A SPITZER SURVEY FOR DUST IN TYPE IIn SUPERNOVAE
International Nuclear Information System (INIS)
Fox, Ori D.; Chevalier, Roger A.; Skrutskie, Michael F.; Soderberg, Alicia M.; Filippenko, Alexei V.; Ganeshalingam, Mohan; Silverman, Jeffrey M.; Smith, Nathan; Steele, Thea N.
2011-01-01
Recent observations suggest that Type IIn supernovae (SNe IIn) may exhibit late-time (>100 days) infrared (IR) emission from warm dust more than other types of core-collapse SNe. Mid-IR observations, which span the peak of the thermal spectral energy distribution, provide useful constraints on the properties of the dust and, ultimately, the circumstellar environment, explosion mechanism, and progenitor system. Due to the low SN IIn rate (<10% of all core-collapse SNe), few IR observations exist for this subclass. The handful of isolated studies, however, show late-time IR emission from warm dust that, in some cases, extends for five or six years post-discovery. While previous Spitzer/IRAC surveys have searched for dust in SNe, none have targeted the Type IIn subclass. This paper presents results from a warm Spitzer/IRAC survey of the positions of all 68 known SNe IIn within a distance of 250 Mpc between 1999 and 2008 that have remained unobserved by Spitzer more than 100 days post-discovery. The detection of late-time emission from 10 targets (∼15%) nearly doubles the database of existing mid-IR observations of SNe IIn. Although optical spectra show evidence for new dust formation in some cases, the data show that in most cases the likely origin of the mid-IR emission is pre-existing dust, which is continuously heated by optical emission generated by ongoing circumstellar interaction between the forward shock and circumstellar medium. Furthermore, an emerging trend suggests that these SNe decline at ∼1000-2000 days post-discovery once the forward shock overruns the dust shell. The mass-loss rates associated with these dust shells are consistent with luminous blue variable progenitors.
A Spitzer Survey for Dust in Type IIn Supernovae
Fox, Ori D.; Chevalier, Roger A.; Skrutskie, Michael F.; Soderberg, Alicia M.; Filippenko, Alexei V.; Ganeshalingam, Mohan; Silverman, Jeffrey M.; Smith, Nathan; Steele, Thea N.
2011-01-01
Recent observations suggest that Type IIn supernovae (SNe IIn) may exhibit late-time (greater than 100 days) infrared (IR) emission from warm dust more than other types of core-collapse SNe. Mid-IR observations, which span the peak of the thermal spectral energy distribution, provide useful constraints on the properties of the dust and, ultimately, the circumstellar environment, explosion mechanism, and progenitor system. Due to the low SN IIn rate (less than 10% of all core-collapse SNe), few IR observations exist for this subclass. The handful of isolated studies, however, show late-time IR emission from warm dust that, in some cases, extends for five or six years post-discovery. While previous Spitzer/IRAC surveys have searched for dust in SNe, none have targeted the Type IIn subclass. This article presents results from a warm Spitzer/IRAC survey of the positions of all 68 known SNe IIn within a distance of 250 Mpc between 1999 and 2008 that have remained unobserved by Spitzer more than 100 days postdiscovery. The detection of late-time emission from ten targets (approximately 15%) nearly doubles the database of existing mid-IR observations of SNe IIn. Although optical spectra show evidence for new dust formation in some cases, the data show that in most cases the likely origin of the mid-IR emission is pre-existing dust, which is continuously heated by optical emission generated by ongoing circumstellar interaction between the forward shock and circumstellar medium. Furthermore, an emerging trend suggests that these SNe decline at approximately 1000-2000 days post-discovery once the forward shock overruns the dust shell. The mass-loss rates associated with these dust shells are consistent with luminous blue variable (LBV) progenitors.
Point-source and diffuse high-energy neutrino emission from Type IIn supernovae
Petropoulou, M.; Coenders, S.; Vasilopoulos, G.; Kamble, A.; Sironi, L.
2017-09-01
Type IIn supernovae (SNe), a rare subclass of core collapse SNe, explode in dense circumstellar media that have been modified by the SNe progenitors at their last evolutionary stages. The interaction of the freely expanding SN ejecta with the circumstellar medium gives rise to a shock wave propagating in the dense SN environment, which may accelerate protons to multi-PeV energies. Inelastic proton-proton collisions between the shock-accelerated protons and those of the circumstellar medium lead to multimessenger signatures. Here, we evaluate the possible neutrino signal of Type IIn SNe and compare with IceCube observations. We employ a Monte Carlo method for the calculation of the diffuse neutrino emission from the SN IIn class to account for the spread in their properties. The cumulative neutrino emission is found to be ˜10 per cent of the observed IceCube neutrino flux above 60 TeV. Type IIn SNe would be the dominant component of the diffuse astrophysical flux, only if 4 per cent of all core collapse SNe were of this type and 20-30 per cent of the shock energy was channeled to accelerated protons. Lower values of the acceleration efficiency are accessible by the observation of a single Type IIn SN as a neutrino point source with IceCube using up-going muon neutrinos. Such an identification is possible in the first year following the SN shock breakout for sources within 20 Mpc.
EARLY ULTRAVIOLET OBSERVATIONS OF A TYPE IIn SUPERNOVA (2007pk)
International Nuclear Information System (INIS)
Pritchard, T. A.; Roming, P. W. A.; Brown, P. J.; Kuin, N. P. M.; Oates, S. R.; Bayless, Amanda J.; Holland, S. T.; Immler, S.; Milne, P.
2012-01-01
We present some of the earliest UV observations of a Type IIn supernova (SN)—SN 2007pk, where UV and optical observations using Swift's Ultra-Violet/Optical Telescope began 3 days after discovery or ∼5 days after shock breakout. The SN observations commence at approximately maximum light in the UV and u-band filters, suggesting that the UV light curve peaks begin very rapidly after the initial explosion, and subsequently exhibit a linear decay of 0.20, 0.21, 0.16 mag day –1 in the UVOT uvw2, uvm2, uvw1 (λ c = 1928, 2246, 2600 Å) filters. Meanwhile the b- and v-band light curves begin approximately seven days before v-band peak and exhibit a shallow rise followed by a subsequent decay. A series of optical/near-IR spectra taken with the Hobby-Eberly Telescope at days 3-26 after discovery show spectra similar to that of the peculiar Type IIn 1998S. The emission from 2007pk falls below detection ∼20 days after discovery in the UV and 50 days in the optical, showing no sign of the long duration emission seen in other Type IIn SNe. We examine the physical and spectral characteristics of 2007pk and compare its UV light curve and decay rate with other Type II SNe.
SN 2008iy: An Unusual Type IIn Supernova with an Enduring 400 Day Rise Time
Miller, A. A.; Silverman, J. M.; Butler, N. R.; Bloom, J. S.; Chornock, R.; Filippenko, A. V.; Ganeshalingam, M.; Klein, C. R.; Li, W.; Nugent, P. E.; Smith, N.; Steele, T. N.
2009-01-01
We present spectroscopic and photometric observations of the Type IIn supernova (SN) 2008iy. SN 2008iy showed an unprecedentedly long rise time of ~400 days, making it the first SN to take significantly longer than 100 days to reach peak optical luminosity. The peak absolute magnitude of SN 2008iy was M_r ~ -19.1 mag, and the total radiated energy over the first ~700 days was ~2 x 10^50 erg. Spectroscopically, SN 2008iy is very similar to the Type IIn SN 1988Z at late times, and, like SN 1988...
Energy Technology Data Exchange (ETDEWEB)
Ofek, Eran O.; Steinbok, Aviram; Arcavi, Iair; Gal-Yam, Avishay; Tal, David; Ben-Ami, Sagi; Yaron, Ofer [Benoziyo Center for Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel); Sullivan, Mark [School of Physics and Astronomy, University of Southampton, Southampton SO17 1BJ (United Kingdom); Shaviv, Nir J. [Racah Institute of Physics, The Hebrew University, 91904 Jerusalem (Israel); Kulkarni, Shrinivas R. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Nugent, Peter E. [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Kasliwal, Mansi M. [Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Cenko, S. Bradley [Astrophysics Science Division, NASA/Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Laher, Russ; Surace, Jason [Spitzer Science Center, California Institute of Technology, M/S 314-6, Pasadena, CA 91125 (United States); Bloom, Joshua S.; Filippenko, Alexei V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Silverman, Jeffrey M. [Department of Astronomy, University of Texas, Austin, TX 78712 (United States)
2014-07-10
There is a growing number of Type IIn supernovae (SNe) which present an outburst prior to their presumably final explosion. These precursors may affect the SN display, and are likely related to poorly charted phenomena in the final stages of stellar evolution. By coadding Palomar Transient Factory (PTF) images taken prior to the explosion, here we present a search for precursors in a sample of 16 Type IIn SNe. We find five SNe IIn that likely have at least one possible precursor event (PTF 10bjb, SN 2010mc, PTF 10weh, SN 2011ht, and PTF 12cxj), three of which are reported here for the first time. For each SN we calculate the control time. We find that precursor events among SNe IIn are common: at the one-sided 99% confidence level, >50% of SNe IIn have at least one pre-explosion outburst that is brighter than 3 × 10{sup 7} L{sub ☉} taking place up to 1/3 yr prior to the SN explosion. The average rate of such precursor events during the year prior to the SN explosion is likely ≳ 1 yr{sup –1}, and fainter precursors are possibly even more common. Ignoring the two weakest precursors in our sample, the precursors rate we find is still on the order of one per year. We also find possible correlations between the integrated luminosity of the precursor and the SN total radiated energy, peak luminosity, and rise time. These correlations are expected if the precursors are mass-ejection events, and the early-time light curve of these SNe is powered by interaction of the SN shock and ejecta with optically thick circumstellar material.
Multi-wavelength Observations of the Enduring Type IIn Supernovae 2005ip and 2006jd
DEFF Research Database (Denmark)
Stritzinger, Maximilian; Taddia, Francesco; Fransson, Claes
2012-01-01
We present an observational study of the Type IIn supernovae (SNe IIn) 2005ip and 2006jd. Broadband UV, optical, and near-IR photometry, and visual-wavelength spectroscopy of SN 2005ip complement and extend upon published observations to 6.5 years past discovery. Our observations of SN 2006jd...... extend from UV to mid-infrared wavelengths, and like SN 2005ip, are compared to reported X-ray measurements to understand the nature of the progenitor. Both objects display a number of similarities with the 1988Z-like subclass of SN IIn including (1) remarkably similar early- and late-phase optical...... spectra, (2) a variety of high-ionization coronal lines, (3) long-duration optical and near-IR emission, and (4) evidence of cold and warm dust components. However, diversity is apparent, including an unprecedented late-time r-band excess in SN 2006jd. The observed differences are attributed...
Detection of a Type IIn Supernova in Optical Follow-up Observations of IceCube Neutrino Events
Aartsen, M. G.; Abraham, K.; Ackermann, M.; Adams, J.; Aguilar, J. A.; Ahlers, M.; Ahrens, M.; Altmann, D.; Anderson, T.; Archinger, M.; Arguelles, C.; Arlen, T. C.; Auffenberg, J.; Bai, X.; Barwick, S. W.
2015-01-01
The IceCube neutrino observatory pursues a follow-up program selecting interesting neutrino events in real-time and issuing alerts for electromagnetic follow-up observations. In 2012 March, the most significant neutrino alert during the first three years of operation was issued by IceCube. In the follow-up observations performed by the Palomar Transient Factory (PTF), a Type IIn supernova (SN IIn) PTF12csy was found 0.degrees 2 away from the neutrino alert direction, with an error radius of 0...
SN 2009kn - the twin of the Type IIn supernova 1994W
DEFF Research Database (Denmark)
Kankare, E.; Ergon, M.; Bufano, F.
2012-01-01
We present an optical and near-infrared photometric and spectroscopic study of supernova (SN) 2009kn spanning ~1.5 yr from the discovery. The optical spectra are dominated by the narrow (full width at half-maximum ~1000 km s^-1) Balmer lines distinctive of a Type IIn SN with P Cygni profiles. Con...
THE 2012 RISE OF THE REMARKABLE TYPE IIn SN 2009ip
International Nuclear Information System (INIS)
Prieto, José L.; Brimacombe, J.; Drake, A. J.; Howerton, S.
2013-01-01
Recent observations by Mauerhan et al. have shown the unprecedented transition of the previously identified luminous blue variable (LBV) and supernova (SN) impostor SN 2009ip to a real Type IIn SN explosion. We present ∼100 optical R- and I-band photometric measurements of SN 2009ip obtained between UT 2012 September 23.6 and October 9.6, using 0.3-0.4 m aperture telescopes from the Coral Towers Observatory in Cairns, Australia. The light curves show well-defined phases, including very rapid brightening early on (0.5 mag in 6 hr observed during the night of September 24), a transition to a much slower rise between September 25 and September 28, and a plateau/peak around October 7. These changes are coincident with the reported spectroscopic changes that most likely mark the start of a strong interaction between the fast SN ejecta and a dense circumstellar medium formed during the LBV eruptions observed in recent years. In the 16-day observing period, SN 2009ip brightened by 3.7 mag from I = 17.4 mag on September 23.6 (M I ≅ –14.2) to I = 13.7 mag (M I ≅ –17.9) on October 9.6, radiating ∼3 × 10 49 erg in the optical wavelength range. As of 2012 October 9.6, SN 2009ip is more luminous than most Type IIP SN and comparable to other Type IIn SN.
Smith, Nathan; Hinkle, Kenneth H.; Ryde, Nils
2009-03-01
We present high-resolution 4.6 μm CO spectra of the circumstellar environments of two red supergiants (RSGs) that are potential supernova (SN) progenitors: Betelgeuse and VY Canis Majoris (VY CMa). Around Betelgeuse, 12CO emission within ±3'' (±12 km s-1) follows a mildly clumpy but otherwise spherical shell, smaller than its ~55'' shell in K I λ7699. In stark contrast, 4.6 μm CO emission around VY CMa is coincident with bright K I in its clumpy asymmetric reflection nebula, within ±5'' (±40 km s-1) of the star. Our CO data reveal redshifted features not seen in K I spectra of VY CMa, indicating a more isotropic distribution of gas punctuated by randomly distributed asymmetric clumps. The relative CO and K I distribution in Betelgeuse arises from ionization effects within a steady wind, whereas in VY CMa, K I is emitted from skins of CO cloudlets resulting from episodic mass ejections 500-1000 yr ago. In both cases, CO and K I trace potential pre-SN circumstellar matter: we conclude that an extreme RSG like VY CMa might produce a Type IIn event like SN 1988Z if it were to explode in its current state, but Betelgeuse will not. VY CMa demonstrates that luminous blue variables are not necessarily the only progenitors of SNe IIn, but it underscores the requirement that SNe IIn suffer enhanced episodic mass loss shortly before exploding. Based on observations obtained at the Gemini Observatory.
An Analysis of the Peculiar Type IIn Supernova 1995N
Baird, M. D.; Garnavich, P. M.; Schlegel, E. M.; Challis, P. M.; Kirshner, R. P.
1998-12-01
SN 1995N is a peculiar type IIn supernova. Spectroscopic and photometric data for this analysis were gathered between May 10, 1995 (two days after discovery) and July 18, 1998. A total of twenty two photometric images and eight spectra were obtained at the FLWO and MMTO. The photometric data show a broad maximum at R=17.0 occurred in late October, 1995, followed by a very slow decline at a rate of 2.39 millimag-day(-1) for R and 1.37 millimag-day(-1) for V. The R decay rate corresponds to a half life of 315 days, which is much longer than that of (56) Co. The spectra show broad hydrogen (1500 km/s FWHM) and oxygen (10000 km/s FWZI) emission features along with many unresolved emission lines. Some of the more interesting narrow lines identified correspond to high ionization states for iron such as Fe VII and Fe X which indicate temperatures as high as 10(6) degrees K. These high ionization states, the X-ray detection by Lewin et al. (1996, IAUC 6445) and the slow photometric decay suggest that SN 1995N is powered by a shock propagating through a dense circumstellar environment. From the earliest observations the energy output appears dominated by the interaction and not by radioactivity, implying that the progenitor exploded well before the discovery of SN 1995N. The situation may be similar to SN 1987A, where the rise in emission from a circumstellar interaction is only now beginning and is expected to peak some 15 years after the supernova explosion.
X-RAY AND RADIO EMISSION FROM TYPE IIn SUPERNOVA SN 2010jl
Energy Technology Data Exchange (ETDEWEB)
Chandra, Poonam [National Centre for Radio Astrophysics, Tata Institute of Fundamental Research, Pune University Campus, Pune 411 007 (India); Chevalier, Roger A. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Chugai, Nikolai [Institute of Astronomy of Russian Academy of Sciences, Pyatnitskaya St. 48, 109017 Moscow (Russian Federation); Fransson, Claes [Oskar Klein Centre, Department of Astronomy, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Soderberg, Alicia M., E-mail: poonam@ncra.tifr.res.in [Smithsonian Astrophysical Observatory, 60 Garden St., MS-20, Cambridge, MA 02138 (United States)
2015-09-01
We present all X-ray and radio observations of the Type IIn supernova SN 2010jl. The X-ray observations cover a period up to day 1500 with Chandra, XMM-Newton, NuSTAR, and Swift-X-ray Telescope (XRT). The Chandra observations after 2012 June, the XMM-Newton observation in 2013 November, and most of the Swift-XRT observations until 2014 December are presented for the first time. All the spectra can be fitted by an absorbed hot thermal model except for Chandra spectra on 2011 October and 2012 June when an additional component is needed. Although the origin of this component is uncertain, it is spatially coincident with the supernova and occurs when there are changes to the supernova spectrum in the energy range close to that of the extra component, indicating that the emission is related to the supernova. The X-ray light curve shows an initial plateau followed by a steep drop starting at day ∼300. We attribute the drop to a decrease in the circumstellar density. The column density to the X-ray emission drops rapidly with time, showing that the absorption is in the vicinity of the supernova. We also present Very Large Array radio observations of SN 2010jl. Radio emission was detected from SN 2010jl from day 570 onwards. The radio light curves and spectra suggest that the radio luminosity was close to its maximum at the first detection. The velocity of the shocked ejecta derived assuming synchrotron self-absorption is much less than that estimated from the optical and X-ray observations, suggesting that free–free absorption dominates.
RADIO AND X-RAY OBSERVATIONS OF SN 2006jd: ANOTHER STRONGLY INTERACTING TYPE IIn SUPERNOVA
Energy Technology Data Exchange (ETDEWEB)
Chandra, Poonam [Department of Physics, Royal Military College of Canada, Kingston, ON K7K 7B4 (Canada); Chevalier, Roger A.; Irwin, Christopher M. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Chugai, Nikolai [Institute of Astronomy of Russian Academy of Sciences, Pyatnitskaya Street 48, 109017 Moscow (Russian Federation); Fransson, Claes [Department of Astronomy, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Soderberg, Alicia M. [Smithsonian Astrophysical Observatory, 60 Garden Street, MS-20, Cambridge, MA 02138 (United States); Chakraborti, Sayan [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, 1 Homi Bhabha Road, Colaba, Mumbai 400005 (India); Immler, Stefan, E-mail: Poonam.Chandra@rmc.ca [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)
2012-08-20
We report four years of radio and X-ray monitoring of the Type IIn supernova SN 2006jd at radio wavelengths with the Very Large Array, Giant Metrewave Radio Telescope, and Expanded Very Large Array; at X-ray wavelengths with Chandra, XMM-Newton, and Swift-XRT. We assume that the radio and X-ray emitting particles are produced by shock interaction with a dense circumstellar medium. The radio emission shows an initial rise that can be attributed to free-free absorption by cool gas mixed into the nonthermal emitting region; external free-free absorption is disfavored because of the shape of the rising light curves and the low gas column density inferred along the line of sight to the emission region. The X-ray luminosity implies a preshock circumstellar density {approx}10{sup 6} cm{sup -3} at a radius r {approx} 2 Multiplication-Sign 10{sup 16} cm, but the column density inferred from the photoabsorption of X-rays along the line of sight suggests a significantly lower density. The implication may be an asymmetry in the interaction. The X-ray spectrum shows Fe line emission at 6.9 keV that is stronger than is expected for the conditions in the X-ray emitting gas. We suggest that cool gas mixed into the hot gas plays a role in the line emission. Our radio and X-ray data both suggest the density profile is flatter than r{sup -2} because of the slow evolution of the unabsorbed emission.
Ghandour, Reem M; Flaherty, Katherine; Hirai, Ashley; Lee, Vanessa; Walker, Deborah Klein; Lu, Michael C
2017-06-01
Infant mortality remains a significant public health problem in the U.S. The Collaborative Improvement & Innovation Network (CoIIN) model is an innovative approach, using the science of quality improvement and collaborative learning, which was applied across 13 Southern states in Public Health Regions IV and VI to reduce infant mortality and improve birth outcomes. We provide an in-depth discussion of the history, development, implementation, and adaptation of the model based on the experience of the original CoIIN organizers and participants. In addition to the political genesis and functional components of the initiative, 8 key lessons related to staffing, planning, and implementing future CoIINs are described in detail. This paper reports the findings from a process evaluation of the model. Data on the states' progress toward reducing infant mortality and improving birth outcomes were collected through a survey in the final months of a 24-month implementation period, as well as through ongoing team communications. The peer-to-peer exchange and platform for collaborative learning, as well as the sharing of data across the states, were major strengths and form the foundation for future CoIIN efforts. A lasting legacy of the initiative is the unique application and sharing of provisional "real time" data to inform "real time" decision-making. The CoIIN model of collaborative learning, QI, and innovation offers a promising approach to strengthening partnerships within and across states, bolstering data systems to inform and track progress more rapidly, and ultimately accelerating improvement toward healthier communities, States, and the Nation as a whole.
Energy Technology Data Exchange (ETDEWEB)
Taghikhani, M.A.; Gholami, A. [Electrical Engineering Department, Iran University of Science and Technology (IUST), Narmak, 16846 Tehran (Iran)
2009-09-15
Power transformer outages have a considerable economic impact on the operation of an electrical network. One of the most important parameters governing transformer's life expectancy is the hottest spot temperature (HST) value. The classical approach has been to consider the hottest spot temperature as the sum of the ambient temperature, the top-oil temperature rise, and the hottest spot to top-oil temperature gradient. The authors proposed a numerical method based on heat transfer theory using the finite element method and they only needed to solve heat conduction equation. The transformer selected for simulation was a 32 MVA transformer with non-directed oil-forced (NDOF) cooling and directed oil-forced (DOF) cooling. A comparison of the authors results with those obtained from finite integral transform and experimental test confirms the validity and accuracy of the proposed method. (author)
KIC 3240411 - the hottest known SPB star with the asymptotic g-mode period spacing
Szewczuk, Wojciech; Daszyńska-Daszkiewicz, Jadwiga
2018-05-01
We report the discovery of the hottest hybrid B-type pulsator, KIC 3240411, that exhibits the period spacing in the low-frequency range. This pattern is associated with asymptotic properties of high-order gravity (g-) modes. Our seismic modelling made simultaneously with the mode identification shows that dipole axisymmetric modes best fit the observations. Evolutionary models are computed with MESA code and pulsational models with the linear non-adiabatic code employing the traditional approximation to include the effects of rotation. The problem of mode excitation is discussed. We confirm that significant modification is indispensable to explain an instability of both pressure and gravity modes in the observed frequency ranges of KIC 3240411.
HIGH-DENSITY CIRCUMSTELLAR INTERACTION IN THE LUMINOUS TYPE IIn SN 2010jl: THE FIRST 1100 DAYS
International Nuclear Information System (INIS)
Fransson, Claes; Ergon, Mattias; Sollerman, Jesper; Challis, Peter J.; Kirshner, Robert P.; Marion, G. H.; Milisavljevic, Dan; Friedman, Andrew S.; Chornock, Ryan; Czekala, Ian; Soderberg, Alicia; Chevalier, Roger A.; France, Kevin; Smith, Nathan; Bufano, Filomena; Kangas, Tuomas; Larsson, Josefin; Mattila, Seppo; Benetti, Stefano
2014-01-01
Hubble Space Telescope and ground-based observations of the Type IIn supernova (SN) 2010jl are analyzed, including photometry and spectroscopy in the ultraviolet, optical, and near-IR bands, 26-1128 days after first detection. At maximum, the bolometric luminosity was ∼3 × 10 43 erg s –1 and even at 850 days exceeds 10 42 erg s –1 . A near-IR excess, dominating after 400 days, probably originates in dust in the circumstellar medium (CSM). The total radiated energy is ≳ 6.5 × 10 50 erg, excluding the dust component. The spectral lines can be separated into one broad component that is due to electron scattering and one narrow with expansion velocity ∼100 km s –1 from the CSM. The broad component is initially symmetric around zero velocity but becomes blueshifted after ∼50 days, while remaining symmetric about a shifted centroid velocity. Dust absorption in the ejecta is unlikely to explain the line shifts, and we attribute the shift instead to acceleration by the SN radiation. From the optical lines and the X-ray and dust properties, there is strong evidence for large-scale asymmetries in the CSM. The ultraviolet lines indicate CNO processing in the progenitor, while the optical shows a number of narrow coronal lines excited by the X-rays. The bolometric light curve is consistent with a radiative shock in an r –2 CSM with a mass-loss rate of M-dot ∼0.1 M ⊙ yr −1 . The total mass lost is ≳ 3 M ☉ . These properties are consistent with the SN expanding into a CSM characteristic of a luminous blue variable progenitor with a bipolar geometry. The apparent absence of nuclear processing is attributed to a CSM that is still opaque to electron scattering
Variability of average SUV from several hottest voxels is lower than that of SUVmax and SUVpeak
Energy Technology Data Exchange (ETDEWEB)
Laffon, E. [CHU de Bordeaux, Service de Medecine Nucleaire, Hopital du Haut-Leveque, Pessac (France); Universite de Bordeaux 2, Centre de Recherche Cardio-Thoracique, Bordeaux (France); INSERM U 1045, Centre de Recherche Cardio-Thoracique, Bordeaux (France); Lamare, F.; Clermont, H. de [CHU de Bordeaux, Service de Medecine Nucleaire, Hopital du Haut-Leveque, Pessac (France); Burger, I.A. [University Hospital of Zurich, Division of Nuclear Medicine, Department Medical Radiology, Zurich (Switzerland); Marthan, R. [Universite de Bordeaux 2, Centre de Recherche Cardio-Thoracique, Bordeaux (France); INSERM U 1045, Centre de Recherche Cardio-Thoracique, Bordeaux (France)
2014-08-15
To assess variability of the average standard uptake value (SUV) computed by varying the number of hottest voxels within an {sup 18}F-fluorodeoxyglucose ({sup 18}F-FDG)-positive lesion. This SUV metric was compared with the maximal SUV (SUV{sub max}: the hottest voxel) and peak SUV (SUV{sub peak}: SUV{sub max} and its 26 neighbouring voxels). Twelve lung cancer patients (20 lesions) were analysed using PET dynamic acquisition involving ten successive 2.5-min frames. In each frame and lesion, average SUV obtained from the N = 5, 10, 15, 20, 25 or 30 hottest voxels (SUV{sub max-N}){sub ,} SUV{sub max} and SUV{sub peak} were assessed. The relative standard deviations (SDrs) from ten frames were calculated for each SUV metric and lesion, yielding the mean relative SD from 20 lesions for each SUV metric (SDr{sub N}, SDr{sub max} and SDr{sub peak}), and hence relative measurement error and repeatability (MEr-R). For each N, SDr{sub N} was significantly lower than SDr{sub max} and SDr{sub peak}. SDr{sub N} correlated strongly with N: 6.471 x N{sup -0.103} (r = 0.994; P < 0.01). MEr-R of SUV{sub max-30} was 8.94-12.63 % (95 % CL), versus 13.86-19.59 % and 13.41-18.95 % for SUV{sub max} and SUV{sub peak} respectively. Variability of SUV{sub max-N} is significantly lower than for SUV{sub max} and SUV{sub peak}. Further prospective studies should be performed to determine the optimal total hottest volume, as voxel volume may depend on the PET system. (orig.)
HIGH-DENSITY CIRCUMSTELLAR INTERACTION IN THE LUMINOUS TYPE IIn SN 2010jl: THE FIRST 1100 DAYS
Energy Technology Data Exchange (ETDEWEB)
Fransson, Claes; Ergon, Mattias; Sollerman, Jesper [Oskar Klein Centre, Department of Astronomy, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden); Challis, Peter J.; Kirshner, Robert P.; Marion, G. H.; Milisavljevic, Dan; Friedman, Andrew S.; Chornock, Ryan; Czekala, Ian; Soderberg, Alicia [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Chevalier, Roger A. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904 (United States); France, Kevin [CASA, University of Colorado, 593UCB Boulder, CO 80309-0593 (United States); Smith, Nathan [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Bufano, Filomena [Departamento de Ciencias Fisicas, Universidad Andres Bello, Avda. Republica 252, Santiago (Chile); Kangas, Tuomas [Tuorla Observatory, University of Turku, Väisäläntie 20 FI-21500 Piikkiö (Finland); Larsson, Josefin [KTH, Department of Physics, and the Oskar Klein Centre, AlbaNova, SE-106 91 Stockholm (Sweden); Mattila, Seppo [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Väisäläntie 20 FI-21500 Piikkiö (Finland); Benetti, Stefano [INAF-Osservatorio Astronomico di Padova, Vicolo dellOsservatorio 5, I-35122 Padova (Italy)
2014-12-20
Hubble Space Telescope and ground-based observations of the Type IIn supernova (SN) 2010jl are analyzed, including photometry and spectroscopy in the ultraviolet, optical, and near-IR bands, 26-1128 days after first detection. At maximum, the bolometric luminosity was ∼3 × 10{sup 43} erg s{sup –1} and even at 850 days exceeds 10{sup 42} erg s{sup –1}. A near-IR excess, dominating after 400 days, probably originates in dust in the circumstellar medium (CSM). The total radiated energy is ≳ 6.5 × 10{sup 50} erg, excluding the dust component. The spectral lines can be separated into one broad component that is due to electron scattering and one narrow with expansion velocity ∼100 km s{sup –1} from the CSM. The broad component is initially symmetric around zero velocity but becomes blueshifted after ∼50 days, while remaining symmetric about a shifted centroid velocity. Dust absorption in the ejecta is unlikely to explain the line shifts, and we attribute the shift instead to acceleration by the SN radiation. From the optical lines and the X-ray and dust properties, there is strong evidence for large-scale asymmetries in the CSM. The ultraviolet lines indicate CNO processing in the progenitor, while the optical shows a number of narrow coronal lines excited by the X-rays. The bolometric light curve is consistent with a radiative shock in an r {sup –2} CSM with a mass-loss rate of M-dot ∼0.1 M{sub ⊙} yr{sup −1}. The total mass lost is ≳ 3 M {sub ☉}. These properties are consistent with the SN expanding into a CSM characteristic of a luminous blue variable progenitor with a bipolar geometry. The apparent absence of nuclear processing is attributed to a CSM that is still opaque to electron scattering.
Mueller, B.; Zhang, X.; Zwiers, F. W.
2015-12-01
Global mean temperatures are projected to increase by 3K and 4.9K above pre-industrial levels by 2100 in a moderate stabilization and a high-emission scenario (RCP4.5 and RCP8.5 from CMIP5). However, warming rates are regionally different. In this presentation, we focus on the regions defined by the IPCC SREX report. We investigate the year in the future in which historically hottest summers are projected to become the norm, i.e. to occur at least every other year. Using results from a detection and attribution analysis, we provide probabilistic estimates based on RCP4.5 and RCP8.5 simulations constrained by observations during 1950-2012. We also estimate the fraction of attributable risk (FAR), i.e. the probability for hot summers that is attributable to past emissions of anthropogenic greenhouse gases and aerosols. We find that the FAR is larger than 0.9 in many regions. We project that under RCP4.5, more than half of the world's population will experience the historically hottest summer of the past 63 years with a probability of 50% and 90% by 2035 and 2050, respectively. Under the higher emission scenario RCP8.5, historically hottest summers are projected to be more wide-spread. The Mediterranean region, Western and Eastern Asia, Northern Eurasia and the Sahara are among the first regions for which such hot summers might become the norm. Even under RCP4.5, more than 90% of summers are projected to be hotter than the historically hottest summers by 2025 and 2035 for Sahara and the Mediterranean regions, respectively.
Directory of Open Access Journals (Sweden)
zahra karimian
2017-09-01
Full Text Available Introduction: With regard to two adverse climatic phenomena of urban heat islands and global warming that has been leading to increase temperature in many cities in the world, providing human thermal comfort especially in large cities with hot and dry climates, during the hottest periods of the year is crucial. Mainly vegetation with three methods: shading, evapotranspiration and wind breaking can affect micro-climate. The aim of this study was to asses and simulate the impact of existing and proposed vegetation on the human thermal comfort and micro climate changes in some residential areas of Mashhad during the hottest periods of the year by using a modeling and computer simulation approach. Materials and Methods: This research was performed in the Ghasemabad residential area, Andisheh and Hesabi blocks, and in the hottest period of the year 2012 in Mashhad. Recorded data in the residential sites along with observed data from Mashhad weather station that included temperature, relative humidity, wind speed and direction. Soil data (soil temperature and humidity, soil\\ type, plant data (plant type, plant height, leaf area index and building data (inner temperature in the building, height and area buildings as input data were used in the ENVI-met model. Both two sites, Andishe and Hesabi residential blocks, with vegetation (different trees and bushes plants, for example Acacia, ash, sycamore, mulberry, chinaberry, barberry, boxwood and Cotoneaster that all of them are tolerant and semi-tolerant to drought about 20% were simulated. Regarding the area of simulating, 3 receptors were considered in per sites. Simulation was commenced from 6 AM and continued until 18 pm, but just data of 11-15 hours were analysed (the hours of peak traffic. Results and Discussion: Analysis of outputs data revealed that the temperature of two residential sites in all three receptors during the study were almost the same. In general, the maximum temperature difference
Tracking the Teletherms: The spatiotemporal dynamics of the hottest and coldest days of the year
Dodds, Peter Sheridan; Mitchell, Lewis; Reagan, Andrew J.; Danforth, Christopher M.
2015-01-01
Instabilities and long term shifts in seasons, whether induced by natural drivers or human activities, pose great disruptive threats to ecological, agricultural, and social systems. Here, we propose, measure, and explore two fundamental markers of location-sensitive seasonal variations: the Summer and Winter Teletherms---the on-average annual dates of the hottest and coldest days of the year. We analyse daily temperature extremes recorded at 1218 stations across the contiguous United States f...
Far-ultraviolet spectrophotometry of two very hot O type subdwarfs
Drilling, J. S.; Holberg, J. B.; Schoenberner, D.
1984-01-01
As a result of a spectroscopic survey of stars classified as nonemission OB+, Drilling (1983) has detected 12 new subluminous O stars. It was found that these stars are the hottest known O type subdwarfs. The effective temperatures of the stars are 60,000 K or higher. It has been possible to observe two of these stars with Voyager 1, taking into account LSE 21 and LS IV +10.9 deg. LSE 21 is one of the hottest of the new subdwarfs, with an effective temperature of at least 100,000 K. The optical spectrum indicates a hydrogen-rich atmosphere of high surface gravity. LX IV +10.9 deg is one of the cooler objects with an effective temperature of 65,000 K. The optical spectrum indicates an extremely helium-rich atmosphere and a somewhat lower surface gravity than LSE 21. The Voyager 1 observations confirm the temperature scale set up by Schoenberger and Drilling (1984) for the hottest O type subdwarfs.
VizieR Online Data Catalog: Palomar Transient Factory SNe IIn photometry (Ofek+, 2014)
Ofek, E. O.; Arcavi, I.; Tal, D.; Sullivan, M.; Gal-Yam, A.; Kulkarni, S. R.; Nugent, P. E.; Ben-Ami, S.; Bersier, D.; Cao, Y.; Cenko, S. B.; De Cia, A.; Filippenko, A. V.; Fransson, C.; Kasliwal, M. M.; Laher, R.; Surace, J.; Quimby, R.; Yaron, O.
2017-07-01
The Palomar Transient Factory (PTF; Law et al. 2009PASP..121.1395L; Rau et al. 2009PASP..121.1334R) and its extension the intermediate PTF (iPTF) found over 2200 spectroscopically confirmed SNe. We selected 19 SNe IIn for which PTF/iPTF has good coverage of the light-curve rise and peak; they are listed in Table 1. Optical spectra were obtained with a variety of telescopes and instruments, including the Double Spectrograph (Oke & Gunn 1982PASP...94..586O) at the Palomar 5 m Hale telescope, the Kast spectrograph (Miller & Stone 1993, Lick Observatory Technical Report 66 (Santa Cruz, CA: Lick Observatory)) at the Lick 3 m Shane telescope, the Low Resolution Imaging Spectrometer (Oke et al. 1995PASP..107..375O) on the Keck-1 10 m telescope, and the Deep Extragalactic Imaging Multi-Object Spectrograph (Faber et al. 2003SPIE.4841.1657F) on the Keck-2 10 m telescope. (2 data files).
Dodds, Peter Sheridan; Mitchell, Lewis; Reagan, Andrew J.; Danforth, Christopher M.
2016-01-01
Instabilities and long term shifts in seasons, whether induced by natural drivers or human activities, pose great disruptive threats to ecological, agricultural, and social systems. Here, we propose, measure, and explore two fundamental markers of location-sensitive seasonal variations: the Summer and Winter Teletherms-the on-average annual dates of the hottest and coldest days of the year. We analyse daily temperature extremes recorded at 1218 stations across the contiguous United States fro...
Directory of Open Access Journals (Sweden)
Chamorro Albeiro Hernán
2007-06-01
Full Text Available
Se evaluaron diferentes concentraciones de reguladores de crecimiento en las fases de multiplicación y enraizamiento <i>in vitro de Limonium var. Misty blue, las cuales son bajas en esta especie. Se trabajó con material <i>in vitro donado por la Empresa La Plazoleta Ltda. Se evaluaron diferentes tipos y concentraciones de citoquininas (kinetina, KIN; 6-bencilaminopurina, BAP; y thidiazuron, TDZ en la fase de multiplicación y dos tipos de auxinas (ácido indolacético, AIA; y ácido indolbutírico, AIB a diferentes concentraciones en la fase de enraizamiento in vitro. En la fase de multiplicación los mejores resultados fueron obtenidos con el uso del medio de cultivo MS (Murashige y Skoog, 1962 suplementado con KIN o BAP a 0,5 mg· L-1 durante un período de cuatro (4 semanas. Se encontró que concentraciones altas de las citoquininas evaluadas en este trabajo inducen desdiferenciación celular y reducen la tasa de multiplicación, especialmente el TDZ a 0,1 mg· L-1. En la fase de enraizamiento <i>in vitro se obtuvieron buenos resultados manteniendo las plántulas por un período de tres (3 semanas en medio MS (1962 suplementado con AIB en concentraciones entre 0,5 y 1,0 mg· L-1, lo cual consiguió un sistema radical adecuado para su posterior endurecimiento. En presencia de AIA no se formaron raíces en ninguna de las concentraciones evaluadas.
Effect of repeated ramadan fasting in the hottest months of the year on renal graft function.
Hejaili, Fayez; Qurashi, Salim; Binsalih, Salih; Jaradt, Maha; Al Sayyari, Abdulla
2014-03-01
Adult Moslems are required to fast during the lunar month of Ramadan every year. Although the sick and travelers, as well as some other specified groups, are exempted from this requirement. To investigate the effect of repeated Ramadan fasting during the hottest months of the year on renal graft functions. This was a prospective cohort study comparing two groups of renal transplant receivers; one group had fasted for two consecutive Ramadan months during 2011 and 2012, while the other group had not fasted. The baseline eGFR (estimated glomerular filtration rate) was compared to the eGFR carried out 19.6 ± 1.3 months later, within and between groups. Further subgroup analysis was done according to eGFR baseline; low ( 75 mL/min/1.73 m(2)). There were 43 fasting and 37 non-fasting participants with comparable; ages, gender, type of transplant, and baseline eGFR and serum creatinine (SCr). The fasting participants, however, had a longer elapsed time since their transplantation. In the fasting group, SCr and eGFR did not change from baseline after a mean follow-up period of 19.6 ± 1.3 months; SCr of 105.1 ± 55.4 and 114.2 ± 71.5 µmol/L, respectively (P-value = 0.8), and eGFR 75.6 ± 29.2 and 70.2 ± 28.1 mL/min/1.73 m(2), respectively (P-value = 0.09). Similarly, no significant changes were observed in the non-fasting group; Sr of 123.1 ± 67 and 115.8 ± 65.2 µmol/L, respectively (P-value = 0.6), and eGFR of 65.9 ± 25.9 and 68.8 ± 24.6 mL/min/1.73 m(2), respectively (P-value = 0.6). On subgroup analysis, according to the eGFR level, we found no significant differences in the eGFR, before and after 19.6 ± 1.3 months, in the severe and moderate subgroups. However, a significant but similar drop was noted in the high GFR subgroups in both the fasting subgroup (96.4 ± 15 to 84.9 ± 20.7 mL/min/1.73 m(2); P = 0.17) and in the non-fasting subgroup (92.9 ± 15.8 to 82.3 ± 18.2 mL/min/1.73 m(2); P = 0.019). Fasting in the month of Ramadan in two consecutive years
Min, Se Hee; Yoon, Jeong-Hwa; Hahn, Seokyung; Cho, Young Min
2017-01-01
Both sodium glucose cotransporter 2 (SGLT2) inhibitors and dipeptidyl peptidase-4 (DPP4) inhibitors can be used to treat patients with type 2 diabetes mellitus (T2DM) that is inadequately controlled with insulin therapy, and yet there has been no direct comparison of these two inhibitors. We searched MEDLINE, EMBASE, LILACS, the Cochrane Central Register of Controlled Trials and ClinicalTrials.gov through June 2015. Randomized controlled trials published in English that compare SGLT2 inhibitor plus insulin (SGLT2i/INS) with placebo plus insulin or DPP4 inhibitor plus insulin (DPP4i/INS) with placebo plus insulin in patients with T2DM were selected. Data on the study characteristics, efficacy and safety outcomes were extracted. We compared the efficacy and safety between SGLT2i/INS and DPP4i/INS indirectly with covariates adjustment. Risk of potential bias was assessed. Fourteen eligible randomized controlled trials comprising 6980 patients were included (five SGLT2 inhibitor studies and nine DPP4 inhibitor studies). Covariate-adjusted indirect comparison using meta-regression analyses revealed that SGLT2i/INS achieved greater reduction in HbA 1c [weighted mean difference (WMD) -0.24%, 95% confidence interval (CI) -0.43 to -0.05%], fasting plasma glucose (WMD -18.0 mg/dL, 95% CI -28.5 to -7.6 mg/dL) and body weight (WMD -2.38 kg, 95% CI -3.18 to -1.58 kg) from baseline than DPP4i/INS without increasing the risk of hypoglycaemia (relative risks 1.19, 95% CI 0.78 to 1.82). Sodium glucose cotransporter 2 inhibitors achieved better glycaemic control and greater weight reduction than DPP4 inhibitors without increasing the risk of hypoglycaemia in patients with T2DM that is inadequately controlled with insulin. There has been no direct comparison of SGLT2 inhibitors and DPP4 inhibitors in patients with T2DM inadequately controlled with insulin therapy. In this study, we performed indirect meta-analysis comparing SGLT2 inhibitors and DPP4 inhibitors added to insulin
SN 2013fs and SN 2013fr: exploring the circumstellar-material diversity in Type II supernovae
Bullivant, Christopher; Smith, Nathan; Williams, G. Grant; Mauerhan, Jon C.; Andrews, Jennifer E.; Fong, Wen-Fai; Bilinski, Christopher; Kilpatrick, Charles D.; Milne, Peter A.; Fox, Ori D.; Cenko, S. Bradley; Filippenko, Alexei V.; Zheng, WeiKang; Kelly, Patrick L.; Clubb, Kelsey I.
2018-05-01
We present photometry and spectroscopy of SN 2013fs and SN 2013fr in the first ˜100 d post-explosion. Both objects showed transient, relatively narrow H α emission lines characteristic of SNe IIn, but later resembled normal SNe II-P or SNe II-L, indicative of fleeting interaction with circumstellar material (CSM). SN 2013fs was discovered within 8 h of explosion; one of the earliest SNe discovered thus far. Its light curve exhibits a plateau, with spectra revealing strong CSM interaction at early times. It is a less luminous version of the transitional SN IIn PTF11iqb, further demonstrating a continuum of CSM interaction intensity between SNe II-P and SNe IIn. It requires dense CSM within 6.5 × 1014 cm of the progenitor, from a phase of advanced pre-SN mass loss beginning shortly before explosion. Spectropolarimetry of SN 2013fs shows little continuum polarization (˜0.5 per cent, consistent with zero), but noticeable line polarization during the plateau phase. SN 2013fr morphed from an SN IIn at early times to an SN II-L. After the first epoch, its narrow lines probably arose from host-galaxy emission, but the bright, narrow H α emission at early times may be intrinsic to the SN. As for SN 2013fs, this would point to a short-lived phase of strong CSM interaction if proven to be intrinsic, suggesting a continuum between SNe IIn and SNe II-L. It is a low-velocity SN II-L like SN 2009kr, but more luminous. SN 2013fr also developed an infrared excess at later times, due to warm CSM dust that requires a more sustained phase of strong pre-SN mass loss.
Institute of Scientific and Technical Information of China (English)
赵欲晓
2010-01-01
@@ Application therapy during the hottest and coldest days of the year is a kind of external therapy of Chinese medicine in which a specifically-prepared Chinese herbal plaster is applied on the specific points of human body during the three ten-day periods of the hottest days in summer, from mid-July to mid-August,and the three nine-day periods after the winter solstice,reputed to be the coldest days of the year, including two sessions of treatment, named the treatment in summer for disorder in winter and prevention in winter for disorder in winter.
Interacting Supernovae: Types IIn and Ibn
Smith, Nathan
Supernovae that show evidence of strong shock interaction between their ejecta and pre-existing slower circumstellar material (CSM) constitute an interesting, diverse, and still poorly understood category of explosive transients. The chief reason they are extremely interesting is because they tell us that in a subset of stellar deaths, the progenitor star becomes wildly unstable in the years, decades, or centuries before explosion. This is something that has not been included in standard stellar evolution models but may significantly change the end product and yield of that evolution and complicates our attempts to map SNe to their progenitors. Another reason they are interesting is because CSM interaction is an efficient engine for making bright transients, allowing superluminous transients to arise from normal SN explosion energy, and transients of normal supernova luminosity to arise from sub-energetic explosions or low radioactivity yield. CSM interaction shrouds the fast ejecta in bright shock emission, obscuring our view of the underlying explosion, and the radiation hydrodynamics is challenging to model. The CSM interaction may also be highly nonspherical, perhaps linked to binary interaction in the progenitor system. In some cases, these complications make it difficult to tell the difference between a core-collapse and thermonuclear explosion or to discern between a nonterminal eruption, failed supernova, or weak supernova. Efforts to uncover the physical parameters of individual events and connections to progenitor stars make this a rapidly evolving topic that challenges paradigms of stellar evolution.
