully promoted and achieve a significant sale in Denmark, it is believed that it is necessary to do a holistic approach. Besides energy savings and new structural solutions more qualitative aspects like architecture, everyday life and the future ways of living needs to be integrated in the future understanding of passive houses. This Ph.D. thesis therefore studies the following research question: What can the experience from the Comfort Houses enlighten about the future production and use of Danish passive houses? This understanding is achieved through studies of different study fields to be able to create a more holistic understanding of the concept both covering qualitative and quantitative analysis. The main focus will be on the study fields Design Process, Architecture and Everyday Life and the Indoor environment, which will answer the following sub-research questions: 1) How has the consortiums behind the Comfort Houses approached the design process according to teamwork, method and tools? And what barriers and possibilities lie within the approaches? 2) How do the occupants of the Comfort Houses experience the passive house architecture and the technical service systems? And has their everyday life changed by moving into a passive house? If so, how? 3) To what extent do the Comfort Houses

Family Open House

Science.gov (United States)

Search Family Open House Join us for an afternoon of science fun. The Fermilab Family Open House is a party for children of all ages to learn about the world of physics. The Open House is supported by Open House? Check out our YouTube video to learn more! Explore physics concepts with hands-on

Radon house doctor

International Nuclear Information System (INIS)

Nitschke, I.A.; Brennan, T.; Wadach, J.B.; O'Neil, R.

1986-01-01

The term house doctor may be generalized to include persons skilled in the use of instruments and procedures necessary to identify, diagnose, and correct indoor air quality problems as well as energy, infiltration, and structural problems in houses. A radon house doctor would then be a specialist in radon house problems. Valuable experience in the skills necessary to be developed by radon house doctors has recently been gained in an extensive radon monitoring and mitigation program in upstate New York sponsored by Niagara Mohawk Power Corporation and the New York State Energy Research and Development Authority. These skills, to be described in detail in this paper, include: (i) the use of appropriate instruments, (ii) the evaluation of the symptoms of a radon-sick house, (iii) the diagnostic procedures required to characterize radon sources in houses, (iv) the prescription procedures needed to specify treatment of the problem, (v) the supervision of the implementation of the treatment program, (vi) the check-up procedures required to insure the house cured of radon problems. 31 references, 3 tables

Housing First or no housing? Housing and homelessness at the end of alcohol and drug treatment.

Science.gov (United States)

Dyb, Evelyn

2016-10-01

The rate of alcohol and drug dependency is high among homeless persons in Norway as well as in other Western societies. National homeless surveys also show a certain correlation between discharge from institutions and homelessness. However, the rate of homelessness versus the rate with fixed abode at the end of specialised alcohol and drug treatment has not been examined using quantitative methods. A cross-sectional survey was conducted in alcohol and drug treatment units in the national health services and private clinics. The survey investigates the housing outcome at the end of treatment compared to the situation at the start of treatment using an individual questionnaire for patients ending treatment in a specific time window. Housing outcome is measured by the odds ratio of having a fixed abode at the end of treatment in relation to main intoxicating substance, type of treatment (in- and outpatient), completing versus cutting short the treatment, housing situation at the start of treatment, socioeconomic capital, mental health problems, individual plan, medical assisted treatment, and a set of background variables. The housing versus homeless situation hardly changes during the treatment period. In both a bivariate analysis and a simple multivariate model, principal intoxicating substance is the strongest predictor of having a fixed abode both before and after treatment. However, a more sophisticated analysis indicates that socioeconomic resources and social capital play along with the preferred intoxicating substance as predictors of having permanent housing. After more than a decade of a housing-led national homeless policy, and wide embracement of Housing First approaches in the European Union, homeless persons entering specialised alcohol and drug treatment are likely to return to the streets and hostels at the end of treatment. Access to housing after treatment is very limited for those lacking resources to solve their housing problem without assistance

Rendez-vous avec les oeuvres du Musée: le speed dating au MAH : quinze minutes pour convaincre

OpenAIRE

Matthey, David

2015-01-01

Tiré du site internet du blog des Musées d'art et d'histoire (http://blog.mahgeneve.ch): "Lors des soirées Afterwork tenues au MAH durant les mois d'octobre et de novembre, les séances de speed dating – un commentaire d'une quinzaine de minutes consacré à une oeuvre ou à un ensemble d'oeuvres – ont remporté un franc succès. Cet engouement nous conforte dans l'idée d'en faire le fil rouge de nos futures manifestations de fin de journée ! Mais pourquoi cette formule?".

(Urginea Altissima), Against the Field Rat, Arvicanthis Abyssinicus

African Journals Online (AJOL)

Bernt Lindtjorn

the field rat, Arvicanthis abyssincus with the aim of developing locally based ... inhabited by humans and is commonly found in open ... rat, A. abyssinicus in a choice and non-choice tests. ..... sowing control of house mice (Mus domesticus):.

House Price, House Quality and Economic Growth

NARCIS (Netherlands)

De Vries, P.; Boelhouwer, P.J.

2010-01-01

The literature on housing markets suggest that periods of economic growth are characterised by a demand for better housing quality and increasing prices. The basic principles of the theory are that the short-run price fluctuations occur due to market imperfection, while over the long term, causality

Livable Housing Design: The voluntary provision of inclusive housing in Australia

Directory of Open Access Journals (Sweden)

Margaret Louise Ward

2014-06-01

Full Text Available This paper reports on a study of the voluntary provision of inclusive housing. The impetus for the study is the Livable Housing Design initiative, an agreement among Australian housing industry and community leaders in 2010 to a national guideline and voluntary strategy with a target to provide minimum access features in all new housing by 2020. Situated in and around Brisbane, Australia, the study problematises the assumption that the housing industry will respond voluntarily; an assumption which this study concludes is unfounded. The Livable Housing Design initiative asks individual agents to consider the needs of people beyond the initial contract, to proceed with objective reasoning and to do the right thing voluntarily. Instead, the study found that interviewees focused on their immediate contractual obligations, were reluctant to change established practices and saw little reason to do more than was legally required of them. This paper argues that the highly-competitive and risk-averse nature of the industry works against a voluntary approach for inclusive housing and, if the 2020 target of the Livable Housing Design.

Tech House

Science.gov (United States)

1978-01-01

The members of the Swain family- Dr. Charles "Bill" Swain, wife Elaine, daughter Carol, 17, son "Chuck", 12, and dog Susie have an interesting assignment. They are active participants in an important NASA research program involving the application of space-age technology to home construction. b' Transplanted Floridians, the Swains now reside in NASA's Tech House, loatedat Langley Research Center, Hampton, Virginia. Their job is to use and help evaluate the variety of advanced technology systems in Tech House. A contemporary three-bedroom home, Tech House incorporates NASA technology, the latest commercial building techniques and other innovations, all designed to reduce energy and water consumption and to provide new levels of comfort, convenience, security and fire safety. Tech House equipment performed well in initial tests, but a house is not a home until it has people. That's where the Swains come in. NASA wants to see how the various systems work under actual living conditions, to confirm the effectiveness of the innovations or to determine necessary modifications for improvement. The Swains are occupying the house for a year, during which NASA engineers are computer monitoring the equipment and assembling a record of day-to-day performance. . Tech House is a laboratory rather than a mass production prototype, but its many benefits may influence home design and construction. In a period of sharply rising utility costs, widespread adoption of Tech House features could provide large-scale savings to homeowners and potentially enormous national benefit in resources conservation. Most innovations are aerospace spinoffs: Some of the equipment is now commercially available; other systems are expected to be in production within a few years. Around 1980, a Tech House-type of home could be built for $45-50,000 (1 976 dollars). It is estimated that the homeowner would save well over $20,000 (again 1976 dollars) in utility costs over the average mortgage span of 20 years.