Directory of Open Access Journals (Sweden)
L. I. A. CASTRO
2008-11-01
Full Text Available
A quinoa (Chenopodium quinoa Willd é um pseudocereal isento de glúten, oriundo dos Andes, onde tem sido cultivado há milhares de anos. O objetivo deste trabalho foi desenvolver e avaliar sensorialmente algumas preparações contendo quinoa em grãos, flocos e farinha, destinadas ao paciente celÃaco, e determinar a digestibilidade <i>in vitro de sua proteÃna, submetida ou não ao tratamento térmico. As amostras foram avaliadas sensorialmente através de um teste de aceitação utilizando a escala hedônica nominal de 9 pontos. O método utilizado na análise da digestibilidade protéica <i>in vitro foi o da queda de pH após 10 minutos, com a adição das enzimas tripsina e pancreatina à s amostras de quinoa, tratadas e não tratadas termicamente. Das sete preparações testadas, seis foram bem aceitas, já que apresentaram um Ãndice de Aceitabilidade maior que 70%. Os flocos e grãos de quinoa, após serem testados termicamente, tiveram sua digestibilidade otimizada. Portanto, a quinoa e seus derivados podem ser considerados uma boa opção para a alimentação dos indivÃduos portadores da doença celÃaca.
Directory of Open Access Journals (Sweden)
Peter Sheridan Dodds
Full Text Available Instabilities and long term shifts in seasons, whether induced by natural drivers or human activities, pose great disruptive threats to ecological, agricultural, and social systems. Here, we propose, measure, and explore two fundamental markers of location-sensitive seasonal variations: the Summer and Winter Teletherms-the on-average annual dates of the hottest and coldest days of the year. We analyse daily temperature extremes recorded at 1218 stations across the contiguous United States from 1853-2012, and observe large regional variation with the Summer Teletherm falling up to 90 days after the Summer Solstice, and 50 days for the Winter Teletherm after the Winter Solstice. We show that Teletherm temporal dynamics are substantive with clear and in some cases dramatic shifts reflective of system bifurcations. We also compare recorded daily temperature extremes with output from two regional climate models finding considerable though relatively unbiased error. Our work demonstrates that Teletherms are an intuitive, powerful, and statistically sound measure of local climate change, and that they pose detailed, stringent challenges for future theoretical and computational models.
Dodds, Peter Sheridan; Mitchell, Lewis; Reagan, Andrew J; Danforth, Christopher M
2016-01-01
Instabilities and long term shifts in seasons, whether induced by natural drivers or human activities, pose great disruptive threats to ecological, agricultural, and social systems. Here, we propose, measure, and explore two fundamental markers of location-sensitive seasonal variations: the Summer and Winter Teletherms-the on-average annual dates of the hottest and coldest days of the year. We analyse daily temperature extremes recorded at 1218 stations across the contiguous United States from 1853-2012, and observe large regional variation with the Summer Teletherm falling up to 90 days after the Summer Solstice, and 50 days for the Winter Teletherm after the Winter Solstice. We show that Teletherm temporal dynamics are substantive with clear and in some cases dramatic shifts reflective of system bifurcations. We also compare recorded daily temperature extremes with output from two regional climate models finding considerable though relatively unbiased error. Our work demonstrates that Teletherms are an intuitive, powerful, and statistically sound measure of local climate change, and that they pose detailed, stringent challenges for future theoretical and computational models.
SUPERNOVA PTF 09UJ: A POSSIBLE SHOCK BREAKOUT FROM A DENSE CIRCUMSTELLAR WIND
International Nuclear Information System (INIS)
Ofek, E. O.; Neill, J. D.; Kulkarni, S. R.; Forster, K.; Kasliwal, M. M.; Law, N.; Martin, C.; Quimby, R. M.; Rabinak, I.; Arcavi, I.; Waxman, E.; Gal-Yam, A.; Cenko, S. B.; Bloom, J. S.; Filippenko, A. V.; Poznanski, D.; Nugent, P. E.; Jacobsen, J.; Bildsten, L.; Howell, D. A.
2010-01-01
Type-IIn supernovae (SNe IIn), which are characterized by strong interaction of their ejecta with the surrounding circumstellar matter (CSM), provide a unique opportunity to study the mass-loss history of massive stars shortly before their explosive death. We present the discovery and follow-up observations of an SN IIn, PTF 09uj, detected by the Palomar Transient Factory (PTF). Serendipitous observations by Galaxy Evolution Explorer (GALEX) at ultraviolet (UV) wavelengths detected the rise of the SN light curve prior to the PTF discovery. The UV light curve of the SN rose fast, with a timescale of a few days, to a UV absolute AB magnitude of about -19.5. Modeling our observations, we suggest that the fast rise of the UV light curve is due to the breakout of the SN shock through the dense CSM (n ∼ 10 10 cm -3 ). Furthermore, we find that prior to the explosion the progenitor went through a phase of high mass-loss rate (∼0.1 M sun yr -1 ) that lasted for a few years. The decay rate of this SN was fast relative to that of other SNe IIn.
Thermal-hydraulic code for estimating safety limits of nuclear reactors with plate type fuels
Energy Technology Data Exchange (ETDEWEB)
Castellanos, Duvan A.; Moreira, João L.; Maiorino, Jose R.; Rossi, Pedro R.; Carajilescov, Pedro, E-mail: duvan.castellanos@ufabc.edu.br, E-mail: joao.moreira@ufabc.edu.br, E-mail: joserubens.maiorino@ufabc.edu.br, E-mail: pedro.rossi@ufabc.edu.br, E-mail: pedro.carajilescov10@gmail.com [Universidade Federal do ABC (UFABC), Santo André, SP (Brazil). Centro de Engenharias, Modelagem e Ciências Sociais Aplicadas
2017-07-01
To ensure the normal and safe operation of PWR type nuclear reactors is necessary the knowledge of nuclear and heat transfer properties of the fuel, coolant and structural materials. The thermal-hydraulic analysis of nuclear reactors yields parameters such as the distribution of fuel and coolant temperatures, and the departure from nucleated boiling ratio. Usually computational codes are used to analyze the safety performance of the core. This research work presents a computer code for performing thermal-hydraulic analyses of nuclear reactors with plate-type fuel elements operating at low pressure and temperature (research reactors) or high temperature and pressure (naval propulsion or small power reactors). The code uses the sub-channel method based on geometric and thermal-hydraulic conditions. In order to solve the conservation equations for mass, momentum and energy, each sub-channel is divided into control volumes in the axial direction. The mass flow distribution for each fuel element of core is obtained. Analysis of critical heat flux is performed in the hottest channel. The code considers the radial symmetry and the chain or cascade method for two steps in order to facilitate the whole analysis. In the first step, we divide the core into channels with size equivalent to a fuel assembly. >From this analysis, the channel with the largest enthalpy is identified as the hot assembly. In the second step, we divide the hottest fuel assembly into sub-channels with size equivalent to one actual coolant channel. As in the previous step, the sub-channel with largest final enthalpy is identified as the hottest sub-channel. For the code validation, we considered results from the chinese CARR research reactor. The code reproduced well the CARR reactor results, yielding detailed information such as static pressure in the channel, mass flow rate distribution among the fuel channels, coolant, clad and centerline fuel temperatures, quality and local heat and critical heat
Thermal-hydraulic code for estimating safety limits of nuclear reactors with plate type fuels
International Nuclear Information System (INIS)
Castellanos, Duvan A.; Moreira, João L.; Maiorino, Jose R.; Rossi, Pedro R.; Carajilescov, Pedro
2017-01-01
To ensure the normal and safe operation of PWR type nuclear reactors is necessary the knowledge of nuclear and heat transfer properties of the fuel, coolant and structural materials. The thermal-hydraulic analysis of nuclear reactors yields parameters such as the distribution of fuel and coolant temperatures, and the departure from nucleated boiling ratio. Usually computational codes are used to analyze the safety performance of the core. This research work presents a computer code for performing thermal-hydraulic analyses of nuclear reactors with plate-type fuel elements operating at low pressure and temperature (research reactors) or high temperature and pressure (naval propulsion or small power reactors). The code uses the sub-channel method based on geometric and thermal-hydraulic conditions. In order to solve the conservation equations for mass, momentum and energy, each sub-channel is divided into control volumes in the axial direction. The mass flow distribution for each fuel element of core is obtained. Analysis of critical heat flux is performed in the hottest channel. The code considers the radial symmetry and the chain or cascade method for two steps in order to facilitate the whole analysis. In the first step, we divide the core into channels with size equivalent to a fuel assembly. >From this analysis, the channel with the largest enthalpy is identified as the hot assembly. In the second step, we divide the hottest fuel assembly into sub-channels with size equivalent to one actual coolant channel. As in the previous step, the sub-channel with largest final enthalpy is identified as the hottest sub-channel. For the code validation, we considered results from the chinese CARR research reactor. The code reproduced well the CARR reactor results, yielding detailed information such as static pressure in the channel, mass flow rate distribution among the fuel channels, coolant, clad and centerline fuel temperatures, quality and local heat and critical heat
SOFIA OBSERVATIONS OF SN 2010jl: ANOTHER NON-DETECTION OF THE 9.7 μm SILICATE DUST FEATURE
International Nuclear Information System (INIS)
Williams, Brian J.; Fox, Ori D.
2015-01-01
We present photometric observations from the Stratospheric Observatory for Infrared Astronomy (SOFIA) at 11.1 μm of the Type IIn supernova (SN IIn) 2010jl. The SN is undetected by SOFIA, but the upper limits obtained, combined with new and archival detections from Spitzer at 3.6 and 4.5 μm, allow us to characterize the composition of the dust present. Dust in other SN IIn has been shown in previous works to reside in a circumstellar shell of material ejected by the progenitor system in the few millenia prior to explosion. Our model fits show that the dust in the system shows no evidence for the strong, ubiquitous 9.7 μm feature from silicate dust, suggesting the presence of carbonaceous grains. The observations are best fit with 0.01–0.05 M ⊙ of carbonaceous dust radiating at a temperature of ∼550–620 K. The dust composition may reveal clues concerning the nature of the progenitor system, which remains ambiguous for this subclass. Most of the single star progenitor systems proposed for SNe IIn, such as luminous blue variables, red supergiants, yellow hypergiants, and B[e] stars, all clearly show silicate dust in their pre-SN outflows. However, this post-SN result is consistent with the small sample of SNe IIn with mid-IR observations, none of which show signs of emission from silicate dust in their IR spectra
SOFIA OBSERVATIONS OF SN 2010jl: ANOTHER NON-DETECTION OF THE 9.7 μm SILICATE DUST FEATURE
Energy Technology Data Exchange (ETDEWEB)
Williams, Brian J. [CRESST and X-ray Astrophysics Laboratory, NASA/GSFC, Code 662, 8800 Greenbelt Road, Greenbelt, MD (United States); Fox, Ori D., E-mail: brian.j.williams@nasa.gov [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States)
2015-07-20
We present photometric observations from the Stratospheric Observatory for Infrared Astronomy (SOFIA) at 11.1 μm of the Type IIn supernova (SN IIn) 2010jl. The SN is undetected by SOFIA, but the upper limits obtained, combined with new and archival detections from Spitzer at 3.6 and 4.5 μm, allow us to characterize the composition of the dust present. Dust in other SN IIn has been shown in previous works to reside in a circumstellar shell of material ejected by the progenitor system in the few millenia prior to explosion. Our model fits show that the dust in the system shows no evidence for the strong, ubiquitous 9.7 μm feature from silicate dust, suggesting the presence of carbonaceous grains. The observations are best fit with 0.01–0.05 M{sub ⊙} of carbonaceous dust radiating at a temperature of ∼550–620 K. The dust composition may reveal clues concerning the nature of the progenitor system, which remains ambiguous for this subclass. Most of the single star progenitor systems proposed for SNe IIn, such as luminous blue variables, red supergiants, yellow hypergiants, and B[e] stars, all clearly show silicate dust in their pre-SN outflows. However, this post-SN result is consistent with the small sample of SNe IIn with mid-IR observations, none of which show signs of emission from silicate dust in their IR spectra.
Zhou, Chunlüe; Wang, Kaicun
2016-05-13
Most studies on global warming rely on global mean surface temperature, whose change is jointly determined by anthropogenic greenhouse gases (GHGs) and natural variability. This introduces a heated debate on whether there is a recent warming hiatus and what caused the hiatus. Here, we presented a novel method and applied it to a 5° × 5° grid of Northern Hemisphere land for the period 1900 to 2013. Our results show that the coldest 5% of minimum temperature anomalies (the coldest deviation) have increased monotonically by 0.22 °C/decade, which reflects well the elevated anthropogenic GHG effect. The warmest 5% of maximum temperature anomalies (the warmest deviation), however, display a significant oscillation following the Atlantic Multidecadal Oscillation (AMO), with a warming rate of 0.07 °C/decade from 1900 to 2013. The warmest (0.34 °C/decade) and coldest deviations (0.25 °C/decade) increased at much higher rates over the most recent decade than last century mean values, indicating the hiatus should not be interpreted as a general slowing of climate change. The significant oscillation of the warmest deviation provides an extension of previous study reporting no pause in the hottest temperature extremes since 1979, and first uncovers its increase from 1900 to 1939 and decrease from 1940 to 1969.
Sensible climates in monsoon Asia.
Ono, H S; Kawamura, T
1991-06-01
This study identifies characteristics of the geographical distribution of sensible climates and their diurnal and annual variations, and presents a classification of bioclimates in monsoon Asia by using Kawamura's discomfort index formula. During the hottest month, tropical areas and areas in central and South China are uncomfortable for humans throughout the day and night, and temperate zones in lowlands are uncomfortable during the daytime. Tropical zones are uncomfortable all year long and temperate zones in lowlands are uncomfortable during summer. Four climatic types were distinguished in monsoon Asia. Climatic type I, hyperthermal throughout the year, occurs in the tropics south of latitude 20 degrees N. Climatic type II, hyperthermal in the hottest month and comfortable in the coldest month, extends over latitudes from 20 degrees to 30 degrees N except in the highlands. Climatic type III, hyperthermal in the hottest month and hypothermal in the coldest month, encompasses temperate zones of East Asia and subtropical arid areas of northwestern India. Climatic type V, comfortable in the hottest month and hypothermal in coldest month, occurs near the southeast coast of the Soviet Union and in the highlands of the Himalayas.
Ananthan, R; Subhash, K; Longvah, T
2018-01-01
The world hottest Naga king chilli is cultivated and consumed in Northeast India. Capsaicinoids, amino acids and fatty acids were studied in fruit and fruit components of Naga king chilli. Capsaicinoid content was increased in each ripening stage and maximum level was observed at red color fruits. Total protein and fat content of placenta was 19.41 and 20.36% respectively. Capsaicinoids of placenta (7.35±2.241%) was higher followed by seed (3.83±1.358%) and pericarp (2.91±0.667%). Similarly, essential amino acid content was also higher in placenta compared to other components. Amino acid score ranged from 37 to 38 with cystine and methionine as limiting amino acid. Low level of palmitic, stearic and α-linolenic acid and very high level of linoleic acid were found in seeds. Total polyunsaturates of seeds were higher followed by whole fruit. Naga king chilli is unique due to its high capsaicinoid content and it offers potential crop for the future exploitation. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Yang, Xiaoli; Hofmann, Ralf; Dapp, Robin; Van de Kamp, Thomas; Rolo, Tomy dos Santos; Xiao, Xianghui; Moosmann, Julian; Kashef, Jubin; Stotzka, Rainer
2015-01-01
High-resolution, three-dimensional (3D) imaging of soft tissues requires the solution of two inverse problems: phase retrieval and the reconstruction of the 3D image from a tomographic stack of two-dimensional (2D) projections. The number of projections per stack should be small to accommodate fast tomography of rapid processes and to constrain X-ray radiation dose to optimal levels to either increase the duration o fin vivo time-lapse series at a given goal for spatial resolution and/or the conservation of structure under X-ray irradiation. In pursuing the 3D reconstruction problem in the sense of compressive sampling theory, we propose to reduce the number of projections by applying an advanced algebraic technique subject to the minimisation of the total variation (TV) in the reconstructed slice. This problem is formulated in a Lagrangian multiplier fashion with the parameter value determined by appealing to a discrete L-curve in conjunction with a conjugate gradient method. The usefulness of this reconstruction modality is demonstrated for simulated and <i>in vivo data, the latter acquired in parallel-beam imaging experiments using synchrotron radiation
The Incredibly Long-Lived SN 2005ip
Fox, Ori
2016-10-01
Type IIn supernovae (SNe IIn) are defined by their relatively narrow spectral line features associated with a dense circumstellar medium (CSM) formed by the progenitor star. The nature of the progenitor and mass loss remains relatively unknown. Shock interaction with the dense CSM can often result in significant UV emission for several years post-explosion, thereby probing the CSM characteristics, progenitor mass loss history and, ultimately, the progenitor itself. The Type IIn SN 2005ip proves to be one of the most interesting and well-studied targets within this subclass. Compared to all other supernovae, SN 2005ip is the most luminous for its age. Now more than 11 years post-explosion, the SN has released >10^51 erg throughout its lifetime as the forward shock continues to collide with a dense CSM. Here we propose HST/STIS-MAMA UV observations of SN 2005ip to investigate the massive CSM. When accounting for the shock travel time, these observations will probe material lost from the progenitor more than 1000 years prior to the explosion. We already have a single HST/STIS spectrum of SN 2005ip from 2014, which was obtained while the shock was still within a higher mass regime. With just 5 orbits, a second spectrum will allow us to directly trace the evolution of the CSM and produce new constraints on the pre-SN mass-loss history. Coinciding with Cycle 24's UV Initiative, this program offers new insight regarding both the progenitor and explosion characteristics of the SN IIn subclass.
Energy Technology Data Exchange (ETDEWEB)
Arcavi, Iair; Gal-Yam, Avishay; Yaron, Ofer [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, Rehovot 76100 (Israel); Cenko, S. Bradley; Becker, Adam B. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Fox, Derek B. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Leonard, Douglas C. [Department of Astronomy, San Diego State University, San Diego, CA 92182 (United States); Moon, Dae-Sik [Department of Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Sand, David J. [Las Cumbres Observatory Global Telescope Network, Santa Barbara, CA 93117 (United States); Soderberg, Alicia M. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Kiewe, Michael [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Scheps, Raphael [King' s College, University of Cambridge, Cambridge CB2 1ST (United Kingdom); Birenbaum, Gali [12 Amos St, Ramat Chen, Ramat Gan 52233 (Israel); Chamudot, Daniel [20 Chen St, Petach Tikvah 49520 (Israel); Zhou, Jonathan, E-mail: iair.arcavi@weizmann.ac.il [101 Dunster Street, Box 398, Cambridge, MA 02138 (United States)
2012-09-10
We present R-band light curves of Type II supernovae (SNe) from the Caltech Core-Collapse Project (CCCP). With the exception of interacting (Type IIn) SNe and rare events with long rise times, we find that most light curve shapes belong to one of three apparently distinct classes: plateau, slowly declining, and rapidly declining events. The last class is composed solely of Type IIb SNe which present similar light curve shapes to those of SNe Ib, suggesting, perhaps, similar progenitor channels. We do not find any intermediate light curves, implying that these subclasses are unlikely to reflect variance of continuous parameters, but rather might result from physically distinct progenitor systems, strengthening the suggestion of a binary origin for at least some stripped SNe. We find a large plateau luminosity range for SNe IIP, while the plateau lengths seem rather uniform at approximately 100 days. As analysis of additional CCCP data goes on and larger samples are collected, demographic studies of core-collapse SNe will likely continue to provide new constraints on progenitor scenarios.
Molecular characterization of 'Bhut Jolokia' the hottest chilli
Indian Academy of Sciences (India)
2012-08-14
Aug 14, 2012 ... variations along with its extreme pungency might be related to ambient environmental factors of northeastern India. ... plant goes through; any type of environmental stress will ...... This work was funded by the Defence.
HIV-1 integrase inhibitors are substrates for the multidrug transporter MDR1-P-glycoprotein
Directory of Open Access Journals (Sweden)
Cara Andrea
2007-03-01
Full Text Available Abstract Background The discovery of diketoacid-containing derivatives as inhibitors of HIV-1 Integrase (IN (IN inhibitors, IINs has played a major role in validating this enzyme as an important target for antiretroviral therapy. Since the in vivo efficacy depends on access of these drugs to intracellular sites where HIV-1 replicates, we determined whether the IINs are recognized by the multidrug transporter MDR1-P-glycoprotein (P-gp thereby reducing their intracellular accumulation. To address the effect of IINs on drug transport, nine quinolonyl diketo acid (DKA derivatives active on the HIV-1 IN strand transfer (ST step and with EC50 ranging from 1.83 to >50 μm in cell-based assays were tested for their in vitro interaction with P-gp in the CEM-MDR cell system. IINs were investigated for the inhibition and induction of the P-gp function and expression as well as for multidrug resistance (MDR reversing ability. Results The HIV-1 IINs act as genuine P-gp substrates by inhibiting doxorubicin efflux and inducing P-gp functional conformation changes as evaluated by the modulation of UIC2 mAb epitope. Further, IINs chemosensitize MDR cells to vinblastine and induce P-gp expression in drug sensitive revertants of CEM-MDR cells. Conclusion To our knowledge, this is the first demonstration that HIV-1 IINs are P-gp substrates. This biological property may influence the absorption, distribution and elimination of these novels anti HIV-1 compounds.
Spectroscopic Classification of MASTER OT J044212.20+230616.7
Shivvers, I.; Kelly, P. L.; Clubb, K. I.; Filippenko, A. V.
2014-09-01
We report that inspection of a CCD spectrum (range 330-1000 nm), obtained on September 22 UT with the 3-m Shane reflector (+ Kast) at Lick Observatory, shows that MASTER OT J044212.20+230616.7 (ATel #6484) is a Type IIn supernova.
Lactic acid bacteria: inhibition of angiotensin converting enzyme <i>in vitro and <i>in vivo
DEFF Research Database (Denmark)
Fuglsang, Anders; Rattray, Fergal; Nilsson, Dan
2003-01-01
A total of 26 strains of wild-type lactic acid bacteria, mainly belonging to Lactococcus lactis and Lactobacillus helveticus , were assayed in vitro for their ability to produce a milk fermentate with inhibitory activity towards angiotensin converting enzyme (ACE). It was clear that the test stra...
Liu, Bailian; Xiong, Ying; Deng, Hong; Gu, Shao; Jia, Fu; Li, Qunhui; Wang, Daxing; Gan, Xuewen; Liu, Wei
2014-07-21
The purpose of this study is to compare the clinical effects of our self-designed rotary self-locking intramedullary nail (RSIN) and interlocking intramedullary nail (IIN) for long bone fractures. A retrospective study was performed in 1,704 patients who suffered bone fractures and underwent RSIN or IIN operation in our hospital between March 1999 and March 2013, including 494 with femoral fractures, 572 with humeral fractures, and 638 with tibial fractures. Among them, 634 patients were followed up for more than 1 year. The operative time, intraoperative blood loss, postoperative complications, healing rate, and the excellent and good rate of functional recovery were compared between two groups. Compared with IIN group, RSIN group exhibited significantly shorter operative time and less intraoperative blood loss no matter for humeral, femoral, or tibial fractures (all p fractures (both p fracture. In IIN group, nail breakage or loosening occurred in 7 patients with femoral fractures and 16 patients with tibial fractures, radial nerve injury was observed in 8 patients with humeral fractures, and incision infection was present in 2 patients with humeral fractures and 1 patient with femoral fracture. The complication rate of IIN group was significantly higher than that of RSIN group (p knee, and ankle joint functional recovery between RSIN group and IIN group. RSIN may be a reliable and practical alternative method for the treatment of long bone fractures.
Harrington, Joseph; Luszcz, Statia; Seager, Sara; Deming, Drake; Richardson, L Jeremy
2007-06-07
Of the over 200 known extrasolar planets, just 14 pass in front of and behind their parent stars as seen from Earth. This fortuitous geometry allows direct determination of many planetary properties. Previous reports of planetary thermal emission give fluxes that are roughly consistent with predictions based on thermal equilibrium with the planets' received radiation, assuming a Bond albedo of approximately 0.3. Here we report direct detection of thermal emission from the smallest known transiting planet, HD 149026b, that indicates a brightness temperature (an expression of flux) of 2,300 +/- 200 K at 8 microm. The planet's predicted temperature for uniform, spherical, blackbody emission and zero albedo (unprecedented for planets) is 1,741 K. As models with non-zero albedo are cooler, this essentially eliminates uniform blackbody models, and may also require an albedo lower than any measured for a planet, very strong 8 microm emission, strong temporal variability, or a heat source other than stellar radiation. On the other hand, an instantaneous re-emission blackbody model, in which each patch of surface area instantly re-emits all received light, matches the data. This planet is known to be enriched in heavy elements, which may give rise to novel atmospheric properties yet to be investigated.
Energy Technology Data Exchange (ETDEWEB)
Shi, L.; Skinner, J. L. [Theoretical Chemistry Institute and Department of Chemistry, University of Wisconsin, Madison, Wisconsin 53706 (United States)
2015-07-07
OH-stretch inelastic incoherent neutron scattering (IINS) has been measured to determine the vibrational density of states (VDOS) in the OH-stretch region for liquid water, supercooled water, and ice Ih, providing complementary information to IR and Raman spectroscopies about hydrogen bonding in these phases. In this work, we extend the combined electronic-structure/molecular-dynamics (ES/MD) method, originally developed by Skinner and co-workers to simulate OH-stretch IR and Raman spectra, to the calculation of IINS spectra with small k values. The agreement between theory and experiment in the limit k → 0 is reasonable, further validating the reliability of the ES/MD method in simulating OH-stretch spectroscopy in condensed phases. The connections and differences between IINS and IR spectra are analyzed to illustrate the advantages of IINS over IR in estimating the OH-stretch VDOS.
International Nuclear Information System (INIS)
Shi, L.; Skinner, J. L.
2015-01-01
OH-stretch inelastic incoherent neutron scattering (IINS) has been measured to determine the vibrational density of states (VDOS) in the OH-stretch region for liquid water, supercooled water, and ice Ih, providing complementary information to IR and Raman spectroscopies about hydrogen bonding in these phases. In this work, we extend the combined electronic-structure/molecular-dynamics (ES/MD) method, originally developed by Skinner and co-workers to simulate OH-stretch IR and Raman spectra, to the calculation of IINS spectra with small k values. The agreement between theory and experiment in the limit k → 0 is reasonable, further validating the reliability of the ES/MD method in simulating OH-stretch spectroscopy in condensed phases. The connections and differences between IINS and IR spectra are analyzed to illustrate the advantages of IINS over IR in estimating the OH-stretch VDOS
Theoretical modeling of the subject: Western and Eastern types of human reflexion.
Lefebvre, Vladimir A
2017-12-01
The author puts forth the hypothesis that mental phenomena are connected with thermodynamic properties of large neural network. A model of the subject with reflexion and capable for meditation is constructed. The processes of reflexion and meditation are presented as the sequence of heat engines. Each subsequent engine compensates for the imperfectness of the preceding engine by performing work equal to the lost available work of the preceding one. The sequence of heat engines is regarded as a chain of the subject's mental images of the self. Each engine can be interpreted as an image of the self that the engine next to it has, and the work performed by engines as the emotions that the subject and his images are experiencing. Two types of meditation are analyzed: The dissolution in nothingness and union with the Absolute. In the first type, the initial engine is the one that yields heat to the coldest reservoir, and in the second type, the initial engine is the one that takes heat from the hottest reservoir. The main concepts of thermodynamics are reviewed in relation to the process of human reflexion. Copyright © 2017 Elsevier Ltd. All rights reserved.
26 CFR 1.163-10T - Qualified residence interest (temporary).
2010-04-01
... general. (ii)Example. (g)Selection of method. (h)Average balance. (1)Average balance defined. (2)Average balance reported by lender. (3)Average balance computed on a daily basis. (i)In general. (ii)Example. (4)Average balance computed using the interest rate. (i)In general. (ii)Points and prepaid interest. (iii...
Type II Supernova Light Curves and Spectra from the CfA
Hicken, Malcolm; Friedman, Andrew S.; Blondin, Stephane; Challis, Peter; Berlind, Perry; Calkins, Mike; Esquerdo, Gil; Matheson, Thomas; Modjaz, Maryam; Rest, Armin; Kirshner, Robert P.
2017-11-01
We present multiband photometry of 60 spectroscopically confirmed supernovae (SNe): 39 SNe II/IIP, 19 IIn, 1 IIb, and 1 that was originally classified as a IIn but later as a Ibn. Of these, 46 have only optical photometry, 6 have only near-infrared (NIR) photometry, and 8 have both optical and NIR. The median redshift of the sample is 0.016. We also present 195 optical spectra for 48 of the 60 SN. There are 26 optical and 2 NIR light curves of SNe II/IIP with redshifts z> 0.01, some of which may give rise to useful distances for cosmological applications. All photometry was obtained between 2000 and 2011 at the Fred Lawrence Whipple Observatory (FLWO), via the 1.2 m and 1.3 m PAIRITEL telescopes for the optical and NIR, respectively. Each SN was observed in a subset of the u\\prime {UBVRIr}\\prime I\\prime {{JHK}}s bands. There are a total of 2932 optical and 816 NIR light curve points. Optical spectra were obtained using the FLWO 1.5 m Tillinghast telescope with the FAST spectrograph and the MMT Telescope with the Blue Channel Spectrograph. Our photometry is in reasonable agreement with select samples from the literature: two-thirds of our star sequences have average V offsets within ±0.02 mag and roughly three-quarters of our light curves have average differences within ±0.04 mag. The data from this work and the literature will provide insight into SN II explosions, help with developing methods for photometric SN classification, and contribute to their use as cosmological distance indicators.
Qurashi, Salem; Tamimi, Abdulrahman; Jaradat, Maha; Al Sayyari, Abulla
2012-12-01
To assess the effect of fasting Ramadan during the hottest month of the year in Riyadh, Saudi Arabia. This prospective cohort study was performed at the King Fahd National Guard Hospital in Riyadh, Saudi Arabia. We used the Modification of Diet in Renal Disease formula to estimate the glomerular filtration rate in renal transplant patients who fasted and did not fast before and after Ramadan. There were 43 fasters and 37 nonfasters of comparable ages, with fasters having longer posttransplant times compared with nonfasters (P = .0001). The 2 groups had similar mean estimated glomerular filtration rates before Ramadan: 75.6 ± 29.2 and 65.9 ± 25.9 mL/min (P = .1) and similar mean estimated glomerular filtration rates 6 months after Ramadan: 77.2 ± 29.7 and 64.1 ± 29 mL/min (P = .21). Mean changes in the estimated glomerular filtration rate were similar in the 2 groups: -1.5 ± 10.9 and -2.8 ± 19.3 (P = .7) as was the percentage change (-0.2.2 ± 13.4 and 1.8 ± 15.9; P = .4). In the fasting group, serum creatinine and estimated glomerular filtration rate were similar before and 6 months after Ramadan: 105.1 ± 55 and 105.14 ± 61 μmol/L (P = 1.0) and 75.6 ± 29 and 72.2 ± 29.7 mL/min (P = .36). No significant changes were observed in the nonfasting group. No significant differences were detected regarding fasting in the estimated glomerular filtration rate before and 6 months after Ramadan in the 3 groups with the low, moderate, and high glomerular filtration rates at baseline. Fasting for Ramadan in August does not adversely affect graft function at a mean follow-up of 7.6 ± 1.3 months.
International Nuclear Information System (INIS)
Peterson, T.
1993-01-01
This paper reviews the growing power and economic strength of Enron Corp., a natural gas distributor and exploration company. The paper reviews the policy of the company to exploit deregulation at home and privatization of all sorts of energy companies abroad. Enron is actively building its own power plants in the US and has successfully boosted their profits by 20 percent in what was considered a flat natural gas market. The paper goes on to discuss the company's view of the new energy tax and how it should benefit natural gas companies as a whole. Finally the paper reviews the contracting procedures of the company to secure long-term fixed price contracts in a volatile market which precludes most companies from taking the risk
Type Ibn Supernovae Show Photometric Homogeneity and Spectral Diversity at Maximum Light
Energy Technology Data Exchange (ETDEWEB)
Hosseinzadeh, Griffin; Arcavi, Iair; McCully, Curtis; Howell, D. Andrew [Las Cumbres Observatory, 6740 Cortona Dr Ste 102, Goleta, CA 93117-5575 (United States); Valenti, Stefano [Department of Physics, University of California, 1 Shields Ave, Davis, CA 95616-5270 (United States); Johansson, Joel [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel); Sollerman, Jesper; Fremling, Christoffer; Karamehmetoglu, Emir [Oskar Klein Centre, Department of Astronomy, Stockholm University, Albanova University Centre, SE-106 91 Stockholm (Sweden); Pastorello, Andrea; Benetti, Stefano; Elias-Rosa, Nancy [INAF-Osservatorio Astronomico di Padova, Vicolo dell’Osservatorio 5, I-35122 Padova (Italy); Cao, Yi; Duggan, Gina; Horesh, Assaf [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Mail Code 249-17, Pasadena, CA 91125 (United States); Cenko, S. Bradley [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Clubb, Kelsey I.; Filippenko, Alexei V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Corsi, Alessandra [Department of Physics, Texas Tech University, Box 41051, Lubbock, TX 79409-1051 (United States); Fox, Ori D., E-mail: griffin@lco.global [Space Telescope Science Institute, 3700 San Martin Dr, Baltimore, MD 21218 (United States); and others
2017-02-20
Type Ibn supernovae (SNe) are a small yet intriguing class of explosions whose spectra are characterized by low-velocity helium emission lines with little to no evidence for hydrogen. The prevailing theory has been that these are the core-collapse explosions of very massive stars embedded in helium-rich circumstellar material (CSM). We report optical observations of six new SNe Ibn: PTF11rfh, PTF12ldy, iPTF14aki, iPTF15ul, SN 2015G, and iPTF15akq. This brings the sample size of such objects in the literature to 22. We also report new data, including a near-infrared spectrum, on the Type Ibn SN 2015U. In order to characterize the class as a whole, we analyze the photometric and spectroscopic properties of the full Type Ibn sample. We find that, despite the expectation that CSM interaction would generate a heterogeneous set of light curves, as seen in SNe IIn, most Type Ibn light curves are quite similar in shape, declining at rates around 0.1 mag day{sup −1} during the first month after maximum light, with a few significant exceptions. Early spectra of SNe Ibn come in at least two varieties, one that shows narrow P Cygni lines and another dominated by broader emission lines, both around maximum light, which may be an indication of differences in the state of the progenitor system at the time of explosion. Alternatively, the spectral diversity could arise from viewing-angle effects or merely from a lack of early spectroscopic coverage. Together, the relative light curve homogeneity and narrow spectral features suggest that the CSM consists of a spatially confined shell of helium surrounded by a less dense extended wind.
Internet-Based Indoor Navigation Services
Zeinalipour-Yazti, Demetrios; Laoudias, Christos; Georgiou, Kyriakos
2017-01-01
Smartphone advances are leading to a class of Internet-based Indoor Navigation services. IIN services rely on geolocation databases that store indoor models, comprising floor maps and points of interest, along with wireless, light, and magnetic signals for localizing users. Developing IIN services creates new information management challenges - such as crowdsourcing indoor models, acquiring and fusing big data velocity signals, localization algorithms, and custodians' location privacy. Here, ...
Tidal and Lunar Data for Point Mugu, San Nicholas Island, and the Barking Sands Area During 1991
1990-12-31
12 13 M 1111 ft" trn able ISI 011 1113 em toao mu" MOO 13 14 am tm Sea 173 am tSOM any 11V am Sell mufi 410 1 Is m 171e Oka 1t0 SNY tell E1 IInS am tat...CA 93106-0260 Naval Oceanography Command Facility Naval Air Station, North Island Ventura College San Diego, CA 92135-5130 Biology Department 4667
SN REFSDAL: CLASSIFICATION AS A LUMINOUS AND BLUE SN 1987A-LIKE TYPE II SUPERNOVA
Energy Technology Data Exchange (ETDEWEB)
Kelly, P. L.; Filippenko, A. V.; Graham, M. L. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Brammer, G.; Strolger, L.-G.; Riess, A. G. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Selsing, J.; Hjorth, J.; Christensen, L. [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen (Denmark); Foley, R. J. [Department of Physics, University of Illinois at Urbana-Champaign, 1110 W. Green Street, Urbana, IL 61801 (United States); Rodney, S. A. [Department of Physics and Astronomy, University of South Carolina, 712 Main St., Columbia, SC 29208 (United States); Treu, T. [University of California, Los Angeles, CA 90095 (United States); Steidel, C. C.; Strom, A.; Zitrin, A. [California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Schmidt, K. B.; McCully, C. [Department of Physics, University of California, Santa Barbara, CA 93106-9530 (United States); Bradač, M. [University of California, Davis, 1 Shields Avenue, Davis, CA 95616 (United States); Jha, S. W. [Department of Physics and Astronomy, Rutgers, The State University of New Jersey, Piscataway, NJ 08854 (United States); Graur, O., E-mail: pkelly@astro.berkeley.edu [Center for Cosmology and Particle Physics, New York University, New York, NY 10003 (United States); and others
2016-11-10
We have acquired Hubble Space Telescope (HST) and Very Large Telescope near-infrared spectra and images of supernova (SN) Refsdal after its discovery as an Einstein cross in fall 2014. The HST light curve of SN Refsdal has a shape consistent with the distinctive, slowly rising light curves of SN 1987A-like SNe, and we find strong evidence for a broad H α P-Cygni profile and Na I D absorption in the HST grism spectrum at the redshift ( z = 1.49) of the spiral host galaxy. SNe IIn, largely powered by circumstellar interaction, could provide a good match to the light curve of SN Refsdal, but the spectrum of a SN IIn would not show broad and strong H α and Na I D absorption. From the grism spectrum, we measure an H α expansion velocity consistent with those of SN 1987A-like SNe at a similar phase. The luminosity, evolution, and Gaussian profile of the H α emission of the WFC3 and X-shooter spectra, separated by ∼2.5 months in the rest frame, provide additional evidence that supports the SN 1987A-like classification. In comparison with other examples of SN 1987A-like SNe, photometry of SN Refsdal favors bluer B - V and V - R colors and one of the largest luminosities for the assumed range of potential magnifications. The evolution of the light curve at late times will provide additional evidence about the potential existence of any substantial circumstellar material. Using MOSFIRE and X-shooter spectra, we estimate a subsolar host-galaxy metallicity (8.3 ± 0.1 dex and <8.4 dex, respectively) near the explosion site.
The Low-luminosity Type IIP Supernova 2016bkv with Early-phase Circumstellar Interaction
Nakaoka, Tatsuya; Kawabata, Koji S.; Maeda, Keiichi; Tanaka, Masaomi; Yamanaka, Masayuki; Moriya, Takashi J.; Tominaga, Nozomu; Morokuma, Tomoki; Takaki, Katsutoshi; Kawabata, Miho; Kawahara, Naoki; Itoh, Ryosuke; Shiki, Kensei; Mori, Hiroki; Hirochi, Jun; Abe, Taisei; Uemura, Makoto; Yoshida, Michitoshi; Akitaya, Hiroshi; Moritani, Yuki; Ueno, Issei; Urano, Takeshi; Isogai, Mizuki; Hanayama, Hidekazu; Nagayama, Takahiro
2018-06-01
We present optical and near-infrared observations of a low-luminosity (LL) Type IIP supernova (SN) 2016bkv from the initial rising phase to the plateau phase. Our observations show that the end of the plateau is extended to ≳140 days since the explosion, indicating that this SN takes one of the longest times to finish the plateau phase among Type IIP SNe (SNe IIP), including LL SNe IIP. The line velocities of various ions at the middle of the plateau phase are as low as 1000–1500 km s‑1, which is the lowest even among LL SNe IIP. These measurements imply that the ejecta mass in SN 2016bkv is larger than that of the well-studied LL IIP SN 2003Z. In the early phase, SN 2016bkv shows a strong bump in the light curve. In addition, the optical spectra in this bump phase exhibit a blue continuum accompanied by a narrow Hα emission line. These features indicate an interaction between the SN ejecta and the circumstellar matter (CSM) as in SNe IIn. Assuming the ejecta–CSM interaction scenario, the mass loss rate is estimated to be ∼ 1.7× {10}-2 {M}ȯ yr‑1 within a few years before the SN explosion. This is comparable to or even larger than the largest mass loss rate observed for the Galactic red supergiants (∼ {10}-3 {M}ȯ yr‑1 for VY CMa). We suggest that the progenitor star of SN 2016bkv experienced a violent mass loss just before the SN explosion.
Das, Sanskriti; Ray, Alak
2017-12-01
We show how dense, compact, discrete shells of circumstellar gas immediately outside of red supergiants affect the optical light curves of Type II-P/II-L supernovae (SNe), using the example of SN 2013ej. Earlier efforts in the literature had used an artificial circumstellar medium (CSM) stitched to the surface of an evolved star that had not gone through a phase of late-stage heavy mass loss, which, in essence, is the original source of the CSM. In contrast, we allow enhanced mass-loss rate from the modeled star during the 16O and 28Si burning stages and construct the CSM from the resulting mass-loss history in a self-consistent way. Once such evolved pre-SN stars are exploded, we find that the models with early interaction between the shock and the dense CSM reproduce light curves far better than those without that mass loss and, hence, having no nearby dense CSM. The required explosion energy for the progenitors with a dense CSM is reduced by almost a factor of two compared to those without the CSM. Our model, with a more realistic CSM profile and presupernova and explosion parameters, fits observed data much better throughout the rise, plateau, and radioactive tail phases as compared to previous studies. This points to an intermediate class of supernovae between Type II-P/II-L and Type II-n SNe with the characteristics of simultaneous UV and optical peak, slow decline after peak, and a longer plateau.
Wave Front Sensor for Solar Concentrator Control
2009-10-01
terrestrial-based and space-based. Both types of concentrator can be either imaging or nonimaging and they can be rigid or inflatable. Other...and T is the temperature of the absorber and propellant. In (5), Iin is input intensity with effects of the optical path through the concentrator acting...Hartmann in 1900 and was used for checking optical telescopes for aberrations. It was an array of holes in a plate placed in front of the mirror of
SEARCH FOR PRECURSOR ERUPTIONS AMONG TYPE IIB SUPERNOVAE
Energy Technology Data Exchange (ETDEWEB)
Strotjohann, Nora L.; Ofek, Eran O.; Gal-Yam, Avishay; Yaron, Ofer [Benoziyo Center for Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel); Sullivan, Mark [School of Physics and Astronomy, University of Southampton, Southampton SO17 1BJ (United Kingdom); Kulkarni, Shrinivas R.; Cao, Yi [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Shaviv, Nir J. [School of Natural Sciences, Institute for Advanced Study, 1 Einstein Drive, Princeton, NJ 08540 (United States); Fremling, Christoffer; Sollerman, Jesper [The Oskar Klein Centre, Department of Astronomy, Stockholm University, AlbaNova, SE-10691 Stockholm (Sweden); Kasliwal, Mansi M. [Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Nugent, Peter E. [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Arcavi, Iair [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Goleta, CA 93111 (United States); Filippenko, Alexei V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Laher, Russ; Surace, Jason [Spitzer Science Center, California Institute of Technology, M/S 314-6, Pasadena, CA 91125 (United States)
2015-10-01
The progenitor stars of several Type IIb supernovae (SNe) show indications of extended hydrogen envelopes. These envelopes might be the outcome of luminous energetic pre-explosion events, so-called precursor eruptions. We use the Palomar Transient Factory (PTF) pre-explosion observations of a sample of 27 nearby SNe IIb to look for such precursors during the final years prior to the SN explosion. No precursors are found when combining the observations in 15-day bins, and we calculate the absolute-magnitude-dependent upper limit on the precursor rate. At the 90% confidence level, SNe IIb have on average <0.86 precursors as bright as an absolute R-band magnitude of −14 in the final 3.5 years before the explosion and <0.56 events over the final year. In contrast, precursors among SNe IIn have a ≳5 times higher rate. The kinetic energy required to unbind a low-mass stellar envelope is comparable to the radiated energy of a few-weeks-long precursor that would be detectable for the closest SNe in our sample. Therefore, mass ejections, if they are common in such SNe, are radiatively inefficient or have durations longer than months. Indeed, when using 60-day bins, a faint precursor candidate is detected prior to SN 2012cs (∼2% false-alarm probability). We also report the detection of the progenitor of SN 2011dh that does not show detectable variability over the final two years before the explosion. The suggested progenitor of SN 2012P is still present, and hence is likely a compact star cluster or an unrelated object.
Dicty_cDB: Contig-U15778-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available vhqv*hlhri*nnyinhymtqvqecivilgvlyq*rgiqvvihqtllqlmisfsliqis sflellvttsntyhyslnplqrmllplvlikqfmkii*lmvqii*iin...ivsfqiqsiqyh*iv*i* iiekl*lilphqqativikwmvtvhifvvlqqvlqrilqlifhhlvvlqlmqrlhsliwq v
Evolution of international trade and investment networks
Zhang, Shuhong; Wang, Lin; Liu, Zhixin; Wang, Xiaofan
2016-11-01
In this paper, an evolving two-layer international economy network (IEN) consisting of international trade network (ITN) and international investment network (IIN) as layers, is constructed to investigate the world economy from 2001 to 2010. First, the structure analysis shows that the average partner numbers for both trade and investment are increasing year by year, and the average volume has a significant decrease in 2008 for investment and 2009 for trade. The IIN has longer average path length and dramatically lower edge density compared with the ITN, yet its clustering coefficient is larger in all years. Then, the regional relativity indicates that the longer the distance between two countries, the smaller trade and investment volumes they carry in are general, and the impact of the geographical distance gradually reduces as time goes on. Furthermore, the countries and regions are ranked by Pagerank in ITN, IIN and IEN to illustrate the roles they played. And finally, community structures are detected to visualize the global economic landscape, with countries and regions in the same community ranked according to the total volume of trade or investment.
U.S. Navy Marine Climatic Atlas of the World. Volume IX. World-Wide Means and Standard Deviations
1981-10-01
TITLE (..d SobtII,) S. TYPE OF REPORT & PERIOD COVERED U. S. Navy Marine Climatic Atlas of the World Volume IX World-wide Means and Standard Reference...Ives the best estimate of the population standard deviations. The means, , are com~nuted from: EX IIN I 90 80 70 60" 50’ 40, 30 20 10 0 1070 T- VErr ...or 10%, whichever is greater Since the mean ice limit approximates the minus two de l temperature isopleth, this analyzed lower limit was Wave Heights
Kamal, Kirti; Jain, Parul; Bansal, Teena; Ahlawat, Geeta
2018-04-01
Both transversus abdominis plane (TAP) block and combined ilioinguinal-iliohypogastric (IIN/IHN) blocks are used routinely under ultrasound (USG) guidance for postoperative pain relief in patients undergoing inguinal hernia surgery. This study compares USG guided TAP Vs IIN/IHN block for post-operative analgesic efficacy in adults undergoing inguinal hernia surgery. Sixty adults aged 18 to 60 with American Society of Anesthesiologsts' grade I or II were included. After general anaesthesia, patients in Group I received USG guided unilateral TAP block using 0.75% ropivacaine 3 mg/kg (maximum 25 mL) and those in Group II received IIN/IHN block using 10 mL 0.75% ropivacaine. Postoperative rescue analgesia was with tramadol (intravenous) IV ± diclofenac IV in the first 4 h followed by oral diclofenac subsequently. Total analgesic consumption in the first 24 h was the primary objective, intraoperative haemodynamics, number of attempts and time required for performing the block as well as the postoperative pain scores were also evaluated. Time to first analgesic request was 319.8 ± 115.2 min in Group I and 408 ± 116.4 min in Group II ( P = 0.005). Seven patients (23.33%) in Group I and two (6.67%) in Group II required tramadol in first four hours. No patient in either groups received diclofenac IV. The average dose of tablet diclofenac was 200 ± 35.96 mg in Group I and 172.5 ± 34.96 mg in Group II ( P = 0. 004). USG guided IIN/IHN block reduces the postoperative analgesic requirement compared to USG guided TAP block.
The 10 Hottest Technologies in Telecom.
Flanagan, Patrick
1996-01-01
Synthesizes opinions of experts regarding technologies deemed most likely to enter the telecommunications mainstream by 1998, including: (1) the Java programming language; (2) voice- over frame relay; (3) virtual local area networks (LANs); (4) cable modems; (5) gigabit LANs; (6) Internet appliances; (7) personal satellite phones; (8) intranets;…
Hair cycle in dogs with different hair types in a tropical region of Brazil.
Favarato, Evandro S; Conceição, Lissandro Gonçalves
2008-02-01
Hair cycle activity has been extensively studied in humans, sheep and laboratory animals, but there is a lack of information in dogs. Besides varying according to species, breed, sex and general health, hair growth is mainly affected by climatic variations. The aim of the study was to evaluate the follicle activity in three breeds of dogs with different hair types, in the city of Viçosa, Minas Gerais (latitude 20 degrees 45'S), Brazil. Twenty-one male dogs of boxer, labrador and schnauzer breeds were trichographically analysed monthly over 12 consecutive months. Hair percentage of telogen and anagen hairs at the different stages of the hair cycle in boxers and labradors was not significantly different, but both differed from the schnauzers. A significant correlation between hair follicle cycle and environmental temperature and photoperiod was noted in the boxers and labradors. In these breeds, a larger number of telogen hairs were observed during the hottest months of the year, and an increase in anagen hairs during the coldest months. The mean percentage of telogen hairs was 93, 90 and 55.3% for boxer, labrador and schnauzer, respectively.
SNaX: A Database of Supernova X-Ray Light Curves
Energy Technology Data Exchange (ETDEWEB)
Ross, Mathias; Dwarkadas, Vikram V., E-mail: Mathias_Ross@msn.com, E-mail: vikram@oddjob.uchicago.edu [Astronomy and Astrophysics, University of Chicago, 5640 S Ellis Avenue, ERC 569, Chicago, IL 60637 (United States)
2017-06-01
We present the Supernova X-ray Database (SNaX), a compilation of the X-ray data from young supernovae (SNe). The database includes the X-ray fluxes and luminosities of young SNe, from days to years after outburst. The original goal and intent of this study was to present a database of Type IIn SNe (SNe IIn), which we have accomplished. Our ongoing goal is to expand the database to include all SNe for which published data are available. The database interface allows one to search for SNe using various criteria, plot all or selected data points, and download both the data and the plot. The plotting facility allows for significant customization. There is also a facility for the user to submit data that can be directly incorporated into the database. We include an option to fit the decay of any given SN light curve with a power-law. The database includes a conversion of most data points to a common 0.3–8 keV band so that SN light curves may be directly compared with each other. A mailing list has been set up to disseminate information about the database. We outline the structure and function of the database, describe its various features, and outline the plans for future expansion.
MT1 melatonin receptors and their role in the oncostatic action of melatonin
Directory of Open Access Journals (Sweden)
Karolina Danielczyk
2009-09-01
Full Text Available Melatonin, the main hormone produced by the pineal gland, strongly inhibits the growth of cancer cells [i]in vitro[/i] and [i]in vivo[/i]. Some publications indicate that the addition of melatonin to culture medium slows the proliferation of some cancer cell lines. It is also suggested that melatonin used as an adjuvant benefits the effectiveness and tolerance of chemotherapy. The mechanisms of this are not fully understood, but melatonin receptors might be one of the most important elements. Two distinct types of membrane-bound melatonin receptors have been identified in humans: MT1 (Mel1a and MT2 (Mel1b receptors. These subtypes are 60�0homologous at the amino-acid level. MT1 receptors are G-protein-coupled receptors. Through the α subunit of G protein, melatonin receptors stimulate an adenylate cyclase and decrease the level of cAMP. This has a significant influence on cell proliferation and has been confirmed in many tests on different cell lines, such as S-19, B-16 murine melanoma cells, and breast cancer cells. It seems that expression of the MT1 melatonin receptors benefits the efficacy of melatonin treatment. Melatonin and its receptors may provide a promising way to establish new alternative therapeutic approaches in human cancer prevention.
SNaX: A Database of Supernova X-Ray Light Curves
International Nuclear Information System (INIS)
Ross, Mathias; Dwarkadas, Vikram V.
2017-01-01
We present the Supernova X-ray Database (SNaX), a compilation of the X-ray data from young supernovae (SNe). The database includes the X-ray fluxes and luminosities of young SNe, from days to years after outburst. The original goal and intent of this study was to present a database of Type IIn SNe (SNe IIn), which we have accomplished. Our ongoing goal is to expand the database to include all SNe for which published data are available. The database interface allows one to search for SNe using various criteria, plot all or selected data points, and download both the data and the plot. The plotting facility allows for significant customization. There is also a facility for the user to submit data that can be directly incorporated into the database. We include an option to fit the decay of any given SN light curve with a power-law. The database includes a conversion of most data points to a common 0.3–8 keV band so that SN light curves may be directly compared with each other. A mailing list has been set up to disseminate information about the database. We outline the structure and function of the database, describe its various features, and outline the plans for future expansion.
Directory of Open Access Journals (Sweden)
Kirti Kamal
2018-01-01
Full Text Available Background and Aims: Both transversus abdominis plane (TAP block and combined ilioinguinal-iliohypogastric (IIN/IHN blocks are used routinely under ultrasound (USG guidance for postoperative pain relief in patients undergoing inguinal hernia surgery. This study compares USG guided TAP Vs IIN/IHN block for post-operative analgesic efficacy in adults undergoing inguinal hernia surgery. Methods: Sixty adults aged 18 to 60 with American Society of Anesthesiologsts' grade I or II were included. After general anaesthesia, patients in Group I received USG guided unilateral TAP block using 0.75% ropivacaine 3 mg/kg (maximum 25 mL and those in Group II received IIN/IHN block using 10 mL 0.75% ropivacaine. Postoperative rescue analgesia was with tramadol (intravenous IV ± diclofenac IV in the first 4 h followed by oral diclofenac subsequently. Total analgesic consumption in the first 24 h was the primary objective, intraoperative haemodynamics, number of attempts and time required for performing the block as well as the postoperative pain scores were also evaluated. Results: Time to first analgesic request was 319.8 ± 115.2 min in Group I and 408 ± 116.4 min in Group II (P = 0.005. Seven patients (23.33% in Group I and two (6.67% in Group II required tramadol in first four hours. No patient in either groups received diclofenac IV. The average dose of tablet diclofenac was 200 ± 35.96 mg in Group I and 172.5 ± 34.96 mg in Group II (P = 0. 004. Conclusion: USG guided IIN/IHN block reduces the postoperative analgesic requirement compared to USG guided TAP block.
1990-03-01
alof basedles app dtch. 7 he is tade dew b proosed Vgla ayb Ceontamintant Ionc s tomectses for i bvuto Oefui e fe avda -Abtelee ae f6 = vsW...cu__teApcue i ee~n be mede acca ~nrd to the provisions to MA4IinS h trave i o AoObtoi esf § 25L for casia-by-case nenkatlovsaf tea of Aie solvents.i Duo...U61a eu,1=4tk’z tn~Jusiing equivulent~ satndsr& Gop nia~ an orýtreplezztfo h prvso itc o T&?O* 1.es POWuVer, acca agtoorized a State M=1 13r .13 &~n
African Journals Online (AJOL)
pc
Temperature ranges from 21oC in the coldest months (December/January) to 31oC in the hottest months April/March). Four distinct seasons are experienced, which are the dry and cool, dry and hot, wet and warm, and dry and warm seasons (Olofin,. 1987; & Olofin, 2013). The natural vegetation is the Sudan Savannah type,.
International Nuclear Information System (INIS)
Straniero, O; Piersanti, L; Cristallo, S
2016-01-01
M up is the minimum stellar mass that, after the core-helium burning, develops temperature and density conditions for the occurrence of a hydrostatic carbon burning. Stars whose mass is lower than this limit are the progenitors of C-O white dwarfs and, when belong to a close binary system, may give rise to explosive phenomena, such as novae or type Ia supernovae. Stars whose mass is only slightly larger than M up ignite C in a degenerate core and, in turn, experience a thermonuclear runaway. Their final fate may be a massive O-Ne WDs or, if the core mass approaches the Chandrasekhar limit, an e-capture SNe. More massive objects ignite C in non-degenerate conditions. These “massive “ stars are the progenitors of various kind of core-collapse supernovae (type IIp. IIL, IIN, Ib, Ic). It goes without saying that M up is a fundamental astrophysical parameter. From its knowledge depends our understanding of the SNe progenitors, of their rates, of the chemical evolution, of the WD luminosity functions and much more. A precise evaluation of M up relies on our knowledge of various input physics used in stellar modeling, such as the plasma neutrino rate, responsible of the cooling of the core, the equation of state of high density plasma, which affects the heating of the contracting core and its compressibility, and some key nuclear reaction rates, such as, in particular, the 12 C+ 12 C and the 12 C+α. In this paper we review the efforts made to determine this important parameter and we provide an up-to-date evaluation of the uncertainties due to the relevant nuclear physics inputs. (paper)
SN 2011A: A Low-luminosity Interacting Transient with a Double Plateau and Strong Sodium Absorption
de Jaeger, T.; Anderson, J. P.; Pignata, G.; Hamuy, M.; Kankare, E.; Stritzinger, M. D.; Benetti, S.; Bufano, F.; Elias-Rosa, N.; Folatelli, G.; Förster, F.; González-Gaitán, S.; Gutiérrez, C. P.; Inserra, C.; Kotak, R.; Lira, P.; Morrell, N.; Taddia, F.; Tomasella, L.
2015-07-01
We present optical photometry and spectroscopy of the optical transient SN 2011A. Our data span 140 days after discovery including {BVRI} u\\prime g\\prime r\\prime i\\prime z\\prime photometry and 11 epochs of optical spectroscopy. Originally classified as a type IIn supernova (SN IIn) due to the presence of narrow Hα emission, this object shows exceptional characteristics. First, the light curve shows a double plateau, a property only observed before in the impostor SN 1997bs. Second, SN 2011A has a very low luminosity ({M}V=-15.72), placing it between normal luminous SNe IIn and SN impostors. Third, SN 2011A shows low velocity and high equivalent width absorption close to the sodium doublet, which increases with time and is most likely of circumstellar origin. This evolution is also accompanied by a change in line profile; when the absorption becomes stronger, a P Cygni profile appears. We discuss SN 2011A in the context of interacting SNe IIn and SN impostors, which appears to confirm the uniqueness of this transient. While we favor an impostor origin for SN 2011A, we highlight the difficulty in differentiating between terminal and non-terminal interacting transients. This paper includes data obtained with the 6.5 m Magellan Telescopes and du Pont telescope; the Gemini-North Telescope, Mauna Kea, USA (Gemini Program GN-2010B-Q67, PI: Stritzinger); the PROMPT telescopes at Cerro Tololo Inter-American Observatory in Chile; with the Liverpool Telescope operated on the island of La Palma by Liverpool John Moores University in the Spanish Observatorio del Roque de los Muchachos of the Instituto de Astrofisica de Canarias with financial support from the UK Science and Technology Facilities Council; based on observations made with the Nordic Optical Telescope, operated by the Nordic Optical Telescope Scientific Association at the Observatorio del Roque de los Muchachos, La Palma, Spain, of the Instituto de Astrofisica de Canarias; the NTT from ESO Science Archive
Lifescience Database Archive (English)
Full Text Available pcesvrarwaykvpgsxiqnllgmkhgapnkhhiilxk Frame B: gk*iin*dvniqtikrnrkrfhc**k*iqsctkq*nlngncqefrsqepqsfqslkmklm l*iyy*mksqkvlkscala...fmlptlx--- ---nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqs lkmklml*iyy*mksqkvlkscalavvplmksvsrk
Hot Dust! Late-Time Infrared Emission From Supernovae
Fox, Ori; Skrutskie, M. F.; Chevalier, R. A.
2010-01-01
Supernovae light curves typically peak and fade in the course of several months. Some supernovae , however, exhibit late-time infrared emission that in some cases can last for several years. These supernovae tend to be of the Type IIn subclass, which is defined by narrow hydrogen and helium emission lines arising from a dense, pre-existing circumstellar medium excited by the supernova radiation. Such a late-time ``IR excess'' with respect to the optical blackbody counterpart typically indicates the presence of warm dust. The origin and heating mechanism of the dust is not, however, always well constrained. In this talk, I will explore several scenarios that explain the observed late-time emission. In particular, I will discuss the case of the Type IIn SN 2005ip, which has displayed an ``IR excess'' for over 3 years. The results allow us to interpret the progenitor system and better understand the late stages of stellar evolution. Much of the data used for this analysis were obtained with TripleSpec, a medium-resolution near-infrared spectrograph located at Apache Point Observatory, NM, and FanCam, a JHK imager located at Fan Mountain Observatory, just outside of Charlottesville, VA. These two instruments were designed, fabricated, built, and commissioned by our instrumentation group at the University of Virginia. I will also spend some time discussing these instruments. I would like to thank the following for financial support of this work throughout my graduate career: NASA GSRP, NSF AAG-0607737, Spitzer PID 50256, Achievement Reward for College Scientists (ARCS), and the Virginia Space Grant Consortium.
PROGENITORS OF RECOMBINING SUPERNOVA REMNANTS
Energy Technology Data Exchange (ETDEWEB)
Moriya, Takashi J., E-mail: takashi.moriya@ipmu.jp [Kavli Institute for the Physics and Mathematics of the Universe, Todai Institutes for Advanced Study, University of Tokyo, Kashiwanoha 5-1-5, Kashiwa, Chiba 277-8583 (Japan)
2012-05-01
Usual supernova remnants have either ionizing plasma or plasma in collisional ionization equilibrium, i.e., the ionization temperature is lower than or equal to the electron temperature. However, the existence of recombining supernova remnants, i.e., supernova remnants with ionization temperature higher than the electron temperature, has been recently confirmed. One suggested way to have recombining plasma in a supernova remnant is to have a dense circumstellar medium at the time of the supernova explosion. If the circumstellar medium is dense enough, collisional ionization equilibrium can be established in the early stage of the evolution of the supernova remnant and subsequent adiabatic cooling, which occurs after the shock wave gets out of the dense circumstellar medium, makes the electron temperature lower than the ionization temperature. We study the circumstellar medium around several supernova progenitors and show which supernova progenitors can have a circumstellar medium dense enough to establish collisional ionization equilibrium soon after the explosion. We find that the circumstellar medium around red supergiants (especially massive ones) and the circumstellar medium dense enough to make Type IIn supernovae can establish collisional ionization equilibrium soon after the explosion and can evolve to become recombining supernova remnants. Wolf-Rayet stars and white dwarfs have the possibility to be recombining supernova remnants but the fraction is expected to be very small. As the occurrence rate of the explosions of red supergiants is much higher than that of Type IIn supernovae, the major progenitors of recombining supernova remnants are likely to be red supergiants.
Leonardo, Jennifer B; Spicer, Rebecca S; Katradis, Maria; Allison, Jennifer; Thomas, Rebekah
2018-02-16
This study investigated whether the Child Safety Collaborative Innovation and Improvement Network (CS CoIIN) framework could be applied in the field of injury and violence prevention to reduce fatalities, hospitalizations and emergency department visits among 0-19 year olds. Twenty-one states/jurisdictions were accepted into cohort 1 of the CS CoIIN, and 14 were engaged from March 2016 through April 2017. A quality improvement framework was used to test, implement and spread evidence-based change ideas (strategies and programs) in child passenger safety, falls prevention, interpersonal violence prevention, suicide and self-harm prevention and teen driver safety. Outcome and process measure data were analyzed using run chart rules. Descriptive data were analyzed for participation measures and descriptive statistics were produced. Qualitative data were analyzed to identify key themes. Seventy-six percent of CS CoIIN states/jurisdictions were engaged in activities and used data to inform decision making. Within a year, states/jurisdictions were able to test and implement evidence-based change ideas in pilot sites. A small group showed improvement in process measures and were ready to spread change ideas. Improvement in outcome measures was not achieved; however, 25% of states/jurisdictions identified data sources and reported on real-time outcome measures. Evidence indicates the CS CoIIN framework can be applied to make progress on process measures, but more time is needed to determine if this will result in progress on long-term outcome measures of fatalities, hospitalizations and emergency department visits. Seventeen states/jurisdictions will participate in cohort 2. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
DEFF Research Database (Denmark)
Kelly, P. L.; Brammer, G.; Selsing, J.
2016-01-01
(SNe), and we find strong evidence for a broad H-alpha P-Cygni profile in the HST grism spectrum at the redshift (z = 1.49) of the spiral host galaxy. SNe IIn, powered by circumstellar interaction, could provide a good match to the light curve of SN Refsdal, but the spectrum of a SN IIn would not show...... in the rest frame, provide additional evidence that supports the SN 1987A-like classification. In comparison with other examples of SN 1987A-like SNe, SN Refsdal has a blue B-V color and a high luminosity for the assumed range of potential magnifications. If SN Refsdal can be modeled as a scaled version of SN...
VizieR Online Data Catalog: Circumstellar-interacting supernovae (Taddia+, 2015)
Taddia, F.; Sollerman, J.; Fremling, C.; Pastorello, A.; Leloudas, G.; Fransson, C.; Nyholm, A.; Stritzinger, M. D.; Ergon, M.; Roy, R.; Migotto, K.
2015-11-01
In Table 1 we report the list of 60 transients included in our sample. Thirty-five of them are SNe IIn, six are SNe Ibn, one is a SN Ia-CSM, 18 are SN IMs (if we also count SN 2009ip in the SN IMs, then we have 19 of these transients). With the NOT, long-slit spectra were obtained for the host galaxies of 13 SNe IIn, five SNe Ibn, one SN Ia-CSM, and 16 SN IMs (the derived metallicity for SN 2007sv was published in Tartaglia et al. 2015MNRAS.447..117T). The host galaxies observed at the NOT are marked with the letter "o" in the third column of Table 1. With the NOT, we also obtained broad-band R and narrow-band Hα images for the SNe IIn (except for SN 1995G) and Ibn. We complemented our observed sample with host galaxies whose metallicities (at the center of the galaxy or at the SN position) were already available in the literature (marked with the letter "l" in the third column of Table 1) or whose spectra were available in public archives (marked with the letter "a" in the third column of Table 1). (7 data files).
Development of aptamers for <i>in vivo and <i>in vitro biosensor applications
DEFF Research Database (Denmark)
Lauridsen, Lasse Holm
block chemicals are now being sustainably produced in bacterial cell-factories. The development of new bacterial cell-factories is a difficult and expensive process, in part due to time required to screen for and optimize productions strains. A new promising way of reducing the development time...... is generating new and faster ways of screening and optimizing using biosensors. In this thesis we develop new functional biological recognition modules for biosensors. These DNA- and RNA-based recognition modules are called aptamers and are developed to interact with targets of choice. Aptamers are developed...... application) and small molecule food additives (for optimization production in cell factories). Additionally, the characterization an all-polymer physicochemical biosensor is presented for the detection of antibiotics in food products. These results have lead to the ongoing development of a high...
The Candidate Progenitor of the Type IIn SN 2010jl Is Not an Optically Luminous Star
Energy Technology Data Exchange (ETDEWEB)
Fox, Ori D. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Dyk, Schuyler D. Van [IPAC/Caltech, Mailcode 100-22, Pasadena, CA 91125 (United States); Dwek, Eli [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 665, Greenbelt, MD 20771 (United States); Smith, Nathan; Andrews, Jennifer [Steward Observatory, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Filippenko, Alexei V.; Kelly, Patrick L.; Shivvers, Isaac [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Arendt, Richard G. [CRESST/UMBC/GSFC Code 665, NASA/GSFC, Greenbelt MD, 20771 (United States); Foley, Ryan J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Miller, Adam A., E-mail: ofox@stsci.edu [Jet Propulsion Laboratory, 4800 Oak Grove Drive, MS 169-506, Pasadena, CA 91109 (United States)
2017-02-20
A blue source in pre-explosion Hubble Space Telescope ( HST )/Wide-Field Planetary Camera 2 (WFPC2) images falls within the 5 σ astrometric error circle (∼0.″24) derived from post-explosion ground-based imaging of SN 2010jl. At the time the ground-based astrometry was published, however, the SN had not faded sufficiently for post-explosion HST follow-up observations to determine a more precise astrometric solution and/or confirm if the pre-explosion source had disappeared, both of which are necessary to ultimately disentangle the possible progenitor scenarios. Here we present HST /WFC3 imaging of the SN 2010jl field obtained in 2014, 2015, and 2016 when the SN had faded sufficiently to allow for new constraints on the progenitor. The SN, which is still detected in the new images, is offset by 0.″061 ± 0.″008 (15 ± 2 pc) from the underlying and extended source of emission that contributes at least partially, if not entirely, to the blue source previously suggested as the candidate progenitor in the WFPC2 data. This point alone rules out the possibility that the blue source in the pre-explosion images is the exploding star, but may instead suggest an association with a young (<5–6 Myr) cluster and still argues for a massive (>30 M {sub ⊙}) progenitor. We obtain new upper limits on the flux from a single star at the SN position in the pre-explosion WFPC2 and Spitzer /IRAC images that may ultimately be used to constrain the progenitor properties.
The Candidate Progenitor of the Type IIn SN 2010jl Is Not an Optically Luminous Star
Fox, Ori D.; Van Dyk, Schuyler D.; Dwek, Eli; Smith, Nathan; Filippenko, Alexei V.; Andrews, Jennifer; Arendt, Richard G.; Foley, Ryan J.; Kelly, Patrick L.; Miller, Adam;
2017-01-01
A blue source in pre-explosion Hubble Space Telescope (HST)/Wide-Field Planetary Camera 2 (WFPC2) images falls within the 5 Sigma astrometric error circle (approx. 0." 24) derived from post-explosion ground-based imaging of SN 2010jl. At the time the ground-based astrometry was published, however, the SN had not faded sufficiently forpost-explosion HST follow-up observations to determine a more precise astrometric solution and/or confirm if the pre-explosion source had disappeared, both of which are necessary to ultimately disentangle the possible progenitor scenarios. Here we present HST/WFC3 imaging of the SN 2010jl field obtained in 2014, 2015, and 2016 when the SN had faded sufficiently to allow for new constraints on the progenitor. The SN, which is still detected in the new images, is offset by 0."061(+/-) 0."008 (15 +/- 2 pc) from the underlying and extended source ofemission that contributes at least partially, if not entirely, to the blue source previously suggested as the candidate progenitor in the WFPC2 data. This point alone rules out the possibility that the blue source in the pre-explosion images is the exploding star, but may instead suggest an association with a young (less than 56 Myr) cluster and still argues for a massive (greater than 30 solar mass) progenitor. We obtain new upper limits on the flux from a single star at the SN position in the pre-explosion WFPC2 and Spitzer/IRAC images that may ultimately be used to constrain the progenitor properties.
International Nuclear Information System (INIS)
Natkanets, I.; Smirnov, L.S.; Solov'ev, A.I.; )
1997-01-01
The investigation of the dynamics of ammonium ion in the disordered α-phase of mixed crystals K 1-x (NH 4 ) x Hal (Hal = Cl, Br, I) is carried out by the inelastic incoherent neutron scattering (IINS) method. IINS spectra are measured in the 2-200 meV energy range and the 10-300 K temperature range by the time-of-flight method. The generalized densities of phonon states are defined in the single-phonon approximation. It is found out that the libration mode of ammonium ion has the weak concentration dependence. Resonant modes are observed at low temperature for all concentration range of the existence of the disordered α-phase. The broadening of resonant modes at the expensive of the jump rotation diffusion of ammonium ions takes place at temperature above 10 K [ru
Lifescience Database Archive (English)
Full Text Available ce nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsst...c*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyqlinkl...**itrxk elnnsvyhv--- ---tnkgk*iin*dvniqtikrnrkrfhc**k*iqsctkq*nl*wklsri*kprttefqs lkmklml*iyy*mesqkvlkscalav
Quantifying the Influence of Global Warming on Unprecedented Extreme Climate Events
Diffenbaugh, Noah S.; Singh, Deepti; Mankin, Justin S.; Horton, Daniel E.; Swain, Daniel L.; Touma, Danielle; Charland, Allison; Liu, Yunjie; Haugen, Matz; Tsiang, Michael;
2017-01-01
Efforts to understand the influence of historical global warming on individual extreme climate events have increased over the past decade. However, despite substantial progress, events that are unprecedented in the local observational record remain a persistent challenge. Leveraging observations and a large climate model ensemble, we quantify uncertainty in the influence of global warming on the severity and probability of the historically hottest month, hottest day, driest year, and wettest 5-d period for different areas of the globe. We find that historical warming has increased the severity and probability of the hottest month and hottest day of the year at >80% of the available observational area. Our framework also suggests that the historical climate forcing has increased the probability of the driest year and wettest 5-d period at 57% and 41% of the observed area, respectively, although we note important caveats. For the most protracted hot and dry events, the strongest and most widespread contributions of anthropogenic climate forcing occur in the tropics, including increases in probability of at least a factor of 4 for the hottest month and at least a factor of 2 for the driest year. We also demonstrate the ability of our framework to systematically evaluate the role of dynamic and thermodynamic factors such as atmospheric circulation patterns and atmospheric water vapor, and find extremely high statistical confidence that anthropogenic forcing increased the probability of record-low Arctic sea ice extent.
Quantifying the influence of global warming on unprecedented extreme climate events.
Diffenbaugh, Noah S; Singh, Deepti; Mankin, Justin S; Horton, Daniel E; Swain, Daniel L; Touma, Danielle; Charland, Allison; Liu, Yunjie; Haugen, Matz; Tsiang, Michael; Rajaratnam, Bala
2017-05-09
Efforts to understand the influence of historical global warming on individual extreme climate events have increased over the past decade. However, despite substantial progress, events that are unprecedented in the local observational record remain a persistent challenge. Leveraging observations and a large climate model ensemble, we quantify uncertainty in the influence of global warming on the severity and probability of the historically hottest month, hottest day, driest year, and wettest 5-d period for different areas of the globe. We find that historical warming has increased the severity and probability of the hottest month and hottest day of the year at >80% of the available observational area. Our framework also suggests that the historical climate forcing has increased the probability of the driest year and wettest 5-d period at 57% and 41% of the observed area, respectively, although we note important caveats. For the most protracted hot and dry events, the strongest and most widespread contributions of anthropogenic climate forcing occur in the tropics, including increases in probability of at least a factor of 4 for the hottest month and at least a factor of 2 for the driest year. We also demonstrate the ability of our framework to systematically evaluate the role of dynamic and thermodynamic factors such as atmospheric circulation patterns and atmospheric water vapor, and find extremely high statistical confidence that anthropogenic forcing increased the probability of record-low Arctic sea ice extent.
Exploring the design space of shape-changing objects
DEFF Research Database (Denmark)
Nørgaard, Mie; Merritt, Timothy Robert; Rasmussen, Majken
2013-01-01
In this paper we describe the outcomes from a design exercise in which eight groups of designers designed and built hardware sketches in the form of playful shape-changing prototypes, generatively working with Rasmussen et al's [31] eight unique types of shape change. Seeing that shape-changing i......In this paper we describe the outcomes from a design exercise in which eight groups of designers designed and built hardware sketches in the form of playful shape-changing prototypes, generatively working with Rasmussen et al's [31] eight unique types of shape change. Seeing that shape...... for the further expansion of the design space of shape changing interfaces relating to the perception and understanding of behaviour, causality and the mechanics involved in shape change events, which we call "Imagined Physics." This concept is described along with additional insights into the qualities of shape...
SN2015bh: NGC2770's 4th supernova or a luminous blue variable on its way to a Wolf-Rayet star?
DEFF Research Database (Denmark)
Thone, C. C.; de Ugarte Postigo, A.; Leloudas, G.
2017-01-01
yr that experienced a possible terminal explosion as type IIn SN in 2015, named SN 2015bh. This possible SN (or " main event") had a precursor peaking similar to 40 days before maximum. The total energy release of the main event ;is similar to 1.8 X 10(49) erg, consistent with a ... 2015bh lies within a spiral arm of NGC2770 next to several small star-forming regions with a metallicity of similar to 0.5 solar and a stellar population age of 7-10 Myr. SN 2015bh shares many similarities with SN 2009ip and may form a new class of objects that exhibit outbursts a few decades prior...
Submarine canyons off Madras Coast
Digital Repository Service at National Institute of Oceanography (India)
Setty, M.G.A.P.
Submarine canyons off the coast of Madras, Tamil Nadu, India were studied during cruise of @iINS Kistna@@ as part of the IIOE programme They consist of hill-like projections and V-shaped valleys Their other features are also reported...
European Atlantic: the hottest oil spill hotspot worldwide
Vieites, David R.; Nieto-Román, Sandra; Palanca, Antonio; Ferrer, Xavier; Vences, Miguel
2004-11-01
Oil spills caused by maritime transport of petroleum products are still an important source of ocean pollution, especially in main production areas and along major transport routes. We here provide a historical and geographic analysis of the major oil spills (>700 t) since 1960. Spills were recorded from several key marine ecosystems and marine biodiversity hotspots. The past four decades have been characterized by an overall decrease in the number of accidents and tonnes of oil spilled in the sea, but this trend was less distinct in the European Atlantic area. Recent black tides from the Erika and Prestige vessels provided new evidence for the high risk of accidents with serious ecological impact in this area, which according to our analysis is historically the most important oil spill hotspot worldwide. The English Channel and waters around Galicia in Spain were the areas with most accidents. Maritime transport in European Atlantic waters has been predicted to continue increasing. Together with our own results this suggests that, in addition to measures for increased traffic safety, deployment of emergency capacities in the spill hotspot areas may be crucial for a sustainable conservation of sea resources and ecosystems.
European Atlantic: the hottest oil spill hotspot worldwide
Rodriguez Vieites, D.; Nieto-Roman, S.; Palanca, A.; Ferrer, X.; Vences, M.
2004-01-01
Oil spills caused by maritime transport of petroleum products are still an important source of ocean pollution, especially in main production areas and along major transport routes. We here provide a historical and geographic analysis of the major oil spills (>700 tonnes) since 1960. Spills were
The Hottest Hot Jupiters May Host Atmospheric Dynamos
Energy Technology Data Exchange (ETDEWEB)
Rogers, T. M. [Department of Mathematics and Statistics, Newcastle University, Newcastle upon Tyne (United Kingdom); McElwaine, J. N. [Planetary Science Institute, Tucson, AZ 85721 (United States)
2017-06-01
Hot Jupiters have proven themselves to be a rich class of exoplanets that test our theories of planetary evolution and atmospheric dynamics under extreme conditions. Here, we present three-dimensional magnetohydrodynamic simulations and analytic results that demonstrate that a dynamo can be maintained in the thin, stably stratified atmosphere of a hot Jupiter, independent of the presumed deep-seated dynamo. This dynamo is maintained by conductivity variations arising from strong asymmetric heating from the planets’ host star. The presence of a dynamo significantly increases the surface magnetic field strength and alters the overall planetary magnetic field geometry, possibly affecting star–planet magnetic interactions.
Directory of Open Access Journals (Sweden)
Martínez-Echevarría, M. J.
2013-03-01
Full Text Available The Pavement Quality Indicator (PQI is a non-nuclear gauge used for the on-site density measurement of asphalt pavements without the need to extract core samples. Previous studies of hot asphalt mixes found that PQI density readings were very similar to laboratory density measurements of pavement cores. This paper describes the first stage of a research project whose objective is to analyze PQI density measurements of mixes manufactured with an asphalt emulsion binder. The PQI density variability for such mixes was verified and compared with the results obtained with other on-site methods for measuring pavement density.
El equipo Pavement Quality Indicator es un dispositivo para la determinación de densidad <i>in situ en pavimentos asfálticos sin extracción de testigos. Las experiencias con este equipo en mezclas bituminosas en caliente, recogidas en diferentes fuentes bibliográficas, muestran que las densidades medidas <i>in situ con el PQI son muy similares a las obtenidas mediante la extracción de testigos. En este artículo se expone la primera etapa de un proyecto de investigación que tiene por objeto analizar los resultados de mediciones efectuadas con PQI en mezclas bituminosas donde se utiliza emulsión asfáltica como ligante. Se comprueba la variabilidad de la densidad obtenida con el equipo para este tipo de mezclas, y se comparan los resultados con otros métodos de medida de densidad <i>in situ.
The science and application of forest carbon projects
Robert J. Moulton
2002-01-01
This year-1999, now in its 7th month-is well on its way to becoming the hottest year in what has already been documented as the hottest decade on record both in the United States and worldwide. This makes a good setting for discussing global climate change, a much better setting than, say, the second week of a record-setting cold spell in February, 1999 when some...
Temperature affects the silicate morphology in a diatom
Javaheri, N.; Dries, R.; Burson, A.; Stal, L.J.; Sloot, P.M.A.; Kaandorp, J.A.
2015-01-01
Silica deposition by diatoms, a common component of the phytoplankton, has attracted considerable interest given the importance in ecology and materials science. There has recently been a great deal of research into the biological control of biosilicifcation, yet the <i>in vivo physical and
African Journals Online (AJOL)
Idistinctive contnbution of psychology to mental health care. Iin South Africa Various .... professional, as this enables closer monitoring of different aspects of treatment, and .... psychiatric disorders; the hazards of dangerous or life- threatening .... balance and complement to a narrow biomedical approach. This perspective ...
Tants õõnestas Skandinaavia turvalisuse müüti / Tiit Tuumalu
Tuumalu, Tiit, 1971-
2006-01-01
Skandinaavia tantsuaktsioonist Nu Scandic Kanuti Gildi saalis, pikemalt Mia Habibi lavastusest "M/issing I/in A/ction /2' " ja Islandilt pärit tantsija Erna ₅marsd̤ttiri ja muusik Jhann Jhanssoni teosest "IBM-1401, A User's Manual" ning Mette Ingvartseni lavastusest "To come"
2010-01-05
... pursuing a full course of study in a college, university, seminary, conservatory, academic high school... creation of SEVIS II user accounts, specifically names; U.S. domestic address; foreign address (F/M/J... residence; username; e-mail addresses; the DHS-assigned Immigrant Identification Number (IIN); Alien...
From Problems to Potentials : The Urban Energy Transition of Gruž, Dubrovnik
van den Dobbelsteen, A.A.J.F.; Martin, C.L.; Keeffe, Greg; Pulselli, Riccardo; Vandevyvere, Han
2018-01-01
IIn the challenge for a sustainable society, carbon-neutrality is a critical objective for all cities in the coming decades. In the EU City-zen project, academic partners collaborate to develop an urban energy transition methodology, which supports cities in making the energy transition to
Human biometeorological analysis of the thermal conditions of the hot Turkish city of Şanliurfa
Toy, Süleyman; Aytaç, Ahmet Serdar; Kántor, Noémi
2018-01-01
This paper offers a throughout human biometeorological assessment about the thermal conditions of Şanliurfa in one of the hottest parts of Turkey, in the hottest period of the year (from April to October), and a comparative analysis of three built-up types (urban, suburban and rural). Therefore, the values of physiologically equivalent temperature (PET), one of the most extensively used indices, were calculated from basic climate data with the help of the RayMan model. It was found by regarding the resulted mean PET values and the occurrence frequency of extreme heat stress periods (PET values above 41 °C) that the urban area exhibited the most unfavourable properties, followed by the suburban and rural areas. We also found very severe heat stress conditions in the summer, which may be explained by the torrid and arid climate, calm air conditions and the lack of abundant vegetation. Aiming to optimise human thermal conditions, thereby improving local life quality and facilitating international tourism, increment of vegetated areas and water surfaces would be required and, of course, highlighting the traditional methods taking into account the important aspects of sustainability.
An analysis of thermal comfort in primary schools in Vietnam
Le, Thi Ho Vi; Gillott, Mark C.; Rodrigues, Lucélia Taranto
2017-01-01
There is a trend of installing air conditioning systems in public primary schools that are currently naturally ventilated in Vietnam. A previous study conducted by the authors provided evidence that there is limited need for air conditioning in Vietnamese mid-season and the hottest season.\\ud \\ud In this study, the authors investigated thermal comfort and users’ perceptions in three primary schools in Ho Chi Minh City during the hottest season (April 2016) and the coldest season (December 201...
Engineering of Ion Sensing by the Cystathionine beta-Synthase Module of the ABC Transporter OpuA
Mahmood, Nik A. B. N.; Biemans-Oldehinkel, Esther; Poolman, Bert
2009-01-01
We have previously shown that the C-terminal cystathionine beta-synthase (CBS) domains of the nucleotide-binding domains of the ABC transporter OpuA, in conjunction with an anionic membrane surface function, act as sensor of internal ionic strength (I(in)). Here, we show that a surface-exposed
<i>In situ diagnostics of the crystal-growth process through neutron imaging
DEFF Research Database (Denmark)
Tremsin, Anton S.; Makowska, Malgorzata Grazyna; Perrodin, Didier
2016-01-01
Neutrons are known to be unique probes in situations where other types of radiation fail to penetrate samples and their surrounding structures. In this paper it is demonstrated how thermal and cold neutron radiography can provide time-resolved imaging of materials while they are being processed (e......, as limited by the resolution of the present experiments). It is also demonstrated that the dopant concentration can be quantified even for very low concentration levels (∼ 0.1%) in 10 mm thick samples. The interface between the solid and liquid phases can also be imaged, provided there is a sufficient change.......g. while growing single crystals). The processing equipment, in this case furnaces, and the scintillator materials are opaque to conventional X-ray interrogation techniques. The distribution of the europium activator within a BaBrCl:Eu scintillator (0.1 and 0.5% nominal doping concentrations per mole...
Cloud Computing: Key to IT Development in West Africa | Nwabuonu ...
African Journals Online (AJOL)
It has been established that Information Technology (IT) Development in West Africa has faced lots of challenges ranging from Cyber Threat to inadequate IT Infrastructure. Cloud Computing is a Revolution. It is creating a fundamental change in Computer Architecture, Software and Tools Development iIn the way we Store, ...
elucidating the mechanism of the adsorption of mucin to ...
African Journals Online (AJOL)
dcu user
The major degradation reactions associated with alkyds during exposure to outdoor environment have been identified2 as photodegradation due to the attack of the UVB component of the solar radiation and hydrolytic degradation due to acid rain. The level of such degradative reactions would be expected to be greater iin ...
137 Analyse fréquentielle des évènements hydro-pluviométriques ...
African Journals Online (AJOL)
Utilisateur
Frequentiel analyse of extreme hydropluviometric events iin the Sota basin of Benin. West Africa is one of the most vulnerable regions of the world to the climatic variability. According to the forecasts of the GIEC, some extreme phenomena will increase frequency and/or intensity in the XXIe century because of the evolution ...
The case of the Kepler DBAV star J1929+4447
Directory of Open Access Journals (Sweden)
Fontaine G.
2013-03-01
Full Text Available A first pulsating white dwarf has been discovered recently in the Kepler field of view [1]. This star, catalogued as GALEX J192904.6+444708 or KIC 8626021, is a He-atmosphere white dwarf of the V777 Her (DBV type. It appears to be the hottest of its class and, as such, has the potential to be a key object in our understanding of the DB gap problem. We present here a seismological analysis of this star and a look at his previous history.
Coupled neutronic core and subchannel analysis of nanofluids in VVER-1000 type reactor
Energy Technology Data Exchange (ETDEWEB)
Zarifi, Ehsan; Sepanloo, Kamran [Nuclear Science and Technology Research Institute (NSTRI), Tehran (Iran, Islamic Republic of). Reactor and Nuclear Safety School; Jahanfarnia, Golamreza [Islamic Azad Univ., Tehran (Iran, Islamic Republic of). Dept. of Nuclear Engineering, Science and Research Branch
2017-05-15
This study is aimed to perform the coupled thermal-hydraulic/neutronic analysis of nanofluids as the coolant in the hot fuel assembly of VVER-1000 reactor core. Water-based nanofluid containing various volume fractions of Al{sub 2}O{sub 3} nanoparticle is analyzed. WIMS and CITATION codes are used for neutronic simulation of the reactor core, calculating neutron flux and thermal power distribution. In the thermal-hydraulic modeling, the porous media approach is used to analyze the thermal behavior of the reactor core and the subchannel analysis is used to calculate the hottest fuel assembly thermal-hydraulic parameters. The derived conservation equations for coolant and conduction heat transfer equation for fuel and clad are discretized by Finite volume method and solved numerically using visual FORTRAN program. Finally the analysis results for nanofluids and pure water are compared together. The achieved results show that at low concentration (0.1 percent volume fraction) alumina is the optimum nanoparticles for normal reactor operation.
Utilization of sugar beets iin alcohol plants
Energy Technology Data Exchange (ETDEWEB)
Kuznetsov, N M
1958-01-01
It is shown that it is easily possible to switch EtOH plants, which have used potatoes as raw material, to sugar beets. The whole regime is presented with respect to volumes, temperatures, amounts, and yields in the various steps.
Circumstellar Interaction in Supernovae in Dense Environments—An Observational Perspective
Chandra, Poonam
2018-02-01
In a supernova explosion, the ejecta interacting with the surrounding circumstellar medium (CSM) give rise to variety of radiation. Since CSM is created from the mass loss from the progenitor, it carries footprints of the late time evolution of the star. This is one of the unique ways to get a handle on the nature of the progenitor system. Here, I will focus mainly on the supernovae (SNe) exploding in dense environments, a.k.a. Type IIn SNe. Radio and X-ray emission from this class of SNe have revealed important modifications in their radiation properties, due to the presence of high density CSM. Forward shock dominance in the X-ray emission, internal free-free absorption of the radio emission, episodic or non-steady mass loss rate, and asymmetry in the explosion seem to be common properties of this class of SNe.
Hunter AAF, Savannah, Georgia. Revised Uniform Summary of Surface Weather Observations (RUSSWO)
1970-11-18
thisar sunlay he violins hease les Ohe 0/3 mr~P~ ile.d" F03 rnOS T IIN hwtepretaeo asrte hnpr cent~e f oseratins.Sine mre tan ne ypeof recpittio or...98.1%. EXAME # 2 Read visibilxtiez ir’e~endently (.f ceilings on bottom line opposite > 0. Frsom the table: Visiblilty > 3 miles a 95.~ Vizibility >2
DEFF Research Database (Denmark)
Iglesias-Gato, Diego; Chuan, Yin-Choy; Jiang, Ning
2015-01-01
BackgroundUbiquitination is a highly dynamic and reversible process with a central role in cell homeostasis. Deregulation of several deubiquitinating enzymes has been linked to tumor development but their specific role in prostate cancer progression remains unexplored.MethodsRNAi screening was us...
DEFF Research Database (Denmark)
Vejzagic, Nermina
Trichuris suis, the pig whipworm is a nematode parasite located in the large intestine of pigs. Embryonated eggs of T. suis (T. suis ova = TSO) constitute the active pharmaceutical ingredient (API) in a new medicinal product, which is currently tested in human clinical trials as a potential treat...