The Special Importance of Housing Policy for the Housing Situation of Ethnic Minorities

DEFF Research Database (Denmark)

Andersen, Hans Skifter; Magnusson Turner, Lena; Søholt, Susanne

The purpose of this article is to uncover, whether housing policy has a special importance for immigrants, compared with the whole population, by comparing housing policies and immigrants’ housing outcomes in four Nordic countries: Denmark, Finland, Norway and Sweden. There are substantial...... population varies much. These differences can only to some extent be explained by income inequalities on the housing markets in the countries, inequalities that affect immigrants. Other important explanations of why immigrants perform worse on the housing market is the shortage of rental housing (Norway......’ housing options are strict needs test for social/public housing (Finland)....

The Special Importance of Housing Policy for the Housing Situation of Ethnic Minorities

DEFF Research Database (Denmark)

Andersen, Hans Skifter; Turner, Lena Magnusson; Søholt, Susanne

2013-01-01

The purpose of this article is to uncover, whether housing policy has a special importance for immigrants, compared with the whole population, by comparing housing policies and immigrants’ housing outcomes in four Nordic countries: Denmark, Finland, Norway and Sweden. There are substantial...... population varies much. These differences can only to some extent be explained by income inequalities on the housing markets in the countries, inequalities that affect immigrants. Other important explanations of why immigrants perform worse on the housing market is the shortage of rental housing (Norway......’ housing options are strict needs test for social/public housing (Finland)....

Female presence and estrous state influence mouse ultrasonic courtship vocalizations.

Directory of Open Access Journals (Sweden)

Jessica L Hanson

Full Text Available The laboratory mouse is an emerging model for context-dependent vocal signaling and reception. Mouse ultrasonic vocalizations are robustly produced in social contexts. In adults, male vocalization during courtship has become a model of interest for signal-receiver interactions. These vocalizations can be grouped into syllable types that are consistently produced by different subspecies and strains of mice. Vocalizations are unique to individuals, vary across development, and depend on social housing conditions. The behavioral significance of different syllable types, including the contexts in which different vocalizations are made and the responses listeners have to different types of vocalizations, is not well understood. We examined the effect of female presence and estrous state on male vocalizations by exploring the use of syllable types and the parameters of syllables during courtship. We also explored correlations between vocalizations and other behaviors. These experimental manipulations produced four main findings: 1 vocalizations varied among males, 2 the production of USVs and an increase in the use of a specific syllable type were temporally related to mounting behavior, 3 the frequency (kHz, bandwidth, and duration of syllables produced by males were influenced by the estrous phase of female partners, and 4 syllable types changed when females were removed. These findings show that mouse ultrasonic courtship vocalizations are sensitive to changes in female phase and presence, further demonstrating the context-sensitivity of these calls.

Exploring the Housing Needs of Older People in Standard and Sheltered Social Housing.

Science.gov (United States)

Fox, Siobhan; Kenny, Lorna; Day, Mary Rose; O'Connell, Cathal; Finnerty, Joe; Timmons, Suzanne

2017-01-01

Objective: Our home can have a major impact on our physical and mental health; this is particularly true for older people who may spend more time at home. Older people in social (i.e., public) housing are particularly vulnerable. Housing options for older people in social housing include standard design dwellings or specially designed "sheltered housing." The most suitable housing model should be identified, with older people consulted in this process. Method: Survey of older people (aged ≥60) living in standard or sheltered social housing. Data were analyzed using descriptive and inferential statistics in SPSS Version 22. Results: Overall, 380 surveys were returned (response rate = 47.2%). All older people had similar housing needs. Those in sheltered housing were more satisfied with the physical home design and reported more positive outcomes. Older people in standard housing were less likely to have necessary adaptations to facilitate aging-in-place. Discussion: Older people in standard housing reported more disability/illnesses, are worried about the future, and felt less safe at home. However, few wanted to move, and very few viewed sheltered housing as an alternative, suggesting limited knowledge about their housing options. Future social housing designs should be flexible, that is, adaptable to the needs of the tenants over time.

Evaluation of perfluoroalkyl acid activity using primary mouse and human hepatocytes

International Nuclear Information System (INIS)

Rosen, Mitchell B.; Das, Kaberi P.; Wood, Carmen R.; Wolf, Cynthia J.; Abbott, Barbara D.; Lau, Christopher

2013-01-01

While perfluorooctanoic acid (PFOA) and perfluorooctane sulfonate (PFOS) have been studied at length, less is known about the biological activity of other perfluoroalkyl acids (PFAAs) detected in the environment. Using a transient transfection assay developed in COS-1 cells, our group has previously evaluated a variety of PFAAs for activity associated with activation of peroxisome proliferator-activated receptor alpha (PPARα). Here we use primary heptatocytes to further assess the biological activity of a similar group of PFAAs using custom designed Taqman Low Density Arrays. Primary mouse and human hepatoyctes were cultured for 48 h in the presence of varying concentrations of 12 different PFAAs or Wy14,643, a known activator of PPARα. Total RNA was collected and the expression of 48 mouse or human genes evaluated. Gene selection was based on either in-house liver microarray data (mouse) or published data using primary hepatocytes (human). Gene expression in primary mouse hepatocytes was more restricted than expected. Genes typically regulated in whole tissue by PPARα agonists were not altered in mouse cells including Acox1, Me1, Acaa1a, Hmgcs1, and Slc27a1. Cyp2b10, a gene regulated by the constitutive androstane receptor and a transcript normally up-regulated by in vivo exposure to PFAAs, was also unchanged in cultured mouse hepatocytes. Cyp4a14, Ehhadh, Pdk4, Cpt1b, and Fabp1 were regulated as expected in mouse cells. A larger group of genes were differentially expressed in human primary hepatocytes, however, little consistency was observed across compounds with respect to which genes produced a significant dose response making the determination of relative biological activity difficult. This likely reflects weaker activation of PPARα in human versus rodent cells as well as variation among individual cell donors. Unlike mouse cells, CYP2B6 was up-regulated in human hepatocytes by a number of PFAAs as was PPARδ. Rankings were conducted on the limited

Rapid bursts of androgen-binding protein (Abp) gene duplication occurred independently in diverse mammals.

Science.gov (United States)

Laukaitis, Christina M; Heger, Andreas; Blakley, Tyler D; Munclinger, Pavel; Ponting, Chris P; Karn, Robert C

2008-02-12

The draft mouse (Mus musculus) genome sequence revealed an unexpected proliferation of gene duplicates encoding a family of secretoglobin proteins including the androgen-binding protein (ABP) alpha, beta and gamma subunits. Further investigation of 14 alpha-like (Abpa) and 13 beta- or gamma-like (Abpbg) undisrupted gene sequences revealed a rich diversity of developmental stage-, sex- and tissue-specific expression. Despite these studies, our understanding of the evolution of this gene family remains incomplete. Questions arise from imperfections in the initial mouse genome assembly and a dearth of information about the gene family structure in other rodents and mammals. Here, we interrogate the latest 'finished' mouse (Mus musculus) genome sequence assembly to show that the Abp gene repertoire is, in fact, twice as large as reported previously, with 30 Abpa and 34 Abpbg genes and pseudogenes. All of these have arisen since the last common ancestor with rat (Rattus norvegicus). We then demonstrate, by sequencing homologs from species within the Mus genus, that this burst of gene duplication occurred very recently, within the past seven million years. Finally, we survey Abp orthologs in genomes from across the mammalian clade and show that bursts of Abp gene duplications are not specific to the murid rodents; they also occurred recently in the lagomorph (rabbit, Oryctolagus cuniculus) and ruminant (cattle, Bos taurus) lineages, although not in other mammalian taxa. We conclude that Abp genes have undergone repeated bursts of gene duplication and adaptive sequence diversification driven by these genes' participation in chemosensation and/or sexual identification.