Mega starbirth cluster is biggest, brightest and hottest ever seen
2003-10-01
Artist’s impression of the Lynx Arc hi-res Size hi-res: 4519 kb Credits: European Space Agency, NASA and Robert A.E. Fosbury (European Space Agency/Space Telescope-European Coordinating Facility, Germany) Artist’s impression of the Lynx Arc This illustration shows an artist’s impression of the so-called Lynx arc, a newly identified distant super-cluster that contains a million blue-white stars twice as hot as similar stars in our Milky Way galaxy. The Lynx arc is one million times brighter than the well-known Orion Nebula, a nearby prototypical ‘starbirth’ region visible with small telescopes. The stars in the Lynx arc are more than twice as hot as the Orion Nebula’s central stars, with surface temperatures up to 80 000°C. Though there are much bigger and brighter star-forming regions than the Orion Nebula in our local Universe, none are as bright as the Lynx arc, nor do they contain such large numbers of hot stars. The stars are so hot that a very large fraction of their light is emitted in the ultraviolet that makes the gas glow with the green and red colours illustrated here. The so-called Lynx Arc is one million times brighter than the well-known Orion Nebula, a nearby prototypical 'starbirth' region visible with small telescopes. The newly identified super-cluster contains a million blue-white stars that are twice as hot as similar stars in our Milky Way galaxy. It is a rarely glimpsed example of the early days of the Universe where furious firestorms of starbirth blazed across the skies. The spectacular cluster's opulence is dimmed when seen from Earth only by the fact that it is 12 000 million light years away. The discovery of this unique and tantalising object was the result of a systematic study of distant clusters of galaxies carried out with major X-ray, optical and infrared telescopes, including the NASA/ESA Hubble Space Telescope, ROSAT and the Keck Telescopes. Bob Fosbury, of the European Space Agency's Space Telescope-European Coordinating Facility in Germany, and a team of international co-authors report the discovery in the 20 October 2003 issue of the Astrophysical Journal. The mega-cluster of stars appears as a puzzling red arc behind a distant galaxy cluster 5400 million light-years away in the northern constellation of Lynx. The arc is the stretched and magnified image of a mysterious celestial object about 12 000 million light-years away (at a redshift of 3.36), far beyond the cluster of galaxies. This means that the remote source existed when the Universe was less than 2000 million years old. Fosbury and colleagues first tried to identify the arc by analysing the light from the object, but the team was not able to recognise the pattern of colours in the spectral signature of the remote object. While looking for matches with the colour spectrum, Fosbury realised that the light was related to that of the nearby Orion Nebula, a star-forming region in our own Milky Way. However where the Orion Nebula is powered by only four hot and bright blue stars, the Lynx Arc must contain around a million such stars! Furthermore, the spectrum shows that the stars in the Lynx Arc are more than twice as hot as the Orion Nebula's central stars, with surface temperatures up to 80 000°C. Though there are much bigger and brighter star-forming regions than the Orion Nebula in our local Universe, none are as bright as the Lynx Arc, nor do they contain such large numbers of hot stars. Even the most massive, normal nearby stars are no hotter than around 40 000°C. However, stars forming from the original, pristine gas in the early Universe can be more massive and consequently much hotter - perhaps up to 120 000°C. The earliest stars may have been as much as several hundred solar masses, but the chemical make-up of the Universe today prevents stars from forming beyond about 100 solar masses. Such 'primordial' super-hot stars are thought to be the first luminous objects to condense after the Big Bang cooled. Astronomers believe that these first 'monster' stars formed considerably earlier than the Lynx Arc - up to 1800 million years earlier. "This remarkable object is the closest we have come so far to seeing what such primordial objects might look like when our telescopes become powerful enough to see them," says Fosbury. The desire to find and study the first luminous objects in the Universe is the main scientific drive behind the construction of the NASA/ESA/CSA James Webb Space Telescope, scheduled for launch in 2011. Notes for editors The team is composed of R. A. E. Fosbury (European Space Agency/Space Telescope-European Coordinating Facility, Germany), M. Villar-Martín and A. Humphrey (University of Hertfordshire, UK), M. Lombardi and P. Rosati (European Southern Observatory, Germany), D. Stern (Institute of Geophysics and Planetary Physics, USA), R. N. Hook (ST-ECF/STScI, USA), B. P. Holden and S. A. Stanford (University of California, USA), G. K. Squires (SIRTF Science Center, USA), M. Rauch (The Observatories of the Carnegie Institution of Washington, USA) and W. L. W. Sargent (California Institute of Technology, USA). For broadcasters, animations of the discovery, interviews and general Hubble Space Telescope background footage are available from the ESA Television Service, see http://television.esa.int, and from http://www.spacetelescope.org/video/heic0312_vnr.html
A New Formation Mechanism for the Hottest Horizontal-Branch Stars
Sweigart, Allen V.; Oegerle, William R. (Technical Monitor)
2002-01-01
Hot subluminous stars lying up to 0.7 mag below the extreme horizontal branch (EHB) are found in the ultraviolet color-magnitude diagrams (CMDs) of both omega Cen and NGC 2808. In order to investigate the origin of these subluminous stars, we have constructed a detailed set of evolutionary sequences that follow the evolution of low-mass stars continuously from the zero-age main sequence through the helium-core flash to the HB for a wide range in the mass loss along the red-giant branch (RGB). Stars with the largest mass loss evolve off the RGB to high effective temperatures before igniting helium in their cores. Our results indicate that the subluminous EHB stars, as well as the high temperature gap along the EHB of NGC 2808, can be explained if these stars undergo a late helium-core flash while descending the white-dwarf cooling curve. Under these conditions the convection zone produced by the main helium flash will penetrate into the stellar envelope, thereby mixing most, if not all, of the envelope hydrogen into the hot helium-burning interior, where it is rapidly consumed. This phenomenon is analogous to the 'born-again' scenario for producing hydrogen-deficient stars following a very late helium-shell flash. This 'flash mixing' of the envelope during a late helium-core flash greatly enhances the envelope helium and carbon abundances and, as a result, leads to a discontinuous increase in the HB effective temperature. We argue that the hot HB gap observed in NGC 2808 is associated with this theoretically predicted dichotomy in the RB properties. Using new helium- and carbon-rich stellar atmospheres, we show that the changes in the envelope abundances due to flash mixing will suppress the ultraviolet flux in the spectra of hot EHB stars. We suggest that such changes in the emergent spectral energy distribution are primarily responsible for explaining the hot subluminous EHB stars in omega Cen and NGC 2808. Moreover, we demonstrate that models without flash mixing lie, at most, only approximately 0.1 mag below the EHB, and hence fail to explain the observations.
Sunrayce 93: The hottest new sport on campus. Technical report
Energy Technology Data Exchange (ETDEWEB)
1994-05-01
The solar powered electric vehicle race began in Arlington, Texas on June 20, 1993 and finished 7 days later in Minneapolis, Minnesota. Thirty four teams from Universities across the United States and Puerto Rico completed the race out of thirty six entries. The race demonstrated the viability of sunlight powered vehicles as the better average daily speeds were in excess of 50 miles an hour. Even in the rain, most average speeds were in excess of 15 miles an hour. Analyzed results, photographs, and project details are included. (GHH)
International Nuclear Information System (INIS)
Kushner, M.J.; Anderson, H.M.; Hargis, P.J.
1985-01-01
In low pressure, radio frequency (RF) discharges of the type used in plasma processing of semiconductor materials, the rate of electron impact excitation and energy transfer processes depends upon both the phase of the RF excitation and position in the discharge. Electron impact collisions create radicals that diffuse or drift to the surfaces of interest where they are adsorbed or otherwise react. To the extent that these radicals have a finite lifetime, their transport time from point of creation to surface of interest is an important parameter. The spatial dependence of the rate of the initial electron impact collisions is therefore also an important parameter. The power that sustains the discharge is coupled into the system by two mechanisms: a high energy e-beam component of the electron distribution resulting from electrons falling through or being accelerated by the sheaths, and by joule heating in the body of the plasma. In this paper, the authors discuss the spatial dependence of excitation rates and the method of power deposition iin RF discharges of the type used for plasma processing
Vogel, M.; Orth, R.; Seneviratne, S. I.
2016-12-01
Land temperatures, and in particular hot extremes, will likely increase by more than 2° C in many regions, even in the case that the global temperature increase with respect to pre-industrial levels can be limited to 2°C. We investigate here the role of soil moisture-temperature feedbacks for projected changes of extreme temperatures by comparing experiments from the GLACE-CMIP5 (Global Land-Atmosphere Coupling Experiment - Coupled Model Intercomparison Project Phase 5) project. In particular, we consider fully coupled experiments with all 6 involved GCMs and corresponding experiments where soil moisture is fixed to the local present-day seasonal cycle until the end of the 21st century. We consider the yearly hottest days and apply a scaling approach whereby we relate changes of hottest days to global mean temperature increase. We find that soil moisture-temperature coupling significantly contributes to additional future warming of extreme temperatures in many regions: In particular, it can explain more than 70% of the warming amplification of hottest days compared to global mean temperature in Central Europe, Central North America and Northern Australia, and around 50% of this signal in the Amazonian Region and Southern Africa.
Multifractal Detrended Fluctuation Analysis of Human gait Diseases
Directory of Open Access Journals (Sweden)
Srimonti eDutta
2013-10-01
Full Text Available IIn this paper multifractal detrended fluctuation analysis is used to study the human gait time series for normal and diseased sets. It is observed that long range correlation is primarily responsible for the origin of multifractality. The study reveals that the degree of multifractality is more for normal set compared to diseased set. However the method fails to distinguish between the two diseased sets.
Smashing WordPress Themes Making WordPress Beautiful
Hedengren, Thord Daniel
2011-01-01
The ultimate guide to WordPress Themes - one of the hottest topics on the web today WordPress is so much more than a blogging platform, and Smashing WordPress Themes teaches readers how to make it look any way they like - from a corporate site, to a photography gallery and moreWordPress is one of the hottest tools on the web today and is used by sites including The New York Times, Rolling Stone, flickr, CNN, NASA and of course Smashing MagazineBeautiful full colour throughout - web designers expect nothing lessSmashing Magazine will fully support this book by by promoting it through their webs
Self-Consistent Atmosphere Models of the Most Extreme Hot Jupiters
Lothringer, Joshua; Barman, Travis
2018-01-01
We present a detailed look at self-consistent PHOENIX atmosphere models of the most highly irradiated hot Jupiters known to exist. These hot Jupiters typically have equilibrium temperatures approaching and sometimes exceeding 3000 K, orbiting A, F, and early-G type stars on orbits less than 0.03 AU (10x closer than Mercury is to the Sun). The most extreme example, KELT-9b, is the hottest known hot Jupiter with a measured dayside temperature of 4600 K. Many of the planets we model have recently attracted attention with high profile discoveries, including temperature inversions in WASP-33b and WASP-121, changing phase curve offsets possibly caused by magnetohydrodymanic effects in HAT-P-7b, and TiO in WASP-19b. Our modeling provides a look at the a priori expectations for these planets and helps us understand these recent discoveries. We show that, in the hottest cases, all molecules are dissociated down to relatively high pressures. These planets may have detectable temperature inversions, more akin to thermospheres than stratospheres in that an optical absorber like TiO or VO is not needed. Instead, the inversions are created by a lack of cooling in the IR combined with heating from atoms and ions at UV and blue optical wavelengths. We also reevaluate some of the assumptions that have been made in retrieval analyses of these planets.
Germ cell neoplasia <i>in situ (GCNIS)
DEFF Research Database (Denmark)
Berney, Daniel M; Looijenga, Leendert H J; Idrees, Muhammad
2016-01-01
The pre-invasive lesion associated with post-pubertal malignant germ cell tumours of the testis was first recognized in the early 1970s and confirmed by a number of observational and follow-up studies. Until this year, this scientific story has been confused by resistance to the entity and disagr......The pre-invasive lesion associated with post-pubertal malignant germ cell tumours of the testis was first recognized in the early 1970s and confirmed by a number of observational and follow-up studies. Until this year, this scientific story has been confused by resistance to the entity...... and disagreement on its name. Initially termed 'carcinoma in situ' (CIS), it has also been known as 'intratubular germ cell neoplasia, unclassified' (IGCNU) and 'testicular intraepithelial neoplasia' (TIN). In this paper, we review the history of discovery and controversy concerning these names and introduce...
<i>In vitro production of bovine embryos
DEFF Research Database (Denmark)
Stroebech, L.; Mazzoni, Gianluca; Pedersen, Hanne Skovsgaard
2015-01-01
be improved, and aspects related to the oocyte donor, oocyte maturation and the recipients are addressed in the following. Also, some of the future aspects of genomic selection and systems biology are addressed with particular focus on the Brazilian-Danish collaboration in the so-called GIFT-project.......In vitro production (IVP) of bovine embryos has become a widespread technology implemented in cattle breeding and production. The implementation of genomic selection and systems biology adds great dimensions to the impact of bovine IVP. The physical procedures included in the IVP process can still...
DEFF Research Database (Denmark)
Pinholt, Mette; Larner-Svensson, Hanna; Littauer, Pia
2015-01-01
-based typing could replace PFGE for typing of VREfm. METHODS: A population-based study was conducted including all VREfm isolates submitted for national surveillance from January 2012 to April 2013. All isolates were investigated by WGS, MLST and PFGE. RESULTS: One-hundred and thirty-two isolates were included......) were identified using WGS. Direct or indirect transmission of VREfm between patients and intra- and inter-regional spreading clones was observed. We identified 10 STs. PFGE identified four major clusters (13-43 isolates) and seven minor clusters (two to three isolates). The results from the typing...... methods were highly concordant. However, WGS-based typing had the highest discriminatory power. CONCLUSIONS: This study emphasizes the importance of infection control measures to limit transmission of VREfm between patients. However, the diversity of the VREfm isolates points to the fact that other...
Asiakastutkimus luomuruokayritykselle
Lähteenkorva, Anna
2013-01-01
Kiinnostus luomuruokaan, vastuulliseen kuluttamiseen ja LOHAS-elämäntapaan on entisestään kasvussa, Suomessa vauhti kiihtyy muun maailman esimerkkiä seuraten. Luomun kuluttajabarometrin 2012 mukaan luomun ostoaikeet ovat lisääntyneet, ja kuluttajat toivovat monipuolisempaa tarjontaa. Viikoittain luomua ostavien määrä on kasvanut 23 %:iin kuluttajista, luomutuottajat uskovat tuotantonsa kasvavan ja vuoden 2012 tammi-kesäkuussa luomuelintarvikkeiden myynnin arvo kasvoi 23 % edellisvuodesta. ...
Flying Qualities (Qualites de Vol)
1991-02-01
CIIANAIT DUMINIIG MAI1 FXCURSIOH /~o --- ~A 0- /10 CMFIGURE 4 AL-PHA-JETr ELEVATOR CONTROL CINEMATIC ; LP HEINi" KINEMATIC HORIZONTAL STABILIZER...ih-flight simulation is the ultimale assessment techntque providing high realism , flexibility, and credibility. rhe utilization (,f an in-fli:,ht si...1london, UK ()PERATIONAL H-ELICOPTER IIN - FLIGHT SIMULATOR (HIGH REALISM ) I(HIGH FLEAiBILITY Fligt t A tehrtqueTechnology implementation Flight t
Energy Technology Data Exchange (ETDEWEB)
Elmore, S., E-mail: Sarah.Elmore@ccfe.ac.uk [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Allan, S.Y.; Fishpool, G.; Kirk, A. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Kočan, M. [ITER Organization, Route de Vinon sur Verdon, 13115 St Paul-lez-Durance (France); Tamain, P. [Association Euratom-CEA, CEA/DSM/IRFM, CEA-Cadarache, F-13108 St Paul-lez-Durance Cedex (France); Thornton, A.J. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom)
2015-08-15
Edge-localised modes (ELMs) can carry significant fractions of their energy as far as main chamber plasma-facing components in divertor tokamaks. Since in future devices (e.g. ITER, DEMO) these energies could cause issues for material lifetime and impurity production, the energy and temperature of ions in ELMs needs to be investigated. In MAST, novel divertor measurements of T{sub i} during ELMs have been made using the divertor retarding field energy analyser (RFEA) probe. These measurements have shown instantaneous ion energy distributions corresponding to an effective T{sub i} at 5 cm from the strike point at the target that can be as high as 60 eV and that this decreases with time after the ELM start. This is consistent with the hottest, fastest ions arriving at the target first by parallel transport, followed by the lower end of the ion energy distribution. This analysis will form a basis for future data analysis of fast swept measurements of ion distributions in ELMs.
International Nuclear Information System (INIS)
Wang Xiaodong; Yang Renjie
2009-01-01
Objective: To investigate the variations of hepatic artery and its extrahepatic arteries on hepatic arteriogram and to provide benefit for transhepatic arterical chemoemblization. Methods: The hepatic arteriograms of 200 cases with unresectable hepatic malignant tumor before interventional therapy were analysed. Two interventional radiologists in common reviewed the incidences of various types according to Michels' classification, the absence of proper hepatic artery, and the variations of extrahepatic arteries originating from hepatic artery. Results: The most common hepatic artery variation was Michels type III(n=17,8.5%), followed by type II(n=10,5.0%) and V(n=9,4.5%). Proper hepatic absence was found in 25 cases and appeared as 5 subtypes. 5 kinds of extrahepatic arteries were found. The most common extrahepatic artery was the right gastric artery (n=156,78.0%), followed by cystic artery (n=126,63.0%), accessory left gastric artery (n=19,9.5%), the hepatic falciform artery (n=5,2.5%), and accessory left inferior phrenic artery (n=4,2.0%). Conclusion: There are some other variations of hepatic artery beside Michels' classification,and there are many variations of extrahepatic arteries originating from hepatic artery, it is important to assure interventional therapy effect for hepatic cancer and prevent complication. (authors)
Finding the first cosmic explosions. III. Pulsational pair-instability supernovae
International Nuclear Information System (INIS)
Whalen, Daniel J.; Smidt, Joseph; Even, Wesley; Fryer, Chris L.; Woosley, S. E.; Heger, Alexander; Stiavelli, Massimo
2014-01-01
Population III supernovae have been the focus of growing attention because of their potential to directly probe the properties of the first stars, particularly the most energetic events that can be seen at the edge of the observable universe. But until now pulsational pair-instability supernovae, in which explosive thermonuclear burning in massive stars fails to unbind them but can eject their outer layers into space, have been overlooked as cosmic beacons at the earliest redshifts. These shells can later collide and, like Type IIn supernovae, produce superluminous events in the UV at high redshifts that could be detected in the near infrared today. We present numerical simulations of a 110 M ☉ pulsational pair-instability explosion done with the Los Alamos radiation hydrodynamics code Radiation Adaptive Grid Eulerian. We find that collisions between consecutive pulsations are visible in the near infrared out to z ∼ 15-20 and can probe the earliest stellar populations at cosmic dawn.
The implications of recurrent disturbances within the world's hottest coral reef.
Bento, Rita; Hoey, Andrew S; Bauman, Andrew G; Feary, David A; Burt, John A
2016-04-30
Determining how coral ecosystems are structured within extreme environments may provide insights into how coral reefs are impacted by future climate change. Benthic community structure was examined within the Persian Gulf, and adjacent Musandam and northern Oman regions across a 3-year period (2008-2011) in which all regions were exposed to major disturbances. Although there was evidence of temporal switching in coral composition within regions, communities predominantly reflected local environmental conditions and the disturbance history of each region. Gulf reefs showed little change in coral composition, being dominated by stress-tolerant Faviidae and Poritidae across the 3 years. In comparison, Musandam and Oman coral communities were comprised of stress-sensitive Acroporidae and Pocilloporidae; Oman communities showed substantial declines in such taxa and increased cover of stress-tolerant communities. Our results suggest that coral communities may persist within an increasingly disturbed future environment, albeit in a much more structurally simple configuration. Copyright © 2015 Elsevier Ltd. All rights reserved.
Answering the Hottest Question in Army Education: What Is Army University?
Kem, John S.; LeBoeuf, Eugene J.; Martin, James B.
2016-01-01
The most common question heard by senior members of Army University is always, "What is Army University?" The newest education institution in the U.S. Army was created to unify the training and educational institutions of the Army, making the large learning organization more effective and efficient for its soldiers, bringing together 37…
Lifescience Database Archive (English)
Full Text Available ttttttttttt tttisyrkininiinir*krr*sin*rv*r*y*tkiki*qqnciyynhry*re*kr*kn* lilinkykyknk*innnk**k*k**FKMILKKK--...kekefk*tttttttt ttttttisyrkininiinir*krr*sin*rv*r*y*tkiki*qqnciyynhry*re*kr* kn*lilinkykyknk*inx*xkik Transl...i*qqnciyynhry*re*kr*kn* lilinkykyknk*innnk**k*k**FKMILKKK--- ---NK**ink*ink*iin**inklin*sengnnl*yfkys****f*k...*y*tkiki*qqnciyynhry*re*kr* kn*lilinkykyknk*inx*xkik Homology vs CSM-cDNA Score E
1973-10-30
PTAC , O .10. 5 (O L- ),t ’puv m oso i t~ i ru oe4, , o wixe " DATA PROCESSING BRANCH USAF ETAC W AHRCNIIN AIR WEATHER SERVtCE/MAC W AHRC N IIN...18 19 - 20 21 22 23 24 25. 26 27. 28 29. 30 *31 O.B. WeB . Dry BulbWe, BAIbTDe-wP.n?. 92/ 91 Ct I l ’___ ____ _ _._ 1 _l’.-v ___ QO/ 87 , 913
Indian Academy of Sciences (India)
n(n + 1)/2. This can be proved easily in several ways. For example, if 8 denotes the sum of first n natural numbers, then 8 = 1:7=1 i = 1:7=1 (n+ I-i) and therefore. 28 = E7=I(i+n+l-i) = n(n+l) which gives 8 = n(n+. 1)/2. One can also use the principle of mathematical induction to prove the result. Here we present a proof.
1982-08-01
three person crew. ’lowove r t he crew was spl it upl into sinalI ocr crew,, when suirveyl ip, some of the sinaI icr irn; N to-tail -f 31 ,Iin (lav-; w:i...37,000 BP (Wornli otn 197:58-59). 4-I I.. A. 1). (J~ 2000 B. C. ~ 50() -1750 750 - - 1000 i o 50 1500 U( 1000 400() .~750 -r- 500. 6000 m250 A. D. 0 I
The Meteorology of Central Africa
1943-11-01
JxUüha^tiGb-bväSt ’" PiM "•" *• i—By taking. law agreosBfe Lhu w:ul- PBJfc3aE5fe„gäfcfia^and fcJa& £ao4 +hn+ *hri rgewfcaga treHr-afcrere i-iin...point to the right and by the constant Ott O-CCoUvit erf; equivalent potential temperature in the lowest layer. « *he low relative humidities
PERIGEE computer codes for reactor simulation in 3 dimensions, using 1 or 2 neutron velocity groups
International Nuclear Information System (INIS)
Olson, A.P.
1964-02-01
PERIGEE is a code written in SNAP for the G-20 computer. It solves the one- or two-group neutron diffusion equations by finite-difference methods on a three-dimensional, uniform mesh having a common spacing in the two directions normal to the fuel channels. The positions of mesh points along a fuel channel, relative to points in adjacent channels, may correspond to either NPD or CANDU fuel bundle positions. The extrapolated flux boundary may be specified in sufficient detail to represent a tapered or stepped circumferential reflector, a variable axial length and, for a reactor with axis horizontal, a variable moderator level and a variable plane bottom surface equivalent to the CANDU dump structure. The neutron flux may be normalized to give a specified power output from the hottest fuel bundle or hottest channel, or to give a total thermal power limited by the turbine and generator. Reactor operation may be simulated in finite time steps, taking into account any fuel shifts, any changes in moderator level and the change in nuclear properties of the fuel with increasing irradiation. The appropriate properties are obtained by interpolation from tables supplied for as many as 8 types of fuel bundle. The mean fuel exit burnup can be calculated at equilibrium for a reactor in which the exit burnups for two zones may be adjusted to give radial power flattening and the fuelling schedules may be designed to give axial power flattening in one or both zones. (author)
Photometry of SN 2002ic and implications for the progenitor mass-loss history
International Nuclear Information System (INIS)
Wood-Vasey, W.M.; Wang, L.; Aldering, G.
2004-01-01
We present new pre-maximum and late-time optical photometry of the Type Ia/IIn supernova 2002ic. These observations are combined with the published V-band magnitudes of Hamuy et al. (2003) and the VLT spectrophotometry of Wang et al. (2004) to construct the most extensive light curve to date of this unusual supernova. The observed flux at late time is significantly higher relative to the flux at maximum than that of any other observed Type Ia supernova and continues to fade very slowly a year after explosion. Our analysis of the light curve suggests that a non-Type Ia supernova component becomes prominent ∼20 days after explosion. Modeling of the non-Type Ia supernova component as heating from the shock interaction of the supernova ejecta with pre-existing circumstellar material suggests the presence of a ∼1.7 x 1015 cm gap or trough between the progenitor system and the surrounding circumstellar material. This gap could be due to significantly lower mass-loss ∼15 (nu omega /10 km/s) -1 years prior to explosion or evacuation of the circumstellar material by a low-density fast wind. The latter is consistent with observed properties of proto-planetary nebulae and with models of white-dwarf + asymptotic giant branch star progenitor systems with the asymptotic giant branch star in the proto-planetary nebula phase
Frazier, D. O.; Facemire, B. R.; Fanning, U. S.
1986-01-01
If a binary homogeneous melt is cooled into an immiscible region, the newly formed second phase will generally have a density different from the parent phase, and will separate readily by sedimentation. Observation of solidification processes in microgravity indicates that outside of sedimentation, at least two other important effets can separate the phases: (1) preferential wetting, and (2) thermal migration of second-phase droplets due to interfacial tension gradients. The latter effect would drive the minority phase along the thermal gradient toward the hottest part (assuming the interfacial tension decreases with increasing temperature), which is usually away from the crucible wall. On the other hand, if the minority phase preferentially wets the crucible, a minority phase layer which thickens as initial solution compositions approach critical, will form adjacent to the solid surface and remain in the coldest region of the ingot. This study presents compelling preliminary evidence that these two effects do exist and that they compete with one another. However, the temperature dependence of preferential wetting below T(c) for the current system of study is, as yet, undetermined. These effects are sensitive to the initial concentration of a hypermonotectic solution cooling through a miscibility gap.
Simulating a Big Bang phenomenon Experiment will cast light on what holds atoms together
Chang, Kenneth
2003-01-01
"Experiments at the Brookhaven National Laboratory have created the hottest, densest matter ever observed, recreating conditions a fraction of a second after the birth of the universe, scientists have announced" (1 page)
First-Trimester <i>In Utero Exposure to Methylphenidate
DEFF Research Database (Denmark)
Dideriksen, Dorthe; Pottegård, Anton; Hallas, Jesper
2013-01-01
published, and safety during pregnancy has not been established. We systematically reviewed available data on birth outcome after human in utero exposure to methylphenidate. Systematic searches in PubMed/Embase were performed from origin to August 2012, and data from Michigan Medicaid recipients...
Mapping climate change in European temperature distributions
International Nuclear Information System (INIS)
Stainforth, David A; Chapman, Sandra C; Watkins, Nicholas W
2013-01-01
Climate change poses challenges for decision makers across society, not just in preparing for the climate of the future but even when planning for the climate of the present day. When making climate sensitive decisions, policy makers and adaptation planners would benefit from information on local scales and for user-specific quantiles (e.g. the hottest/coldest 5% of days) and thresholds (e.g. days above 28 ° C), not just mean changes. Here, we translate observations of weather into observations of climate change, providing maps of the changing shape of climatic temperature distributions across Europe since 1950. The provision of such information from observations is valuable to support decisions designed to be robust in today’s climate, while also providing data against which climate forecasting methods can be judged and interpreted. The general statement that the hottest summer days are warming faster than the coolest is made decision relevant by exposing how the regions of greatest warming are quantile and threshold dependent. In a band from Northern France to Denmark, where the response is greatest, the hottest days in the temperature distribution have seen changes of at least 2 ° C, over four times the global mean change over the same period. In winter the coldest nights are warming fastest, particularly in Scandinavia. (letter)
Implementing Embedded Training (ET): Volume 4. Identifying ET Requirements
1988-11-01
Database Step 1.1Step 1.6 On System and Identify Libary and Pf(t iinAnnotated: SMEs and Other Data Contats Phsases Commonality - DabawAnalysis and...convenient approach is to use two digit numbers to represent mission phases (or other functional break-outs) (e.g., 02, Mission Preparation phase), two...additional digits separated from the phase digits by periods to represent tasks (e.g., 02.06, Load Ammunition), two mcre digits to represent subtasks, and
Chemical and Photochemical Reactivity in Microemulsions and Waterless Microemulsions.
1988-02-10
virtually the same as that found in the alcohol rich microemulsion A. This value is also close to that found in pure butanol (= 5.0 - table I). It would...formamide or alcohol rich). RESEARCH PATTERN -Supplementing the physical chemical study of the microemulsion medium involving ionic surfactants with density...SAMII (1/02/1988) Ii&N 3 Part II - OXYDATIONS BY HYDROPEROXIDES IN MICROEMULSIONS E. OLIVEROS and M.T. MAURETTE During the past six months, the financial
The death of massive stars - I. Observational constraints on the progenitors of Type II-P supernovae
Smartt, S. J.; Eldridge, J. J.; Crockett, R. M.; Maund, J. R.
2009-05-01
We present the results of a 10.5-yr, volume-limited (28-Mpc) search for supernova (SN) progenitor stars. In doing so we compile all SNe discovered within this volume (132, of which 27 per cent are Type Ia) and determine the relative rates of each subtype from literature studies. The core-collapse SNe break down into 59 per cent II-P and 29 per cent Ib/c, with the remainder being IIb (5 per cent), IIn (4 per cent) and II-L (3 per cent). There have been 20 II-P SNe with high-quality optical or near-infrared pre-explosion images that allow a meaningful search for the progenitor stars. In five cases they are clearly red supergiants, one case is unconstrained, two fall on compact coeval star clusters and the other twelve have no progenitor detected. We review and update all the available data for the host galaxies and SN environments (distance, metallicity and extinction) and determine masses and upper mass estimates for these 20 progenitor stars using the STARS stellar evolutionary code and a single consistent homogeneous method. A maximum likelihood calculation suggests that the minimum stellar mass for a Type II-P to form is mmin = 8.5+1-1.5Msolar and the maximum mass for II-P progenitors is mmax = 16.5 +/- 1.5Msolar, assuming a Salpeter initial mass function holds for the progenitor population (in the range Γ = -1.35+0.3-0.7). The minimum mass is consistent with current estimates for the upper limit to white dwarf progenitor masses, but the maximum mass does not appear consistent with massive star populations in Local Group galaxies. Red supergiants in the Local Group have masses up to 25Msolar and the minimum mass to produce a Wolf-Rayet star in single star evolution (between solar and LMC metallicity) is similarly 25-30Msolar. The reason we have not detected any high-mass red supergiant progenitors above 17Msolar is unclear, but we estimate that it is statistically significant at 2.4σ confidence. Two simple reasons for this could be that we have systematically
Lou, Bi-Dan; Yang, Li-Bai; Zhang, Wei; Li, Jin-Xiang; Li, Xiao-Ping; Li, Wu; Yang, Shu-Quan; Huang, Xiang-Hong; Liu, Xing-Ping; Cao, Yue; Pan, Jiang
2012-11-01
To observe the impacts on repeated common cold for the adults with different constitutions treated by acupoint application in the dog days (the three periods of the hottest days) and the three nine-day periods after the winter solstice (the three periods of the coldest days). One hundred and fifty-two cases of repeated common cold were divided into four zones according to the body constitution. Each zone was sub-divided into a group of the dog days + the three nine-day periods of the coldest days (group A), and a simple group of the dog periods (group B). In both groups, Dazhui (GV 14), Feishu (BL 13), Tiantu (CV 22), Danzhong (CV 17), Zhongfu (LU 1) and Shenshu (BL 23) were selected. In group A, the acupoint application was given on the 1st or 2nd day of the first, second and third periods of the hottest days in 2010, as well as the 1st or 2nd day of the first, second and third periods of the coldest days in 2010 separately. In group B, the acupoint application was only given on the 1st or 2nd day of the first, second and third periods of the hottest days in 2010. The follow-up visit was conducted before the acupoint application in the three periods of the coldest days in 2010 and before the acupoint application in the three periods of the hottest days in 2011. Additionally, the frequency of disease attack and the symptom score in sickness were taken as the observation indices for the efficacy assessment in both groups. (1) In both groups, the attack frequency was reduced obviously in half a year after the three periods of the hottest days for the patients of qi deficiency constitution, yang deficiency constitution and qi stagnation constitution and the clinical symptom score were reduced apparently (all Pcoldest days for the patients of those four constitutions as compared with those before treatment (all Pcoldest days, the efficacy for reducing the attack frequency and the improvements in the clinical symptoms were better than those in group B (all P<0.01). The
Heat flow during sawtooth collapse in tokamak plasmas
International Nuclear Information System (INIS)
Hanada, Kazuaki
1994-01-01
Heat flow during sawtooth collapse was studied on the WT-3 tokamak by using temporal evolution of soft X-ray intensity profile in the poloidal cross section in a lower hybrid current driven plasma as well as an electron cyclotron heated plasma. Two phase in sawtooth collapses were observed. In the first phases, the hottest spot that is the peak of the soft X-ray distribution approaches the inversion surface and heat flows out through a narrow gate on the inversion surface. In the second phase, the hottest spot stays on the inversion surface, and heat flows out through the whole inversion surface. This suggests that magnetic reconnection as predicted by Kadomtsev's model occurs in the first phase, but in the second phase, a different mechanism dominates heat flow. (author)
Hume, Benjamin C. C.; D'Angelo, Cecilia; Burt, John A.; Wiedenmann, Jö rg
2018-01-01
The adaptation of tropical coral communities to the world's hottest sea, the Persian/Arabian Gulf (PAG), has recently been associated with ecological selection acting on a group of coral-associated algal symbionts, the Symbiodinium thermophilum
Digital piracy management in creative content industry
Akulavičius, Marius
2015-01-01
The present habits of digital content consumption and a rather easy access to illegal creative content reduce the opportunities to limit digital piracy by banning or invoking legislation. such a context of the creative content industry results in the need to search for new business models that would encourage users to voluntarily switch from illegal to legal products of the creative content industry, rather than simply banning them from using the illegal ones. iIn order to determine which bus...
MAGIC: THE GATHERING APUSOVELLUS ANDROIDILLE
Isopahkala, Ville
2017-01-01
Opinnäytetyönä oli omavalintainen android-sovellus Magic: The Gathering –korttipelille. Tavoitteena oli toteuttaa akkuystävällinen apusovellus kyseistä peliä pelaaville käyttäen android studiota. Työssä tutustutaan javaan, androidiin sekä android studioon, niiden historiaan sekä ominaisuuksiin. Magic: The Gathering:iin tutustutaan perustasolla. Opinnäytetyö keskittyy sovellukseen, sen luomiseen, koodauskieleen sekä alustaan. Tarkoituksena ei ole opettaa pelaamaan Magic: The Gatheringiä. Th...
Effects of sample treatments on genome recovery via single-cell genomics
Energy Technology Data Exchange (ETDEWEB)
Clingenpeel, Scott [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States); Schwientek, Patrick [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States); Hugenholtz, Philip [Univ. of Queensland, Brisbane (Australia); Woyke, Tanja [USDOE Joint Genome Institute (JGI), Walnut Creek, CA (United States)
2014-06-13
It is known that single-cell genomics is a powerful tool for accessing genetic information from uncultivated microorganisms. Methods of handling samples before single-cell genomic amplification may affect the quality of the genomes obtained. Using three bacterial strains we demonstrate that, compared to cryopreservation, lower-quality single-cell genomes are recovered when the sample is preserved in ethanol or if the sample undergoes fluorescence <i>in situ hybridization, while sample preservation in paraformaldehyde renders it completely unsuitable for sequencing.
Probing Late-Stage Stellar Evolution through Robotic Follow-Up of Nearby Supernovae
Hosseinzadeh, Griffin
2018-01-01
Many of the remaining uncertainties in stellar evolution can be addressed through immediate and long-term photometry and spectroscopy of supernovae. The early light curves of thermonuclear supernovae can contain information about the nature of the binary companion to the exploding white dwarf. Spectra of core-collapse supernovae can reveal material lost by massive stars in their final months to years. Thanks to a revolution in technology—robotic telescopes, high-speed internet, machine learning—we can now routinely discover supernovae within days of explosion and obtain well-sampled follow-up data for months and years. Here I present three major results from the Global Supernova Project at Las Cumbres Observatory that take advantage of these technological advances. (1) SN 2017cbv is a Type Ia supernova discovered within a day of explosion. Early photometry shows a bump in the U-band relative to previously observed Type Ia light curves, possibly indicating the presence of a nondegenerate binary companion. (2) SN 2016bkv is a low-luminosity Type IIP supernova also caught very young. Narrow emission lines in the earliest spectra indicate interaction between the ejecta and a dense shell of circumstellar material, previously observed only in the brightest Type IIP supernovae. (3) Type Ibn supernovae are a rare class that interact with hydrogen-free circumstellar material. An analysis of the largest-yet sample of this class has found that their light curves are much more homogeneous and faster-evolving than their hydrogen-rich counterparts, Type IIn supernovae, but that their maximum-light spectra are more diverse.
Metal Abundances in the Hottest Known DO White Dwarf (KPD 0005+5106)
Wassermann, Daniel; Werner, Klaus; Rauch, Thomas; Kurk, Jeffrey W.
2010-01-01
We performed a new analysis of UV and optical spectra of KPD 0005+5106. We find T(sub eff) = 200000 +/- 20000 K, log(g) = 6.7+/-0.3, M =.64 Stellar mass and logL/L = 3.7. The mass fractions of the metals are in the range 0.7 - 4.3 times solar. This abundance pattern is probably unaffected by gravitational settling and radiative levitation, hence, its origin lies in previous evolutionary stages. We speculate about a link of KPD 0005+5106 to the RCrB stars and its possible outcome of a double-degenerate merger event. Keywords: White dwarfs, atmospheres, abundances
Cubic zirconia in >2370 °C impact melt records Earth's hottest crust
Timms, Nicholas E.; Erickson, Timmons M.; Zanetti, Michael R.; Pearce, Mark A.; Cayron, Cyril; Cavosie, Aaron J.; Reddy, Steven M.; Wittmann, Axel; Carpenter, Paul K.
2017-11-01
Bolide impacts influence primordial evolution of planetary bodies because they can cause instantaneous melting and vaporization of both crust and impactors. Temperatures reached by impact-generated silicate melts are unknown because meteorite impacts are ephemeral, and established mineral and rock thermometers have limited temperature ranges. Consequently, impact melt temperatures in global bombardment models of the early Earth and Moon are poorly constrained, and may not accurately predict the survival, stabilization, geochemical evolution and cooling of early crustal materials. Here we show geological evidence for the transformation of zircon to cubic zirconia plus silica in impact melt from the 28 km diameter Mistastin Lake crater, Canada, which requires super-heating in excess of 2370 °C. This new temperature determination is the highest recorded from any crustal rock. Our phase heritage approach extends the thermometry range for impact melts by several hundred degrees, more closely bridging the gap between nature and theory. Profusion of >2370 °C superheated impact melt during high intensity bombardment of Hadean Earth likely facilitated consumption of early-formed crustal rocks and minerals, widespread volatilization of various species, including hydrates, and formation of dry, rigid, refractory crust.
Simplified model for DNB analysis
International Nuclear Information System (INIS)
Silva Filho, E.
1979-08-01
In a pressurized water nuclear reactor (PWR), the power of operation is restricted by the possibility of the occurrence of the departure from nucleate boiling called DNB (Departure from Nucleate Boiling) in the hottest channel of the core. The present work proposes a simplified model that analyses the thermal-hydraulic conditions of the coolant in the hottest channel of PWRs with the objective to evaluate BNB in this channel. For this the coupling between the hot channel and typical nominal channels assumed imposing the existence of a cross flow between these channels in a way that a uniforme pressure axial distribution results along the channels. The model is applied for Angra-I reactor and the results are compared with those of Final Safety Analysis Report (FSAR) obtained by Westinghouse through the THINC program, beeing considered satisfactory (Author) [pt
DEFF Research Database (Denmark)
Das, Promi; Ji, Boyang; Kovatcheva-Datchary, Petia
2018-01-01
Network analysis of large metagenomic datasets generated by current sequencing technologies can reveal significant co-occurrence patterns between microbial species of a biological community. These patterns can be analyzed in terms of pairwise combinations between all species comprising a community...... thetaiotaomicron, as well as Faecalibacterium prausnitzii and Roseburia inulinivorans as model organisms for our study. We then delineate the outcome of the co-cultures when equal distributions of resources were provided. The growth behavior of the co-culture was found to be dependent on the types of microbial...... species present, their specific metabolic activities, and resulting changes in the culture environment. Through this reductionist approach and using novel in vitro combinations of microbial species under anaerobic conditions, the results of this work will aid in the understanding and design of synthetic...
SU-E-T-636: Investigation of Dose Variation in High Dose Radiation Brachytherapy
Energy Technology Data Exchange (ETDEWEB)
Hyvarinen, M; Leventouri, T; Casey, C; Long, S [Florida Atlantic University, Boca Raton, FL (United States); Pella, S [South Florida Radiation Oncology and Florida Atlantic University, Boca Raton, FL (United States); Dumitru, N [University of Bucharest, Bucharest-magurele, Ilfov (Romania); Herrera, R [Louis Stokes VA Medical Center, Cleveland, OH (United States)
2014-06-15
Purpose: The purpose of this study is to revise most of the HDR types of treatments with their applicators and their localization challenges. Since every millimeter of misplacement counts the study will look into the necessity of increasing the immobilization for several types of applicators Methods: The study took over 136 plans generated by the treatment planning system (TPS) looking into the applicator's placement in regard to the organs at risk (OR) and simulated the three possible displacements at the hottest dose point on the critical organ for several accessories to evaluate the variation of the delivered dose at the point due to the displacement. Results: Significant dose variation was obtained for the Contura, Savi, MLM and Prostate applicators. Conclusion: This study data indicates that an improvement of the immobilization devices for HDR is absolutely necessary. Better applicator fixation devices are required too. Developing new immobilization devices for all the applicators is recommended. Florida Atlantic University may provide Travel reimbursements.
[Bibliometric analysis on relations between cardiovascular disease and erectile dysfunction].
Tian, G X; Liu, X P; Zeng, X T; Su, X J; Wei, W L; Wang, X H
2017-06-10
Objective: To understand the current situation and trend on the relations between erectile dysfunction (ED) and cardiovascular disease (CVD) through analyzing the epidemiologic research data. Methods: We conducted a literature search on the Scopus for potentially relevant epidemiologic studies on ED and CVD published from 1957 to October, 28, 2016. Age of the article, types, regions, citation, and co-authorship of the documents were recorded. Results: A total number of 412 pieces of literature were published in the past six decades, with original articles the most common types of ED and CVD. ED and CVD associated epidemiologic topics had an annual increase in number, and remained stable in the past decade, with occident countries as the United States and Italy taking the lead in this area. Clinical and epidemiological studies were the hottest areas, with most authors sharing a co-authorship. Conclusion: Our results suggested that inter-disciplinary cooperation with emphasize on clinical application were the effective starting points for ED and CVD associated epidemiologic studies.
SN 2016coi/ASASSN-16fp: An example of residual helium in a type Ic supernova?
Prentice, S. J.; Ashall, C.; Mazzali, P. A.; Zhang, J.-J.; James, P. A.; Wang, X.-F.; Vinkó, J.; Percival, S.; Short, L.; Piascik, A.; Huang, F.; Mo, J.; Rui, L.-M.; Wang, J.-G.; Xiang, D.-F.; Xin, Y.-X.; Yi, W.-M.; Yu, X.-G.; Zhai, Q.; Zhang, T.-M.; Hosseinzadeh, G.; Howell, D. A.; McCully, C.; Valenti, S.; Cseh, B.; Hanyecz, O.; Kriskovics, L.; Pál, A.; Sárneczky, K.; Sódor, Á.; Szakáts, R.; Székely, P.; Varga-Verebélyi, E.; Vida, K.; Bradac, M.; Reichart, D. E.; Sand, D.; Tartaglia, L.
2018-05-01
The optical observations of Ic-4 supernova (SN) 2016coi/ASASSN-16fp, from ˜2 to ˜450 days after explosion, are presented along with analysis of its physical properties. The SN shows the broad lines associated with SNe Ic-3/4 but with a key difference. The early spectra display a strong absorption feature at ˜5400 Åwhich is not seen in other SNe Ic-3/4 at this epoch. This feature has been attributed to HeIin the literature. Spectral modelling of the SN in the early photospheric phase suggests the presence of residual He in a C/O dominated shell. However, the behaviour of the HeIlines is unusual when compared with He-rich SNe, showing relatively low velocities and weakening rather than strengthening over time. The SN is found to rise to peak ˜16 d after core-collapse reaching a bolometric luminosity of Lp ˜ 3 × 1042 erg s-1. Spectral models, including the nebular epoch, show that the SN ejected 2.5 - 4 M⊙of material, with ˜1.5 M⊙below 5000 km s-1, and with a kinetic energy of (4.5 - 7) × 1051 erg. The explosion synthesised ˜0.14 M⊙of 56Ni. There are significant uncertainties in E(B - V)host and the distance however, which will affect Lp and MNi. SN 2016coi exploded in a host similar to the Large Magellanic Cloud (LMC) and away from star-forming regions. The properties of the SN and the host-galaxy suggest that the progenitor had MZAMS of 23 - 28 M⊙and was stripped almost entirely down to its C/O core at explosion.
DEFF Research Database (Denmark)
Staliulionis, Ž.; Mohanty, S.; Jabbari, Mahmoud
2017-01-01
In contrast to high fidelity CFD codes which require higher computational effort/time, the well-known Resistor-Capacitor (RC) approach requires much lower calculation time, but has a lower resolution of the geometrical arrangement. Therefore, for enclosures without too complex geometry in their i......In contrast to high fidelity CFD codes which require higher computational effort/time, the well-known Resistor-Capacitor (RC) approach requires much lower calculation time, but has a lower resolution of the geometrical arrangement. Therefore, for enclosures without too complex geometry...
FAA Air Traffic Activity. Fiscal Year 1984.
1984-09-30
FLAGSTAFF N I TINF PANTI ’lP3PAtl3’I’C 0 1919 74 1 F 126 L [(CAL f’PtRd19AT1,S 1523 1512 a TOTAL ’~ 1 1 I(INS 10993 0 1919 81930 134 GOODYEF~AR I 21...COUNTY (UBS) MS 2 0 0 ? COLUMBUS RECI’INAL ( GIRl MS 261 218 0 43 COLUM8US-LOWNOES COUNTY (us) MS 21 0 0 21 STARKVILLE ORTIRBFHA (15) MS 0 0 0 0 3
Diversity and frequency of Acacia spp. in three regions in the ...
African Journals Online (AJOL)
bismillha
2012-06-28
Jun 28, 2012 ... differences in soil texture associated with the various species, with some ... shape of the diameter distribution of uneven-sized and ... temperature of the hottest month (°C); m is the average ... typical reverse J-shape (Figure 8).
An Evaluation of the Grammar Teaching Material
Institute of Scientific and Technical Information of China (English)
张可科
2013-01-01
Of the many issues surrounding grammar, perhaps the hottest debate is whether to teach it or not. We review briefly argu⁃ments against and in support of grammar teaching before examining current grammar approaches in second language teaching.
New prospects for detecting high-energy neutrinos from nearby supernovae
Murase, Kohta
2018-04-01
Neutrinos from supernovae (SNe) are crucial probes of explosive phenomena at the deaths of massive stars and neutrino physics. High-energy neutrinos are produced through hadronic processes by cosmic rays, which are accelerated during interaction between the supernova (SN) ejecta and circumstellar material (CSM). Recent observations of extragalactic SNe have revealed that a dense CSM is commonly expelled by the progenitor star. We provide new quantitative predictions of time-dependent high-energy neutrino emission from diverse types of SNe. We show that IceCube and KM3Net can detect ˜103 events from a SN II-P (and ˜3 ×105 events from a SN IIn) at a distance of 10 kpc. The new model also enables us to critically optimize the time window for dedicated searches for nearby SNe. A successful detection will give us a multienergy neutrino view of SN physics and new opportunities to study neutrino properties, as well as clues to the cosmic-ray origin. GeV-TeV neutrinos may also be seen by KM3Net, Hyper-Kamiokande, and PINGU.
Energy Technology Data Exchange (ETDEWEB)
Amano, Masayuki; Salcedo-Gómez, Pedro Miguel; Zhao, Rui; Yedidi, Ravikiran S.; Das, Debananda; Bulut, Haydar; Delino, Nicole S.; Sheri, Venkata Reddy; Ghosh, Arun K.; Mitsuya, Hiroaki (Kumamoto); (NIH); (Purdue)
2016-09-12
We here report that GRL-10413, a novel non-peptidic HIV-1 protease inhibitor (PI) containing a modified P1 moiety and a sulfonamide isostere, is highly active against laboratory HIV-1 strains and primary clinical isolates (EC50: 0.00035 - 0.0018 μM) with minimal cytotoxicity (CC50: 35.7 μM). GRL-10413 blocked the infectivity and replication of HIV-1NL4-3variants selected by up to 5 μM concentrations of atazanavir, lopinavir, or amprenavir (EC50: 0.0021 - 0.0023 μM). GRL-10413 also maintained its strong antiviral activity against multi-drug-resistant clinical HIV-1 variants isolated from patients, who no longer responded to various antiviral regimens after long-term antiretroviral therapy. The development of resistance against GRL-10413 was significantly delayed compared to that of APV. In addition, GRL-10413 showed a favorable central nervous system (CNS) penetration property as assessed with an
Producción de recubrimientos de fosfato cálcico mediante ablación láser para aplicaciones biomédicas
Directory of Open Access Journals (Sweden)
Mayor, M. B.
1998-04-01
Full Text Available Apatitic calcium phosphates are used as coatings to improve the fixation of orthopedic and dental implants. The commercial technique to produce these coatings (plasm-spray shows some problems of adherence and control of their physicochemical properties. In this communication laser ablation is presented as a solution to overcome these problems. The ablation system consists in a vacuum chamber filled with water vapour up to the desired pressure. The laser beam of an ArF excimer laser is focused on a hydroxyapatite target, and the coating is deposited on a substrate parallel to the target maintained at certain temperature. The physicochemical properties of the material were analysed by Fourier transformed infrared spectroscopy (FT-IR X ray diffraction (XRD, scanning electron microscopy (SEM, and energy dispersive X ray spectroscopy (EDX. Taking into account these results, two types of coatings were choosen to asses their biocompatibility <i>in vitro.
Los fosfatos cálcicos apatíticos se utilizan como recubrimientos para mejorar la fijación de implantes ortopédicos y dentales. La técnica comercial para la producción de estos recubrimientos (plasma-spray presenta problemas de adherencia y control de propiedades físico-químicas. En esta comunicación, se presenta la ablación láser como alternativa para solventar estos problemas. El sistema de ablación consiste en una cámara de vacío llena de vapor de agua hasta la presión deseada. El haz de un láser excímero de ArF se focaliza en un blanco de hidroxiapatito, depositándose el recubrimiento en un substrato paralelo al blanco mantenido a una cierta temperatura. Las propiedades físico-químicas del material se analizaron por espectroscopia infrarroja por transformada de Fourier (FT-IR, difracción de rayos X (XRD, microscopía electrónica de barrido (SEM y espectroscopia de rayos X por dispersión de energías (EDX. Basándose en estos resultados, se escogieron
<i>In silico optimization of critical currents in superconductors
Energy Technology Data Exchange (ETDEWEB)
Kimmel, Gregory; Sadovskyy, Ivan A.; Glatz, Andreas
2017-07-01
For many technological applications of superconductors the performance of a material is determined by the highest current it can carry losslessly-the critical current. In turn, the critical current can be controlled by adding nonsuperconducting defects in the superconductor matrix. Here we report on systematic comparison of different local and global optimization strategies to predict optimal structures of pinning centers leading to the highest possible critical currents. We demonstrate performance of these methods for a superconductor with randomly placed spherical, elliptical, and columnar defects.
IIn vitro antifungal evaluation of various plant extracts against early ...
African Journals Online (AJOL)
Antifungal activities of 27 plant extracts were tested against Alternaria solani (E. & M.) Jones and Grout using radial growth technique. While all tested plant extracts produced some antifungal activities, the results revealed that Circium arvense, Humulus lupulus, Lauris nobilis and Salvia officinalis showed significant ...
Refinement Types for TypeScript
Vekris, Panagiotis; Cosman, Benjamin; Jhala, Ranjit
2016-01-01
We present Refined TypeScript (RSC), a lightweight refinement type system for TypeScript, that enables static verification of higher-order, imperative programs. We develop a formal core of RSC that delineates the interaction between refinement types and mutability. Next, we extend the core to account for the imperative and dynamic features of TypeScript. Finally, we evaluate RSC on a set of real world benchmarks, including parts of the Octane benchmarks, D3, Transducers, and the TypeScript co...
Organic Additives Improves the <i>in Vitro Growth of Native Orchid Vanda helvola Blume
Directory of Open Access Journals (Sweden)
Devina DAVID
2015-06-01
Full Text Available In vitro seed germination has been proven to be the most efficient technique to propagate orchid. The application of this aseptic technique has contributed to conservation of many endangered orchid species. In this study, undehisced capsules of Vanda helvola Blume were collected from Orchid Conservation Centre in Lagud Sebrang Agriculture Park, after 120 days from hand pollination and aseptically cultured on three types of basal media such as Murashige and Skoog (MS, Knudson C (KC and Vacin and Went (VW. After 90 days of culture, 66.40 ± 4.14% of seeds successfully germinated on KC medium. The effect of organic additives such as tomato juice, coconut water, peptone and yeast extract at different level of concentrations in KC basal medium were also tested on seed germination and seedling development of this native orchid. After 90 days of culture, over 90% of seeds were tremendously germinated on KC medium supplemented with 10% or 15% (v/v of tomato juice. The incorporation of peptone at 0.1% (w/v in KC basal media promoted rapid development of protocorm to seedling. Seedlings on this treatment produced an average of three leaves and two roots after 90 days of culture and were successfully acclimatized.
Refining types using type guards in TypeScript
de Wolff, Ivo Gabe; Hage, J.
2017-01-01
We discuss two adaptations of the implementation of type guards and narrowing in the TypeScript compiler. The first is an improvement on the original syntax-directed implementation, and has now replaced the original one in the TypeScript compiler. It is specifically suited for the scenario in which
Neuroethology of ultrasonic hearing in nocturnal butterflies (Hedyloidea)
DEFF Research Database (Denmark)
Yack, Jayne E.; Kalko, Elisabeth K.V.; Surlykke, Annemarie
2007-01-01
Nocturnal Hedyloidea butterflies possess ultrasound-sensitive ears that mediate evasive flight maneuvers. Tympanal ear morphology, auditory physiology and behavioural responses to ultrasound are described for Macrosoma heliconiaria, and evidence for hearing is described for eight other hedylid...... species. The ear is formed by modifications of the cubital and subcostal veins at the forewing base, where the thin (1-3 m), ovoid (520 £ 220 )mpanal membrane occurs in a cavity. The ear is innervated by nerve IIN1c, with three chordotonal organs attaching to separate regions of the tympanal membrane...
Independent Review of the Defense Logistics Agencys Roles and Missions
2014-12-01
3,000 3,500 C-5 F-15 C-130 KC-135 B-1 B-52 E-3 N IIN / N SN s BoM Items Ordered BoM Items Not Ordered Orders Not on BoM Warner- Robbins ALC Tinker... Tony Poleo Fred Pribble Michael Scott BG Steven Shapiro Brig Gen Giovanni Tuck Col Rex Adee Linda Barnett Matthew Beebe CDR Tim Benesh COL...DeVincentis Lt Gen (Ret) Kathleen Gainey RADM (Ret) Mark Heinrich CAPT (Ret) Stuart Jones Eric Peltz Marc Robbins This page is intentionally blank
Pearson's correlation coefficient in the theory of networks: A comment
Ahmed, Zafar; Kumar, Sachin
2018-01-01
In statistics, the Pearson correlation coefficient $r_{x,y}$ determines the degree of linear correlation between two variables and it is known that $-1 \\le r_{x,y} \\le 1$. In the theory of networks, a curious expression proposed in [PRL {\\bf 89} 208701 (2002)] for degree-degree correlation coefficient $r_{j_i,k_i}, i\\in [1,M]$ has been in use. We realize that the suggested form is the conventional Pearson's coefficient for $\\{(j_i,k_i), (k_i,j_i)\\}$ for $2M$ data points and hence it is rightl...
Directional Ocean Wave Spectra
1991-01-01
thle The basin is also equipped with a 50-rn-wide hydraulic Wasesc~an-menasured spec\\trum., Pitch ndroll motions AA C D Figure 5. Results of Tydeman...LDescnption and Mfodetling of IVieraonal Seas. Danish Hydraulic Institute rnd Danish Maritime Institute. Copenhagen, pp. 0-5-1 V-5-17 (1984). ACKNOWLEDGMENTS...iins oý 1 eak k II V. I" a t’A1101` icnt the large circles with inrscribed crssesý. lihe grL)wrd fracks Radar (kcaiw VOac~eoicc s.ha~k,,in, this on
Type Classes for Lightweight Substructural Types
Directory of Open Access Journals (Sweden)
Edward Gan
2015-02-01
Full Text Available Linear and substructural types are powerful tools, but adding them to standard functional programming languages often means introducing extra annotations and typing machinery. We propose a lightweight substructural type system design that recasts the structural rules of weakening and contraction as type classes; we demonstrate this design in a prototype language, Clamp. Clamp supports polymorphic substructural types as well as an expressive system of mutable references. At the same time, it adds little additional overhead to a standard Damas-Hindley-Milner type system enriched with type classes. We have established type safety for the core model and implemented a type checker with type inference in Haskell.
Yang, Xianjin; Debonneuil, Edouard; Zhavoronkov, Alex; Mishra, Bud
2016-01-01
Advances in financial engineering are radically reshaping the biomedical marketplace. For instance, new methods of pooling diversified drug development programs by placing them in a special purpose vehicle (SPV) have been proposed to create a securitized cancer megafund allowing for debt and equity participation. In this study, we perform theoretical and numerical simulations that highlight the role of empirical validation of the projects comprising a cancer megafund. We quantify the degree to which the deliberately designed structure of derivatives and investments is key to its liquidity. Research megafunds with comprehensive in silico and laboratory validation protocols and ability to issue both debt, and equity as well as hybrid financial products may enable conservative investors including pension funds and sovereign government funds to profit from unique securitization opportunities. Thus, while hedging investor's longevity risk, such well-validated megafunds will contribute to health, well being and longevity of the global population.
Ter Braak, A.M.; Geyskens, I.; Dekimpe, M.G.
Premium private labels (PLs) are considered one of the hottest trends in grocery retailing. Still, retailers do not feel the need to introduce premium PLs in every category. Generalizing across approximately 150 categories for six retailers from two countries that already carry premium PLs for
Towards LarKC : A platform for Web-scale reasoning
Fensel, Dieter; Van Harmelen, Frank; Andersson, Bo; Brennan, Paul; Cunningham, Hamish; Valle, Emanuele Delia; Fischer, Florian; Huang, Zhisheng; Kiryakov, Atanas; Lee, Tony Kyung Il; Schooler, Lael; Tresp, Volker; Wesner, Stefan; Witbrock, Michael; Zhong, Ning
2008-01-01
Current Semantic Web reasoning systems do not scale to the requirements of their hottest applications, such as analyzing data from millions of mobile devices, dealing with terabytes of scientific data, and content management in enterprises with thousands of knowledge workers. In this paper, we
Future equivalent of 2010 Russian heatwave intensified by weakening soil moisture constraints
Rasmijn, L.M.; Schrier, van der G.; Bintanja, R.; Barkmeijer, J.; Sterl, A.; Hazeleger, W.
2018-01-01
The 2010 heatwave in eastern Europe and Russia ranks among the hottest events ever recorded in the region1,2. The excessive summer warmth was related to an anomalously widespread and intense quasi-stationary anticyclonic circulation anomaly over western Russia, reinforced by depletion of spring soil
Open Corpus Adaptation++ in GALE : friend or foe?
De Bra, P.M.E.; Smits, D.; Pechenizkiy, M.; Knutov, E.; Yudelson, M.; Abel, F.; Houben, G.J.P.M.; Herder, E.
2012-01-01
"Open" has quickly become the hottest topic in any field related to information, including open government data, open learning resources, open user models, … Open Corpus Adaptation has been defined as the ability to perform adaptation to resources located anywhere on the Web. This leaves the
2013-07-31
... treat affected stands, improve the resiliency of stands at risk of these large-scale epidemics and... across diverse vegetation ranging from sagebrush, pi[ntilde]on, juniper and ponderosa pine to Engelmann... past decade has been the hottest and driest in centuries. This climate pattern, together with...
Indian Academy of Sciences (India)
sriranga
health. Lottery tickets are one of the hottest items on sale in India. Com- mon people love to .... which make bad choices and we are presumably left with those which make correct .... Now if any new girth value is given, the graph can tell us the.
Innovate or perish : The RSM Insight debate
R. Gilbert (Russell)
2014-01-01
markdownabstract__Abstract__ Although innovation is one the hottest management topics of the 21st century, very few firms excel at it. Here, in the first RSM Insight debate, three of the school’s leading management scholars discuss how firms should approach the subject of innovation and what
Institute of Scientific and Technical Information of China (English)
2007-01-01
The hottest financial market topic of the moment could be the subprime loan crisis in the United States. The crisis has stormed the U.S. stock market, dragging it to its biggest falls in a single trading day. Other markets, such as Japan’s, were also vul
Understanding Green Software Development: A Conceptual Framework
Ardito, Luca; Procaccianti, Giuseppe; Torchiano, Marco; Vetrò, Antonio
2015-01-01
The energy efficiency of IT has become one of the hottest topics in the last few years. The problem has been typically addressed by hardware manufacturers and designers, but recently the attention of industry and academia has shifted to the role of software for IT sustainability. Writing
Effect of temperature and rainfall on the distribution of the South ...
African Journals Online (AJOL)
A multiple regression analysis based on quantified spatial abundance (the number of sixteenth degree squares recorded with shelduck in a degree square), mean annual rainfall, mean annual temperature and mean temperature of the coldest (July) and hottest (January) months indicated a significant (P < 0,001) negative ...
Vogel, M. M.; Orth, R.; Cheruy, F.; Hagemann, S.; Lorenz, R.; Hurk, B. J. J. M.; Seneviratne, S. I.
2017-02-01
Regional hot extremes are projected to increase more strongly than global mean temperature, with substantially larger changes than 2°C even if global warming is limited to this level. We investigate the role of soil moisture-temperature feedbacks for this response based on multimodel experiments for the 21st century with either interactive or fixed (late 20th century mean seasonal cycle) soil moisture. We analyze changes in the hottest days in each year in both sets of experiments, relate them to the global mean temperature increase, and investigate processes leading to these changes. We find that soil moisture-temperature feedbacks significantly contribute to the amplified warming of the hottest days compared to that of global mean temperature. This contribution reaches more than 70% in Central Europe and Central North America. Soil moisture trends are more important for this response than short-term soil moisture variability. These results are relevant for reducing uncertainties in regional temperature projections.
Type inference for correspondence types
DEFF Research Database (Denmark)
Hüttel, Hans; Gordon, Andy; Hansen, Rene Rydhof
2009-01-01
We present a correspondence type/effect system for authenticity in a π-calculus with polarized channels, dependent pair types and effect terms and show how one may, given a process P and an a priori type environment E, generate constraints that are formulae in the Alternating Least Fixed......-Point (ALFP) logic. We then show how a reasonable model of the generated constraints yields a type/effect assignment such that P becomes well-typed with respect to E if and only if this is possible. The formulae generated satisfy a finite model property; a system of constraints is satisfiable if and only...... if it has a finite model. As a consequence, we obtain the result that type/effect inference in our system is polynomial-time decidable....
Ng, Carl Jon Way
2016-01-01
This article examines the corporate branding efforts of Singapore's publicly funded higher education institutions within a context of neoliberal marketization. Adopting a discourse-analytic perspective, it examines the kind of branding approaches employed by Singapore's universities and polytechnics, and how these approaches are realized…
Thermal states of coldest and hottest neutron stars in soft X-ray transients
Yakovlev, D. G.; Levenfish, K. P.; Potekhin, A. Y.; Gnedin, O. Y.; Chabrier, G.
2003-01-01
We calculate the thermal structure and quiescent thermal luminosity of accreting neutron stars (warmed by deep crustal heating in accreted matter) in soft X-ray transients (SXTs). We consider neutron stars with nucleon and hyperon cores and with accreted envelopes. It is assumed that an envelope has an outer helium layer (of variable depth) and deeper layers of heavier elements, either with iron or with much heavier nuclei (of atomic weight A > 100) on the top (Haensel & Zdunik 1990, 2003, as...
Using the Hottest Particles in the Universe to Probe Icy Solar System Worlds
National Aeronautics and Space Administration — The proposed instrument, which uses experimental techniques adapted from high energy physics, is a passive receiver of a naturally occurring signal generated by...
Tech Directions, 2011
2011-01-01
One of the hottest areas in technology is invisible. Wireless communications allow people to transmit voice messages, data, and other signals through the air without physically connecting senders to receivers with cables or wires. And the technology is spreading at lightning speed. Cellular phones, personal digital assistants, and wireless…
Selfies are out - Now we take Healthies
DEFF Research Database (Denmark)
Fausing, Bent
2014-01-01
This article is about healthy selfies. Images of fit bodies and sweat are the hottest thing in selfies these days. They fit somewhere between recognition and narcissism, says an associate professor and PhD, Bent Fausing, who believes that the fit body is an images of success - and protection...
The Challenges of Defining and Measuring Student Engagement in Science
Sinatra, Gale M.; Heddy, Benjamin C.; Lombardi, Doug
2015-01-01
Engagement is one of the hottest research topics in the field of educational psychology. Research shows that multifarious benefits occur when students are engaged in their own learning, including increased motivation and achievement. However, there is little agreement on a concrete definition and effective measurement of engagement. This special…
Open innovation : State of the art and future perspectives
Huizingh, K.R.E.
Open innovation has become one of the hottest topics in innovation management. This article intends to explore the limits in our understanding of the open innovation concept. In doing so, I address the questions of what (the content of open innovation), when (the context dependency) and how (the
School-Based Management: Theory and Practice.
George, Patricia, Ed.; Potter, Eugenia Cooper, Ed.
School-based management (SBM), sometimes called site-based management, is fast becoming the hottest restructuring item in the arsenal of reformers, teachers' unions, governors, and legislators who want to change the traditional ways in which schools and school districts do business. This document comprises three main sections with contributions…
Evaluation of tests in 4x4 assemblies carried out in Columbia University
International Nuclear Information System (INIS)
Pedron, M.Q.
1989-01-01
Tests in 4x4 assemblies with BWR characteristics carried out in Columbia University are analysed, using the PANTERA-1P computer code. The experiments aim for measuring fluid, flow and enthalpies in exits of two subchannels, the coldest and hottest using iso kinetic sampling method. (M.C.K.)
ZHENG ZHOU: A Prospering City in Middle China
Institute of Scientific and Technical Information of China (English)
2010-01-01
@@ With a pleasant climate,Zhengzhou is welcoming all year round.The hottest month is July and the average temperature is about 27 C while the coldest month is January with an average temperature of -0.2 C.Autumn and spring ale the best and the peak tourist seasons.
Pious Entertainment: Hizbullah's Islamic Cultural Sphere
Alagha, J.E.; Nieuwkerk, K. van
2011-01-01
Alagha’s chapter on Hezbollah’s Islamic cultural sphere is sure to generate some of the most interesting discussion. Lebanon and Hezbollah in particular are among the hottest topics in the studies of contemporary Islam, but few people actually have the appropriate levels of both access to and
Energy Technology Data Exchange (ETDEWEB)
Moriya, Takashi J.; Tanaka, Masaomi; Ohsuga, Ken [Division of Theoretical Astronomy, National Astronomical Observatory of Japan, National Institutes of Natural Sciences, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Morokuma, Tomoki, E-mail: takashi.moriya@nao.ac.jp [Institute of Astronomy, Graduate School of Science, The University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan)
2017-07-10
We propose that superluminous transients that appear at central regions of active galactic nuclei (AGNs) such as CSS100217:102913+404220 (CSS100217) and PS16dtm, which reach near- or super-Eddington luminosities of the central black holes, are powered by the interaction between accretion-disk winds and clouds in broad-line regions (BLRs) surrounding them. If the disk luminosity temporarily increases by, e.g., limit–cycle oscillations, leading to a powerful radiatively driven wind, strong shock waves propagate in the BLR. Because the dense clouds in the AGN BLRs typically have similar densities to those found in SNe IIn, strong radiative shocks emerge and efficiently convert the ejecta kinetic energy to radiation. As a result, transients similar to SNe IIn can be observed at AGN central regions. Since a typical black hole disk-wind velocity is ≃0.1 c , where c is the speed of light, the ejecta kinetic energy is expected to be ≃10{sup 52} erg when ≃1 M {sub ⊙} is ejected. This kinetic energy is transformed to radiation energy in a timescale for the wind to sweep up a similar mass to itself in the BLR, which is a few hundred days. Therefore, both luminosities (∼10{sup 44} erg s{sup −1}) and timescales (∼100 days) of the superluminous transients from AGN central regions match those expected in our interaction model. If CSS100217 and PS16dtm are related to the AGN activities triggered by limit–cycle oscillations, they become bright again in coming years or decades.
Guarded dependent type theory with coinductive types
DEFF Research Database (Denmark)
Bizjak, Aleš; Grathwohl, Hans Bugge; Clouston, Ranald
2016-01-01
We present guarded dependent type theory, gDTT, an extensional dependent type theory with a later' modality and clock quantifiers for programming and proving with guarded recursive and coinductive types. The later modality is used to ensure the productivity of recursive definitions in a modular......, type based, way. Clock quantifiers are used for controlled elimination of the later modality and for encoding coinductive types using guarded recursive types. Key to the development of gDTT are novel type and term formers involving what we call delayed substitutions’. These generalise the applicative...... functor rules for the later modality considered in earlier work, and are crucial for programming and proving with dependent types. We show soundness of the type theory with respect to a denotational model....
Parameterization of Terrain in Army Combat Analysis
1976-03-01
on co h»m f*l cmo com rfl—• co in <vj <T« 4toc« rococo cococmcmcmcm »-•—«— o cm cnj cmco c\\jcm c\\jcm cmcm cmcm c\\j cm cm cm, qnO co cm cr> in (7> <m p... rococo • r*» r*- r*» p~- r-» r— r*- iin^rMONONcom laooo-^ooom • cm—i*o r— >*• in— < • I s- r- incm aocm in t >J* >o 0^ co r«» co cj>>!•••••• - f
Energy Technology Data Exchange (ETDEWEB)
Commonwealth Associates, Inc.; IIT Research Institute
1997-08-01
This draft report consists of two volumes. Volume 1, the main body, contains an introducto~ sectionj an overview of magnetic fields sectio~ and field reduction technology evaluation section. Magnetic field reduction methods are evalpated for transmission lines, distribution Iines,sulxtations, building wiring applkmd machinery, and transportation systems. The evaluation considers effectiveness, co% and other ftiors. Volume 2 contains five appendices, Append~ A presents magnetic field shielding information. Appendices B and C present design assumptions and magnetic field plots for transmission and distribution lines, respectively. Appendices D and E present cost estimate details for transmission and distribution limes, respectively.
1978-09-29
FREQUENCY OF WIND DIRECTION AND SPEED (FROM HOURLY OBSERVATIONS) 34_D5_ 1 hf.H A / -/ rJC< L:: P .,-’l 7 STAMIn SIAT..AS II I""n SSy. __ _L r nl :..T...opposite > 0. Froa the table: Visibility>, 3 Iles -95.-I%. Visibility> 2 Iles - 96.9%. Viaibility > 1 Ile - 96.3%. EM4PLE j3 To Obtain combintions of celling ...VERSUS VISIBILITY A;IR E, T-"F S 7 " " PERCENTAGE FREQUENCY OF OCCURRENCE (FROM HOURLY OBSERVATIONS) CEll , tWINSIB4ITY STATUTE MILES C,00 I/IN- . I
Mirador de la Qubba Mayor (Lindaraja. Armadura apeinazada de cintas con vidrios de colores
Directory of Open Access Journals (Sweden)
Fernández-Puertas, Antonio
2009-12-01
Full Text Available This work studies the only decorative wooden ceiling with coloured glass that survived <i>in situ in Hispano- Muslim Art, in the Palace of the Riyāḍ al-Sa'īd of the Alhambra, hence its enormous importance for the History of Art.
En este trabajo se estudia la única armadura apeinazada decorativa con vidrios de colores que ha pervivido in situ en el arte hispanomusulmán, en el palacio del Riyāḍ al-Sa'īd de la Alhambra, de ahí su enorme importancia para la Historia del Arte.
Energy Technology Data Exchange (ETDEWEB)
Kempton, Eliza M.-R. [Department of Physics, Grinnell College, Grinnell, IA 50112 (United States); Perna, Rosalba [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794 (United States); Heng, Kevin, E-mail: kemptone@grinnell.edu [University of Bern, Center for Space and Habitability, Sidlerstrasse 5, CH-3012 Bern (Switzerland)
2014-11-01
We present high resolution transmission spectra of giant planet atmospheres from a coupled three-dimensional (3D) atmospheric dynamics and transmission spectrum model that includes Doppler shifts which arise from winds and planetary motion. We model Jovian planets covering more than two orders of magnitude in incident flux, corresponding to planets with 0.9-55 day orbital periods around solar-type stars. The results of our 3D dynamical models reveal certain aspects of high resolution transmission spectra that are not present in simple one-dimensional (1D) models. We find that the hottest planets experience strong substellar to anti-stellar (SSAS) winds, resulting in transmission spectra with net blueshifts of up to 3 km s{sup –1}, whereas less irradiated planets show almost no net Doppler shifts. We find only minor differences between transmission spectra for atmospheres with temperature inversions and those without. Compared to 1D models, peak line strengths are significantly reduced for the hottest atmospheres owing to Doppler broadening from a combination of rotation (which is faster for close-in planets under the assumption of tidal locking) and atmospheric winds. Finally, high resolution transmission spectra may be useful in studying the atmospheres of exoplanets with optically thick clouds since line cores for very strong transitions should remain optically thick to very high altitude. High resolution transmission spectra are an excellent observational test for the validity of 3D atmospheric dynamics models, because they provide a direct probe of wind structures and heat circulation. Ground-based exoplanet spectroscopy is currently on the verge of being able to verify some of our modeling predictions, most notably the dependence of SSAS winds on insolation. We caution that interpretation of high resolution transmission spectra based on 1D atmospheric models may be inadequate, as 3D atmospheric motions can produce a noticeable effect on the absorption
Netbooks: Small but Powerful Friends
Descy, Don E.
2009-01-01
Netbooks, sometimes called "mini-notebooks," are lightweight, small, and low-priced computers. Some writers ridicule them by calling them "one of the hottest tech toys of the year" (Saltzman, 2008). Others enthusiastically embrace them as "my perfect new travel companion" (Grossman, 2009). Netbooks are not toys. They are honest-to-goodness real…
What's Hot: Texas and the Nation
Cassidy, Jack; Ortlieb, Evan; Grote-Garcia, Stephanie
2016-01-01
For two decades the International Literacy Association (ILA) has published the "What's Hot, What's Not in Literacy Survey." In the last five years, the hottest topics featured on the lists have largely been connected to the English Language Arts Common Core State Standards (ELA CCSS)--a publication produced by the National Governors…
Lambert, Chip
2015-01-01
You've started down the path of jQuery Mobile, now begin mastering some of jQuery Mobile's higher level topics. Go beyond jQuery Mobile's documentation and master one of the hottest mobile technologies out there. Previous JavaScript and PHP experience can help you get the most out of this book.
The preparation of the National Environmental Action Plan (NEAP ...
African Journals Online (AJOL)
A place where biodiversity assets are unique and fascinating, one of the best and hottest hotspots of conservation around the world; but also a place where environmental mismanagement has created severe erosion and water quality problems. What to do when the daily life of the average Malagasy is spent surviving for ...
Global climate change has already begun
International Nuclear Information System (INIS)
Sinclair, J.
1991-01-01
Global warning and climate change is now evident around the planet. Six of the eight warmest years on record occurred in the 1980s, while 1990 was the hottest year on record. The global imbalances seem set to worsen unless greenhouse gas emissions are reduced and restoration of the earth's forests is begun
A new trends in high-energy physics. Current topics in nuclear and particle physics
International Nuclear Information System (INIS)
Terazawa, H.
2001-01-01
The hottest subjects in high energy physics for the last couple of years are discussed in some details. The contents of this talk include: exotic nuclei; color ball as pomeron; neutrino masses and mixings; Higgs scalar mass; superparticles; substructure of quarks and leptons; structure of the universe and conclusion and future prospects
A Case Analysis of Business English Teacher Development in China with GDUFS as an Example
Wenzhong, Zhu; Jingzi, Deng
2015-01-01
Business English education has evolved into a cross-disciplinary programme in China as one of the hottest majors pursued by students and professionals. As Business English teaching develops in terms of diversity, richness, and depth, the demands placed on the teacher are also increasing. The paper assumes that the kind of teachers with…
Type Families with Class, Type Classes with Family
DEFF Research Database (Denmark)
Serrano, Alejandro; Hage, Jurriaan; Bahr, Patrick
2015-01-01
Type classes and type families are key ingredients in Haskell programming. Type classes were introduced to deal with ad-hoc polymorphism, although with the introduction of functional dependencies, their use expanded to type-level programming. Type families also allow encoding type-level functions......, now as rewrite rules. This paper looks at the interplay of type classes and type families, and how to deal with shortcomings in both of them. Furthermore, we show how to use families to simulate classes at the type level. However, type families alone are not enough for simulating a central feature...... of type classes: elaboration, that is, generating code from the derivation of a rewriting. We look at ways to solve this problem in current Haskell, and propose an extension to allow elaboration during the rewriting phase....
DEFF Research Database (Denmark)
Frandsen, Stine Krog; Gehl, Julie
2017-01-01
cancer cell lines: Breast (MDA-MB231) and colon (HT29), and in normal human fibroblasts (HDF-n), as well as investigating viability in human bladder cancer cells (SW780) and human small cell lung cancer cells (H69) where we have previously published intracellular ATP levels. RESULTS: Calcium...... with calcium alone (pHDF-n, and MDA-MB231; p
Richards, Gregor; Zappa Nardelli, Francesco; Vitek, Jan
2015-01-01
Typescript extends JavaScript with optional type annotations that are, by design, unsound and, that the Typescript compiler discards as it emits code. This design point preserves programming idioms developers are familiar with, and allows them to leave their legacy code unchanged, while offering a measure of static error checking in parts of the program that have type annotations. We present an alternative design for TypeScript, one where it is possible to support the same degree of dynamism,...
Gallagher, T. M.; Sheldon, N. D.; Mauk, J. L.; Gueneli, N.; Brocks, J. J.
2015-12-01
The Mesoproterozoic (~1.1 Ga) North American Midcontinent Rift System (MRS) has been of widespread interest to researchers studying its economic mineral deposits, continental rifting processes, and the evolution of early terrestrial life and environments. For their age, the MRS rocks are well preserved and have not been deeply buried, yet a thorough understanding of the regional thermal history is necessary to constrain the processes that emplaced the mineral deposits and how post-burial alteration may have affected various paleo-records. To understand the thermal history of the MRS better, this study presents carbonate clumped isotope (Δ47) temperatures from deposits on the north and south sides of the rift. Due to the age of these deposits and known post-depositional processes, uncertainties exist about whether the clumped isotope signature has been reset. To test this, three generations of calcite were analyzed from the Nonesuch Fm. from the White Pine mine in Michigan including: sedimentary limestone beds, early diagenetic carbonate nodules, and hydrothermal calcite veins associated with the emplacement of copper mineralization. Clumped isotope temperatures from the White Pine mine range from 84 to 131°C, with a hydrothermal vein producing the hottest temperature. The clumped isotope temperature range for samples throughout the rift expands to 41-134°C. The hottest temperatures are associated with areas of known copper mineralization, whereas the coolest temperatures are found on the northern arm of the rift in Minnesota, far from known basin-bounding faults. Our hottest temperatures are broadly consistent with preexisting maximum thermal temperature estimates based on clay mineralogy, fluid inclusions, and organic geochemistry data. Clumped isotope results will also be compared to new hydrocarbon maturity data from the Nonesuch Fm., which suggest that bitumen maturities consistently fall within the early oil window across Michigan and Wisconsin.
Teaching Art to Teens in Public Libraries
Crawford Barniskis, Shannon
2013-01-01
One of the hottest terms among public librarians today is "content creation," which involves stuff that library patrons make instead of simply use in a library context. Videos, music, fiction, paintings, 3D printed materials, websites--all these are made in public libraries, and will increase in popularity as more libraries shift from purveyors of…
Innovate or perish: The RSM Insight debate
Gilbert, Russell
2014-01-01
markdownabstract__Abstract__ Although innovation is one the hottest management topics of the 21st century, very few firms excel at it. Here, in the first RSM Insight debate, three of the school’s leading management scholars discuss how firms should approach the subject of innovation and what it takes to be successful at it.
Bodice Rippers without the Bodice: Ten Male-on-Male Romances for a Core Collection
Thomas, Devon
2011-01-01
One of the hottest growing segments of the romance genre is male-on-male (M/M) romance--gay romantic fiction mostly written and read by straight women. Featuring traditional romance conventions, including mistaken identities, star-crossed lovers, and happy endings, these stories show both physical and emotional intimacy between men. M/M builds on…
A Brand New Way of Looking at Library Marketing
Germain, Carol Anne, Ed.
2008-01-01
Currently, one of the hottest topics in library marketing is branding. Over the years, businesses have utilized this technique to achieve commercial success. Is it possible for libraries to utilize this same strategy to promote their resources and services? One of the key components of a good branding campaign is passion, dedication, and a quality…
Dansk Almenmedicinsk Forskningsdag - DAF 2013
DEFF Research Database (Denmark)
Jensen, Jacob Reinholdt; Ryborg, Christina Trankjær; Smidth, Margrethe
2013-01-01
Ideen om DAF udsprang på en indisk restaurant for to år siden, da repræsentanter fra det daværende Forskningsudvalg var til Society for Academic Primary Care (SAPC) i Bristol. En konference, hvor den nyeste forskning og de hotteste forskere inden for almen medicin i Storbritannien var repræsenteret...
Now playing in a browser near you: TEDxCERN
Katarina Anthony
2013-01-01
Earlier this month, CERN played host to one of the hottest, hippest and most educational parties around: TEDx. The event brought together thousands of viewers, speakers and participants from around the world. The TEDxCERN event was the hottest ticket in town – and those who couldn’t make the event in person turned up online! More than 1,000 TEDxCERN fans watched the event via simulcast at viewing parties held in 27 institutions, but dominating the audience were the 10,870 unique viewers who tuned in to the live webcast, along with over 300 people who joined the webcast from CERN and another 300 watching it live from the Globe of Science and Innovation at CERN. But if you missed the excitement, never fear. Videos of the talks, as well as the clips presented during the talks themselves, are now available online. Just head to the TEDxCERN homepage and catch up! Watch as researcher Maya Tolstoy discusses seafloor earthquakes, Google Science Fair winner Brittany Wengler ...
CFD analyses of the rod bowing effect on the subchannel outlet temperature distribution
Energy Technology Data Exchange (ETDEWEB)
Ekstroem, Karoliina; Toppila, Timo [Fortum Power and Heat, Fortum (Finland)
2017-09-15
In the Loviisa 1 and 2 nuclear power plants the subcooling margin of the hottest subchannel of the fuel assembly is monitored. The temperature of the coolant in the hottest subchannel is limited to the constant saturation temperature. Bending of the fuel rods occurs during normal operation due to the differences in the heat profiles of the rods. The coolant temperature will rise more in the subchannel with smaller flow area due to the bending and this has to be taken into account in the safety margin of subchannel enthalpy rise. Computational Fluid Dynamics (CFD) simulations are used to estimate how much the estimated maximum bow of a rod affects the temperature rise of the subchannel. The quantitative uncertainty of the predicted enthalpy rise in fuel bundle subchannel is estimated based on the uncertainty of modelling of mixing between subchannels. The measured turbulence quantities from LDA measurements of cold test assembly made in 1990s in Fortum are compared with CFD results to give uncertainty estimation for turbulence, which is further used for uncertainty estimation of mixing and simulated subchannel enthalpy rise.
Summer does not always mean lower: seasonality of 24 h, daytime, and night-time blood pressure.
Fedecostante, Massimiliano; Barbatelli, Paolo; Guerra, Federico; Espinosa, Emma; Dessì-Fulgheri, Paolo; Sarzani, Riccardo
2012-07-01
Evaluation of seasonal influences on ambulatory blood pressure monitoring (ABPM) values in a very large population living in a mild-climate geographic area. Among patients referred to our Hypertension Center between September 2002 and January 2011 with a reliable ABPM, we considered those in the two hottest (July and August) vs. those in the two coldest (January and February) months. Seven hundred and forty-two men (53.2%) and 653 women (46.8%) were studied; 1245 (89.3%) were hypertensive patients of which 795 (63.9%) were drug-treated. In winter, mean daytime SBP and DBP were higher (P = 0.001 and P hottest summer months are associated with lower daytime BP and also lower 24-h DBP. However, we found an inverse relationship regarding night-time BP, dipping pattern, and INH that were higher or more common in summer. These findings were even more evident in treated patients, especially when not at target. Different sleeping behaviors or improper dose reduction of drug therapy in summer may explain the findings.
Microstructure and microchemistry variation during thermal exposure of low alloy steels
International Nuclear Information System (INIS)
Kim, S.; Shekhter, A.; Ringer, S.P.
2002-01-01
The microstructure of an ex-service (136,000 h) Fe-1Cr-1Mo-0.25V (wt%) low alloy steel turbine rotor was investigated using energy dispersive X-ray spectroscopy (EDXS) techniques in TEM/STEM on extraction replicas. Since different stages of the rotor experience different thermal histories, an examination of microstructural variations can serve as a method to indicate metallurgical factors affecting service-lifetime of the material. The coldest, hottest and most embrittled stages were taken for investigation. The overall fraction of carbide precipitation was measured using image analysis techniques and results indicated that the hottest stage possessed the highest precipitate volume fraction. Large area EDXS analysis using a defocused electron beam was also performed on the replica samples and this was supported by spot analyses using scanning TEM to identify individual carbides so as to allow quantification of the enrichment of solute into carbides as a function of service temperature. Three-dimensional atom probe field ion microscopy was also used to assess the chemistry at the interface between matrix and precipitate
Hetmańczyk, Joanna; Hetmańczyk, Lukasz; Migdał-Mikuli, Anna; Mikuli, Edward; Florek-Wojciechowska, Małgorzata; Harańczyk, Hubert
2014-04-24
Vibrational-reorientational dynamics of H2O ligands in the high- and low-temperature phases of [Sr(H2O)6]Cl2 was investigated by Raman Spectroscopy (RS), proton magnetic resonance ((1)H NMR), quasielastic and inelastic incoherent Neutron Scattering (QENS and IINS) methods. Neutron powder diffraction (NPD) measurements, performed simultaneously with QENS, did not indicated a change of the crystal structure at the phase transition (detected earlier by differential scanning calorimetry (DSC) at TC(h)=252.9 K (on heating) and at TC(c)=226.5K (on cooling)). Temperature dependence of the full-width at half-maximum (FWHM) of νs(OH) band at ca. 3248 cm(-1) in the RS spectra indicated small discontinuity in the vicinity of phase transition temperature, what suggests that the observed phase transition may be associated with a change of the H2O reorientational dynamics. However, an activation energy value (Ea) for the reorientational motions of H2O ligands in both phases is nearly the same and equals to ca. 8 kJ mol(-1). The QENS peaks, registered for low temperature phase do not show any broadening. However, in the high temperature phase a small QENS broadening is clearly visible, what implies that the reorientational dynamics of H2O ligands undergoes a change at the phase transition. (1)H NMR line is a superposition of two powder Pake doublets, differentiated by a dipolar broadening, suggesting that there are two types of the water molecules in the crystal lattice of [Sr(H2O)6]Cl2 which are structurally not equivalent average distances between the interacting protons are: 1.39 and 1.18 Å. However, their reorientational dynamics is very similar (τc=3.3⋅10(-10) s). Activation energies for the reorientational motion of these both kinds of H2O ligands have nearly the same values in an experimental error limit: and equal to ca. 40 kJ mole(-1). The phase transition is not seen in the (1)H NMR spectra temperature dependencies. Infrared (IR), Raman (RS) and inelastic
DEFF Research Database (Denmark)
Hansen, D S; Skov, R; Benedí, J.V.
2002-01-01
OBJECTIVE: To compare pulsed-field gel electrophoresis (PFGE) typing and O:K-serotyping of Klebsiella in two different epidemiological settings. METHODS: One hundred and four bacteremia isolates without known epidemiological relation and 47 isolates from an outbreak in a neonatal intensive care...... unit (NICU) were K-typed by countercurrent immunoelectrophoresis (CCIE), O-typed by an inhibition enzyme-linked immunosorbent assay method, and typed by pulsed-field gel electrophoresis (PFGE) using the restriction enzyme XbaI. RESULTS: Typing data for the 104 bacteremia isolates were compared...... with regard to typability, number of types, maximum number of isolates per type, and the Discriminative Index (DI). O-typing combined with K-typing (DI 0.98) as O:K-serotyping (DI 0.99) gave a very discriminative typing system, whereas O-typing alone was not very discriminative (DI 0.76). PFGE (DI 1...
Han, Ki-Soon
2007-01-01
Education for gifted children is currently one of the hottest educational issues in Korea. Much money and effort are being invested in this area of education. Recent announcements by the Korean Ministry of Education state that all children should be educated to the level of which they are capable, and the current program for gifted students should…
Willey, David
2010-01-01
This article gives a brief history of fire-walking and then deals with the physics behind fire-walking. The author has performed approximately 50 fire-walks, took the data for the world's hottest fire-walk and was, at one time, a world record holder for the longest fire-walk (www.dwilley.com/HDATLTW/Record_Making_Firewalks.html). He currently…
49 CFR 571.105 - Standard No. 105; Hydraulic and electric brake systems.
2010-10-01
... brake actuating forces in response to signals from one or more sensed wheels. Initial brake temperature means the average temperature of the service brakes on the hottest axle of the vehicle 0.2 mi before any... procedures and in the sequence set forth in S7. Each school bus with a GVWR greater than 10,000 pounds must...
Energy Technology Data Exchange (ETDEWEB)
Luest, Dieter
2014-11-01
Can all physical phenomena from the smallest particles to the universe be uniquely described? The hottest candidate for such a world formula is the string theory. The renowned physicist Dieter Luest explains by means of a story of ''quantum fishes'', intelligent fishes in a pond, the foundations and essential principles of the string theory.
Modeling the potential impacts of global climate change in ...
African Journals Online (AJOL)
One of the hottest issues in the recent environmental research worldwide has become the harmful effects of climate change on the ecosystems and environment due to global warming. Bangladesh is one of the most vulnerable countries not only in the South East Asia but also in the world. It is predicted that a large portion of ...
Donkey in Disguise: Jack Jennings and the Center on Education Policy
Forster, Greg
2006-01-01
With the passage of the No Child Left Behind Act (NCLB), the proliferation of high school exit exams, the success of school choice initiatives, and a dozen other smaller if more bitter battles, education has become one of the hottest policy topics in Washington. That means there is a booming market for education experts, especially those who claim…
21st Century Skills: What Are They and How Do We Assess Them?
Geisinger, Kurt F.
2016-01-01
One of the "hottest" topics in the educational measurement community in the past decade has been the assessment of 21st century skills. This special issue demonstrates work being performed in this realm. The present article provides a context for the four primary articles that follow and a brief but broad view of some models of 21st…
Elemental Sulphur Content Of Onion Bulb (Allium cepa L.) as ...
African Journals Online (AJOL)
acer
flood water from August to October. Average temperature ranges from 18.7 to 390C during the coldest and hottest periods of the year respectively. The treatments consisted of factorial combination of three levels of cow-dung (0, 15 and 30 t/ha), three levels of nitrogen (0, 50 and. 75 kg/ha) and three weeding regimes (weedy.
African Journals Online (AJOL)
A.S RINGIM
2017-12-04
Dec 4, 2017 ... The average temperature is around 30.9° C during the hottest period, and 22° C during the coldest period, January. (https://en.climate-data.org/location/46667/; https://en.m.wikipedia.org/wiki/Dutse). Dutse is home to one of the five substations of the Nigerian. Institute for Oil Palm Research (NIFOR), with an.
A sultry afternoon in a naturally ventilated office during the hottest summer on record
CSIR Research Space (South Africa)
Conradie, Dirk
2016-10-01
Full Text Available Weather Service. Although this particular office has a split unit air conditioner the author, being a great believer in passive design, never uses it. Conventional design wisdom argues that a high thermal mass building is the answer in climates that have a...
Those Were Some of the Hottest Days of My Life: The Genesis of SCOLT
Swanson, Pete
2015-01-01
The following article recounts the creation and development of the Southern Conference on Language Teaching (SCOLT) through the words of one of its founders, Dr. Herman Bostick. The article is not intended to tell the entire history of the founding of the organization, nor the full story of Dr. Bostick's contributions to the civil rights movement…
Applicability study on a ceramic filter with hot-test conducted in a BWR plant
International Nuclear Information System (INIS)
Yamada, K.; Shirai, T.; Wada, M.; Nakamizo, H.
1991-01-01
Radioactive crud removal and filtration performance recovery by backwashing were examined with a BWR plant pool water using a ceramic filter element, 0.1 micron in nominal pore size and 0.2m 2 in filtration area. Totally 1114 hours filter operation were accumulated. Ten backwashings were accomplished during the test period. The following results were obtained. (1) Radioactive crud concentration in the filter effluent remained below 10 5 Bq/m 3 . (2) Both pressure loss through the filter and dose rate at the filter vessel surface were recovered to the initial level by each backwashing. The surface dose rate after backwashing was approximately 0.01mSv/h. According to these test results, it is confirmed that the ceramic filter is appropriate for the treatment of highly crud concentrated radioactive liquid, which is generated in nuclear facilities, such as spent fuel reprocessing plants. (author)
Typing is writing: Linguistic properties modulate typing execution.
Pinet, Svetlana; Ziegler, Johannes C; Alario, F-Xavier
2016-12-01
Typing is becoming our preferred way of writing. Perhaps because of the relative recency of this change, very few studies have investigated typing from a psycholinguistic perspective. In addition, and despite obvious similarities between typing and handwriting, typing research has remained rather disconnected from handwriting research. The current study aimed at bridging this gap by evaluating how typing is affected by a number of psycholinguistic variables defined at the word, syllable, and letter levels. In a writing-to-dictation task, we assessed typing performance by measuring response accuracy, onset latencies - an index of response preparation and initiation - and interkeystroke intervals (IKIs) - an index of response execution processes. The lexical and sublexical factors revealed a composite pattern of effects. Lexical frequency improved response latencies and accuracy, while bigram frequency speeded up IKIs. Sound-spelling consistency improved latencies, but had an inhibitory effect on IKI. IKIs were also longer at syllable boundaries. Together, our findings can be fit within a framework for typed production that combines the previously developed theories of spelling and typing execution. At their interface, we highlight the need for an intermediate hierarchical stage, perhaps in the form of a graphemic buffer for typing.
On the Possibility of Fast Radio Bursts from Inside Supernovae: The Case of SN 1986J
Bietenholz, Michael F.; Bartel, Norbert
2017-12-01
We discuss the possibility of obtaining fast radio bursts (FRBs) from the interior of supernovae, in particular SN 1986J. Young neutron stars are involved in many of the possible scenarios for the origin of FRBs, and it has been suggested that the high dispersion measures observed in FRBs might be produced by the ionized material in the ejecta of associated supernovae. Using VLA and VLBI measurements of the Type IIn SN 1986J, which has a central compact component not seen in other supernovae, we can directly observe for the first time radio signals, which originate in the interior of a young (∼30 year old) supernova. We show that at an age of 30 years, any FRB signal at ∼1 GHz would still be largely absorbed by the ejecta. By the time the ejecta have expanded so that a 1 GHz signal would be visible, the internal dispersion measure due to the SN ejecta would be below the values typically seen for FRBs. The high dispersion measures seen for the FRBs detected so far could of course be due to propagation through the intergalactic medium provided that the FRBs are at distances much larger than that of SN 1986J, which is 10 Mpc. We conclude that if FRBs originate in Type II SNe/SNRs, they would likely not become visible until 60 ∼ 200 years after the SN explosion.