AcEST: BP911457 [AcEST

Lifescience Database Archive (English)

Full Text Available D K YR G++ + N +G Sbjct: 192 WLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKREEGGQVSNWLHNHANVG 240 >sp|Q5TIS6|NOTO_MOUSE Homeobox protein notochord...=h... 32 2.1 sp|Q7ABK6|HMP_ECO57 Flavohemoprotein OS=Escherichia coli O157:H7... 32 2.1 sp|Q5TIS6|NOTO_MOUSE Homeobox protein notocho...rd OS=Mus musculus ... 31 2.8 sp|Q9BYQ7|KRA41_HUMAN Kera

Experiment list: SRX471838 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : ChIPseq GS WT Bmi1; Mus musculus; ChIP-Seq source_name=Cultured germline stem cells || genotype/variation=...Wild-type || strain=CD1 x C57BL/6 || cell type=Cultured germline stem cells || chip antibody=Mouse anti-Bmi1

REVIEW - Thermal Physiology of Laboratory Mice: Defining Thermoneutrality

Science.gov (United States)

In terms of total number of publications, the laboratory mouse (Mus musculus) has emerged as the most popular test subject in biomedical research. Mice are used as models to study obesity, diabetes, eNS diseases and variety of other pathologies. Mice are classified as homeotherms...

Essays on Housing Markets

DEFF Research Database (Denmark)

Bäckman, Claes

In Denmark and in many countries around the world, housing markets are of considerable importance for households and policy-makers alike. As the boom and bust in the US and Danish housing market so aptly demonstrated, disruptions in the housing market potentially have wide-ranging consequences...... for individual households and for the aggregate economy. Housing is important because we all have to live somewhere, but also because it serves as a considerable source of both wealth and debt. As such, housing market policy can not only create vast benefits for many, but can also have substantial negative...... impacts for all, and should therefore be a topic of major interest for economists and policy makers alike. This Ph.D. thesis, entitled “Essays on Housing Markets”, analyzes the Danish housing market during the 2000s, with a focus on how policy changes affected house prices and how changes in house prices...

The bishops and housing.

Science.gov (United States)

Shellabarger, Thomas

2005-01-01

According to Catholic social teaching, housing is not a commodity but a human right. To ensure that all people--especially low-income elderly and other vulnerable populations--have access to affordable housing, the church has established a variety of programs, services, and advocacy efforts. Much of this work is based on key concepts: preserving existing housing stock, creating new programs to provide more options for the underserved, empowering residents and communities to deal with housing issues, establishing partnerships to make organizations' efforts more successful, making housing affordable, and ending discrimination in housing. Although church ministries, community groups, the private sector, and other players must work together to find solutions to the housing crisis, federal leadership is essential. Especially with the housing affordability gap growing and the U.S. population aging, the federal government must provide the resources, leadership, and direction for effective housing solutions.

Predators are attracted to the olfactory signals of prey.

Directory of Open Access Journals (Sweden)

Nelika K Hughes

2010-09-01

Full Text Available Predator attraction to prey social signals can force prey to trade-off the social imperatives to communicate against the profound effect of predation on their future fitness. These tradeoffs underlie theories on the design and evolution of conspecific signalling systems and have received much attention in visual and acoustic signalling modes. Yet while most territorial mammals communicate using olfactory signals and olfactory hunting is widespread in predators, evidence for the attraction of predators to prey olfactory signals under field conditions is lacking.To redress this fundamental issue, we examined the attraction of free-roaming predators to discrete patches of scents collected from groups of two and six adult, male house mice, Mus domesticus, which primarily communicate through olfaction. Olfactorily-hunting predators were rapidly attracted to mouse scent signals, visiting mouse scented locations sooner, and in greater number, than control locations. There were no effects of signal concentration on predator attraction to their prey's signals.This implies that communication will be costly if conspecific receivers and eavesdropping predators are simultaneously attracted to a signal. Significantly, our results also suggest that receivers may be at greater risk of predation when communicating than signallers, as receivers must visit risky patches of scent to perform their half of the communication equation, while signallers need not.

Radon in houses

International Nuclear Information System (INIS)

Toohey, R.E.; Essling, M.A.; Markun, F.

1985-01-01

The purpose of this study is to determine the concentrations of 222 Rn and its short-lived daughter products in the air of single-family houses in the midwestern US. During the past year, more than 200 houses were added to the study, resulting in a total of more than 400 houses. So far, results are available for 270 of these houses, equally divided between the Chicago area and Bloomsburg, Pennsylvania. 6 refs

Detection of quantitative trait loci causing abnormal spermatogenesis and reduced testis weight in the small testis (Smt) mutant mouse.

Science.gov (United States)

Bolor, Hasbaira; Wakasugi, Noboru; Zhao, Wei Dong; Ishikawa, Akira

2006-04-01

The small testis (Smt) mutant mouse is characterized by a small testis of one third to one half the size of a normal testis, and its spermatogenesis is mostly arrested at early stages of meiosis, although a small number of spermatocytes at the late prophase of meiosis and a few spermatids can sometimes be seen. We performed quantitative trait locus (QTL) analysis of these spermatogenic traits and testis weight using 221 F2 males obtained from a cross between Smt and MOM (Mus musculus molossinus) mice. At the genome-wide 5% level, we detected two QTLs affecting meiosis on chromosomes 4 and 13, and two QTLs for paired testis weight as a percentage of body weight on chromosomes 4 and X. In addition, we found several QTLs for degenerated germ cells and multinuclear giant cells on chromosomes 4, 7 and 13. Interestingly, for cell degeneration, the QTL on chromosome 13 interacted epistatically with the QTL on chromosome 4. These results reveal polygenic participation in the abnormal spermatogenesis and small testis size in the Smt mutant.

Housing preferences of young adults in Indonesia: housing attributes and consequences

Science.gov (United States)

Farasa, N.; Kusuma, H. E.

2018-03-01

Nowadays, the housing demand of young adults in Indonesia is important issues for the sustainable development of the market. Facing differences of life phases, such as marriage, leaving home after graduation, and new job positioning, young adults become the main segment facing constant housing choice decisions in the housing market. In their particular phase of life, young adults have distinct preferences for housing attributes which bring a great influence on their lives in the future. Data was gathered from a survey questionnaire that was answered by 180 young adults in Indonesia, ranging from age 22-33 years. The findings suggest that the green area and view, location, simplicity, home design, and accessibility are the significant parts as housing attributes for young adults’ housing preferences in Indonesia. The effect of these attributes has many consequences such as security, personalization, mood/ambiance, maintenance, interaction, image, flexibility, environmental, economy, durability, convenience, comfort, and circulation. The biggest group of young adults who prefer comfort as their wanted consequences tend to have high preferences on housing attributes of the green area and view, and simplicity.

Housing of Hobson's Choice

DEFF Research Database (Denmark)

Vestergaard, Hedvig

2010-01-01

This paper looks at policies implemented to improve troubled housing estates during more than two decades. Based on evaluations of implemented programmes and case studies the paper provides a basis for discussing a number of questions: • Why do we have troubled housing estates? • What...... is the definition of troubled housing estates? • Who lives on troubled housing estates? • Who owns and manages the troubled housing estates? • What have been the reasons behind improvement programmes for troubled housing estates? • What kind of improvement programmes have been implemented and with what kind...... of results? • Have improvement programmes changed the position of the estates on the local housing markets? • What are the changes in policies and results? • What are the perspectives for policy initiatives in the field of troubled housing estates?...

Centralized mouse repositories.