Type Inference for Session Types in the Pi-Calculus
DEFF Research Database (Denmark)
Graversen, Eva Fajstrup; Harbo, Jacob Buchreitz; Huttel, Hans
2014-01-01
In this paper we present a direct algorithm for session type inference for the π-calculus. Type inference for session types has previously been achieved by either imposing limitations and restriction on the π-calculus, or by reducing the type inference problem to that for linear types. Our approach...
Energy Technology Data Exchange (ETDEWEB)
Anon.
1990-04-15
What was the hottest particle physics of the past decade? When CERN information specialist David Dallman looked into the high energy physics database to find the most frequently cited papers of the 1980s he found two dominant themes, one theoretical - string theory, and one experimental - the discovery of the W and Z carriers of the weak nuclear force at CERN in 1983.
International Nuclear Information System (INIS)
Anon.
1990-01-01
What was the hottest particle physics of the past decade? When CERN information specialist David Dallman looked into the high energy physics database to find the most frequently cited papers of the 1980s he found two dominant themes, one theoretical - string theory, and one experimental - the discovery of the W and Z carriers of the weak nuclear force at CERN in 1983
Dal "San Marco" al "Vega". (English Title: From "San Marco" to Vega)
Savi, E.
2017-10-01
Apart from the two superpowers, among the other countries Italy has had an important role in astronautics. The roots of Italian astronautics' history runs deep in the hottest years of the Cold War, and it had its first remarkable achievement in the San Marco project..after years of advanced technologies testing, they achieved European cooperation and built VEGA, the current Arianespace light launcher.
Class Warfare: When Getting in Is the Hardest Part
Bartlett, Thomas
2008-01-01
Every college has a hot-ticket class. It is perhaps the subject matter or a celebrity professor. Whatever it is, everybody wants to get in. Yet, not everybody can. When an academic course is the hottest ticket on campus, students will go to great trouble to get a seat. This article discusses how university officials decide who gets a seat and…
Type checking with open type functions
DEFF Research Database (Denmark)
Schrijvers, Tom; Jones, Simon Peyton; Chakravarty, Manual
2008-01-01
We report on an extension of Haskell with open type-level functions and equality constraints that unifies earlier work on GADTs, functional dependencies, and associated types. The contribution of the paper is that we identify and characterise the key technical challenge of entailment checking; an...
Updating signal typing in voice: addition of type 4 signals.
Sprecher, Alicia; Olszewski, Aleksandra; Jiang, Jack J; Zhang, Yu
2010-06-01
The addition of a fourth type of voice to Titze's voice classification scheme is proposed. This fourth voice type is characterized by primarily stochastic noise behavior and is therefore unsuitable for both perturbation and correlation dimension analysis. Forty voice samples were classified into the proposed four types using narrowband spectrograms. Acoustic, perceptual, and correlation dimension analyses were completed for all voice samples. Perturbation measures tended to increase with voice type. Based on reliability cutoffs, the type 1 and type 2 voices were considered suitable for perturbation analysis. Measures of unreliability were higher for type 3 and 4 voices. Correlation dimension analyses increased significantly with signal type as indicated by a one-way analysis of variance. Notably, correlation dimension analysis could not quantify the type 4 voices. The proposed fourth voice type represents a subset of voices dominated by noise behavior. Current measures capable of evaluating type 4 voices provide only qualitative data (spectrograms, perceptual analysis, and an infinite correlation dimension). Type 4 voices are highly complex and the development of objective measures capable of analyzing these voices remains a topic of future investigation.
Directory of Open Access Journals (Sweden)
Ada H. Zohar
2016-02-01
Full Text Available Background. Type D personality was suggested as a marker of poorer prognosis for patients of cardiovascular disease. It is defined by having a score of 10 or more on both sub-scales of the DS14 questionnaire, Social Inhibition (SI and Negative Affectivity (NA. As Type D was designed to predict risk, its temporal stability is of prime importance. Methods. Participants in the current study were 285 community volunteers, who completed the DS14, and other personality scales, at a mean interval of six years. Results. The prevalence of Type D did not change. The component traits of Type D showed rank order stability. Type D caseness temporal stability was improved by using the sub-scales product as a criterion. Logistic hierarchical regression predicting Type D classification from Time1 demonstrated that the best predictors were Time1 scores on NA and SI, with the character trait of Cooperation, and the alexithymia score adding some predictive power. Conclusions. The temporal stability of the component traits, and of the prevalence of Type D were excellent. Temporal stability of Type D caseness may be improved by using a product threshold, rather than the current rule. Research is required in order to formulate the optimal timing for Type D measurement for predictive purposes.
<i>In situ ingestion of microfibres by meiofauna from sandy beaches
DEFF Research Database (Denmark)
Gusmão, Felipe; Di Domenico, Maikon; Amaral, A. Cecilia Z.
2016-01-01
Microfibres are widespread contaminants in marine environments across the globe. Detecting in situ ingestion of microfibres by small marine organisms is necessary to understand their potential accumulation in marine food webs and their role in marine pollution. We have examined the gut contents o...
Illuga saga Gríðarfóstra i>in Sweden
DEFF Research Database (Denmark)
Lavender, Philip Thomas
2014-01-01
This article looks at the intellectual history behind and scholarly preparation towards the first edition of Illuga saga Gríðarfóstra in Sweden in 1695. One of the main questions which the article tries to answer is why an edition of a saga about Danish kings and heroes would end up being produce...
<i>In Situ Molecular Imaging of the Biofilm and Its Matrix
Energy Technology Data Exchange (ETDEWEB)
Ding, Yuanzhao; Zhou, Yufan; Yao, Juan; Szymanski, Craig J.; Fredrickson, Jim K.; Shi, Liang; Cao, B.; Zhu, Zihua; Yu, Xiao-Ying
2016-11-15
Molecular mapping of live biofilms at submicron resolution presents a grand challenge. Here, we present the first chemical mapping results of biofilm extracellular polymeric sub-stance (EPS) components in biofilms using correlative imaging be-tween super resolution florescence microscopy and liquid time-of-flight secondary ion mass spectrometry (ToF-SIMS). Shewanella oneidensis is used as a model organism. Heavy metal anions chro-mate (Cr2O72-) consisting of chromium Cr (VI) was a model envi-ronmental stressor used to treat the biofilms. Of particular interest, biologically relevant water clusters have been first observed in the biofilms. Characteristic fragments of biofilm matrix components such as proteins, polysaccharides, and lipids can be spatially im-aged. Furthermore, characteristic fatty acids (e.g., palmitic acid), quinolone signal, and riboflavin fragments are found to respond af-ter the biofilm is treated with Cr (VI), leading to biofilm dispersion. Significant changes in water clusters and quorum sensing signals indicative of intercellular communication in the aqueous environ-ment are observed, suggesting that they might result in fatty acid synthesis and inhibit riboflavin production. The Cr (VI) reduction seems to follow the Mtr pathway leading to Cr (III) formation. Our approach potentially opens a new avenue for mechanistic insight of microbial community processes and communications using in situ imaging mass spectrometry and superresolution optical micros-copy.
Accumulation of heavy metals by .I.in vitro./I. cultures of plants
Czech Academy of Sciences Publication Activity Database
Kališová-Špirochová, I.; Punčochářová, J.; Kafka, Z.; Kubal, M.; Soudek, Petr; Vaněk, Tomáš
2003-01-01
Roč. 3, - (2003), s. 269-276 ISSN 1567-7230 R&D Projects: GA MŠk OC 837.10 Institutional research plan: CEZ:AV0Z4055905 Keywords : heavy metals * phytoremediation * sunflower Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides
Tumor markers in finding recurrent disease iin colorectal cancer: a diagnostic review
DEFF Research Database (Denmark)
Verberne, Charlotte; de Jong, W.H.; Grossmann, Irene
2013-01-01
Aim: In the search for evidence-based follow-up of patients after resection for colorectal cancer, numerous tumor markers have been proposed. This review has evaluated these markers and comments on the diagnostic accuracy in finding recurrent disease in relation to Carcino-Embryonic Antigen (CEA...
Present status of nuclear containments in Korea
International Nuclear Information System (INIS)
Park, Jihong; Hong, Jaekeun; Lee, Byunghoon; Son, Youngho
2007-01-01
Since the first nuclear power plant in Korea, Kori unit no.1, was started in commercial service in 1978, 20 units including Kori unit no.1 have been operated and maintained until now in Korea. Recently several units were started to be constructed and also, additionally more than 4 units were planned to be constructed in the near future. The importance of nuclear containments has been always one of the hottest issues for the safety and protection of nuclear power plants until now. At the beginning of nuclear power plants construction in Korea, several typed nuclear containment systems were adopted. For those reasons, various codes, standards, and inspection technologies are applied to nuclear containment systems differently. In this study, the status of inservice inspection performed for the safety and maintenance of nuclear containments in Korea was researched. Overall nuclear containment systems and inspections performed up to recently in Korea including trends, inspection items, periods, and regulations were described briefly. (author)
Image Segmentation Method Using Fuzzy C Mean Clustering Based on Multi-Objective Optimization
Chen, Jinlin; Yang, Chunzhi; Xu, Guangkui; Ning, Li
2018-04-01
Image segmentation is not only one of the hottest topics in digital image processing, but also an important part of computer vision applications. As one kind of image segmentation algorithms, fuzzy C-means clustering is an effective and concise segmentation algorithm. However, the drawback of FCM is that it is sensitive to image noise. To solve the problem, this paper designs a novel fuzzy C-mean clustering algorithm based on multi-objective optimization. We add a parameter λ to the fuzzy distance measurement formula to improve the multi-objective optimization. The parameter λ can adjust the weights of the pixel local information. In the algorithm, the local correlation of neighboring pixels is added to the improved multi-objective mathematical model to optimize the clustering cent. Two different experimental results show that the novel fuzzy C-means approach has an efficient performance and computational time while segmenting images by different type of noises.
Chandra Observations of the Eclipsing Wolf-Rayet Binary CQ CepOver a Full Orbital Cycle
Skinner, Steve L.; Guedel, Manuel; Schmutz, Werner; Zhekov, Svetozar
2018-06-01
We present results of Chandra X-ray observations and simultaneous optical light curves of the short-period (1.64 d) eclipsing WN6+O9 binary system CQ Cep obtained in 2013 and 2017 covering a full binary orbit. Our primary objective was to compare the observed X-ray properties with colliding wind shock theory, which predicts that the hottest shock plasma (T > 20 MK) will form on or near the line-of-centers between the stars. Thus, X-ray variability is expected during eclipses when the hottest plasma is occulted. The X-ray spectrum is strikingly similar to apparently single WN6 stars such as WR 134 and spectral lines reveal plasma over a broad range of temperatures T ~ 4 - 40 MK. Both primary and secondary optical eclipses were clearly detected and provide an accurate orbital period determination (P = 1.6412 d). The X-ray emission remained remarkably steady throughout the orbit and statistical tests give a low probability of variability. The lack of significant X-ray variabililty during eclipses indicates that the X-ray emission is not confined along the line-of-centers but is extended on larger spatial scales, contrary to colliding wind predictions.
... detect these minor antigens. It is done before transfusions, except in emergency situations. Alternative Names Cross matching; Rh typing; ABO blood typing; Blood group; Anemia - immune hemolytic blood type; ...
Ogihara, Shinji; Saito, Ryoichi; Sawabe, Etsuko; Kozakai, Takahiro; Shima, Mari; Aiso, Yoshibumi; Fujie, Toshihide; Nukui, Yoko; Koike, Ryuji; Hagihara, Michio; Tohda, Shuji
2018-04-01
The recently developed PCR-based open reading frame typing (POT) method is a useful molecular typing tool. Here, we evaluated the performance of POT for molecular typing of methicillin-resistant Staphylococcus aureus (MRSA) isolates and compared its performance to those of multilocus sequence typing (MLST) and Staphylococcus protein A gene typing (spa typing). Thirty-seven MRSA isolates were collected between July 2012 and May 2015. MLST, spa typing, and POT were performed, and their discriminatory powers were evaluated using Simpson's index analysis. The MRSA isolates were classified into 11, 18, and 33 types by MLST, spa typing, and POT, respectively. The predominant strains identified by MLST, spa typing, and POT were ST8 and ST764, t002, and 93-191-127, respectively. The discriminatory power of MLST, spa typing, and POT was 0.853, 0.875, and 0.992, respectively, indicating that POT had the highest discriminatory power. Moreover, the results of MLST and spa were available after 2 days, whereas that of POT was available in 5 h. Furthermore, POT is rapid and easy to perform and interpret. Therefore, POT is a superior molecular typing tool for monitoring nosocomial transmission of MRSA. Copyright © 2017 Japanese Society of Chemotherapy and The Japanese Association for Infectious Diseases. Published by Elsevier Ltd. All rights reserved.
Bio production of Vanillin from Agro-Industrial Wastes
International Nuclear Information System (INIS)
Abd EI-Aziz, A.B.
2011-01-01
The present study describes an environmentally friendly vanillin production processes from agro industrial wastes. Ferulic 'acid is a well-known product of cereal. brans and sugarcane bagasse lignin degradation, ferulic acid and cellulose degradation sugars were used as feedstock for the vanillin bio production by Debaryomyces hansenii. The bioconversion of ferulic into vanillin by Debaryomyces hansenii was affected by the type and amount of ferulic acid. Addition of purified ferulic acid (2 g/l) and using of adapted yeast cells. increase the yield of vanillin and decrease the secondary products. Yeast extract (3 g/l) and glucose (20 g/l) proved to be the best component as co-substrates for bio production of vanillin. Variable aeration conditions were tested by simultaneously vanilIin the ratio of medium to vessel volume and the agitation speed. under excess aeration, oxidation of a, significant portion of vanillin to vanillic acid occur, thus reducing the vanillin yield. Increasing the inoculum size up to 1 g/I and using low doses of gamma irradiation (0.25 kGy) increase the vanillin production. Under optimum conditions vanillin production from ferulic acid by Debaryomyces attained very high level of 1531 mg/1 with a molar yield of 76.5%
Numancia: The lived past. The felt past
Directory of Open Access Journals (Sweden)
Jimeno Martínez, Alfredo
2000-12-01
Full Text Available In this paper the principal components of the Management Plan of Numancia (Soria are exposed. Its aim is to integrate the different activities (research, conservation, diffusion and management that have been undertaken at this historic site. For their better understanding, some previous considerations are presented about the ''leisure culture ", tourism and Archaeology, as well as about the ideological use and the mental reconstruction of the past, having always the site of Numancia as a reference. Afterwards we expose the need of reconstructions made <i>in situ as a means to offer a comprehensible and living past. Finally, these programs of work are evaluated in relation with the evolution of the number of visitors and the socioeconomic implications.
En este artículo se exponen los componentes del Plan Director de Numancia (Soria, que tiene como objetivo integrar el conjunto de actuaciones (investigación, conservación, difusión y gestión a realizar en este histórico yacimiento. Para entender mejor las actuaciones que se están realizando en la presentación didáctica y puesta en valor de Numancia, se hace previamente una serie de consideraciones sobre ocio cultural, turismo y Arqueología, uso ideológico y reconstrucción mental del pasado, teniendo a Numancia como referente. A continuación se expone la necesidad de presentar este yacimiento a través de reconstrucciones realizadas <i>in situ, como fórmula para hacer el pasado comprensible y vivido. Finalmente se valoran estas intervenciones, atendiendo a la evolución del número de visitantes y a las implicaciones socioeconómicas.
Directory of Open Access Journals (Sweden)
Giuseppe Altieri
2008-12-01
Full Text Available As quality is a very important factor in milk powder produced by drying, the optimal process must protect both nutritional and sensorial properties. Although heat damage indices (namely the insolubility index (IINS, thermal damage (IDT, protein denaturation could be used to evaluate the correct processing of milk, they are very time-consuming. Hence a chemical marker, like vitamin C, is proposed for rapid assessment of the overall damage to the quality of the produced milk powder. Trials were carried out on milk concentrates from cow, goat and she-ass so as to optimize the process performance of the spray dryer, for each kind of milk, at three inlet temperatures (120, 150, 185 °C; the feed flow rate was set at 0.5 dm3/h with outlet air RH% in the range 10-40%; raw milk was concentrated using a low pressure evaporator until an average level of 23% dry matter was reached. As expected, the thermal damage of the milk powder increased as the inlet air temperature increased; the outlet powder RH% was 96-98% poorly correlated with the mass flow rate of the concentrate inlet. Moreover, the destruction kinetic of vitamin C was found highly correlated with the thermal damage to the milk powder. At 175 °C inlet air temperature the overall thermal treatment on the she-ass milk concentrate, which is very heat-sensitive due to its high lactose content, was “weak” (IDT<80 and the milk powder of “premium or extra” quality (IINS<1.25ml and lactic acid = 0.07% < 0.15% ADMI. The titratable acidity values are uncorrelated with the process air temperature but depend uniquely from the raw milk freshness.
Stripped-envelope supernova SN 2004dk is now interacting with hydrogen-rich circumstellar material
Mauerhan, Jon C.; Filippenko, Alexei V.; Zheng, WeiKang; Brink, Thomas; Graham, Melissa L.; Shivvers, Isaac; Clubb, Kelsey
2018-05-01
The dominant mechanism and time scales over which stripped-envelope supernovae (SNe) progenitor stars shed their hydrogen envelopes are uncertain. Observations of Type Ib and Ic SNe at late phases could reveal the optical signatures of interaction with distant circumstellar material (CSM) providing important clues on the origin of the necessary pre-SN mass loss. We report deep late-time optical spectroscopy of the Type Ib explosion SN 2004dk 4684 days (13 years) after discovery. We detect strong Hα emission with an intermediate line width of ˜400 km s-1 and luminosity ˜2.5 × 1039 erg s-1, signaling that the SN blast wave has caught up with the hydrogen-rich CSM lost by the progenitor system. The line luminosity is the highest ever reported for a SN at this late stage. Prominent emission features of He I, Fe, and Ca are also detected. The spectral characteristics are consistent with CSM energized by the forward shock, and resemble the late-time spectra of the persistently interacting Type IIn SNe 2005ip and 1988Z. We suggest that the onset of interaction with H-rich CSM was associated with a previously reported radio rebrightening at ˜1700 days. The data indicate that the mode of pre-SN mass loss was a relatively slow dense wind that persisted millennia before the SN, followed by a short-lived Wolf-Rayet phase that preceded core-collapse and created a cavity within an extended distribution of CSM. We also present new spectra of SNe 2014C, PTF11iqb, and 2009ip, all of which also exhibit continued interaction with extended CSM distributions.
Type classes for mathematics in type theory
Spitters, Bas; Van der Weegen, Eelis
2011-01-01
The introduction of first-class type classes in the Coq system calls for re-examination of the basic interfaces used for mathematical formalization in type theory. We present a new set of type classes for mathematics and take full advantage of their unique features to make practical a particularly flexible approach formerly thought infeasible. Thus, we address both traditional proof engineering challenges as well as new ones resulting from our ambition to build upon this development a library...
Luminescence dynamics in type-II GaAs/AlAs superlattices near the type-I to type-II crossover
DEFF Research Database (Denmark)
Langbein, Wolfgang Werner; Kalt, H.; Hvam, Jørn Märcher
1996-01-01
We report on a study of the time-resolved luminescence of type-II GaAs/AlAs superlattices near the type-I to type-II crossover. In spite of the slight type-II band alignment, the luminescence is dominated by the type-I transition. This is due to the inhomogeneous broadening of the type-I transiti...
Several types of types in programming languages
Martini, Simone
2015-01-01
Part 2: Regular Submissions; International audience; Types are an important part of any modern programming language, but we often forget that the concept of type we understand nowadays is not the same it was perceived in the sixties. Moreover, we conflate the concept of " type " in programming languages with the concept of the same name in mathematical logic, an identification that is only the result of the convergence of two different paths, which started apart with different aims. The paper...
Energy Technology Data Exchange (ETDEWEB)
Aguilas, F; Moneva, M A; Garcia Ramirez, L; Lopez Jimenez, J; Diaz Diaz, J
1971-07-01
It is analysed the thermal distribution of a fuel element of tubular plates irradiated in the JEN-1 reactor in the case of shaft locking of the primary cooling pump without opening the emergency gate. The fuel element hottest channel is studied in the position of maximum neutronic flux for three reactor power levels: 3 Hw (maximum reactor power), 2 Mw and 1 Hw. (Author) 8 refs.
18 GHz SZ Measurements of the Bullet Cluster Siddharth S. Malu ...
Indian Academy of Sciences (India)
1E0657-56, known as the 'Bullet cluster', is one of the hottest known clusters. It is a cluster collision/merger event at z ∼0.296, with the larger, westward cluster being ∼10 times the mass of the smaller 'bullet'. It is known to have a strong radio halo (Liang et al. 2000), and the Sunyaev–Zel'dovich effect (Andreani et al. 1999;.
1985-01-01
C 41 i • 1 *- ( X: — a» «-» ** »o ** -- *o h X» O i a» —• o *J 3 O 41 • o • •-» E flj ...34 *- * • -’--’’’ -"- • - - i’ i • i’ i * i i - iin td mä • i • • • na >Mi*i^BiB*a***ftfc *. *. • ii ^^•^^^^Vf^^V •«’•»•* •"• ^•W^ WT.i« ii, i...c C 3 TD O <Ü (O c* C C*_l oooooooooooooooooo i-H O HOOH i-HOt—«OI-HOOOOOOO CO en oo en en oooocncocncocncncncncncncn OcnH
1993-01-01
gn -*( 0Q 0 00 N 40 a a:wo to00)0 . C4 L~.4 U.U.L f6 - 1 -l 00o.00 4 Cfl4 mlC4 P. q w-i N4 r- Z-i (A N f 6-0 -IIn 4c (A (fl i N r- -I .4 C4 w-4 (no 00...V40& X U -- C -- 0. - =: z 0.V 4L CLO U U .4 .4U isQ3t lb 4. Cl . c൰VLSC io&C -4 CL > . 0O ACCa I.- (A-1.. S4 It ;: 0 0 04 06 > t I .. C ..4 0 o 1
DEFF Research Database (Denmark)
Christensen, Christian Bech; Christensen-Dalsgaard, Jakob; Madsen, Professor Peter Teglberg
2015-01-01
of early tetrapods such as Acanthostega. Therefore, experimental studies on the hearing capabilities of lungfish may shed light on the possible hearing capabilities of early tetrapods and broaden our understanding of hearing across the water-to-land transition. Here, we tested the hypotheses that (i......In the transition from an aquatic to a terrestrial lifestyle, vertebrate auditory systems have undergone major changes while adapting to aerial hearing. Lungfish are the closest living relatives of tetrapods and their auditory system may therefore be a suitable model of the auditory systems...... for aerial hearing, such as the first tetrapods, had rudimentary aerial hearing that may have led to the evolution of tympanic middle ears in recent tetrapods....
A THIOLATO-BRIDGED OCTANUCLEAR COPPER(I,II MIXED- VALENCE COMPLEX WITH N,N,S-TRIDENTATE LIGAND
Directory of Open Access Journals (Sweden)
Takanori Kotera
2007-06-01
Full Text Available Thiolato-bridged complex [CuI4CuII4(peampt4Cl8]·2H2O (Hpeampt = 1-(2-pyridylethylamino methylpropane-2-thiol has been synthesized and characterized by the elemental analysis, IR and UV-vis spectroscopies and magnetic susceptibility measurement. The X-ray crystal structure analysis of this complex shows a localized mixed-valence octanuclear cage structure made up of four trigonal-bipyramidal CuIIN2SCl2, two trigonal CuIS2Cl, and two tetrahedral CuIS2Cl2 coordination sites. Temperature dependence of magnetic susceptibility (4.5— 300 K shows that a fairly strong antiferromagnetic interaction is operating between the four CuII ions.
DEFF Research Database (Denmark)
Schwartzbach, Michael Ignatieff; Meineche Smidt, Erik
A hierarchical type system for imperative programming languages gives rise to various computational problems, such as type equivalence, type ordering, etc. We present a particular class of finite automata which are shown to be isomorphic to type equations. All the relevant type concepts turn out...... to have well-known automata analogues, such as language equality, language inclusion, etc. This provides optimal or best known algorithms for the type system, by a process of translating type equations to automata, solving the analogous problem, and translating the result back to type equations. Apart...
SPECTRAL AND PHOTOMETRIC DIAGNOSTICS OF GIANT PLANET FORMATION SCENARIOS
International Nuclear Information System (INIS)
Spiegel, David S.; Burrows, Adam
2012-01-01
Gas-giant planets that form via core accretion might have very different characteristics from those that form via disk instability. Disk-instability objects are typically thought to have higher entropies, larger radii, and (generally) higher effective temperatures than core-accretion objects. In this paper, we provide a large set of models exploring the observational consequences of high-entropy (hot) and low-entropy (cold) initial conditions, in the hope that this will ultimately help to distinguish between different physical mechanisms of planet formation. However, the exact entropies and radii of newly formed planets due to these two modes of formation cannot, at present, be precisely predicted. It is possible that the distribution of properties of core-accretion-formed planets and the distribution of properties of disk-instability-formed planets overlap. We, therefore, introduce a broad range of 'warm-start' gas-giant planet models. Between the hottest and the coldest models that we consider, differences in radii, temperatures, luminosities, and spectra persist for only a few million to a few tens of millions of years for planets that are a few times Jupiter's mass or less. For planets that are ∼five times Jupiter's mass or more, significant differences between hottest-start and coldest-start models persist for on the order of 100 Myr. We find that out of the standard infrared bands (J, H, K, L', M, N) the K and H bands are the most diagnostic of the initial conditions. A hottest-start model can be from ∼4.5 mag brighter (at Jupiter's mass) to ∼9 mag brighter (at 10 times Jupiter's mass) than a coldest-start model in the first few million years. In more massive objects, these large differences in luminosity and spectrum persist for much longer than in less massive objects. Finally, we consider the influence of atmospheric conditions on spectra, and find that the presence or absence of clouds, and the metallicity of an atmosphere, can affect an object
DEFF Research Database (Denmark)
Villumsen, Kasper Rømer; Koppang, Erling Olaf; Christensen, Dennis
2017-01-01
In an effort to reduce the frequency and severity of adverse reactions seen from the use of mineral oil adjuvants in salmonid fish, the effects of two alternative adjuvants were assessed, focusing on the induction of adverse effects as well as protection. Using rainbow trout (Oncorhynchus mykiss)...... protection appears similar to that of the benchmark formulation, thus introducing viable, potential alternative types of adjuvants for use in future fish vaccines....
Directory of Open Access Journals (Sweden)
Nathella Pavan Kumar
Full Text Available Although Type 1 cytokine responses are considered protective in pulmonary tuberculosis (PTB, their role as well as those of Type 2, 17 and immunoregulatory cytokines in tuberculous lymphadenitis (TBL and latent tuberculosis (LTB have not been well studied.To identify cytokine responses associated with pulmonary tuberculosis (TB, TB lymphadenitits and latent TB, we examined mycobacterial antigen-specific immune responses of PTB, TBL and LTB individuals. More specifically, we examined ESAT-6 and CFP-10 induced Type 1, Type 2 and Type 17 cytokine production and their regulation using multiplex ELISA.PTB individuals exhibited a significantly lower baseline as well as antigen-specific production of Type 1 (IFNγ, TNFα and IL-2; Type 2 (IL-4 and Type 17 (IL-17A and IL-17F cytokines in comparison to both TBL and LTB individuals. TBL individuals exhibited significantly lower antigen-specific IFNγ responses alone in comparison to LTB individuals. Although, IL-10 levels were not significantly higher, neutralization of IL-10 during antigen stimulation resulted in significantly enhanced production of IFNγ, IL-4 and IL-17A in PTB individuals, indicating that IL-10 mediates (at least partially the suppression of cytokine responses in PTB.Pulmonary TB is characterized by an IL-10 dependent antigen-specific suppression of Type 1, Type 2 and Type 17 cytokines, reflecting an important association of these cytokines in the pathogenesis of active TB.
Hand functions in type 1 and type 2 diabetes mellitus
Directory of Open Access Journals (Sweden)
Akpinar Pinar
2017-01-01
Full Text Available Introduction/Objective. Hand functions have an enormous impact on activities of daily living in patients with diabetes mellitus (DM, such as self-care, administering insulin injections, and preparing and eating meals. The aim of the study was to evaluate hand functions and grip strength in patients with type 1 and type 2 DM. Methods. This was an observational case-control study investigating the hand functions and grip strength in patients with type 1 and type 2 DM. The study comprised 41 patients with type 1 DM aged 25–50 years sex- and age-matched, 40 non-diabetic controls, and 91 patients with type 2 DM aged 40–65 years sex- and age-matched 60 non-diabetic controls. Patients with documented history of diabetic sensorimotor neuropathy and adhesive capsulitis were excluded. The Duruoz Hand Index was used to assess the functional hand disability. Grip strength was tested with a calibrated Jamar dynamometer. Results. The Duruoz Hand Index scores in patients with type 2 DM were significantly higher than in persons in the control group (p 0.05. Grip strength values of patients with type 1 DM were significantly lower compared to those in the control group (p < 0.05, whereas there was no significant difference between patients with type 2 DM and their control group. There was a negatively significant correlation between grip strength and the Duruoz Hand Index scores in patients with both type 1 and type 2 DM (p < 0.05. Conclusion. Patients with type 1 DM and type 2 DM have different degrees of hand disability as compared to healthy control groups.
International Nuclear Information System (INIS)
Lee, Yoonhee; Cho, Nam Zin
2015-01-01
Highlights: • Fully ceramic microencapsulated fuel-loaded core is analyzed via a two-temperature homogenized thermal-conductivity model. • The model is compared to harmonic- and volumetric-average thermal conductivity models. • The three thermal analysis models show ∼100 pcm differences in the k eff eigenvalue. • The three thermal analysis models show more than 70 K differences in the maximum temperature. • There occur more than 3 times differences in the maximum power for a control rod ejection accident. - Abstract: Fully ceramic microencapsulated (FCM) fuel, a type of accident-tolerant fuel (ATF), consists of TRISO particles randomly dispersed in a SiC matrix. In this study, for a thermal analysis of the FCM fuel with such a high heterogeneity, a two-temperature homogenized thermal-conductivity model was applied by the authors. This model provides separate temperatures for the fuel-kernels and the SiC matrix. It also provides more realistic temperature profiles than those of harmonic- and volumetric-average thermal conductivity models, which are used for thermal analysis of a fuel element in VHTRs having a composition similar to the FCM fuel, because such models are unable to provide the fuel-kernel and graphite matrix temperatures separately. In this study, coupled with a neutron diffusion model, a FCM fuel-loaded reactor core is analyzed via a two-temperature homogenized thermal-conductivity model at steady- and transient-states. The results are compared to those from harmonic- and volumetric-average thermal conductivity models, i.e., we compare k eff eigenvalues, power distributions, and temperature profiles in the hottest single-channel at steady-state. At transient-state, we compare total powers, reactivity, and maximum temperatures in the hottest single-channel obtained by the different thermal analysis models. The different thermal analysis models and the availability of fuel-kernel temperatures in the two-temperature homogenized thermal
International Nuclear Information System (INIS)
Ofek, E. O.; Gal-Yam, A.; Yaron, O.; Arcavi, I.; Fox, D.; Cenko, S. B.; Filippenko, A. V.; Bloom, J. S.; Sullivan, M.; Gnat, O.; Frail, D. A.; Horesh, A.; Kulkarni, S. R.; Corsi, A.; Quimby, R. M.; Gehrels, N.; Nugent, P. E.; Kasliwal, M. M.; Bildsten, L.; Poznanski, D.
2013-01-01
The optical light curve of some supernovae (SNe) may be powered by the outward diffusion of the energy deposited by the explosion shock (the so-called shock breakout) in optically thick (τ ∼> 30) circumstellar matter (CSM). Recently, it was shown that the radiation-mediated and radiation-dominated shock in an optically thick wind must transform into a collisionless shock and can produce hard X-rays. The X-rays are expected to peak at late times, relative to maximum visible light. Here we report on a search, using Swift/XRT and Chandra, for X-ray emission from 28 SNe that belong to classes whose progenitors are suspected to be embedded in dense CSM. Our sample includes 19 Type IIn SNe, one Type Ibn SN, and eight hydrogen-poor superluminous SNe (SLSN-I such as SN 2005ap). Two SNe (SN 2006jc and SN 2010jl) have X-ray properties that are roughly consistent with the expectation for X-rays from a collisionless shock in optically thick CSM. However, the X-ray emission from SN 2006jc can also be explained as originating in an optically thin region. Thus, we propose that the optical light curve of SN 2010jl is powered by shock breakout in CSM. We suggest that two other events (SN 2010al and SN 2011ht) were too X-ray bright during the SN maximum optical light to be explained by the shock-breakout model. We conclude that the light curves of some, but not all, SNe IIn/Ibn are powered by shock breakout in CSM. For the rest of the SNe in our sample, including all of the SLSN-I events, our X-ray limits are not deep enough and were typically obtained too early (i.e., near the SN maximum light) for definitive conclusions about their nature. Late-time X-ray observations are required in order to further test whether these SNe are indeed embedded in dense CSM. We review the conditions required for a shock breakout in a wind profile. We argue that the timescale, relative to maximum light, for the SN to peak in X-rays is a probe of the column density and the density profile above the
Phage typing or CRISPR typing for epidemiological surveillance of Salmonella Typhimurium?
Mohammed, Manal
2017-11-07
Salmonella Typhimurium is the most dominant Salmonella serovar around the world. It is associated with foodborne gastroenteritis outbreaks but has recently been associated with invasive illness and deaths. Characterization of S. Typhimurium is therefore very crucial for epidemiological surveillance. Phage typing has been used for decades for subtyping of S. Typhimurium to determine the epidemiological relation among isolates. Recent studies however have suggested that high throughput clustered regular interspaced short palindromic repeats (CRISPR) typing has the potential to replace phage typing. This study aimed to determine the efficacy of high-throughput CRISPR typing over conventional phage typing in epidemiological surveillance and outbreak investigation of S. Typhimurium. In silico analysis of whole genome sequences (WGS) of well-documented phage types of S. Typhimurium reveals the presence of different CRISPR type among strains belong to the same phage type. Furthermore, different phage types of S. Typhimurium share identical CRISPR type. Interestingly, identical spacers were detected among outbreak and non-outbreak associated DT8 strains of S. Typhimurium. Therefore, CRISPR typing is not useful for the epidemiological surveillance and outbreak investigation of S. Typhimurium and phage typing, until it is replaced by WGS, is still the gold standard method for epidemiological surveillance of S. Typhimurium.
Solar Type II Radio Bursts and IP Type II Events
Cane, H. V.; Erickson, W. C.
2005-01-01
We have examined radio data from the WAVES experiment on the Wind spacecraft in conjunction with ground-based data in order to investigate the relationship between the shocks responsible for metric type II radio bursts and the shocks in front of coronal mass ejections (CMEs). The bow shocks of fast, large CMEs are strong interplanetary (IP) shocks, and the associated radio emissions often consist of single broad bands starting below approx. 4 MHz; such emissions were previously called IP type II events. In contrast, metric type II bursts are usually narrowbanded and display two harmonically related bands. In addition to displaying complete dynamic spectra for a number of events, we also analyze the 135 WAVES 1 - 14 MHz slow-drift time periods in 2001-2003. We find that most of the periods contain multiple phenomena, which we divide into three groups: metric type II extensions, IP type II events, and blobs and bands. About half of the WAVES listings include probable extensions of metric type II radio bursts, but in more than half of these events, there were also other slow-drift features. In the 3 yr study period, there were 31 IP type II events; these were associated with the very fastest CMEs. The most common form of activity in the WAVES events, blobs and bands in the frequency range between 1 and 8 MHz, fall below an envelope consistent with the early signatures of an IP type II event. However, most of this activity lasts only a few tens of minutes, whereas IP type II events last for many hours. In this study we find many examples in the radio data of two shock-like phenomena with different characteristics that occur simultaneously in the metric and decametric/hectometric bands, and no clear example of a metric type II burst that extends continuously down in frequency to become an IP type II event. The simplest interpretation is that metric type II bursts, unlike IP type II events, are not caused by shocks driven in front of CMEs.
Tension Type Headache: Evaluation of Chronic Type
Directory of Open Access Journals (Sweden)
Ömer Karadaş
2013-11-01
Full Text Available Tension type headache(TTH which is a primary headache has episodic and chronic forms. Episodic TTH (ETTH can also be frequent-type and non-frequent-type. According to population-based studies, annual prevalence rates are 38.3% for ETTH and 2.2% for chronic TTH (CTTH. Patients can shift between the sub-groups of TTH. In particular, patients with ETTH are at risk of developing CTTH. Peripheral and central nociceptive mechanism are thought to be responsible in occurrence of TTH. Psychiatric disorders are frequently associated with TTH. Although basic and combined analgesics are used in acute treatment and antidepresants are used in prophylaxis, new treatment modalities are needed.
Differing causes of pregnancy loss in type 1 and type 2 diabetes.
Cundy, Tim; Gamble, Greg; Neale, Leonie; Elder, Rose; McPherson, Paul; Henley, Patrick; Rowan, Janet
2007-10-01
Women with type 2 and type 1 diabetes have differing risk factors for pregnancy loss. We compared the rates and causes of pregnancy loss in women with type 1 and type 2 diabetes. We utilized prospectively collected data on all pregnancies in a 20-year period (1986-2005) from a single center with a high prevalence of type 2 diabetes. Pregnancy losses included terminations for medical reasons and deaths up to 1 month postpartum but not spontaneous pregnancy losses pregnancies in women with known diabetes (330 with type 1 and 540 with type 2 diabetes) and 325 in women with diabetes diagnosed in pregnancy but persisting postpartum (97% type 2 diabetes). The rate of pregnancy loss was similar in type 1 and type 2 diabetes (2.6 vs. 3.7%, P = 0.39), but the causes of pregnancy loss differed. In type 1 diabetes >75% were attributable to major congenital anomalies or prematurity; in type 2 diabetes >75% were attributable to stillbirth or chorioamnionitis (P = 0.017). Women with type 2 and type 1 diabetes had similar A1C at presentation and near term, but the former were older (P causes of pregnancy loss in women with type 1 and type 2 diabetes. The higher rates of stillbirth in women with type 2 diabetes, suggest that other features, such as obesity, contribute significantly to pregnancy losses.
Innate-Type and Acquired-Type Allergy Regulated by IL-33
Directory of Open Access Journals (Sweden)
Tomohiro Yoshimoto
2014-01-01
Full Text Available We propose two types of allergic response: IgE-dependent and IgE-independent, and designate these as 'acquired-type allergy' and 'innate-type allergy', respectively. IL-33 stimulates both innate (basophils, mast cells, or group 2 innate lymphoid cells and acquired (Th2 cells allergy-related cells to induce and/or augment Th2 cytokine production, which leads to eosinophilic inflammation in vivo. Thus, IL-33 is an essential regulator for both 'innate-type allergy' and 'acquired-type allergy', and might be an attractive therapeutic target for allergic diseases.
Anne Maryani
2006-01-01
Computer-mediated-communication (CMC) probably has become the hottest buzzword in the field of media communication nowadays. CMC has laid the basics of hypersonal communication which interrelating agents and subjects of communication process by virtual communication. Internet Relay Chat, as one of CMC product widely used by public, characterizes hypersonal communication which involved sender-receiver interactions, the channel, and the feedback in a new transmitting mode. Emoticon, digital-bas...
Maryani, Anne
2006-01-01
Computer-mediated-communication (CMC) probably has become the hottest buzzword in the field of media communication nowadays. CMC has laid the basics of hypersonal communication which interrelating agents and subjects of communication process by virtual communication. Internet Relay Chat, as one of CMC product widely used by public, characterizes hypersonal communication which involved sender-receiver interactions, the channel, and the feedback in a new transmitting mode. Emoticon, digital-bas...
Everson,Kathryn; Olson,Link
2018-01-01
Madagascar is one of the world’s hottest biodiversity hotspots and a natural laboratory for evolutionary research. Tenrecs (Tenrecidae; 32 currently recognized species) – small placental mammals endemic to Madagascar – colonized the island >35 million years ago and have evolved a stunning range of behaviors and morphologies, including heterothermic species; species with hedgehog-like spines; and fossorial, aquatic, and scansorial ecotypes. In 2016, we produced the first taxonomically complete...
Everson, Kathryn; Olson, Link
2018-01-01
Madagascar is one of the world's hottest biodiversity hotspots and a natural laboratory for evolutionary research. Tenrecs (Tenrecidae; 32 currently recognized species) – small placental mammals endemic to Madagascar – colonized the island >35 million years ago and have evolved a stunning range of behaviors and morphologies, including heterothermic species; species with hedgehog-like spines; and fossorial, aquatic, and scansorial ecotypes. In 2016, we produced the first taxonomically complete...
More Than Just Monkey Business: What the Primate Microbiome Might Say About the Human One.
Berglund, Jennifer
2016-01-01
The science of the microbiome is arguably one of the hottest topics in medicine, and rightfully so. A deeper understanding of the ecology of the flora in our bodies is providing revolutionary insight beyond the simple form and function of our major parts. This new frontier is dauntingly complex, and most studies focus on details, failing to place these microbial ecosystems within the larger context of evolutionary time and environment.
Pursuing for the case of safety
Energy Technology Data Exchange (ETDEWEB)
Hansen, H; Salaber, A [Geco-Prakla, Paris (France); Myers, S [Sedco Forex, Montrouge (France); Redd, E [Sedco Forex, Aberdeen (United Kingdom); Shannon, R [Anadrill HSE, London (United Kingdom)
1993-01-01
Ever since the Piper Alpha disaster, safety has become one of the industry's hottest issues. Attention to safety leads to improved communication within organizations as well as between operators and contractors, and ultimately to more efficient operations. In this article descriptions are given of safety management systems, the safety-case philosophy and legislative changes hat are helping promote these new safety tools. 6 figs., 4 ills., 3 refs.
Security For Wireless Sensor Network
Saurabh Singh,; Dr. Harsh Kumar Verma
2011-01-01
Wireless sensor network is highly vulnerable to attacks because it consists of various resourceconstrained devices with their low battery power, less memory, and associated low energy. Sensor nodescommunicate among themselves via wireless links. However, there are still a lot of unresolved issues in wireless sensor networks of which security is one of the hottest research issues. Sensor networks aredeployed in hostile environments. Environmental conditions along with resource-constraints give...
Francia B. Avila; Siyan Dong; Kaah P. Menang; Jan Rajczak; Madeleine Renom; Markus G. Donat; Lisa V. Alexander
2015-01-01
Using daily station observations over the period 1951–2013 in a region of south-east Australia, we systematically compare how the horizontal resolution, interpolation method and order of operation in generating gridded data sets affect estimates of annual extreme indices of temperature and precipitation maxima (hottest and wettest days). Three interpolation methods (natural neighbors, cubic spline and angular distance weighting) are used to calculate grids at five different horizontal gridded...
Pursuing for the case of safety
Energy Technology Data Exchange (ETDEWEB)
Hansen, H.; Salaber, A. (Geco-Prakla, Paris (France)); Myers, S. (Sedco Forex, Montrouge (France)); Redd, E. (Sedco Forex, Aberdeen (United Kingdom)); Shannon, R. (Anadrill HSE, London (United Kingdom))
1993-01-01
Ever since the Piper Alpha disaster, safety has become one of the industry's hottest issues. Attention to safety leads to improved communication within organizations as well as between operators and contractors, and ultimately to more efficient operations. In this article descriptions are given of safety management systems, the safety-case philosophy and legislative changes hat are helping promote these new safety tools. 6 figs., 4 ills., 3 refs.
Software engineering a practitioner's approach
Pressman, Roger S
1997-01-01
This indispensable guide to software engineering exploration enables practitioners to navigate the ins and outs of this rapidly changing field. Pressman's fully revised and updated Fourth Edition provides in-depth coverage of every important management and technical topic in software engineering. Moreover, readers will find the inclusion of the hottest developments in the field such as: formal methods and cleanroom software engineering, business process reengineering, and software reengineering.
Modeling and Evaluating the Environmental Degradation of UHTCs under Hypersonic Flow (Preprint)
2014-02-01
catalytic recombination at the material’s surface. In addition, under realistic conditions, resistance to acoustic and mechanical vibrations and thermal...of the sample which is measured using an optical pyrometer . The key advantage of this method is that it provides a simulation of dissociation of...torch tip. The calibration is usually made based on the measured optical pyrometer reading on the hottest section of the exposed sample. The heat
International Nuclear Information System (INIS)
Prieto, J. L.; Knapp, G. R.; Rest, A.; Walborn, N. R.; Bianco, F. B.; Matheson, T.; Smith, N.; Hsiao, E. Y.; Campillay, A.; Contreras, C.; González, C.; Morrell, N.; Phillips, M. M.; Chornock, R.; Paredes Álvarez, L.; James, D.; Smith, R. C.; Kunder, A.; Margheim, S.; Welch, D. L.
2014-01-01
We present follow-up optical imaging and spectroscopy of one of the light echoes of η Carinae's nineteenth century Great Eruption discovered by Rest et al. By obtaining images and spectra at the same light echo position between 2011 and 2014, we follow the evolution of the Great Eruption on a 3 yr timescale. We find remarkable changes in the photometric and spectroscopic evolution of the echo light. The i-band light curve shows a decline of ∼0.9 mag in ∼1 yr after the peak observed in early 2011 and a flattening at later times. The spectra show a pure-absorption early G-type stellar spectrum at peak, but a few months after peak the lines of the Ca II triplet develop strong P-Cygni profiles and we see the appearance of [Ca II] 7291, 7324 doublet in emission. These emission features and their evolution in time resemble those observed in the spectra of some Type IIn supernovae and supernova impostors. Most surprisingly, starting ∼300 days after peak brightness, the spectra show strong molecular transitions of CN at ≳ 6800 Å. The appearance of these CN features can be explained if the ejecta are strongly nitrogen enhanced, as is observed in modern spectroscopic studies of the bipolar Homunculus nebula. Given the spectroscopic evolution of the light echo, velocities of the main features, and detection of strong CN, we are likely seeing ejecta that contributes directly to the Homunculus nebula
Type 1 or Type 2 Diabetes and Pregnancy
... and Pregnancy Articles Type 1 or Type 2 Diabetes and Pregnancy Language: English (US) Español (Spanish) Recommend on Facebook Tweet Share Compartir Problems of Diabetes in Pregnancy Blood sugar that is not well ...
Discriminating the reaction types of plant type III polyketide synthases.
Shimizu, Yugo; Ogata, Hiroyuki; Goto, Susumu
2017-07-01
Functional prediction of paralogs is challenging in bioinformatics because of rapid functional diversification after gene duplication events combined with parallel acquisitions of similar functions by different paralogs. Plant type III polyketide synthases (PKSs), producing various secondary metabolites, represent a paralogous family that has undergone gene duplication and functional alteration. Currently, there is no computational method available for the functional prediction of type III PKSs. We developed a plant type III PKS reaction predictor, pPAP, based on the recently proposed classification of type III PKSs. pPAP combines two kinds of similarity measures: one calculated by profile hidden Markov models (pHMMs) built from functionally and structurally important partial sequence regions, and the other based on mutual information between residue positions. pPAP targets PKSs acting on ring-type starter substrates, and classifies their functions into four reaction types. The pHMM approach discriminated two reaction types with high accuracy (97.5%, 39/40), but its accuracy decreased when discriminating three reaction types (87.8%, 43/49). When combined with a correlation-based approach, all 49 PKSs were correctly discriminated, and pPAP was still highly accurate (91.4%, 64/70) even after adding other reaction types. These results suggest pPAP, which is based on linear discriminant analyses of similarity measures, is effective for plant type III PKS function prediction. pPAP is freely available at ftp://ftp.genome.jp/pub/tools/ppap/. goto@kuicr.kyoto-u.ac.jp. Supplementary data are available at Bioinformatics online. © The Author(s) 2017. Published by Oxford University Press.
International Nuclear Information System (INIS)
Jeong, Hyunseok; Nguyen Ba An
2006-01-01
We study Greenberger-Horne-Zeilinger-type (GHZ-type) and W-type three-mode entangled coherent states. Both types of entangled coherent states violate Mermin's version of the Bell inequality with threshold photon detection (i.e., without photon counting). Such an experiment can be performed using linear optics elements and threshold detectors with significant Bell violations for GHZ-type entangled coherent states. However, to demonstrate Bell-type inequality violations for W-type entangled coherent states, additional nonlinear interactions are needed. We also propose an optical scheme to generate W-type entangled coherent states in free-traveling optical fields. The required resources for the generation are a single-photon source, a coherent state source, beam splitters, phase shifters, photodetectors, and Kerr nonlinearities. Our scheme does not necessarily require strong Kerr nonlinear interactions; i.e., weak nonlinearities can be used for the generation of the W-type entangled coherent states. Furthermore, it is also robust against inefficiencies of the single-photon source and the photon detectors
2015-01-01
There are many types of intersections in the Netherlands. In an inherently safe road traffic system, however, the number of intersection types needs to be limited, depending on the road types that intersect. The desired types of intersections do not always correspond with the recommendations in the
Manca, V.; Salibra, A.; Scollo, Giuseppe
1990-01-01
Equational type logic is an extension of (conditional) equational logic, that enables one to deal in a single, unified framework with diverse phenomena such as partiality, type polymorphism and dependent types. In this logic, terms may denote types as well as elements, and atomic formulae are either
Energy Technology Data Exchange (ETDEWEB)
Saitoh, Hiroshi (Tokushima Univ. (Japan). School of Medicine)
1991-07-01
CT scans of muscles in patients with limb girdle type (LG), myotonic type (MYD) and Duchenne type (DMD) dystrophies were obtained at five different body levels: the neck, L3 vertebral body, pelvic girdle, thigh and lower leg. CT numbers, cross sectional areas (CSA) and %CSA of muscle or fat were evaluated in each muscle. The characteristic CT patterns for each type of muscular dystrophy were obtained. Compared with DMD, the gracilis and soleus were more severely damaged in LG and the biceps femoris remained relatively preserved among the hamstrings. In addition, the multifidus of the neck and sternocleidomastoid also were more severely damaged in MYD. This study suggests that CT scan will be useful in the differential diagnosis of these types of muscular dystrophy as well as in planning appropriate rehabilitation and detecting damaged muscles. (author).
Thinking about gender types: cognitive organization of female and male types.
Vonk, Roos; Ashmore, Richard D
2003-06-01
We examined the content and dimensional structure of a large and representative sample of gender types. In Study 1, using an open-ended procedure, participants generated 306 different labels for female types (e.g. housewife, feminist, femme fatale, secretary, slob) and 310 for male types (e.g. workaholic, family man, sissy, womanizer, labourer). In Study 2A, a multidimensional configuration of 229 of these male and female types was derived from a free sorting task among a new set of participants. In Study 2B, a subset of types was judged on several dimensions of meaning, which were then fitted into the configuration of types. The most important dimensions in describing the structure of gender types were: young-old, masculine-feminine and traditional-modern. The masculine-feminine dimension showed that the male and female types were largely separated from each other; within each gender category, the types were ordered by their position on the masculine-feminine dimension. Several other aspects of current thinking about men and women are discussed.
DEFF Research Database (Denmark)
Birkedal, Lars; Bizjak, Aleš; Clouston, Ranald
2016-01-01
This paper improves the treatment of equality in guarded dependent type theory (GDTT), by combining it with cubical type theory (CTT). GDTT is an extensional type theory with guarded recursive types, which are useful for building models of program logics, and for programming and reasoning...... with coinductive types. We wish to implement GDTT with decidable type-checking, while still supporting non-trivial equality proofs that reason about the extensions of guarded recursive constructions. CTT is a variation of Martin-L\\"of type theory in which the identity type is replaced by abstract paths between...... terms. CTT provides a computational interpretation of functional extensionality, is conjectured to have decidable type checking, and has an implemented type-checker. Our new type theory, called guarded cubical type theory, provides a computational interpretation of extensionality for guarded recursive...
DEFF Research Database (Denmark)
Birkedal, Lars; Bizjak, Aleš; Clouston, Ranald
2016-01-01
This paper improves the treatment of equality in guarded dependent type theory (GDTT), by combining it with cubical type theory (CTT). GDTT is an extensional type theory with guarded recursive types, which are useful for building models of program logics, and for programming and reasoning...... with coinductive types. We wish to implement GDTT with decidable type checking, while still supporting non-trivial equality proofs that reason about the extensions of guarded recursive constructions. CTT is a variation of Martin-L\\"of type theory in which the identity type is replaced by abstract paths between...... terms. CTT provides a computational interpretation of functional extensionality, enjoys canonicity for the natural numbers type, and is conjectured to support decidable type-checking. Our new type theory, guarded cubical type theory (GCTT), provides a computational interpretation of extensionality...
Vogel, Martha Marie; Orth, René; Cheruy, Frederique; Hagemann, Stefan; Lorenz, Ruth; van den Hurk, Bart; Seneviratne, Sonia Isabelle
2017-04-01
Regional hot extremes are projected to increase more strongly than global mean temperature, with substantially larger changes than 2°C even if global warming is limited to this level. We investigate here the role of soil moisture-temperature feedbacks for this response based on multi-model experiments for the 21st century with either interactive or fixed (late 20th century mean seasonal cycle) soil moisture. We analyze changes in the hottest days in each year in both sets of experiments, relate them to the global mean temperature increase, and investigate physical processes leading to these changes. We find that soil moisture-temperature feedbacks significantly contribute to the amplified warming of hottest days compared to that of global mean temperature. This contribution reaches more than 70% in Central Europe and Central North America and between 42%-52% in Amazonia, Northern Australia and Southern Africa. Soil moisture trends (multi-decadal soil moisture variability) are more important for this response than short-term (e.g. seasonal, interannual) soil moisture variability. These results are relevant for reducing uncertainties in regional temperature projections. Vogel, M.M. et al.,2017. Regional amplification of projected changes in extreme temperatures strongly controlled by soil moisture-temperature feedbacks. Geophysical Research Letters, accepted.
International Nuclear Information System (INIS)
Bae, In Ho; Na, Man Gyun; Lee, Yoon Joon; Park, Goon Cherl
2009-01-01
Knowing more about the Local Power Density (LPD) at the hottest part of a nuclear reactor core can provide more important information than knowledge of the LPD at any other position. The LPD at the hottest part needs to be estimated accurately in order to prevent the fuel rod from melting in a nuclear reactor. Support Vector Machines (SVMs) have successfully been applied in classification and regression problems. Therefore, in this paper, the power peaking factor, which is defined as the highest LPD to the average power density in a reactor core, was estimated by SVMs which use numerous measured signals of the reactor coolant system. The SVM models were developed by using a training data set and validated by an independent test data set. The SVM models' uncertainty was analyzed by using 100 sampled training data sets and verification data sets. The prediction intervals were very small, which means that the predicted values were very accurate. The predicted values were then applied to the first fuel cycle of the Yonggwang Nuclear Power Plant Unit 3. The root mean squared error was approximately 0.15%, which is accurate enough for use in LPD monitoring and for core protection that uses LPD estimation
Improved grazing activity of dairy heifers in shaded tropical grasslands
Directory of Open Access Journals (Sweden)
Andréia Cristina Tavares de Mello
Full Text Available ABSTRACT: Trees in the production systems can effectively reduce hot weather-induced stress in the Brazilian Midwest. High temperatures cause changes in animals daily routine, and trees into pastures can promote benefits. The aim of this research was to evaluate the behavior of dairy heifers in silvopastoral systems in the state of Mato Grosso, Brazil. A herd of 24 crossbreed heifers (3/4 and 7/8 Holstein/Zebu, 350kg average weight, was evaluated over three seasons. Piatã grass was managed under three shade levels: full-sun, moderate-shade, and intensive-shade provided by 10 to 12m high Eucalyptus trees. Behavior data were collected every 15 minutes from 8:30h to 16h. Shade availability significantly impacted heifer behavior, mainly affecting grazing frequency and time during the hottest hours. Grazing behavior was affected by shade levels during the different seasons. Heifers showed preferred grazing times. Heifers in the intensive-shade system visited shady areas during the hottest hours throughout the seasons. Heifers in the full sun-system avoided grazing during the warmer times, ceasing feeding activities. Our results from the Brazilian Midwest showed that shade availability causes breed heifers to change their daily routine.
Mapping of Aspergillus Section Nigri in Southern Europe and Israel based on geostatistical analysis.
Battilani, P; Barbano, C; Marin, S; Sanchis, V; Kozakiewicz, Z; Magan, N
2006-09-01
Geostatistical analysis was applied to the incidence of Aspergillus Section Nigri and A. carbonarius in Southern Europe and Israel for the 3-year period 2001-2003 to facilitate identification of regions of high risk from contamination with these fungi and production of ochratoxin. The highest incidence of black aspergilli was normally observed at harvesting. At this grape growth stage, spatial variability of black aspergilli was significantly related to latitude and longitude, showing a positive West-East and North-South gradient. Predictive maps of infected berries incidence were drawn and showed the same trend in the 3 years, but incidence was highest in 2003, followed by 2001 and 2002. The highest incidence was always observed in Israel, Greece and Southern France, associated with the highest incidence of A. carbonarius. Southern Spain and Southern Italy also had relevant incidence of black aspergilli. The thermo-wetness maps for the 3 years showed a trend similar to the incidence of black aspergilli. The coldest and wettest year was 2002, while 2003 was the hottest and driest, particularly during August, with Israel being the hottest and driest country, followed by Greece and Southern Italy. This indicates that meteorological conditions can contribute to explain spatial distribution variation of black aspergilli within the Mediterranean basin.
International Nuclear Information System (INIS)
Lee, Yoon Hee; Cho, Bum Hee; Cho, Nam Zin
2016-01-01
In Part I of this paper, the two-temperature homogenized model for the fully ceramic microencapsulated fuel, in which tristructural isotropic particles are randomly dispersed in a fine lattice stochastic structure, was discussed. In this model, the fuel-kernel and silicon carbide matrix temperatures are distinguished. Moreover, the obtained temperature profiles are more realistic than those obtained using other models. Using the temperature-dependent thermal conductivities of uranium nitride and the silicon carbide matrix, temperature-dependent homogenized parameters were obtained. In Part II of the paper, coupled with the COREDAX code, a reactor core loaded by fully ceramic microencapsulated fuel in which tristructural isotropic particles are randomly dispersed in the fine lattice stochastic structure is analyzed via a two-temperature homogenized model at steady and transient states. The results are compared with those from harmonic- and volumetric-average thermal conductivity models; i.e., we compare keff eigenvalues, power distributions, and temperature profiles in the hottest single channel at a steady state. At transient states, we compare total power, average energy deposition, and maximum temperatures in the hottest single channel obtained by the different thermal analysis models. The different thermal analysis models and the availability of fuel-kernel temperatures in the two-temperature homogenized model for Doppler temperature feedback lead to significant differences
A Type System For Certified Runtime Type Analysis
2002-12-01
1999 ACM SIGPLAN International Conf. on Functional Pro- gramming (ICFP’99), pages 183–196. ACM Press, September 1999. [Min97] Yasuhiko Minamide. Full...lifting of type parameters. Technical report, RIMS, Kyoto University, 1997. [MMH96] Yasuhiko Minamide, Greg Morrisett, and Robert Harper. Typed
DEFF Research Database (Denmark)
Winther, Johnni
2011-01-01
conditional using the instanceof operator and thus the cast type is redundantly mentioned twice. We propose a new typing rule for Java called Guarded Type Promotion aimed at eliminating the need for the explicit casts when guarded. This new typing rule is backward compatible and has been fully implemented...... in a Java 6 compiler. Through our extensive testing of real-life code we show that guarded casts account for approximately one fourth of all casts and that Guarded Type Promotion can eliminate the need for 95 percent of these guarded casts....
Full Text Available ... Alert Day Diabetes Basics Home Symptoms Diagnosis America's Diabetes Challenge Type 1 Type 2 Facts About Type 2 Enroll in ... Where Do I Begin With Type2? Living With Type 1 Diabetes Enroll in the Living WIth Type 2 Diabetes ...
Energy Technology Data Exchange (ETDEWEB)
Joh, Seung Hun; Dellink, Rob; Nam, Yunmi; Kim, Yong Gun; Song, Yang Hoon [Korea Environment Institute, Seoul (Korea)
2000-12-01
In the beginning of the 21st century, climate change is one of hottest issues in arena of both international environment and domestic one. During the COP6 meeting held in The Hague, over 10,000 people got together from the world. This report is a series of policy study on climate change in context of Korea. This study addresses on interactions of economy and environment in a perfect foresight dynamic computable general equilibrium with a focus on greenhouse gas mitigation strategy in Korea. The primary goal of this study is to evaluate greenhouse gas mitigation portfolios of changes in timing and magnitude with a particular focus on developing a methodology to integrate the bottom-up information on technical measures to reduce pollution into a top-down multi-sectoral computable general equilibrium framework. As a non-Annex I country Korea has been under strong pressure to declare GHG reduction commitment. Of particular concern is economic consequences GHG mitigation would accrue to the society. Various economic assessment have been carried out to address on the issue including analyses on cost, ancillary benefit, emission trading, so far. In this vein, this study on GHG mitigation commitment is a timely answer to climate change policy field. Empirical results available next year would be highly demanded in the situation. 62 refs., 13 figs., 9 tabs.
Reform and Research: Re-connecting Prison and Society in the 21st Century
Directory of Open Access Journals (Sweden)
Peter Scharff Smith
2015-04-01
Full Text Available IIn this contribution I briefly outline some of the historical and current trends in prison research and question how a prison researcher can work towards influencing policy and practice. I discuss the current role of ‘what works’ research and the way it is sometimes utilized in a time of penal populism and rising prison populations. I argue in favour of a broader approach which recognizes the wider societal effects of imprisonment and I provide a concrete example of how one can attempt to plan research and project work in order to facilitate progression from research and knowledge production to action and implementation. Finally I discuss some of the scientific and ethical implications which can arise when working with reform and implementation projects.
Alpha List of Prime Contract Awards. Oct 91 - Sep 92. FY 92. (Johnson Regina A - Mac-Bestos Inc).
1993-01-01
00 C) m zaw Z 0 2 4 NM4 I CcON C4 N1 -I 4N1-" 0 j 0 (j 0 0 00 1--- 0 1-1 I-IN " -I 1-I1 - CC 0 z I MOON " I (A 0)- eve0)0 0 0 0 10 Il-0 < 0) 1-- ft 1...Cw DU LU0 -11 -4 1 M0) --4 440 0L o-4 W m 0 . U) 0 OC 1-4 1 M0o0-4 It 0 0 00 CO rl) 00 (ND 00 0- it a I Ot0-o4 it W O tUN Col o0 M0 100 XL%) m-4
A Theoretical Framework Mapping Barriers of Integrating and Adopting Educational Techonology
DEFF Research Database (Denmark)
Khalid, Md. Saifuddin; Buus, Lillian
2018-01-01
In the field of educational technology, a decades-long research question is: what barriers exist in integration and adoption of information and communication technology (ICT) in education educational technology? The intensity of integration and the rate of adoption are significantly low and the i......In the field of educational technology, a decades-long research question is: what barriers exist in integration and adoption of information and communication technology (ICT) in education educational technology? The intensity of integration and the rate of adoption are significantly low......) adoption decision. Instead of “system blame” or “individual blame”, an integration and adoption approach should consider national holistic view for careful strategic changes in policies, procedures, and practices at each decision level of the educational system and related external systems....
A platform for local entrepreneurship
DEFF Research Database (Denmark)
Freire-Gibb, L. Carlos; Lorentzen, Anne
2011-01-01
This article discusses the birth and evolution of a festival that has targeted the entrepreneurial dynamics in the provincial city of Frederikshavn (North Denmark). The festival was initiated in 2004 to confront a local economic crisis and has enjoyed support from a broad range of stakeholders. I......-in. Empirically, the article is based on interviews with a wide range of actors across the organizing network. The article offers some preliminary lessons about what such an event can contribute to local entrepreneurship.......This article discusses the birth and evolution of a festival that has targeted the entrepreneurial dynamics in the provincial city of Frederikshavn (North Denmark). The festival was initiated in 2004 to confront a local economic crisis and has enjoyed support from a broad range of stakeholders...
Stellar mass estimation based on IRAC photometry for Spitzer SWIRE-field galaxies
International Nuclear Information System (INIS)
Zhu Yinan; Wu Hong; Li Haining; Cao Chen
2010-01-01
We analyze the feasibility of estimating the stellar mass of galaxies by mid-infrared luminosities based on a large sample of galaxies cross-identified from Spitzer SWIRE fields and the SDSS spectrographic survey. We derived the formulae to calculate the stellar mass by using IRAC 3.6 μm and 4.5 μm luminosities. The mass-to-luminosity ratios of IRAC 3.6 μm and 4.5 μm luminosities are more sensitive to the star formation history of galaxies than to other factors, such as the intrinsic extinction, metallicity and star formation rate. To remove the effect of star formation history, we used g - r color to recalibrate the formulae and obtain a better result. Researchers must be more careful when estimating the stellar mass of low metallicity galaxies using our formulae. Due to the emission from dust heated by the hottest young stars, luminous infrared galaxies present higher IRAC 4.5 μm luminosities compared to IRAC 3.6 μm luminosities. For most of type-II AGNs, the nuclear activity cannot enhance 3.6 μm and 4.5 μm luminosities compared with normal galaxies. Star formation in our AGN-hosting galaxies is also very weak, almost all of which are early-type galaxies.
... type 2 diabetes; Oral hypoglycemic - type 2 diabetes; High blood sugar - type 2 diabetes ... your kidneys are working well ( microalbuminuria and serum creatinine ). Visit your eye doctor at least once a ...
DEFF Research Database (Denmark)
Kristensen, Ditte Bech; Prats Gavalda, Clara; Larsen, Steen
2012-01-01
This study investigated fiber-type-specific muscle ceramide content in obese subjects and type 2 diabetes patients. Two substudies, one which compared type 2 diabetes patients to both lean- and obese BMI-matched subjects and the other study which compared lean body-matched post-obese, obese......, and control subjects, were performed. A fasting blood sample was obtained and plasma insulin and glucose determined. A muscle biopsy was obtained from deltoideus and vastus lateralis, and fiber-type ceramide content was determined by fluorescence immunohistochemistry. Insulin sensitivity estimated by Quicki...... index was higher in lean compared to type 2 diabetes patients and obese controls. Also in control and post-obese subjects, a higher insulin sensitivity was observed compared to obese subjects. Ceramide content was consistently higher in type I than in type II muscle fibers and higher in deltoideus than...
Hybrid type I-type II superconducting behavior in magnesium diboride
International Nuclear Information System (INIS)
Kunchur, M.N.; Saracila, G.; Arcos, D.A.; Cui, Y.; Pogrebnyakov, A.; Orgiani, P.; Xi, X.X.
2006-01-01
In traditional type-II superconductors, an applied magnetic field depresses the transition temperature and introduces magnetic flux vortices that cause resistive losses accompanied by a broadening of the transition. High-field high-pulsed-current measurements have revealed a new hybrid behavior in disordered magnesium diboride films: The superconductivity survives high magnetic fields by entering a mixed state with vortices (like a type II superconductor) but holds its vortices nearly motionless and avoids dissipation (like a type I superconductor). A study of this phenomenon in magnesium diboride films with varying degrees of scattering indicate that the hybrid type I-type II behavior arises from the two-band nature of the superconductivity and the different degrees of influence that disorder exerts on its different bands. (author)
... blood, safe blood transfusions depend on careful blood typing and cross-matching. There are four major blood ... cause exceptions to the above patterns. ABO blood typing is not sufficient to prove or disprove paternity ...
Engineering a Polyketide Synthase for <i>In Vitro Production of Adipic Acid
Energy Technology Data Exchange (ETDEWEB)
Hagen, A; Poust, S; De Rond, T; Fortman, JL; Katz, L; Petzold, CJ; Keasling, JD
2015-10-26
Polyketides have enormous structural diversity, yet polyketide synthases (PKSs) have thus far been engineered to produce only drug candidates or derivatives thereof. Thousands of other molecules, including commodity and specialty chemicals, could be synthesized using PKSs if composing hybrid PKSs from well-characterized parts derived from natural PKSs was more efficient. Here, using modern mass spectrometry techniques as an essential part of the design–build–test cycle, we engineered a chimeric PKS to enable production one of the most widely used commodity chemicals, adipic acid. To accomplish this, we introduced heterologous reductive domains from various PKS clusters into the borrelidin PKS’ first extension module, which we previously showed produces a 3-hydroxy-adipoyl intermediate when coincubated with the loading module and a succinyl-CoA starter unit. Acyl-ACP intermediate analysis revealed an unexpected bottleneck at the dehydration step, which was overcome by introduction of a carboxyacyl-processing dehydratase domain. Appending a thioesterase to the hybrid PKS enabled the production of free adipic acid. Using acyl-intermediate based techniques to “debug” PKSs as described here, it should one day be possible to engineer chimeric PKSs to produce a variety of existing commodity and specialty chemicals, as well as thousands of chemicals that are difficult to produce from petroleum feedstocks using traditional synthetic chemistry.
Strategy for <i>in vitro propagation of Stevia rebaudiana Bertoni
Diego Martínez Rivilla; Aura Urrea; Elio Jiménez; Lucia Atehortua
2016-01-01
In vitro multiplication of Stevia rebaudiana Bertoni has been described previously in different reference sources. However, the implication of the investigations carried out in the productive scale processes is not informed. The present work was carried out with the objective of establishing a strategy for the in vitro propagation of S. rebaudiana. Studies were carried out on planting, seedling multiplication as well as rooting. The effect of growth regulators at different concentrations was ...
Identification of type II and type III pyoverdine receptors from Pseudomonas aeruginosa.
de Chial, Magaly; Ghysels, Bart; Beatson, Scott A; Geoffroy, Valérie; Meyer, Jean Marie; Pattery, Theresa; Baysse, Christine; Chablain, Patrice; Parsons, Yasmin N; Winstanley, Craig; Cordwell, Stuart J; Cornelis, Pierre
2003-04-01
Pseudomonas aeruginosa produces, under conditions of iron limitation, a high-affinity siderophore, pyoverdine (PVD), which is recognized at the level of the outer membrane by a specific TonB-dependent receptor, FpvA. So far, for P. aeruginosa, three different PVDs, differing in their peptide chain, have been described (types I-III), but only the FpvA receptor for type I is known. Two PVD-producing P. aeruginosa strains, one type II and one type III, were mutagenized by a mini-TnphoA3 transposon. In each case, one mutant unable to grow in the presence of the strong iron chelator ethylenediaminedihydroxyphenylacetic acid (EDDHA) and the cognate PVD was selected. The first mutant, which had an insertion in the pvdE gene, upstream of fpvA, was unable to take up type II PVD and showed resistance to pyocin S3, which is known to use type II FpvA as receptor. The second mutant was unable to take up type III PVD and had the transposon insertion in fpvA. Cosmid libraries of the respective type II and type III PVD wild-type strains were constructed and screened for clones restoring the capacity to grow in the presence of PVD. From the respective complementing genomic fragments, type II and type III fpvA sequences were determined. When in trans, type II and type III fpvA restored PVD production, uptake, growth in the presence of EDDHA and, in the case of type II fpvA, pyocin S3 sensitivity. Complementation of fpvA mutants obtained by allelic exchange was achieved by the presence of cognate fpvA in trans. All three receptors posses an N-terminal extension of about 70 amino acids, similar to FecA of Escherichia coli, but only FpvAI has a TAT export sequence at its N-terminal end.
... Diabetes, Sexual, & Bladder Problems Clinical Trials What is Diabetes? Diabetes is a disease that occurs when your ... is serious. What are the different types of diabetes? The most common types of diabetes are type ...
Extending Dylan's type system for better type inference and error detection
DEFF Research Database (Denmark)
Mehnert, Hannes
2010-01-01
a dynamically typed language. Dylan poses several special challenges for gradual typing, such as multiple return values, variable-arity methods and generic functions (multiple dispatch). In this paper Dylan is extended with function types and parametric polymorphism. We implemented the type system...... and aunification-based type inference algorithm in the mainstream Dylan compiler. As case study we use the Dylan standard library (roughly 32000 lines of code), which witnesses that the implementation generates faster code with fewer errors. Some previously undiscovered errors in the Dylan library were revealed....
FEATURES ON ALLOTMENT OF BUDGETRY RESOURCES IN ROMANIAN COAL INDUSTRY
CORICI MARIAN CĂTĂLIN; LUCIAN-ION MEDAR
2014-01-01
In the market economy the efficient management of production costs becomes the hottest action direction of the organization due to the requirements and demands of socio-economic. The itinerary of the economic entity is required to some extent so the possibilities for financing current activity through access to working capital becoming more expensive, and the existence of an increasingly complex legal framework, focused on accountability factors decision in order to protect the environment. C...
1981 Hartwell Lake Water Quality Study.
1982-09-01
located approximately eight kilometers from stabions 2, 3, and 8. The highest and lowest temp- eratures were 101 and 11 farenheit (F) during the hottest...stations and months for ORP measurements are given in Figures B-21 through B-23. There was absolutely no pattern to the August values for both...all lake stations (excluding Station 9), but which was most pronounced in the cove where denisties dropped to zero , is unknown. Physical and chemical
Towards Blockchain-enabled Wireless Mesh Networks
Selimi, Mennan; Kabbinale, Aniruddh Rao; Ali, Anwaar; Navarro, Leandro; Sathiaseelan, Arjuna
2018-01-01
Recently, mesh networking and blockchain are two of the hottest technologies in the telecommunications industry. Combining both can reformulate internet access and make connecting to the Internet not only easy, but affordable too. Hyperledger Fabric (HLF) is a blockchain framework implementation and one of the Hyperledger projects hosted by The Linux Foundation. We evaluate HLF in a real production mesh network and in the laboratory, quantify its performance, bottlenecks and limitations of th...
Conception d'un dispositif de récupération d'énergie vibratoire large bande
Liu , Weiqun
2014-01-01
As scavenging the energy from the vibration sources has the wide adaptability and the easy feasibility of integration with other sources, it becomes one of the hottest topic in the energy harvesting field. Numerous works have been done to enhance the harvested power by optimizing the interface circuit and the mechanical structure. The variability of the environmental vibrations introduces a challenge to the conventional linear harvesters and calls for the development of wideband vibration gen...
White Dwarf Model Atmospheres: Synthetic Spectra for Super Soft Sources
Rauch, Thomas
2011-01-01
The T\\"ubingen NLTE Model-Atmosphere Package (TMAP) calculates fully metal-line blanketed white dwarf model atmospheres and spectral energy distributions (SEDs) at a high level of sophistication. Such SEDs are easily accessible via the German Astrophysical Virtual Observatory (GAVO) service TheoSSA. We discuss applications of TMAP models to (pre) white dwarfs during the hottest stages of their stellar evolution, e.g. in the parameter range of novae and super soft sources.
White Dwarf Model Atmospheres: Synthetic Spectra for Supersoft Sources
Rauch, Thomas
2013-01-01
The Tübingen NLTE Model-Atmosphere Package (TMAP) calculates fully metal-line blanketed white dwarf model atmospheres and spectral energy distributions (SEDs) at a high level of sophistication. Such SEDs are easily accessible via the German Astrophysical Virtual Observatory (GAVO) service TheoSSA. We discuss applications of TMAP models to (pre) white dwarfs during the hottest stages of their stellar evolution, e.g. in the parameter range of novae and supersoft sources.
Tissot Dupont, H; Raoult, D
1993-05-01
Due to their worldwide distribution, from hottest to coldest climates, and due to their behaviour, ticks are capable of transmitting numerous human and animal bacterial viral or parasitous diseases. Depending on the disease, they play the role of biological vector or intermediate host. In France, six tick borne diseases are of epidemiologic importance. Q fever (not often tick-borne), Mediterranean Spotted Fever, Lyme disease, Turalemia (human and animal), Babesiosis and Tick-borne Viral Encephalitis.
Database Reorganization in Parallel Disk Arrays with I/O Service Stealing
Zabback, Peter; Onyuksel, Ibrahim; Scheuermann, Peter; Weikum, Gerhard
1996-01-01
We present a model for data reorganization in parallel disk systems that is geared towards load balancing in an environment with periodic access patterns. Data reorganization is performed by disk cooling, i.e. migrating files or extents from the hottest disks to the coldest ones. We develop an approximate queueing model for determining the effective arrival rates of cooling requests and discuss its use in assessing the costs versus benefits of cooling.
... Kids For Teens For Parents & Teachers Resolving Family Conflicts The Holidays and Alzheimer's Glossary Virtual Library Online ... Use Map Selector Search Alzheimer’s Association Alzheimer's & Dementia Types of Dementia Types of Dementia Types of Dementia ...
Chemical-free n-type and p-type multilayer-graphene transistors
Energy Technology Data Exchange (ETDEWEB)
Dissanayake, D. M. N. M., E-mail: nandithad@voxtel-inc.com [Voxtel Inc, Lockey Laboratories, University of Oregon, Eugene Oregon 97402 (United States); Eisaman, M. D. [Sustainable Energy Technologies Department, Brookhaven National Laboratory, Upton, New York 11973 (United States); Department of Electrical and Computer Engineering, Stony Brook University, Stony Brook, New York 11794 (United States); Department of Physics and Astronomy, Stony Brook University, Stony Brook, New York 11794 (United States)
2016-08-01
A single-step doping method to fabricate n- and p-type multilayer graphene (MG) top-gate field effect transistors (GFETs) is demonstrated. The transistors are fabricated on soda-lime glass substrates, with the n-type doping of MG caused by the sodium in the substrate without the addition of external chemicals. Placing a hydrogen silsesquioxane (HSQ) barrier layer between the MG and the substrate blocks the n-doping, resulting in p-type doping of the MG above regions patterned with HSQ. The HSQ is deposited in a single fabrication step using electron beam lithography, allowing the patterning of arbitrary sub-micron spatial patterns of n- and p-type doping. When a MG channel is deposited partially on the barrier and partially on the glass substrate, a p-type and n-type doping profile is created, which is used for fabricating complementary transistors pairs. Unlike chemically doped GFETs in which the external dopants are typically introduced from the top, these substrate doped GFETs allow for a top gate which gives a stronger electrostatic coupling to the channel, reducing the operating gate bias. Overall, this method enables scalable fabrication of n- and p-type complementary top-gated GFETs with high spatial resolution for graphene microelectronic applications.
Insulin-dependent diabetes; Juvenile onset diabetes; Diabetes - type 1; High blood sugar - type 1 diabetes ... Type 1 diabetes can occur at any age. It is most often diagnosed in children, adolescents, or young adults. Insulin is ...
Type D (distressed) personality in primary care patients with type 2 diabetes
DEFF Research Database (Denmark)
Nefs, Giesje; Pouwer, Francois; Pop, Victor J M
2012-01-01
D Scale-14 (DS14) in type 2 diabetes patients. METHODS: 1553 primary care patients with type 2 diabetes were assessed for demographic, clinical, lifestyle and psychological characteristics in 2007. A subgroup (n=1012) completed the DS14 again 1 year later. RESULTS: The two-factor model of the Type D...... or physiological risk factors, but Type D women had a more sedentary lifestyle (p=.003). Type D patients experienced less social support and more stressful life events, loneliness, and more depressed mood, anhedonia and anxiety (p0......OBJECTIVE: In cardiovascular research, Type D personality (high negative affectivity and social inhibition) has been associated with a more than 3-fold increased risk of adverse health outcomes. This study examined the validity and clinical correlates of the Type D construct as assessed by the Type...
Poursaeidesfahani, A.; de Lange, M.F.; Khodadadian, F.; Dubbeldam, D.; Rigutto, Marcello; Nair, Nitish; Vlugt, T.J.H.
2017-01-01
The influence of product shape selectivity on the bifunctional conversion of n-C7 by zeolite catalysts is investigated. Three different zeolite catalysts with different pore sizes (MFI-type, MEL-type, and BEA-type zeolites) have been investigated experimentally. For all three
Diabetes means your blood glucose, or blood sugar, levels are too high. With type 2 diabetes, the more common type, your body does not ... You have a higher risk of type 2 diabetes if you are older, have obesity, have a ...
Role of type 1 and type 3 fimbriae in Klebsiella pneumoniae biofilm formation
DEFF Research Database (Denmark)
Schroll, C.; Barken, Kim Bundvig; Krogfelt, K.A.
2010-01-01
nosocomial infections. Most clinical K. pneumoniae isolates express two types of fimbrial adhesins, type 1 fimbriae and type 3 fimbriae. In this study, we characterized the role of type 1 and type 3 fimbriae in K. pneumoniae biofilm formation. Results: Isogenic fimbriae mutants of the clinical K. pneumoniae...... of planktonic cells. Type 1 fimbriae did not influence biofilm formation and the expression of type 1 fimbriae was found to be down-regulated in biofilm forming cells. In contrast, expression of type 3 fimbriae was found to strongly promote biofilm formation. Conclusion: By use of well defined isogenic mutants...... we found that type 3 fimbriae, but not type 1 fimbriae, strongly promote biofilm formation in K. pneumoniae C3091. As the vast majority of clinical K. pneumoniae isolates express type 3 fimbriae, this fimbrial adhesin may play a significant role in development of catheter associated K. pneumoniae...
Type Inference with Inequalities
DEFF Research Database (Denmark)
Schwartzbach, Michael Ignatieff
1991-01-01
of (monotonic) inequalities on the types of variables and expressions. A general result about systems of inequalities over semilattices yields a solvable form. We distinguish between deciding typability (the existence of solutions) and type inference (the computation of a minimal solution). In our case, both......Type inference can be phrased as constraint-solving over types. We consider an implicitly typed language equipped with recursive types, multiple inheritance, 1st order parametric polymorphism, and assignments. Type correctness is expressed as satisfiability of a possibly infinite collection...
Pattern of thyroid auto immunity in type 1 and type 2 diabetics
International Nuclear Information System (INIS)
Yasmin, T.
2006-01-01
To determine the level of thyroid auto immunity among clinically euthyroid patients of type 1 and type 2 diabetics and to correlate the levels with pattern of diabetes. Blood samples were collected from 163 subjects (51 of type 1, 61 of type 2 diabetics and 51 non- diabetic controls) and sera were separated. They were all clinically euthyroid and selected conveniently. Thyroid profile (FT4, TSH and anti- TPO) was assessed in the three groups and compared. It was observed that at a cut off value of less than 100 units of anti-TPO level was normal, raised anti-TPO antibodies were found in 12% of normal control group, 61% in type 1 and 42.3% in type 2 diabetics. In type 1 diabetics, the TSH was higher in the younger age patients with progressive rise in anti-TPO antibodies level by age. The TSH, anti-TPO antibodies and BSF were significantly higher in type 1 diabetics than in the controls. In type 2 diabetics, TSH was moderately low but anti-TPO antibodies and BSF were higher than in the controls (author)
Multiparty Asynchronous Session Types
DEFF Research Database (Denmark)
Honda, Kohei; Yoshida, Nobuko; Carbone, Marco
2016-01-01
. This work extends the foregoing theories of binary session types to multiparty, asynchronous sessions, which often arise in practical communication-centered applications. Presented as a typed calculus for mobile processes, the theory introduces a new notion of types in which interactions involving multiple......Communication is a central elements in software development. As a potential typed foundation for structured communication-centered programming, session types have been studied over the past decade for a wide range of process calculi and programming languages, focusing on binary (two-party) sessions...... peers are directly abstracted as a global scenario. Global types retain the friendly type syntax of binary session types while specifying dependencies and capturing complex causal chains of multiparty asynchronous interactions. A global type plays the role of a shared agreement among communication peers...
Multiparty symmetric sum types
DEFF Research Database (Denmark)
Nielsen, Lasse; Yoshida, Nobuko; Honda, Kohei
2010-01-01
This paper introduces a new theory of multiparty session types based on symmetric sum types, by which we can type non-deterministic orchestration choice behaviours. While the original branching type in session types can represent a choice made by a single participant and accepted by others...... determining how the session proceeds, the symmetric sum type represents a choice made by agreement among all the participants of a session. Such behaviour can be found in many practical systems, including collaborative workflow in healthcare systems for clinical practice guidelines (CPGs). Processes...... with the symmetric sums can be embedded into the original branching types using conductor processes. We show that this type-driven embedding preserves typability, satisfies semantic soundness and completeness, and meets the encodability criteria adapted to the typed setting. The theory leads to an efficient...
DEFF Research Database (Denmark)
Schwartzbach, Michael Ignatieff; Palsberg, Jens
binding. Existing languages employ different type systems, and it can be difficult to compare, evaluate and improve them, since there is currently no uniform theory for such languages. This book provides such a theory. The authors review the type systems of Simula, Smalltalk, C++ and Eiffel and present......Object-Oriented Type Systems Jens Palsberg and Michael I. Schwartzbach Aarhus University, Denmark Type systems are required to ensure reliability and efficiency of software. For object-oriented languages, typing is an especially challenging problem because of inheritance, assignment, and late...... a type system that generalizes and explains them. The theory is based on an idealized object-oriented language called BOPL (Basic Object Programming Language), containing common features of the above languages. A type system, type inference algorithm, and typings of inheritance and genericity...
Best Proximity Points of Contractive-type and Nonexpansive-type Mappings
Directory of Open Access Journals (Sweden)
R. Kavitha
2018-02-01
Full Text Available The purpose of this paper is to obtain best proximity point theorems for multivalued nonexpansive-type and contractive-type mappings on complete metric spaces and on certain closed convex subsets of Banach spaces. We obtain a convergence result under some assumptions and we prove the existence of common best proximity points for a sequence of multivalued contractive-type mappings.
Zollinger, Paul E; Kreis, Robert W; van der Meulen, Hub G; van der Elst, Maarten; Breederveld, Roelf S; Tuinebreijer, Wim E
2010-02-17
Operative and conservative treatment of wrist fractures might lead to complex regional pain syndrome (CRPS) type I.In our multicenter dose response study in which patients with distal radial fractures were randomly allocated to placebo or vitamin C in a daily dose of 200mg, 500mg or 1500mg during 50 days, an operated subgroup was analyzed.48 (of 427) fractures) were operated (11.2%). Twenty-nine patients (60%) were treated with external fixation, 14 patients (29%) with K-wiring according to Kapandji and five patients (10%) with internal plate fixation. The 379 remaining patients were treated with a plaster.In the operated group of patients who received vitamin C no CRPS (0/37) was seen in comparison with one case of CRPS (Kapandji technique) in the operated group who received placebo (1/11 = 9%, p=.23). There was no CRPS after external fixation.In the conservatively treated group 17 cases of CRPS (17/379 = 4.5%) occurred in comparison with one in case of CRPS in the operated group (1/48 = 2.1%, p=.71).External fixation doesn't necessarily lead to a higher incidence of CRPS in distal radial fractures. Vitamin C may also play a role in this. This subgroup analysis in operated distal radial fractures showed no CRPS occurrence with vitamin C prophylaxis.
The Origin and Evolution of the Infrared Light Curve of SN2010jl
Dwek, Eli; Sarangi, Arkaprabha; Arendt, Richard; Fox, Ori; Kallman, Timothy; Kazanas, Demosthenes
2018-01-01
SN2010jl is a luminous core-collapse supernova (CCSN) of Type IIn that is surrounded by a dense circumstellar medium (CSM). The supernova (SN) luminosity vastly exceeds the available power from radiactive elements in the ejecta, and is powered by the interaction of the SN shock wave with the ambient medium. Upper limits on the UV and near-IR (NIR) emission from pre-explosion images of the region suggest that any progenitor star was hidden by pre-existing CSM dust. After day ~80, the SN spectrum shows the development of an IR excess above the extrapolated UVO emission arising from the shocked CSM. This IR component is attributed to thermal emission from dust.After day ~300, the light curve exhibits a rise in the NIR luminosity, concurrent with a steep decline at UVO wavelengths. Ruling out any possible contribution of SN-condensed dust to the IR light curve, we show that the early IR emission arises from the pre-existing CSM dust that survived the flash of radiation from the shock breakout. The late IR emission arises from newly-formed CSM dust that condensed in the cooling dust-free postshock gas of the advancing SN shock wave. Our analysis presents the first detailed modeling of dust formation in a cooling postshock environment, and provides important insights into the interaction of the SN shock wave with the CSM.
Riazi, Afsane; Bradley, Clare
2007-01-01
This chapter provides an overview of the role of psychological stress in Type 1 diabetes. Studies relating to stress and Type 1 diabetes onset and control, as well as the evidence relating to stress management training in people with Type 1 diabetes are discussed.
Muratori, L; Cataleta, M; Muratori, P; Lenzi, M; Bianchi, F
1998-01-01
Background—Liver/kidney microsomal antibody type 1 (LKM1) and liver cytosol antibody type 1 (LC1) are the serological markers of type 2 autoimmune hepatitis (AIH). Aims—Since LKM1 and LC1 react against two distinct liver specific autoantigens (cytochrome P450IID6 (CYP2D6) and a 58 kDa cytosolic polypeptide respectively), the aim was to see whether LKM1 and LC1 concentrations correlate with liver disease activity. Patients—Twenty one patients with type 2 AIH were studied. Methods—A...
Qualification of Type IP-2, Type IP-3 and Type A packages for radioactive liquid shipments
International Nuclear Information System (INIS)
Marcu, L.; Sullivan, G.; Lo, K.K.
2006-01-01
Commercial products such as pails, drums or bulk containers can be used for radioactive materials transportation if they can be shown to meet the regulatory requirements. Ontario Power Generation (OPG) has successfully tested and qualified several off-the-shelf containers as Type IP-2, Type IP-3 and Type A packages for liquids in accordance with the International and Canadian Regulations. This paper describes the testing and qualification of these commercial products, and discusses the problems encountered and lessons learned during this process. (author)
Relationships between hole type penetrameter sensitivities and wire type penetrameter sensitivities
International Nuclear Information System (INIS)
Iwahashi, Y.; Ebata, M.; Ooka, K.; Hirayama, K.; Senda, T.
1985-01-01
Radiographic investigations were conducted using the two types of penetrameters (hole and wire types) to obtain the relationships between hole type penetrameter sensitivities and wire type penetrameter sensitivities. Furthermore, the effects of radiation sources and kinds of X-ray films on the relationships were investigated. As a result, the quantitative relationship were defined. It was also clarified that the kinds of X-ray films and radiation sources have a relatively little effect on the relationship
Theoretical models for Type I and Type II supernova
International Nuclear Information System (INIS)
Woosley, S.E.; Weaver, T.A.
1985-01-01
Recent theoretical progress in understanding the origin and nature of Type I and Type II supernovae is discussed. New Type II presupernova models characterized by a variety of iron core masses at the time of collapse are presented and the sensitivity to the reaction rate 12 C(α,γ) 16 O explained. Stars heavier than about 20 M/sub solar/ must explode by a ''delayed'' mechanism not directly related to the hydrodynamical core bounce and a subset is likely to leave black hole remnants. The isotopic nucleosynthesis expected from these massive stellar explosions is in striking agreement with the sun. Type I supernovae result when an accreting white dwarf undergoes a thermonuclear explosion. The critical role of the velocity of the deflagration front in determining the light curve, spectrum, and, especially, isotopic nucleosynthesis in these models is explored. 76 refs., 8 figs
DEFF Research Database (Denmark)
Hüttel, Hans
2011-01-01
A large variety of process calculi extend the pi-calculus with more general notions of messages. Bengtson et al. have shown that many of these pi-like calculi can be expressed as so-called psi-calculi. In this paper, we describe a simple type system for psi-calculi. The type system satisfies a su...... for the distributed pi-calculus of Hennessy and Riely and finally show how existing type systems for secrecy and authenticity in the spi calculus can be represented and shown to be safe.......A large variety of process calculi extend the pi-calculus with more general notions of messages. Bengtson et al. have shown that many of these pi-like calculi can be expressed as so-called psi-calculi. In this paper, we describe a simple type system for psi-calculi. The type system satisfies...... a subject reduction property and a general notion of channel safety. A number of existing systems are shown to be instances of our system, and other, new type systems can also be obtained. We first present a new type system for the calculus of explicit fusions by Wischik and Gardner, then one...
A Kantorovich-Stancu Type Generalization of Szasz Operators including Brenke Type Polynomials
Directory of Open Access Journals (Sweden)
Rabia Aktaş
2013-01-01
Full Text Available We introduce a Kantorovich-Stancu type modification of a generalization of Szasz operators defined by means of the Brenke type polynomials and obtain approximation properties of these operators. Also, we give a Voronovskaya type theorem for Kantorovich-Stancu type operators including Gould-Hopper polynomials.
Charting improvements in US registry HLA typing ambiguity using a typing resolution score.
Paunić, Vanja; Gragert, Loren; Schneider, Joel; Müller, Carlheinz; Maiers, Martin
2016-07-01
Unrelated stem cell registries have been collecting HLA typing of volunteer bone marrow donors for over 25years. Donor selection for hematopoietic stem cell transplantation is based primarily on matching the alleles of donors and patients at five polymorphic HLA loci. As HLA typing technologies have continually advanced since the beginnings of stem cell transplantation, registries have accrued typings of varied HLA typing ambiguity. We present a new typing resolution score (TRS), based on the likelihood of self-match, that allows the systematic comparison of HLA typings across different methods, data sets and populations. We apply the TRS to chart improvement in HLA typing within the Be The Match Registry of the United States from the initiation of DNA-based HLA typing to the current state of high-resolution typing using next-generation sequencing technologies. In addition, we present a publicly available online tool for evaluation of any given HLA typing. This TRS objectively evaluates HLA typing methods and can help define standards for acceptable recruitment HLA typing. Copyright © 2016 American Society for Histocompatibility and Immunogenetics. Published by Elsevier Inc. All rights reserved.