Science.gov (United States)

Donahue, Leah Rae; Hrabe de Angelis, Martin; Hagn, Michael; Franklin, Craig; Lloyd, K C Kent; Magnuson, Terry; McKerlie, Colin; Nakagata, Naomi; Obata, Yuichi; Read, Stuart; Wurst, Wolfgang; Hörlein, Andreas; Davisson, Muriel T

2012-10-01

Because the mouse is used so widely for biomedical research and the number of mouse models being generated is increasing rapidly, centralized repositories are essential if the valuable mouse strains and models that have been developed are to be securely preserved and fully exploited. Ensuring the ongoing availability of these mouse strains preserves the investment made in creating and characterizing them and creates a global resource of enormous value. The establishment of centralized mouse repositories around the world for distributing and archiving these resources has provided critical access to and preservation of these strains. This article describes the common and specialized activities provided by major mouse repositories around the world.

Drosophila mutations at the mei-9 and mus(2)201 loci which block excision of thymine dimers also block induction of unscheluded DNA synthesis by methyl methanesulfonate, ethyl methanesulfonate, N-methyl-N-nitrosourea, UV light and X-rays

International Nuclear Information System (INIS)

Dusenbery, R.L.; McCormick, S.C.; Smith, P.D.

1983-01-01

The mei-9 and mus(2)201 mutants of Drosophila melanogaster were identified as mutagen-sensitive mutants on the basis of larval hypersensitivity to methyl methanesulfonate and characterized as excision repair-deficient on the basis of a greatly reduced capacity to excise thymine dimers from cellular DNA. The high degree of larval cytotoxicity observed with a variety of other chemical and physical agents indicated that these mutants may be unable to excise other important classes of DNA adducts. We have measured the ability of the single mutants and the double mutant combination mei-9;mus(2)201 to perform the resynthesis step in excision repair by means of an autoradiographic analysis of unscheduled DNA synthesis (UDS) induced in a mixed population of primary cells in culture. The 3 strains exhibit no detectable UDS activity in response to applied doses of 1.5-6.0 mM methyl methanesulfonate, 1.0-4.5 nM N-methyl-N-nitrosourea or 10-40 J/m 2 254-nm UV light, dose ranges in which control cells exhibit a strong dose-dependent UDS response. The mei-9 and mei-9;mus(2)201 mutants also have no detectable UDS response to X-ray doses of 300-1.800 rad, whereas the mus(2)201 mutant exhibits a reduced, but dose-dependent, response over this range. These data correlate well with the degree of larval hypersensitivity of the strains and suggest that mutations at both loci block the excision repair of a wide variety of DNA damage prior to the resynthesis step. (orig.)

No Evidence that Infection Alters Global Recombination Rate in House Mice.

Directory of Open Access Journals (Sweden)

Beth L Dumont

Full Text Available Recombination rate is a complex trait, with genetic and environmental factors shaping observed patterns of variation. Although recent studies have begun to unravel the genetic basis of recombination rate differences between organisms, less attention has focused on the environmental determinants of crossover rates. Here, we test the effect of one ubiquitous environmental pressure-bacterial infection-on global recombination frequency in mammals. We applied MLH1 mapping to assay global crossover rates in male mice infected with the pathogenic bacterium Borrelia burgdorferi, the causative agent of Lyme Disease, and uninfected control animals. Despite ample statistical power to identify biologically relevant differences between infected and uninfected animals, we find no evidence for a global recombination rate response to bacterial infection. Moreover, broad-scale patterns of crossover distribution, including the number of achiasmate bivalents, are not affected by infection status. Although pathogen exposure can plastically increase recombination in some species, our findings suggest that recombination rates in house mice may be resilient to at least some forms of infection stress. This negative result motivates future experiments with alternative house mouse pathogens to evaluate the generality of this conclusion.

AcEST: DK956080 [AcEST

Lifescience Database Archive (English)

Full Text Available ABYR-binding protein OS=Mus... 33 0.85 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin... OS=... 33 1.1 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.1

Experiment list: SRX897943 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 153,97.9,13.9,15440 GSM1624628: ChIP seq Renilla Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

NCBI nr-aa BLAST: CBRC-CINT-01-0064 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0064 sp|Q9QY96|CASR_MOUSE Extracellular calcium-sensing receptor precu...rsor (CaSR) (Parathyroid Cell calcium-sensing receptor) gb|AAD28371.1|AF110178_1 calcium-sensing receptor [Mus musculus] Q9QY96 0.0 41% ...

AcEST: BP920102 [AcEST

Lifescience Database Archive (English)

Full Text Available DC04|RGS3_MOUSE Regulator of G-protein signaling 3 OS=Mus m... 32 1.9 sp|P87245|KMS1_SCHPO Karyoga...PAGQESTSQDPLLSQE 569 Query: 327 SP 332 P Sbjct: 570 PP 571 >sp|P87245|KMS1_SCHPO Karyogamy meiotic segregati

African Zoology - Vol 29, No 2 (1994)

African Journals Online (AJOL)

Population biology of house mice (Mus musculus L.) on sub-Antarctic Marion Island · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D.C. Matthewson, R.J. van Aarde, J.D. Skinner, 99-106 ...

Nordic Housing Enabler

DEFF Research Database (Denmark)

Helle, Tina; Brandt, Åse

Development and reliability testing of the Nordic Housing Enabler – an instrument for accessibility assessment of the physical housing. Tina Helle & Åse Brandt University of Lund, Health Sciences, Faculty of Medicine (SE) and University College Northern Jutland, Occupational Therapy department (DK......). Danish Centre for Assistive Technology. Abstract. For decades, accessibility to the physical housing environment for people with functional limitations has been of interest politically, professionally and for the users. Guidelines and norms on accessible housing design have gradually been developed......, however, the built environment shows serious deficits when it comes to accessibility. This study addresses development of a content valid cross-Nordic version of the Housing Enabler and investigation of inter-rater reliability, when used in occupational therapy practice. The instrument was translated from...

20 CFR 654.407 - Housing.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Housing. 654.407 Section 654.407 Employees... EMPLOYMENT SERVICE SYSTEM Housing for Agricultural Workers Housing Standards § 654.407 Housing. (a) Housing... occupants against the elements. (b) Housing shall have flooring constructed of rigid materials, smooth...

The role of outsourcing in the project house - mining house relationship

OpenAIRE

2008-01-01

M.Phil. The relationship between the Mining House / Owner and Project House can be spectacularly successful for both partners (and has resulted in the emergence of a few successful new project houses and plant operation companies all over the world), but can also be disastrous for both parties, if managed incorrectly. The main requirement for a successful relationship between a Mining- and Project House is that there must be something in it for both parties. This is not only measured in cu...

Potential implementation of light steel housing system for affordable housing project in Malaysia

Science.gov (United States)

Saikah, M.; Kasim, N.; Zainal, R.; Sarpin, N.; Rahim, M. H. I. A.

2017-11-01

An unparalleled number between housing demand and housing supply in Malaysia has increased the housing prices, which gives consequences to the homeownership issue. One way to reduce the housing price is by faster increase the number of affordable housing, but the construction sector faces difficulties in delivering as expected number by using conventional and current industrialised building system (IBS) due to the issue related high project cost, time and labour. Therefore, light steel housing (LSH) system as one of another type of IBS method can be utilised in housing construction project. This method can replace the conventional method that was currently used in the construction of affordable housing project. The objectives of this study are to identify the potential of LSH and influencing factors of system implementation. This is an initial stage to review the previous study related to LSH implementation in developed and developing countries. The previous study will be analysed regarding advantages and disadvantages of LSH and factors that influence the implementation of the system. Based on the literature review it is expected to define the potential and influencing factors of the LSH system. The findings are meaningful in framing and enhance construction housing method of an affordable housing project in Malaysia.

Assisted Housing - Housing Choice Vouchers by Tract - National Geospatial Data Asset (NGDA)

Data.gov (United States)

Department of Housing and Urban Development — The U.S. Department of Housing and Urban Development’s (HUD) Housing Choice Voucher Program (HCVP) is the federal government's major program for assisting very...

Behavioral and other phenotypes in a cytoplasmic Dynein light intermediate chain 1 mutant mouse.

Science.gov (United States)

Banks, Gareth T; Haas, Matilda A; Line, Samantha; Shepherd, Hazel L; Alqatari, Mona; Stewart, Sammy; Rishal, Ida; Philpott, Amelia; Kalmar, Bernadett; Kuta, Anna; Groves, Michael; Parkinson, Nicholas; Acevedo-Arozena, Abraham; Brandner, Sebastian; Bannerman, David; Greensmith, Linda; Hafezparast, Majid; Koltzenburg, Martin; Deacon, Robert; Fainzilber, Mike; Fisher, Elizabeth M C

2011-04-06

The cytoplasmic dynein complex is fundamentally important to all eukaryotic cells for transporting a variety of essential cargoes along microtubules within the cell. This complex also plays more specialized roles in neurons. The complex consists of 11 types of protein that interact with each other and with external adaptors, regulators and cargoes. Despite the importance of the cytoplasmic dynein complex, we know comparatively little of the roles of each component protein, and in mammals few mutants exist that allow us to explore the effects of defects in dynein-controlled processes in the context of the whole organism. Here we have taken a genotype-driven approach in mouse (Mus musculus) to analyze the role of one subunit, the dynein light intermediate chain 1 (Dync1li1). We find that, surprisingly, an N235Y point mutation in this protein results in altered neuronal development, as shown from in vivo studies in the developing cortex, and analyses of electrophysiological function. Moreover, mutant mice display increased anxiety, thus linking dynein functions to a behavioral phenotype in mammals for the first time. These results demonstrate the important role that dynein-controlled processes play in the correct development and function of the mammalian nervous system.

Peroral Echinococcus multilocularis egg inoculation in Myodes glareolus, Mesocricetus auratus and Mus musculus (CD-1 IGS and C57BL/6j)

DEFF Research Database (Denmark)

Woolsey, Ian David; Jensen, Per Moestrup; Deplazes, Peter

2016-01-01

Echinococcus multilocularis transmission predominantly occurs in Europe between the red fox (Vulpes vulpes) and various species of rodent intermediate hosts. We infected 3 species of rodent, Myodes glareolus (n = 47), Mesocricetus auratus (n = 11) and outbred Mus musculus (CD-1 IGS) (n = 9...

Spatial Analysis on Future Housing Markets: Economic Development and Housing Implications

Directory of Open Access Journals (Sweden)

Xin Liu

2014-01-01

Full Text Available A coupled projection method combining formal modelling and other statistical techniques was developed to delineate the relationship between economic and social drivers for net new housing allocations. Using the example of employment growth in Tyne and Wear, UK, until 2016, the empirical analysis yields housing projections at the macro- and microspatial levels (e.g., region to subregion to elected ward levels. The results have important implications for the strategic planning of locations for housing and employment, demonstrating both intuitively and quantitatively how local economic developments affect housing demand.

Social Housing Provision in Copenhagen

DEFF Research Database (Denmark)

Tsenkova, Sasha; Vestergaard, Hedvig

-profit housing providers, and a wide range of fiscal and regulatory instruments enhancing the competitive performance of the social housing sector. The research analyses recent housing policy measures and their impact on new social housing provision in Copenhagen. The emphasis is on the mix of housing policy......The paper provides an overview of trends and processes of change affecting new social housing provision in Denmark with a focus on Copenhagen. The local responses are reviewed within the context of changes to the unitary national housing system that functions with a robust range of private and non...... instruments implemented in three major policy domains-fiscal, financial and regulatory-to promote the production of new social housing. The system of new social housing provision is examined as a dynamic process of interaction between public and private institutions defining housing policy outcomes...

Experiment list: SRX897941 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 081,98.0,12.4,11292 GSM1624626: ChIP seq Chaf1a.166 Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

NCBI nr-aa BLAST: CBRC-XTRO-01-3247 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3247 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 69% ...

NCBI nr-aa BLAST: CBRC-MMUS-14-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-14-0085 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 99% ...

AcEST: BP917335 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Length = 993 Score = 42.4 bits (98),...THGEYTSAAE 635 >tr|Q9EQN5|Q9EQN5_RAT Antifreeze-enhancer binding protein AEP OS=Rattus norvegicus GN=Ighmbp2

The murine retinoblastoma homolog maps to chromosome 14 near Es-10

NARCIS (Netherlands)

Stone, J.C.; Crosby, J.J.; Kozak, C.A.; Schievella, A.R.; Bernards, R.A.; Nadeau, J.H.

1989-01-01

Restriction fragment length variants have been exploited to map genetically Rb-1, the murine homolog of the human retinoblastoma gene. Rb-1 localized to mouse chromosome 14 on the basis of results from analysis of somatic cell hybrids. In an interspecific backcross involving Mus spretus, Rb-1 and

Radon in Syrian houses

International Nuclear Information System (INIS)

Othman, I.; Hushari, M.; Raja, G.; Alsawaf, A.

1996-01-01

A nationwide investigation of radon levels in Syrian houses was carried out during the period 1991-1993. Passive radon diffusion dosemeters using polycarbonate detectors were distributed in houses all over Syria. Detectors were subjected to electrochemical etching to reveal latent tracks of alpha particles. The mean radon concentration in Syrian houses was found to be 45 Bq m -3 with some values several times higher. This investigation indicated that there were a few houses in Syria that require remedial action. Most houses that have high levels of radon were found in the southern area, especially in the Damascus governorate. The study also indicated that radon concentrations were higher in old houses built from mud with no tiling. (author)

Do housing regimes matter? : Assessing the concept of housing regimes through configurations of housing outcomes

NARCIS (Netherlands)

Dewilde, C.L.

2017-01-01

Based on a conceptualisation of de-commodification as the right to decent and affordable housing, we assessed to what extent this right is realised for low-to-moderate-income owners and renters across Western European housing regimes in 1995 and 2012. If differences in the social production of

Room temperature housing results in premature cancellous bone loss in growing female mice: implications for the mouse as a preclinical model for age-related bone loss.

Science.gov (United States)

Iwaniec, U T; Philbrick, K A; Wong, C P; Gordon, J L; Kahler-Quesada, A M; Olson, D A; Branscum, A J; Sargent, J L; DeMambro, V E; Rosen, C J; Turner, R T

2016-10-01

Room temperature housing (22 °C) results in premature cancellous bone loss in female mice. The bone loss was prevented by housing mice at thermoneutral temperature (32 °C). Thermogenesis differs markedly between mice and humans and mild cold stress induced by standard room temperature housing may introduce an unrecognized confounding variable into preclinical studies. Female mice are often used as preclinical models for osteoporosis but, in contrast to humans, mice exhibit cancellous bone loss during growth. Mice are routinely housed at room temperature (18-23 °C), a strategy that exaggerates physiological differences in thermoregulation between mice (obligatory daily heterotherms) and humans (homeotherms). The purpose of this investigation was to assess whether housing female mice at thermoneutral (temperature range where the basal rate of energy production is at equilibrium with heat loss) alters bone growth, turnover and microarchitecture. Growing (4-week-old) female C57BL/6J and C3H/HeJ mice were housed at either 22 or 32 °C for up to 18 weeks. C57BL/6J mice housed at 22 °C experienced a 62 % cancellous bone loss from the distal femur metaphysis during the interval from 8 to 18 weeks of age and lesser bone loss from the distal femur epiphysis, whereas cancellous and cortical bone mass in 32 °C-housed mice were unchanged or increased. The impact of thermoneutral housing on cancellous bone was not limited to C57BL/6J mice as C3H/HeJ mice exhibited a similar skeletal response. The beneficial effects of thermoneutral housing on cancellous bone were associated with decreased Ucp1 gene expression in brown adipose tissue, increased bone marrow adiposity, higher rates of bone formation, higher expression levels of osteogenic genes and locally decreased bone resorption. Housing female mice at 22 °C resulted in premature cancellous bone loss. Failure to account for species differences in thermoregulation may seriously confound interpretation of studies

38 CFR 18.445 - Housing.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Housing. 18.445 Section....445 Housing. (a) Housing provided by a recipient. A recipient that provides housing to its nonhandicapped students shall provide comparable, convenient, and accessible housing to qualified handicapped...

Hubungan Hiperglikemia dengan Prothrombin Time pada Mencit (Mus musculus yang Diinduksi Aloksan

Directory of Open Access Journals (Sweden)

Muhammad Ibnu Malik

2015-01-01

. Endothelial disfungtion can be detected by activated partial thromboplastin time (APTT and prothrombin time (PT. The objective of this studi was to determine the correlation between hyperglycemia and prothrombin time in mice (Mus musculus induced with aloxan. The design of this research was a post test only control group design conducted in October 2013 until February 2014 in Central Laboratory RS Dr. M. Djamil Padang. The subject were white mice (Mus musculus who have met the inclusion and exclusion criteria. The subject were divided as hyperglycemia group (induced with aloxan and control group. After seven days of adaptation, the aloxan was injected and measurenment of blood glucose and body weight had been done, one time in every four days. Then in day 30th the termination of mice had been done to meassure the prothrombin time. The result showed the prothrombin time between group was shortened with the average prothrombin time of the control group was 7,96 second and the hiperglicemia group was 8,12 second. The result showing no correlation between hyperglycemia and prothrombin time with the degree of signification is (p 0,7 (p > 0,05.Keywords: hyperglycemia, diabetes mellitus, prothrombin time,

Passive Immunization of Anti bZP3 (Zone Pellucida3 in Wistar Rat (Rattus novergicus and Mouse (Mus musculus

Directory of Open Access Journals (Sweden)

Y. Pantiwati

2012-12-01

Full Text Available This study was aimed at comparing the influence of anti bZP3’s passive immunization on anti-anti bZP3’s titer and pregnancy level on Wistar rats and mice. This study employed factorial design experiment with completely randomized design. The first factor was immunogenic type. The treated rats were immunized with 100 L anti bZP3 in 100 L Complete Freund’s Adjuvant (CFA, while the treated mice were injected with 50 L anti bZP3 in 50 L CFA. Control Wistar rats and mice were immunized with CFA and Incomplete Freund’s Adjuvant (IFA without anti bZP3. The second factor was animal type. The third factor was the length of serum incubation, i.e. 38, 49, 63, 86, 100, and 126 d. Dot blot on the treated Wistar rats and mice showed positive response proven by blue gradation; pre-immune mice as well as control Wistar rats and mice showed negative response proven by white gradation. The highest antibody titer in treated mouse serum was shown in 63 d incubation. The pregnancy on treated mice, control mice and Wistar rat occurred 100% until day 126; while the failure percentage on the treated mice was 4.5%. The pregnancy on treated mice occurred in 86 d incubation (1 rat, 100 d incubation (1 rat, and 126 d incubation (3 rats. Effective passive immunization on similar hospes occurred until day 63; while different hospes was ineffective. Antibodi anti-bZP3 was potential as a contraception through passive immunization on similar hospes.

Labour Mobility and Housing: The Impact of Housing Tenure and Housing Affordability on Labour Migration in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Lux, Martin; Sunega, Petr

2012-01-01

Roč. 49, č. 3 (2012), s. 489-504 ISSN 0042-0980 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : housing * housing policy * housing tenure Subject RIV: AO - Sociology, Demography Impact factor: 1.493, year: 2012 http://usj.sagepub.com/content/early/2011/05/20/0042098011405693

34 CFR 104.45 - Housing.

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false Housing. 104.45 Section 104.45 Education Regulations of... Postsecondary Education § 104.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall provide comparable, convenient, and accessible housing to...

45 CFR 605.45 - Housing.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 3 2010-10-01 2010-10-01 false Housing. 605.45 Section 605.45 Public Welfare... § 605.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall provide comparable, convenient, and accessible housing to handicapped students at...

Situation based housing

DEFF Research Database (Denmark)

Duelund Mortensen, Peder; Welling, Helen; Wiell Nordberg, Lene

2007-01-01

of the average family's lifestyle. These dwellings were ground-breaking when they were built, but today are clearly a product of their time. The reaction to functionalism and the postwar mass production gave rise to flexible dwelling with countless possibilities for room division. The housing of this period has...... characteristics which in the long run have proven to be unfortunate both in terms in terms of durability and architectural quality. Today there is a focus on the development of more open and functionally non-determined housing. A number of new housing schemes in and around Copenhagen reveal a variety...... of approaches to these goals. This working paper reviews not only a selection of new housing types, but also dwellings from the past, which each contain an aspect of changeability. Our study is based on information from users in the selected housing schemes, gathered from questionnaires, information about...

How healthy and sustainable is the Dutch housing mix? Measuring and comparing the theoretical housing market balance of Dutch regional housing markets

Directory of Open Access Journals (Sweden)

Leonie B. Janssen-Jansen

2015-01-01

Full Text Available Housing and its distribution over groups of households dominates debates on urban socio-spatial justice. Amsterdam even received the label ‘Just City’ as the large stock of social housing in the core of the city is said to increase societal equity. Within the Netherlands, however, the Greater Amsterdam housing market is perceived to be the most dysfunctional. As the discussion is fed by highly political and ideological perspectives, it is difficult to assess at face value how balanced the housing mix of a housing market is and to what extent it meets the community’s needs. Consequently, it is difficult to inform politicians about strategies that contribute to a healthy and sustainable housing mix and address the lack of affordable housing which is high on urban policy agendas worldwide. In an attempt to go beyond ideological and political discussions, the aim of this interdisciplinary paper is to develop a metric to measure and compare the theoretical balance of housing markets across regions and across groups of households based on income. The metric will be applied to the case of the Netherlands. The findings of the theoretical model show that large-scale provisions for low-income households may not always result in an improved housing market balance.

75 FR 5706 - Federal Housing Administration: Insurance for Manufactured Housing: Reopening of Public Comment...

Science.gov (United States)

2010-02-04

... 2502-AI45 Federal Housing Administration: Insurance for Manufactured Housing: Reopening of Public.... ACTION: Proposed rule; reopening of public comment period. SUMMARY: On September 15, 2008, HUD published a proposed rule entitled ``Federal Housing Administration: Insurance for Manufactured Housing.'' The...

Epigenetic interplay between mouse endogenous retroviruses and host genes.

Science.gov (United States)

Rebollo, Rita; Miceli-Royer, Katharine; Zhang, Ying; Farivar, Sharareh; Gagnier, Liane; Mager, Dixie L

2012-10-03

Transposable elements are often the targets of repressive epigenetic modifications such as DNA methylation that, in theory, have the potential to spread toward nearby genes and induce epigenetic silencing. To better understand the role of DNA methylation in the relationship between transposable elements and genes, we assessed the methylation state of mouse endogenous retroviruses (ERVs) located near genes. We found that ERVs of the ETn/MusD family show decreased DNA methylation when near transcription start sites in tissues where the nearby gene is expressed. ERVs belonging to the IAP family, however, are generally heavily methylated, regardless of the genomic environment and the tissue studied. Furthermore, we found full-length ETn and IAP copies that display differential DNA methylation between their two long terminal repeats (LTRs), suggesting that the environment surrounding gene promoters can prevent methylation of the nearby LTR. Spreading from methylated ERV copies to nearby genes was rarely observed, with the regions between the ERVs and genes apparently acting as a boundary, enriched in H3K4me3 and CTCF, which possibly protects the unmethylated gene promoter. Furthermore, the flanking regions of unmethylated ERV copies harbor H3K4me3, consistent with spreading of euchromatin from the host gene toward ERV insertions. We have shown that spreading of DNA methylation from ERV copies toward active gene promoters is rare. We provide evidence that genes can be protected from ERV-induced heterochromatin spreading by either blocking the invasion of repressive marks or by spreading euchromatin toward the ERV copy.

24 CFR 3.405 - Housing.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Housing. 3.405 Section 3.405 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 3.405 Housing. (a) Generally...

The architects house

DEFF Research Database (Denmark)

Welling, Helen

2007-01-01

The architects house is an article on Edward Heiberg's own house built in 1924. Edward Heiberg was a strong advocate of functionalism, and of the notion that hitherto individualistic and emotional architecture should be replaced by an objective function-based architecture with dwellings...... for everyone. In 1924 he designed a house for himself and his family: one of the first examples of functionalism in Denmark....

TARP Monthly Housing Scorecard

Data.gov (United States)

Department of the Treasury — Treasury and the U.S. Department of Housing and Urban Development (HUD) jointly produce a Monthly Housing Scorecard on the health of the nation’s housing market. The...

Assisted Housing - Public Housing Buildings - National Geospatial Data Asset (NGDA)

Data.gov (United States)

Department of Housing and Urban Development — The approximate physical location of each individual Public Housing Building. If the building has more than one entrance or street address, the address of the...

Inadequate housing in Ghana

Directory of Open Access Journals (Sweden)

Franklin Obeng-Odoom

2011-01-01

Full Text Available Two themes are evident in housing research in Ghana. One involves the study of how to increase the number of dwellings to correct the overall housing deficit, and the other focuses on how to improve housing for slum dwellers. Between these two extremes, there is relatively little research on why the existing buildings are poorly maintained. This paper is based on a review of existing studies on inadequate housing. It synthesises the evidence on the possible reasons for this neglect, makes a case for better maintenance and analyses possible ways of reversing the problem of inadequate housing.

Student Housing a Resilient Housing Rental Market: Case of Federal Polytechnic Neighbourhood Bauchi, Nigeria

Directory of Open Access Journals (Sweden)

Zubairu Abubakar Ghani

2018-03-01

Full Text Available In the last three decades globally higher institutions (HIs have been experiencing an unprecedented upsurge in student population and student enrolment in His generally outstrip the HIs student housing. In many countries of the world like Nigeria, HIs are obviously incapacitated in accommodating the growing student population which compelled numerous students to overflow into their HIs’ neighbourhood seeking for alternative housing accommodation in the private housing rental market. Indeed the scenario of HIs student's housing shortfalls and increasing students housing demand evolved the interest of many people in a student housing rental market. This is because it has been uncovered that business in student housing rental is lucrative and guaranteeing business that ensured profit for a long term. This paper, therefore, explores the nature and landscape of student housing rental in Nigeria where the business is immature then drawn the conclusion.

Assisted Housing - Multifamily Properties - Assisted

Data.gov (United States)

Department of Housing and Urban Development — HUD's Multifamily Housing property portfolio consist primarily of rental housing properties with five or more dwelling units such as apartments or town houses, but...

Experiment list: SRX218536 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available strain=C57Bl/6 || age/gender=2-3 month old males || chip antibody=Santa Cruz Tech. rIgG (sc-2027) http://db....7,16.5,1194 GSM1067409: Rabbit IgG mouse liver ChIP-seq; Mus musculus; ChIP-Seq GEO Accession=GSM1067409 ||

24 CFR 1715.27 - Fair housing.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Fair housing. 1715.27 Section 1715.27 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN...

Friendly vertical housing: case of walk-up flat housing development in Yogyakarta

Science.gov (United States)

Fosterharoldas Swasto, Deva

2018-03-01

In Yogyakarta Province, the local government have developed walk-up flats housing for more than ten years since the mid of the 2000s. Yogyakarta City and Sleman Regency was pioneering the construction with some blocks of flats in several locations. However, after this period, there is limited evaluation about the effectiveness of the occupancy. One of the issues is related to the sustainable housing development. Concerning this situation, it is proposed to examine how the development of walk-up flats housing in Yogyakarta City and Sleman Regency can be evaluated based on specific housing indicator, as a part of sustainable housing development concept. This paper would like to explore the phenomenon on how ‘friendly’ the flats is. The researcher will qualitatively asses variables from the walk-up flat cases in Yogyakarta City and Sleman Regency. The results suggested that the physical quality of the vertical housing situation could be enhanced to meet residents’ satisfaction.

Mouse allergen exposure and immunologic responses: IgE-mediated mouse sensitization and mouse specific IgG and IgG4 levels

NARCIS (Netherlands)

Matsui, Elizabeth C.; Krop, Esmeralda J. M.; Diette, Gregory B.; Aalberse, Rob C.; Smith, Abigail L.; Eggleston, Peyton A.

2004-01-01

Although there is evidence that contact with mice is associated with IgE-mediated mouse sensitization and mouse specific antibody responses, the exposure-response relationships remain unclear. To determine whether IgE-mediated mouse sensitization and mouse specific IgG (mIgG) and mIgG4 levels

American Housing Survey (AHS)

Data.gov (United States)

Department of Housing and Urban Development — The AHS is the largest, regular national housing sample survey in the United States. The U.S. Census Bureau conducts the AHS to obtain up-to-date housing statistics...

United States housing, 2012

Science.gov (United States)

Delton Alderman

2013-01-01

Provides current and historical information on housing market in the United States. Information includes trends for housing permits and starts, housing completions for single and multifamily units, and sales and construction. This report will be updated annually.

"House Arrest" or "Developmental Arrest"? A Study of Youth Under House Arrest.

Science.gov (United States)

Chamiel, Elad; Walsh, Sophie D

2018-06-01

Studies have examined the potential benefits and risks of alternative forms of detention, such as house arrest, for adults but, despite its growing use, little research has examined the implications of house arrest for juveniles. The current research examined the experience of 14 adolescents under house arrest. Six main themes were identified in the narratives of the participants: the experience of detention, daily schedule and utilization of time, emotions and self-reflection, relationships with peers, relation to parents and supervisor(s), and contact with professionals. Findings emphasized the potential developmental dangers of house arrest at the critical stage of adolescence. Yet, analysis also showed that the period of house arrest has the potential to be a period of positive changes, and can be used for successful rehabilitation.

Assisted Housing - Low Income Housing Tax Credit Properties - National Geospatial Data Asset (NGDA)

Data.gov (United States)

Department of Housing and Urban Development — The Low-Income Housing Tax Credit (LIHTC) is the primary Federal program for creating affordable housing in the United States. The LIHTC database, created by HUD and...

A Painted House In Ankara: Dedebayrak House

Directory of Open Access Journals (Sweden)

Muzaffer Karaaslan

2016-06-01

Full Text Available The conservative family lifestyle in the Ottoman State affected the ways that houses were planned and decorated. Different decorative programs emerged with major differences in each period. New techniques and styles began to be seen in the 18th century thanks to the influence of the West. This article will focus on the decoration of Dedebayrak House in Ankara. Decoration in the architecture found within the boundaries of Ankara consist mostly of geometrical or floral decorations and various inscriptions. The Dedebayrak House not only has these kind of decorations, but also it has these decorations in its architectural descriptions, so it makes this house the only one to have survived in Ankara. Moreover, this building is especially important as the décor included work belonging to Nakkaş Mustafa. However, these decorative features do not remain today. The situation in Turkey is such that architecture is not conserved, which leads to many historically important buildings vanishing. Neither local authorities, nor the owner of these buildings look after these buildings properly, leading their specific historical features to be lost. This situation both damages the urban fabric and harms the historical heritage of the city. Therefore, decorative features in the building will be analysed both on their own and compared to other buildings in Ankara in order to create an overall picture.

Onset and progress of meiotic prophase in the oocytes in the B6.YTIR sex-reversed mouse ovary.

Science.gov (United States)

Park, E-H; Taketo, T

2003-12-01

When the Y chromosome of a Mus musculus domesticus male mouse (caught in Tirano, Italy) is placed on a C57BL/6J genetic background, approximately half of the XY (B6.YTIR) progeny develop into normal-appearing but infertile females. We have previously reported that the primary cause of infertility can be attributed to their oocytes. To identify the primary defect in the XY oocyte, we examined the onset and progress of meiotic prophase in the B6.YTIR fetal ovary. Using bromo-deoxyuridine incorporation and culture, we determined that the germ cells began to enter meiosis at the developmental ages and in numbers comparable to those in the control XX ovary. Furthermore, the meiotic prophase appeared to progress normally until the late zygotene stage. However, the oocytes that entered meiosis early in the XY ovary failed to complete the meiotic prophase. On the other hand, a considerable number of oocytes entered meiosis at late developmental stages and completed the meiotic prophase in the XY ovary. We propose that the timing of entry into meiosis and the XY chromosomal composition influence the survival of oocytes during meiotic prophase in the fetal ovary.

Is Housing a Health Insult?

Science.gov (United States)

Baker, Emma; Beer, Andrew; Lester, Laurence; Pevalin, David; Whitehead, Christine; Bentley, Rebecca

2017-05-26

In seeking to understand the relationship between housing and health, research attention is often focussed on separate components of people's whole housing 'bundles'. We propose in this paper that such conceptual and methodological abstraction of elements of the housing and health relationship limits our ability to understand the scale of the accumulated effect of housing on health and thereby contributes to the under-recognition of adequate housing as a social policy tool and powerful health intervention. In this paper, we propose and describe an index to capture the means by which housing bundles influence health. We conceptualise the index as reflecting accumulated housing 'insults to health'-an Index of Housing Insults (IHI). We apply the index to a sample of 1000 low-income households in Australia. The analysis shows a graded association between housing insults and health on all outcome measures. Further, after controlling for possible confounders, the IHI is shown to provide additional predictive power to the explanation of levels of mental health, general health and clinical depression beyond more traditional proxy measures. Overall, this paper reinforces the need to look not just at separate housing components but to embrace a broader understanding of the relationship between housing and health.

Adventure of Architecture Example of Housing and Housing Areas

Directory of Open Access Journals (Sweden)

Ali Asasoğlu

2013-08-01

Full Text Available Housing and the concept of space associated with this requirement are among the initial attitudes towards the human reign over the nature. The dawn of the structured environment found life with this approach within the nature. Both, housing and the housing design process overlap with the historical development of modern man, and is covered within the concept of architecture today. The contribution made by culture within this period is yet another undeniable fact. While the interaction between architecture and culture are moving forward thereby leaving traces in every era throughout the history, the culture of housing and housing design exhibits a parallel attitude which is a subsidiary, yet a highly title with a close human relationship. Culture and architecture are two closely interacting aspects which are drawing the borders of each other from time to time, hinting at quality and quantity, and evaluating such. Quite naturally, the structure which is in a deep relationship with mankind is in an exchange with all physical, social and economic qualities of the human. These qualities are fundamental determinants of the concept of culture as a human trait. The process of architecture which is usually defined as a sequence of eras that involve social movements, impulses and trends, sometimes kept moving ahead in the pursuit of individual leadership and styles. The concerns regarding the solution of space problems, setting up /designing venues and arranging the environment in line with the requirements brought up increasingly complex issues and stacks of solutions which follow such problems. It is this dynamic structure which forms the basis of the architectural problem to date. Starting with the housing and residential concepts, this study brings a critical view on the application samples and methods of the relationship between architecture and culture in terms of our country in particular while putting emphasis on the architectural venture of the

Performance analysis on natural energy autonomous house, HARBEMAN house; Shizen energy jiritsu house (HARBEMAN house) no simulation ni kansuru kenkyu

Energy Technology Data Exchange (ETDEWEB)

Fujino, T; Saito, T [Tohoku University, Sendai (Japan)

1997-11-25

Outlined herein are a procedure developed to simulate performance of an energy-autonomous (independent) solar house referred to as HARBEMAN HOUSE (HH) built in 1996 in City of Sendai, comparison between the simulated and observed results, and characteristics of the solar house. The house is equipped with a solar collector and sky radiator, both installed on the roof, the former facing south to collect solar energy and generate hot water whereas the latter facing north to radiate heat and generate cool water. Both are connected to an underground heat-insulated tank having a capacity of 31m{sup 3}, which stores hot or cool water to keep their conditions for extended periods. The solar system operates in heat- or cool-storage mode. In the heat-storage mode, quantity of heat stored increases, although at a slow rate, as tank capacity increases. In the cool-storage mode, on the other hand, quantity of cool stored increases in proportion to tank capacity. This is because solar energy is collected throughout the year whereas cooling by radiation is concentrated in early spring. Loss rate of heat stored increases as tank capacity increases, and the opposite trend is observed with cool stored. 12 refs., 7 figs., 2 tabs.

In-Migration and Housing Choice in Ho Chi Minh City: Toward Sustainable Housing Development in Vietnam

Directory of Open Access Journals (Sweden)

Ducksu Seo

2017-09-01

Full Text Available Since the initiation of Vietnam’s Doi Moi policy in 1986, the rate of urbanization has rapidly increased with a great influx of immigrants from rural areas. With such migration becoming a large acceleration factor for urban growth, the shortage of housing has become a critical problem in the cities. The Vietnamese government encouraged self-built housing and public–private partnerships to produce different types of housing stock. There are few available academic studies about housing choice in Vietnam to help understand movement dynamics and to foster sustainable housing development. The purpose of this study is to analyze housing choice and moving determinants in Ho Chi Minh City, and thereby establish recommendations for sustainable housing development in Vietnam. For an empirical study, a citizen questionnaire survey was conducted in HCMC and an in-depth analysis was carried out. The results indicate that the row house type for single-family housing is strongly preferred, but a preference for apartments is also observed for future planning. The factors influencing housing choice and movement are family income, housing ownership, housing typology, and commuting environment. These phenomena suggest that the government should prudently consider affordable housing development in many districts. The results of this study will help to establish policies for sustainable housing development in Ho Chi Minh City, Vietnam.

Housing Programs for Homeless Individuals With Mental Illness: Effects on Housing and Mental Health Outcomes.

Science.gov (United States)

Benston, Elizabeth A

2015-08-01

This systematic review analyzed the best available research in the United States on permanent supportive housing programs for homeless individuals with mental illness and the effect of these programs on housing status and mental health. It updates older and broader reviews that included weaker studies or those that did not analyze permanent housing as an input and housing and mental health as primary outcomes. The literature search (1980-2013) yielded 14 studies (randomized controlled trials and quasi-experimental studies). The studies found that a majority of participants placed in experimental housing programs with case management support remained in housing for at least one year or experienced more days housed than homeless relative to a comparison group. Although this finding is in line with previous literature reviews on permanent supportive housing, this analysis found limitations in each of the 14 reviewed studies, such as attrition, selection and response bias, imprecise definitions and implementation of housing programs, and a lack of appropriate controls. Only three of the reviewed studies reported using a housing fidelity assessment tool to test whether the housing intervention was faithful to theoretical standards, and conceptions and implementation of housing varied widely across studies, threatening internal and external validity. Pitfalls in the best available studies on permanent supportive housing programs in the United States limit the ability of research to inform the policy goal of ending chronic homelessness and demonstrate a need for further experimental research upon which to make funding and policy decisions, especially in light of prioritized federal funds.