Linearly Refined Session Types
Directory of Open Access Journals (Sweden)
Pedro Baltazar
2012-11-01
Full Text Available Session types capture precise protocol structure in concurrent programming, but do not specify properties of the exchanged values beyond their basic type. Refinement types are a form of dependent types that can address this limitation, combining types with logical formulae that may refer to program values and can constrain types using arbitrary predicates. We present a pi calculus with assume and assert operations, typed using a session discipline that incorporates refinement formulae written in a fragment of Multiplicative Linear Logic. Our original combination of session and refinement types, together with the well established benefits of linearity, allows very fine-grained specifications of communication protocols in which refinement formulae are treated as logical resources rather than persistent truths.
HABITABLE ZONES OF POST-MAIN SEQUENCE STARS
International Nuclear Information System (INIS)
Ramirez, Ramses M.; Kaltenegger, Lisa
2016-01-01
Once a star leaves the main sequence and becomes a red giant, its Habitable Zone (HZ) moves outward, promoting detectable habitable conditions at larger orbital distances. We use a one-dimensional radiative-convective climate and stellar evolutionary models to calculate post-MS HZ distances for a grid of stars from 3700 to 10,000 K (∼M1 to A5 stellar types) for different stellar metallicities. The post-MS HZ limits are comparable to the distances of known directly imaged planets. We model the stellar as well as planetary atmospheric mass loss during the Red Giant Branch (RGB) and Asymptotic Giant Branch (AGB) phases for super-Moons to super-Earths. A planet can stay between 200 million years up to 9 Gyr in the post-MS HZ for our hottest and coldest grid stars, respectively, assuming solar metallicity. These numbers increase for increased stellar metallicity. Total atmospheric erosion only occurs for planets in close-in orbits. The post-MS HZ orbital distances are within detection capabilities of direct imaging techniques.
HABITABLE ZONES OF POST-MAIN SEQUENCE STARS
Energy Technology Data Exchange (ETDEWEB)
Ramirez, Ramses M.; Kaltenegger, Lisa [Carl Sagan Institute, Cornell University, Ithaca, NY (United States)
2016-05-20
Once a star leaves the main sequence and becomes a red giant, its Habitable Zone (HZ) moves outward, promoting detectable habitable conditions at larger orbital distances. We use a one-dimensional radiative-convective climate and stellar evolutionary models to calculate post-MS HZ distances for a grid of stars from 3700 to 10,000 K (∼M1 to A5 stellar types) for different stellar metallicities. The post-MS HZ limits are comparable to the distances of known directly imaged planets. We model the stellar as well as planetary atmospheric mass loss during the Red Giant Branch (RGB) and Asymptotic Giant Branch (AGB) phases for super-Moons to super-Earths. A planet can stay between 200 million years up to 9 Gyr in the post-MS HZ for our hottest and coldest grid stars, respectively, assuming solar metallicity. These numbers increase for increased stellar metallicity. Total atmospheric erosion only occurs for planets in close-in orbits. The post-MS HZ orbital distances are within detection capabilities of direct imaging techniques.
Fetsch, Corinna
2011-09-13
Preparation of defined and functional polymers has been one of the hottest topics in polymer science and drug delivery in the recent decade. Also, research on (bio)degradable polymers gains more and more interest, in particular at the interface of these two disciplines. However, in the majority of cases, combination of definition, functionality and degradability, is problematic. Here we present the preparation and characterization (MALDI-ToF MS, NMR, GPC) of nonionic hydrophilic, hydrophobic, and amphiphilic N-substituted polyglycines (polypeptoids), which are expected to be main-chain degradable and are able to disperse a hydrophobic model compound in aqueous media. Polymerization kinetics suggest that the polymerization is well controlled with strictly linear pseudo first-order kinetic plots to high monomer consumption. Moreover, molar mass distributions of products are Poisson-type and molar mass can be controlled by the monomer to initiator ratio. The presented polymer platform is nonionic, backbone degradable, and synthetically highly flexible and may therefore be valuable for a broad range of applications, in particular as a biomaterial. © 2011 American Chemical Society.
Fetsch, Corinna; Grossmann, Arlett; Holz, Lisa; Nawroth, Jonas F.; Luxenhofer, Robert
2011-01-01
Preparation of defined and functional polymers has been one of the hottest topics in polymer science and drug delivery in the recent decade. Also, research on (bio)degradable polymers gains more and more interest, in particular at the interface of these two disciplines. However, in the majority of cases, combination of definition, functionality and degradability, is problematic. Here we present the preparation and characterization (MALDI-ToF MS, NMR, GPC) of nonionic hydrophilic, hydrophobic, and amphiphilic N-substituted polyglycines (polypeptoids), which are expected to be main-chain degradable and are able to disperse a hydrophobic model compound in aqueous media. Polymerization kinetics suggest that the polymerization is well controlled with strictly linear pseudo first-order kinetic plots to high monomer consumption. Moreover, molar mass distributions of products are Poisson-type and molar mass can be controlled by the monomer to initiator ratio. The presented polymer platform is nonionic, backbone degradable, and synthetically highly flexible and may therefore be valuable for a broad range of applications, in particular as a biomaterial. © 2011 American Chemical Society.
The effect of solarradiation and UV photons on the CR-39 nuclear track detector
International Nuclear Information System (INIS)
Saad, A.F.
2003-01-01
The effects induced in the CR-39 polymer detector by total solar radiation (TSR) and UV photons were investigated. Thr exposure of detector samples to solar photons was carried out according to certain conditions. The TSR exposure period started in the middle of july and lasted unitel 12 th of september. 2000: the hottest months in zagazig, egypt. Another set of detector samples was exposed to UV photons from a UV lamp for different intervals. After UV exposure, these detectors were analysed with an FT-IR sepectrometer of jasco type 5300 in transmission mode. The FT-IR spectra does not show any considerable modifications due to UV irradiation in that detector. The effects of UV light were compared with those of solar radiation containing ultraviolet photons , on the registration properties of this polymer detector. Preliminaryresults revealed a proportionate increase in bluk etch rate of CR-39 detector with the increase of exposure time to the solar radiation. The results indicated that the CR-39 polymer detector can be used as a solar radiation dosimeter
DEFF Research Database (Denmark)
Schwartzbach, Michael Ignatieff; Palsberg, Jens
a type system that generalizes and explains them. The theory is based on an idealized object-oriented language called BOPL (Basic Object Programming Language), containing common features of the above languages. A type system, type inference algorithm, and typings of inheritance and genericity......Object-Oriented Type Systems Jens Palsberg and Michael I. Schwartzbach Aarhus University, Denmark Type systems are required to ensure reliability and efficiency of software. For object-oriented languages, typing is an especially challenging problem because of inheritance, assignment, and late...... are provided for BOPL. Throughout, the results are related to the languages on which BOPL is based. This text offers advanced undergraduates and professional software developers a sound understanding of the key aspects of object-oriented type systems. All algorithms are implemented in a freely available...
Institute of Scientific and Technical Information of China (English)
林宇
2011-01-01
应用回归分析的方法,分析主要气候因子对沿海防护林卷荚相思树高、胸径生长的影响.结果表明,气候因子对沿海防护林卷荚相思树高生长的影响为年日照时数>年最冷月平均气温>月平均气温>年最热月平均气温>月均相对湿度;气候因子对沿海防护林卷荚相思胸径生长的影响为年日照时数>月平均气温>年最热月平均气温>年最冷月平均气温>月均相对湿度.其中,年日照时数、年最冷月平均气温、年最热月平均气温、月平均气温与卷荚相思树高和胸径的生长量有极显著的正相关关系.%The regression method was used to analyze the effects of principal climatic factors on the growth of tree height and diameter at breast height of Acacia cincinnata in coastal protection forest. The results showed that the order for the effects of climatic factors on the tree height growth of A. Cincinnata was that: annual sunshine hours > annual coldest month mean temperature > monthly mean temperature > annual hottest month mean temperature > monthly mean relative humidity. The order for the effects of climatic factors on the diameter at breast height growth of A, cincinnata was that: annual sunshine hours > monthly mean temperature > annual hottest month mean temperature > annual coldest month mean temperature > monthly mean relative humidity. Among them, annual sunshine hours, annual coldest month mean temperature, annual hottest month mean temperature, monthly mean temperature have a very significant positive correlation with the growth of A. Cincinnata' s height and diameter at breast height.
Thinking about gender types: Cognitive organization of female and male types
Vonk, R.; Ashmore, R.D.
2003-01-01
We examined the content and dimensional structure of a large and representative sample of gender types. In Study 1, using an open-ended procedure, participants generated 306 different labels for female types (e.g. housewife, feminist, femme fatale, secretary, slob) and 310 for male types (e.g.
Quraishy, N; Sapatnekar, S
The clinical importance of blood group antigens relates to their ability to evoke immune antibodies that are capable of causing hemolysis. The most important antigens for safe transfusion are ABO and D (Rh), and typing for these antigens is routinely performed for patients awaiting transfusion, prenatal patients, and blood donors. Typing for other blood group antigens, typically of the Kell, Duffy, Kidd, and MNS blood groups, is sometimes necessary, for patients who have, or are likely to develop antibodies to these antigens. The most commonly used typing method is serological typing, based on hemagglutination reactions against specific antisera. This method is generally reliable and practical for routine use, but it has certain drawbacks. In recent years, molecular typing has emerged as an alternative or supplemental typing method. It is based on detecting the polymorphisms and mutations that control the expression of blood group antigens, and using this information to predict the probable antigen type. Molecular typing methods are useful when traditional serological typing methods cannot be used, as when a patient has been transfused and the sample is contaminated with red blood cells from the transfused blood component. Moreover, molecular typing methods can precisely identify clinically significant variant antigens that cannot be distinguished by serological typing; this capability has been exploited for the resolution of typing discrepancies and shows promise for the improved transfusion management of patients with sickle cell anemia. Despite its advantages, molecular typing has certain limitations, and it should be used in conjunction with serological methods. © 2016 Elsevier Inc. All rights reserved.
Wild type measles virus attenuation independent of type I IFN
Directory of Open Access Journals (Sweden)
Horvat Branka
2008-02-01
Full Text Available Abstract Background Measles virus attenuation has been historically performed by adaptation to cell culture. The current dogma is that attenuated virus strains induce more type I IFN and are more resistant to IFN-induced protection than wild type (wt. Results The adaptation of a measles virus isolate (G954-PBL by 13 passages in Vero cells induced a strong attenuation of this strain in vivo. The adapted virus (G954-V13 differs from its parental strain by only 5 amino acids (4 in P/V/C and 1 in the M gene. While a vaccine strain, Edmonston Zagreb, could replicate equally well in various primate cells, both G954 strains exhibited restriction to the specific cell type used initially for their propagation. Surprisingly, we observed that both G954 strains induced type I IFN, the wt strain inducing even more than the attenuated ones, particularly in human plasmacytoid Dendritic Cells. Type I IFN-induced protection from the infection of both G954 strains depended on the cell type analyzed, being less efficient in the cells used to grow the viral strain. Conclusion Thus, mutations in M and P/V/C proteins can critically affect MV pathogenicity, cellular tropism and lead to virus attenuation without interfering with the α/β IFN system.
Full Text Available ... Care of Type 2 Diabetes This two-page introduction to type 2 diabetes is in PDF format ... Basics Symptoms Type 1 Type 2 Gestational Myths Statistics Common Terms Genetics Living With Diabetes Recently Diagnosed ...
Dynamic behavior of cellular materials and cellular structures: Experiments and modeling
Gao, Ziyang
Cellular solids, including cellular materials and cellular structures (CMS), have attracted people's great interests because of their low densities and novel physical, mechanical, thermal, electrical and acoustic properties. They offer potential for lightweight structures, energy absorption, thermal management, etc. Therefore, the studies of cellular solids have become one of the hottest research fields nowadays. From energy absorption point of view, any plastically deformed structures can be divided into two types (called type I and type II), and the basic cells of the CMS may take the configurations of these two types of structures. Accordingly, separated discussions are presented in this thesis. First, a modified 1-D model is proposed and numerically solved for a typical type II structure. Good agreement is achieved with the previous experimental data, hence is used to simulate the dynamic behavior of a type II chain. Resulted from different load speeds, interesting collapse modes are observed, and the parameters which govern the cell's post-collapse behavior are identified through a comprehensive non-dimensional analysis on general cellular chains. Secondly, the MHS specimens are chosen as an example of type I foam materials because of their good uniformity of the cell geometry. An extensive experimental study was carried out, where more attention was paid to their responses to dynamic loadings. Great enhancement of the stress-strain curve was observed in dynamic cases, and the energy absorption capacity is found to be several times higher than that of the commercial metal foams. Based on the experimental study, finite elemental simulations and theoretical modeling are also conducted, achieving good agreements and demonstrating the validities of those models. It is believed that the experimental, numerical and analytical results obtained in the present study will certainly deepen the understanding of the unsolved fundamental issues on the mechanical behavior of
Xu, Linli; Tian, Wenya
2012-01-01
The 2012 International Conference on Emerging Computation and Information teChnologies for Education (ECICE 2012) was held on Jan. 15-16, 2012, Hangzhou, China. The main results of the conference are presented in this proceedings book of carefully reviewed and accepted paper addressing the hottest issues in emerging computation and information technologies used for education. The volume covers a wide series of topics in the area, including Computer-Assisted Education, Educational Information Systems, Web-based Learning, etc.
Ultraviolet colors of subdwarf O stars
International Nuclear Information System (INIS)
Wesselius, P.R.
1978-01-01
The group of subdwarf O stars consisting of field stars and some central stars of old planetary nebulae does occupy an interesting place in the HR diagram. Greenstein and Sargent (1974) have tried to establish this place, and conclude that especially the hottest ones need ultraviolet data to improve the values of effective temperature and absolute luminosity. The author therefore observed some twenty sdO stars in the far ultraviolet using the spectrophotometer in the Netherlands' satellite ANS. (Auth.)
Communicating Geography with the Cloud. GI_Forum|GI_Forum 2015 – Geospatial Minds for Society|
Silva, Durval; Donert, Karl
2016-01-01
Cloud computing is one of the hottest technological trends in education. According to MICROSOFT (2012), “With Cloud computing in education, you get powerful software and massive computing resources where and when you need them. […] Cloud services can be used to combine on-demand computing and storage, familiar experience with on-demand scalability and online services for anywhere, anytime access to powerful web-based tools.” This paper discusses the potentials that the cloud delivers for educ...
The future of 3D printing technology in biomedicine
Iraj Nabipour
2015-01-01
3D printing, one of the hottest cutting-edge interdisciplinary technologies, is projected to have revenue of $8.4 billion in 2020. #D printing technology will implement the concept of personalized medicine in medical healthcare industry and pharmaceutical fabrication. Organ printing, which it is defined as computer-aided, jet based 3D tissue-engineering of living human organs, is an interesting and challengeable field for 3D printing. Customized implants and prostheses can be produced in any ...
Ownership Concentration and IPO Underpricing: Evidence from the U.S. Stock Market
Jiang, Yanru
2012-01-01
Underpricing for Initial Public Offering (IPO) is one of the hottest field financial researchers studied. Many existing theories have tried to explain the reason for underpricing. This study proposes that IPO is not a basic step for a firm raising new capital. It is also a conflict process of interest between different shareholders among large shareholders, controlling shareholders and small or outside shareholders. Because of the initial owners’ desire of controlling the firm after IPO, the ...
Rozentals, Nathan
2015-01-01
Whether you are a JavaScript developer aiming to learn TypeScript, or an experienced TypeScript developer wanting to take your skills to the next level, this book is for you. From basic to advanced language constructs, test-driven development, and object-oriented techniques, you will learn how to get the most out of the TypeScript language.
DEFF Research Database (Denmark)
Beier, Sofie
2017-01-01
‘Type Tricks’ is about typographical rules and the underlying structure of the work process in the design of new typefaces. In that way, it is both a reference book and a user manual. In an illustrative format, it presents the different stages of type design in an easily accessible manner. Being...
Maharry, Dan
2013-01-01
TypeScript Revealed is a quick 100-page guide to Anders Hejlsberg's new take on JavaScript. With this brief, fast-paced introduction to TypeScript, .NET, Web and Windows 8 application developers who are already familiar with JavaScript will easily get up to speed with TypeScript and decide whether or not to start incorporating it into their own development. TypeScript is 'JavaScript for Application-scale development'; a superset of JavaScript that brings to it an additional object-oriented-like syntax familiar to .NET programmers that compiles down into simple, clean JavaScript that any browse
Directory of Open Access Journals (Sweden)
Vera K Jandackova
Full Text Available Type-D personality, defined as a combination of high negative affect and high social isolation, has been associated with poor health outcomes. However, pathways underlying this association are largely unknown. We investigated the relationship between Type-D personality and several biological and behavioral pathways including the autonomic nervous system, the immune system, glucose regulation and sleep in a large, apparently healthy sample.Data from a total of 646 respondents (age 41.6±11.5, 12,2% women were available for analysis. Persons with Type-D (negative affect and social isolation score ≥10 were contrasted with those without Type-D. Measures of plasma fibrinogen levels, white blood cell count, high sensitivity C-reactive protein, fasting plasma glucose (FPG, cholesterol, high-density and low-density lipoprotein, glycated hemoglobin (HbA1c, creatinine, triglycerides, and albumin were derived from fasting blood samples. Urine norepinephrine and free cortisol were determined by high-performance liquid chromatography. Time-domain heart rate variability (HRV measures were calculated for the 24hr recording period and for nighttime separately.Persons with Type-D had higher HbA1c, FPG, and fibrinogen, and lower nighttime HRV than those without Type-D, suggesting worse glycemic control, systemic inflammation and poorer autonomic nervous system modulation in Type-D persons. In addition, those with Type-D reported less social support and greater sleep difficulties while no group differences were observed for alcohol and cigarette consumption, physical activity and body mass index.Findings provide some of the first evidence for multiple possible biological and behavioral pathways between Type-D personality and increased morbidity and mortality.
Interspecies radioimmunoassay for the major structural proteins of primate type-D retroviruses
International Nuclear Information System (INIS)
Colcher, D.; Teramoto, Y.A.; Schlom, J.
1977-01-01
A competition radioimmunoassay has been developed in which type-D retroviruses from three primate species compete. The assay utilizes the major structural protein (36,000 daltons) of the endogenous squirrel monkey retrovirus and antisera directed against the major structural protein (27,000 daltons) of the Mason-Pfizer monkey virus isolated from rhesus monkeys. Purified preparations of both viruses grown in heterologous cells, as well as extracts of heterologous cells infected with squirrel monkey retrovirus or Mason-Pfizer monkey virus, compete completely in the assay. Addition of an endogenous virus of the langur monkey also results in complete blocking. No blocking in the assay is observed with type-C baboon viruses, woolly monkey virus, and gibbon virus. Various other type-C and type-B viruses also showed no reactivity. An interspecies assay has thus been developed that recognizes the type-D retroviruses from both Old World monkey (rhesus and langur) and New World monkey (squirrel) species
Sistema integrado para toma de decisiones en el diseño de estructuras de hormigón
Directory of Open Access Journals (Sweden)
Armengou, J.
2012-09-01
Full Text Available This paper presents a methodology to analyze decisions in the design of concrete structures. Specifically, we propose a multi-criteria approach to assess the value implications of precast concrete technologies versus in-situ concrete solutions. First, we emphasize the importance of careful decision-making in early stages of construction projects to enhance customer value. Second, we present a decisionmaking methodology that uses fuzzy logic to represent and synthesize information about risk-return tradeoffs in the different kinds of variables involved in the evaluation of a project’s value. To illustrate, we use our methodology to analyze precast vs. in-situ solutions in the design of drainage structures. The results of our analysis point at precast solutions as the most desirable design choice in this setting, and highlight the importance of value analysis in early stages of construction projects.
El presente artículo hace una breve reflexión sobre las alternativas <i>in situ y prefabricadas para estructuras de hormigón, justificando la necesidad de profundizar en métodos multicriterio como ayuda a la toma de decisiones. Manifiesta la trascendencia de la calidad en las decisiones más allá de este ámbito concreto, así como su influencia en la mayor eficiencia de las obras. Presenta luego un sistema de ayuda a la toma de decisiones basado en matemática difusa, que considera el valor de cada alternativa contemplando el riesgo inherente. Para ilustrarlo desarrolla un ejemplo aplicado a pasos inferiores que pueden resolverse mediante prefabricación o <i>in situ. Efectuándolo por completo, llega a dos conclusiones principales: la bondad de la herramienta presentada y cómo la solución prefabricada, en este caso, aporta mayor valor. Concluye también que todo buen gestor debe plantearse su toma de decisión desde los inicios de cualquier proyecto, empleando herramientas como la presentada.
Construcción de un péndulo de torsión para la medida de la fricción interna a bajas temperaturas
Directory of Open Access Journals (Sweden)
San Juan, J. M.
2001-04-01
Full Text Available In this work we describe the assembly, operation and specifications of an inverted torsion pendulum designed to measure internal friction at low temperatures (from 4.2 K to 500 K. The high precision mechanics allow us to obtain internal friction spectra with low levels of noise from amplitudes as small as 2x10-7. The inertia components of the pendulum have been built with specific materials, so that the resonance frequency of the pendulum can be changed within two orders of magnitude (0.1-10 Hz. In addition, the sample can be <i>in situ deformed at any temperature and can be inserted into the pendulum at liquid nitrogen temperature. The operation of the pendulum, all the control processes and data acquisition are completely automated.
En el presente trabajo se describe el montaje, funcionamiento y especificaciones de un péndulo de torsión invertido que permite realizar ensayos de fricción interna desde 4,2 K hasta 500 K. La sección mecánica de la nueva instalación es de alta precisión y la medición de la fricción interna se consigue efectuar con niveles de ruido muy bajos a partir de amplitudes tan pequeñas como 2x10-7. Los miembros de inercia del péndulo se han construido con materiales específicos, de modo que la frecuencia de resonancia pueda variarse en dos órdenes de magnitud (0.1-10 Hz. Por otro lado, la muestra puede deformarse <i>in situ a cualquier temperatura y puede montarse dentro del péndulo a la temperatura del nitrógeno líquido. El funcionamiento del péndulo y todos los procesos de control y adquisición de datos están completamente automatizados.
International Nuclear Information System (INIS)
Fuller, K.N.G.; Gough, J.; Ahmadi, H.R.
1993-01-01
The International Atomic Energy Agency has initiated a co-ordinated research programme on implementation of base-isolation for nuclear structures. This paper discusses two areas relevant to modelling elastomeric base-isolators. These are the use of simplified models to predict the response of isolated structures to earthquake inputs and finite element analysis for calculating the stress distributions within the isolators. In the former, a curvilinear hysteretic model of the high damping natural rubber able to accommodate the stiffening of the rubber at large shear deflections is presented. Its predictions of structural accelerations and bearing displacement produced by design earthquakes and those above the design level are compared with those using a linear spring and dashpot model. A comparison has been made between two finite element analyses using MARC and ABAQUS of the force-deformation behaviour of a single disc of rubber bonded on both sides. The disc was loaded both in compression and shear. Two forms of strain energy functions were used namely Mooney-RivIin and Ogden. The agreement between MARC and ABAQUS for the Mooney-Rivlin model for the material was very good. This was not however the case for the Ogden model and a difference of 25% in the maximum vertical deflection of the disc under 200kN load was observed. The need for a 'benchmark' problem is identified. This could be used to establish the accuracy of the finite element solvers. A problem based on the work of Rivlin on the force-deformation behaviour of cylinder of rubber under torsion is nominated. An appraisal of strain energy functions based on Mooney-RivIin formulations is carried out. It is shown that even for a five term series the strain energy function is incapable of catering for the rapid change of modulus at small strains both for simple and pure shear modes of deformation. This function models tension/compression data much better. The work identifies the need for evaluating other forms
Directory of Open Access Journals (Sweden)
M. RODRíGUEZ-PéREZ
2009-01-01
Full Text Available
La búsqueda de nuevas alternativas terapéuticas es una alta prioridad en la lucha por el control de la malaria. El objetivo del presente estudio fue evaluar extractos preparados a partir de plantas seleccionadas en base a información etnobotánica obtenida de la Medicina Tradicional Cubana. Extractos de seis plantas (Bambusa vulgaris, Parthenium hysterophorus, Melaleuca leucadendron, Indigofera suffruticosa, Artemisia absinthium, Simarouba glauca, fueron evaluados <i>in vitro frente a la cepa F32/Tanzania de Plasmodium falciparum, S. glauca, P. hysterophorus, M. leucadendron y A. absinthium mostraron valores de Concentración Mínima Inhibitoria en el rango de 3,1 a 50 µg/mL, mientras B. vulgaris e I. suffruticosa presentaron valores negativos contra esta cepa. Al evaluar estas cuatro especies <i>in vivo frente a Plasmodium berghei NK65, mostraron mayor actividad inhibidora A. absinthium con un 65,9% de reducción de la parasitemia a la dosis de 500 mg/kg, M. leucadendron con un 50% de reducción a la dosis de 250 mg/kg y S. glauca con una reducción del 43,2% a la dosis de 100 mg/kg. Los extractos que mostraron menor toxicidad fueron A. absinthium, y M. leucadendron. Estos resultados muestran las potencialidades antimaláricas de algunas plantas medicinales utilizadas en Cuba y trazan el camino para estudios posteriores de sus constituyentes químicos activos. Palabras-claves: Plasmodium falciparum; Plasmodium berghei; plantas antimaláricas; etnobotánico.
Directory of Open Access Journals (Sweden)
Youngsoo KIM
2017-04-01
Full Text Available This paper aims to clarify when the term of Byoin (hospital was introduced and how its concept was developed in modern Japan. The word “Byoin” was introduced in Japan in 1787 for the first time, but it had not been in use until early 1860s. Instead, various medical institutions performing the functions of modern medical facilities, such as Yojosho (A place for preserving health, Shijuku (private school, called by traditional names as ever. Japanese intellectuals already adopted the word Byoin and the concept of western hospital in early 1860s when their national delegates were dispatched to Europe to revise the treaties forged with western powers. Japanese translations of hospital appeared in English-Japanese/Japanese-English dictionaries published in the 1860s. For instance, the word Byoin (hospital in Japanese was first published in a dictionary published in 1867 and unclearly connected to the words, hospital, infirmary. This paper will argue that the concept of Byoin was sophisticated through Meiji government's efforts to implement reforms distinguishing medical facilities based on their capacity of inpatients and quality. The first medical law (Isei proclaimed by the Meiji government in 1874 articulated regulations for a hospital in eight different articles. The government established hospitals in various parts of the country, following its newly established modern medical care policies. However, in this process, Iin (hospital/clinic, another term for “hospital” appeared. Regional differences and financial issues made standardizing the concept of a hospital even more difficult. In response to the widely embedded confusion, the Japanese government made an effort to clarify the concept of a hospital, setting up provisions regarding the size of medical facilities. As a result, the word Byoin finally came to be used for a hospital with more than ten beds, while a clinic with beds below ten was called Shinryojo (clinic. On the other hand
Undifferentiated-type gastric adenocarcinoma: prognostic impact of three histological types
Directory of Open Access Journals (Sweden)
Lee Han
2012-11-01
Full Text Available Abstract Background The prognostic value of the three constituents of undifferentiated-type gastric adenocarcinoma remains unclear. The present study assessed the clinicopathological characteristics and prognosis of undifferentiated-type mucinous adenocarcinoma (uMAC and signet ring cell carcinoma (SRC compared with those of poorly differentiated adenocarcinoma (PDAC. Methods In total, 1,376 patients with undifferentiated-type gastric adenocarcinoma were included, consisting of 1,002 patients diagnosed with PDAC, 54 with uMAC and 320 with SRC. Clinicopathological factors and survival rates were compared among the three histological types. Results Significant differences in the distribution of pathological stages were observed among the groups. Patients with SRC had a significantly better survival rate than those with PDAC or uMAC, in both the all patients including non-curative resected patients and curative-resected groups. In addition, there was significant difference in survival between the PDAC and uMAC groups. Multivariate analysis suggested that age, gender, tumor depth, lymph node metastasis and curability significantly affected survival. Histological type was not an independent prognostic factor. There was no significant difference in the pattern of recurrence among the three groups. Conclusions The uMAC and SRC had worse and favorable prognosis compared with PDCA, respectively. However, there were no differences in survival by pathological stage, thus histological type was not an independent predictor of prognosis.
Web-based depression treatment for type 1 and type 2 diabetic patients
DEFF Research Database (Denmark)
van Bastelaar, Kim M P; Pouwer, Francois; Cuijpers, Pim
2011-01-01
intervention on a large scale at relatively low costs. This study evaluated the effectiveness of Web-based CBT for depression treatment in adults with type 1 or type 2 diabetes, with minimal guidance. RESEARCH DESIGN AND METHODS: A randomized controlled trial was conducted in the Netherlands in 255 adult...... no beneficial effect on glycemic control (P > 0.05). CONCLUSIONS: Web-based CBT depression treatment is effective in reducing depressive symptoms in adults with type 1 and type 2 diabetes. In addition, the intervention reduces diabetes-specific emotional distress in depressed patients.......OBJECTIVE: Comorbid depression is common in patients with type 1 and type 2 diabetes, adversely affecting quality of life, diabetes outcomes, and mortality. Depression can be effectively treated with cognitive behavior therapy (CBT). The Internet is a new and attractive method for delivering CBT...
US healthcare costs attributable to type A and type B influenza.
Yan, Songkai; Weycker, Derek; Sokolowski, Stefania
2017-09-02
While the overall healthcare burden of seasonal influenza in the United States (US) has been well characterized, the proportion of influenza burden attributable to type A and type B illness warrants further elucidation. The aim of this study was to estimate numbers of healthcare encounters and healthcare costs attributable to influenza viral strains A and B in the US during the 2001/2002 - 2008/2009 seasons. Healthcare encounters and costs in the US during the 2001/2002 - 2008/2009 seasons for influenza type A and influenza type B were estimated separately and collectively, by season and age group, based on data from published literature and secondary sources for: rates of influenza-related encounters requiring formal healthcare, unit costs of influenza-related healthcare encounters, and estimates of population size. Across 8 seasons, projected annual numbers of influenza-related healthcare encounters ranged from 11.3-25.6 million, and healthcare costs, from $2.0-$5.8 billion. While the majority of influenza illness was attributable to type A strains, type B strains accounted for 37% of healthcare costs across all seasons, and as much as 66% in a single season. The outpatient burden of type B disease was considerable among persons aged 18-64 y while the hospital cost burden was highest in young children. Influenza viral strain B was associated with considerable health system burden each year during the period of interest. Increasing influenza vaccine coverage, especially with the recently approved quadrivalent products including an additional type B strain, could potentially reduce overall annual influenza burden in the US.
Towards Practical Gradual Typing
Takikawa, Asumu; Feltey, Daniel; Dean, Earl; Flatt, Matthew; Findler, Robert Bruce; Tobin-Hochstadt, Sam; Felleisen, Matthias
2015-01-01
Over the past 20 years, programmers have embraced dynamically-typed programming languages. By now, they have also come to realize that programs in these languages lack reliable type information for software engineering purposes. Gradual typing addresses this problem; it empowers programmers to annotate an existing system with sound type information on a piecemeal basis. This paper presents an implementation of a gradual type system for a full-featured class-based language as well as a novel p...
International Nuclear Information System (INIS)
Milisavljevic, D.; Margutti, R.; Kamble, A.; Patnaude, D. J.; Raymond, J. C.; Challis, P.; Drout, M. R.; Grindlay, J. E.; Kirshner, R. P.; Lunnan, R.; Miller, G. F.; Parrent, J. T.; Sanders, N. E.; Eldridge, J. J.; Fong, W.; Bietenholz, M.; Chornock, R.; Fransson, C.; Fesen, R. A.; Mackey, J.
2015-01-01
We present optical observations of supernova SN 2014C, which underwent an unprecedented slow metamorphosis from H-poor type Ib to H-rich type IIn over the course of one year. The observed spectroscopic evolution is consistent with the supernova having exploded in a cavity before encountering a massive shell of the progenitor star’s stripped hydrogen envelope. Possible origins for the circumstellar shell include a brief Wolf–Rayet fast wind phase that overtook a slower red supergiant wind, eruptive ejection, or confinement of circumstellar material by external influences of neighboring stars. An extended high velocity Hα absorption feature seen in near-maximum light spectra implies that the progenitor star was not completely stripped of hydrogen at the time of core collapse. Archival pre-explosion Subaru Telescope Suprime-Cam and Hubble Space Telescope Wide Field Planetary Camera 2 images of the region obtained in 2009 show a coincident source that is most likely a compact massive star cluster in NGC 7331 that hosted the progenitor system. By comparing the emission properties of the source with stellar population models that incorporate interacting binary stars we estimate the age of the host cluster to be 30–300 Myr, and favor ages closer to 30 Myr in light of relatively strong Hα emission. SN 2014C is the best observed member of a class of core-collapse supernovae that fill the gap between events that interact strongly with dense, nearby environments immediately after explosion and those that never show signs of interaction. Better understanding of the frequency and nature of this intermediate population can contribute valuable information about the poorly understood final stages of stellar evolution
Energy Technology Data Exchange (ETDEWEB)
Milisavljevic, D.; Margutti, R.; Kamble, A.; Patnaude, D. J.; Raymond, J. C.; Challis, P.; Drout, M. R.; Grindlay, J. E.; Kirshner, R. P.; Lunnan, R.; Miller, G. F.; Parrent, J. T.; Sanders, N. E. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA, 02138 (United States); Eldridge, J. J. [Department of Physics, University of Auckland, Private Bag 92019, Auckland (New Zealand); Fong, W. [Steward Observatory, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Bietenholz, M. [Hartebeesthoek Radio Observatory, P.O. Box 443, Krugersdorp 1740 (South Africa); Chornock, R. [Astrophysical Institute, Department of Physics and Astronomy, 251B Clippinger Lab, Ohio University, Athens, OH 45701 (United States); Fransson, C. [Oskar Klein Centre, Department of Astronomy, Stockholm University, AlbaNova, SE106 91 Stockholm (Sweden); Fesen, R. A. [Department of Physics and Astronomy, Dartmouth College, 6127 Wilder Lab, Hanover, NH 03755 (United States); Mackey, J., E-mail: dmilisav@cfa.harvard.edu [Argelander-Institut für Astronomie, Auf dem Hgel 71, D-53121 Bonn (Germany); and others
2015-12-20
We present optical observations of supernova SN 2014C, which underwent an unprecedented slow metamorphosis from H-poor type Ib to H-rich type IIn over the course of one year. The observed spectroscopic evolution is consistent with the supernova having exploded in a cavity before encountering a massive shell of the progenitor star’s stripped hydrogen envelope. Possible origins for the circumstellar shell include a brief Wolf–Rayet fast wind phase that overtook a slower red supergiant wind, eruptive ejection, or confinement of circumstellar material by external influences of neighboring stars. An extended high velocity Hα absorption feature seen in near-maximum light spectra implies that the progenitor star was not completely stripped of hydrogen at the time of core collapse. Archival pre-explosion Subaru Telescope Suprime-Cam and Hubble Space Telescope Wide Field Planetary Camera 2 images of the region obtained in 2009 show a coincident source that is most likely a compact massive star cluster in NGC 7331 that hosted the progenitor system. By comparing the emission properties of the source with stellar population models that incorporate interacting binary stars we estimate the age of the host cluster to be 30–300 Myr, and favor ages closer to 30 Myr in light of relatively strong Hα emission. SN 2014C is the best observed member of a class of core-collapse supernovae that fill the gap between events that interact strongly with dense, nearby environments immediately after explosion and those that never show signs of interaction. Better understanding of the frequency and nature of this intermediate population can contribute valuable information about the poorly understood final stages of stellar evolution.
1994-03-01
4 YuN0 H CJa- La.0Lm La. 00 0 00oa 0 0 0000 0 N 0’a-4 cy 4 00 0 00 0 0 0000 0 0ON 4 m6U CIO acca anaH )N P. P 0 v N N Nn N CaM i0 111191 CA In S as...P 1 0t In’n’’n’’nl" fI4)4)Il" ffM f Nf I1co0(Go11 0, =.4 NN o0 x- 0 <ý 0C’)V I-In 40 (0 444 4444t444 44444L 0.. 1’ (00e 11 -4L >.. ItJN I-4 4) 1-4 to4
Directory of Open Access Journals (Sweden)
Oľga Danišová
2015-05-01
Full Text Available Increased risk of zoonotic transmission of the potential human pathogenic species [i]Enterocytozoon bieneusi[/i], [i]Encephalitozoon intestinalis[/i] and [i]Encephalitozoon cuniculi [/i]was detected in wild immunocompetent mice (Mus musculus musculus; n=280. Analysis was conducted with the use of PMP1/PMP2 primers and SYBR Green RT-PCR. Using Real Time PCR and comparing the sequences with sequences in the GenBank, [i]E. bieneusi[/i] was detected in 3 samples (1.07 %, [i]E. cuniculi [/i]in 1 sample (0.35 % and [i]E. intestinalis[/i] in 1 sample (0.35 %. The results of this report document the low host specificity of detected microsporidia species, and imply the importance of synanthropic rodents as a potential source of human microsporidial infection.
NOTE ABOUT THE MORALS CONCEIVED IN DIRTY HANDS
Directory of Open Access Journals (Sweden)
Humberto Pereira da Silva
2007-12-01
Full Text Available Sartre’s philosophy and the existentialism were very important to the thought in the last century. Besides being a philosopher, Sartre was also a great writer and, in his play, Dirty hands, one can see many of his ideas. Tthis paper indicates the moral question, thus, the problem of liberty, presented in this Sartre’s specific work. Tthe matter of Dirty hands, when the characters are inside of the “border-situation”, is the liberty of choice. is the moment of affirmation of liberty, to Sartre. Iin this paper it is not the objective to contest Sartre’s concepts, as the one about “border-situation” or the other about liberty, because the purpose is only to show as Sartre use them in the play Dirty hands.
Weather types in the South Shetlands (Antarctica) using a circulation type approach
Mora, Carla; João Rocha, Maria; Dutra, Emanuel; Trigo, Isabel; Vieira, Gonçalo; Fragoso, Marcelo; Ramos, Miguel
2010-05-01
Weather types in the South Shetlands (Antarctica) were defined using an automated method based on the Lamb Weather Type classification scheme (Jones et al. 1993). This is an objective classification originally developed for the British Isles (Jones et al., 1993) and also applied to southeast (Goodess and Palutikof 1998) and northwest Spain (Lorenzo et al, 2009), Portugal (Trigo and DaCamara 2000) and Greece (Maheras et al. 2004) with good results. Daily atmospheric circulation in the South Shetlands region from 1989 to 2009 was classified using a 16-node grid of sea level pressure data from the ERA Interim. The classification is obtained through the comparison of the magnitudes of the directional and rotational components of the geostrophic flow. Basic circulation types were combined into 10 groups of weather types: four directional types (NW, N, S and SW), three anticyclonic types (A, ASW and ANW), and three cyclonic types (C, CSW and CNW). Westerly flow and cyclonic circulation are the most frequent events throughout the year. The sea level pressure field for each weather type is presented and the synoptic characteristics are described. The analysis is based on ERA-Interim fields, including mean sea level pressure, precipitation, cloud cover, humidity and air temperature. Snow thickess modelled using HTESSEL is also considered. Analysis of variance (anova) and multivariate analysis (principal component analysis) are applied to evaluate the characteristics of each weather type. This circulation-type approach showed good results in the past for the downscaling of precipitation in other regions, and we are interested in evaluating the possibilities that the classification offers for downscaling precipitation, but also for snow and air temperature. For this we will be using observational data at test sites in Livingston and Deception islands. We are also motivated by the possibility of using the circulation-type approach as a predictor in statistical downscaling
Evaluation of thermal performance of all-GaN power module in parallel operation
International Nuclear Information System (INIS)
Chou, Po-Chien; Cheng, Stone; Chen, Szu-Hao
2014-01-01
This work presents an extensive thermal characterization of a single discrete GaN high-electron-mobility transistor (HEMT) device when operated in parallel at temperatures of 25 °C–175 °C. The maximum drain current (I D max ), on-resistance (R ON ), pinch-off voltage (V P ) and peak transconductance (g m ) at various chamber temperatures are measured and correlations among these parameters studied. Understanding the dependence of key transistor parameters on temperature is crucial to inhibiting the generation of hot spots and the equalization of currents in the parallel operation of HEMTs. A detailed analysis of the current imbalance between two parallel HEMT cells and its consequential effect on the junction temperature are also presented. The results from variations in the characteristics of the parallel-connected devices further verify that the thermal stability and switching behavior of these cells are balanced. Two parallel HEMT cells are operated at a safe working distance from thermal runaway to prevent destruction of the hottest cell. - Highlights: • This work reveals the sorting process of GaN devices for parallel operation. • The variations of I D max , R ON , V P , and g m with temperature are established. • The temperature-dependence parameters are crucial to prevent hot spots generation. • Safe working operation prevents thermal runaway and hottest cell destruction
Geographical distribution of hot flash frequencies: considering climatic influences.
Sievert, Lynnette Leidy; Flanagan, Erin K
2005-10-01
Laboratory studies suggest that hot flashes are triggered by small elevations in core body temperature acting within a reduced thermoneutral zone, i.e., the temperature range in which a woman neither shivers nor sweats. In the present study, it was hypothesized that women in different populations develop climate-specific thermoneutral zones, and ultimately, population-specific frequencies of hot flashes at menopause. Correlations were predicted between hot flash frequencies and latitude, elevation, and annual temperatures. Data on hot flash frequencies were drawn from 54 studies. Pearson correlation analyses and simple linear regressions were applied, first using all studies, and second using a subset of studies that included participants only to age 60 (n = 36). Regressions were repeated with all studies, controlling for method of hot flash assessment. When analyses were restricted to studies that included women up to age 60, average temperature of the coldest month was a significant predictor of hot flash frequency (P hottest and coldest temperatures was also a significant predictor (P coldest month, difference between hottest and coldest temperatures, and mean annual temperature were significant predictors of hot flash frequency. Women reported fewer hot flashes in warmer temperatures, and more hot flashes with increasing seasonality. These results suggest that acclimatization to coldest temperatures or sensitivity to seasonality may explain part of the population variation in hot flash frequency.
TypingSuite: Integrated Software for Presenting Stimuli, and Collecting and Analyzing Typing Data
Mazerolle, Erin L.; Marchand, Yannick
2015-01-01
Research into typing patterns has broad applications in both psycholinguistics and biometrics (i.e., improving security of computer access via each user's unique typing patterns). We present a new software package, TypingSuite, which can be used for presenting visual and auditory stimuli, collecting typing data, and summarizing and analyzing the…
ClusType: Effective Entity Recognition and Typing by Relation Phrase-Based Clustering
Ren, Xiang; El-Kishky, Ahmed; Wang, Chi; Tao, Fangbo; Voss, Clare R.; Ji, Heng; Han, Jiawei
2015-01-01
Entity recognition is an important but challenging research problem. In reality, many text collections are from specific, dynamic, or emerging domains, which poses significant new challenges for entity recognition with increase in name ambiguity and context sparsity, requiring entity detection without domain restriction. In this paper, we investigate entity recognition (ER) with distant-supervision and propose a novel relation phrase-based ER framework, called ClusType, that runs data-driven phrase mining to generate entity mention candidates and relation phrases, and enforces the principle that relation phrases should be softly clustered when propagating type information between their argument entities. Then we predict the type of each entity mention based on the type signatures of its co-occurring relation phrases and the type indicators of its surface name, as computed over the corpus. Specifically, we formulate a joint optimization problem for two tasks, type propagation with relation phrases and multi-view relation phrase clustering. Our experiments on multiple genres—news, Yelp reviews and tweets—demonstrate the effectiveness and robustness of ClusType, with an average of 37% improvement in F1 score over the best compared method. PMID:26705503
International Nuclear Information System (INIS)
Edwards, W.S.
1995-11-01
The Type B Drum package is a container in which a single drum containing Type B quantities of radioactive material will be packaged for shipment. The Type B Drum containers are being developed to fill a void in the packaging and transportation capabilities of the US Department of Energy (DOE), as no double containment packaging for single drums of Type B radioactive material is currently available. Several multiple-drum containers and shielded casks presently exist. However, the size and weight of these containers present multiple operational challenges for single-drum shipments. The Type B Drum containers will offer one unshielded version and, if needed, two shielded versions, and will provide for the option of either single or double containment. The primary users of the Type B Drum container will be any organization with a need to ship single drums of Type B radioactive material. Those users include laboratories, waste retrieval facilities, emergency response teams, and small facilities
Comparison of diabetic ketoacidosis in patients with type-1 and type-2 diabetes mellitus.
Barski, Leonid; Nevzorov, Roman; Harman-Boehm, Ilana; Jotkowitz, Alan; Rabaev, Elena; Zektser, Miri; Zeller, Lior; Shleyfer, Elena; Almog, Yaniv
2013-04-01
Diabetic ketoacidosis (DKA) occurs most often in patients with type 1 diabetes, however patients with type 2 diabetes are also susceptible to DKA under stressful conditions. The aims of our study were to evaluate and compare the clinical and biochemical characteristics and outcomes of type 1 versus type 2 diabetes mellitus (DM) patients with DKA. A retrospective cohort study of adult patients hospitalized with DKA between January 1, 2003, and January 1, 2010. The clinical and biochemical characteristics of DKA patients with type-1 DM were compared with those of patients with type-2 DM. The primary outcome was in-hospital all-cause mortality. The study cohort included 201 consecutive patients for whom the admission diagnosis was DKA: 166 patients (82.6%) with type-1 DM and 35 patients (17.4%) with type-2 DM. The patients with DKA and type-2 DM were significantly older than patients with type-1 DM (64.3 versus 37.3, P ventilation and bed-ridden state were independent predictors of 30-day mortality.
Bartoletti , Massimo; Scalas , Alceste; Tuosto , Emilio; Zunino , Roberto
2013-01-01
We propose a type system for a calculus of contracting processes. Processes can establish sessions by stipulating contracts, and then can interact either by keeping the promises made, or not. Type safety guarantees that a typeable process is honest - that is, it abides by the contracts it has stipulated in all possible contexts, even in presence of dishonest adversaries. Type inference is decidable, and it allows to safely approximate the honesty of processes using either synchronous or async...
International Nuclear Information System (INIS)
Nagamachi, Shigeki; Inoue, Kenjiro; Jinnouchi, Seishi; Hoshi, Hiroaki; Ono, Seiji; Ohnishi, Takashi; Futami, Shigemi; Watanabe, Katsushi; Hayashi, Tohru
1994-01-01
Tl-201 SPECT and Tc-99m-Human serum albumin (HSA) multigated radionuclide ventriculography were performed on 11 patients with progressive muscular dystrophy (Becker type 2, Fukuyama type 2, Limb-girdle type 7) to evaluate myocardial involvement. Hypoperfusion was detected in 8 patients on Tl-201 SPECT. Decreases in both systolic function (left ventricular ejection fraction; LVEF) and diastolic function (peak filling rate; PFR) were also seen in these patients. A high incidence of myocardial involvement of these kinds of progressive muscular dystrophy was suggested. (author)
Energy Technology Data Exchange (ETDEWEB)
Nagamachi, Shigeki; Inoue, Kenjiro; Jinnouchi, Seishi; Hoshi, Hiroaki; Ono, Seiji; Ohnishi, Takashi; Futami, Shigemi; Watanabe, Katsushi; Hayashi, Tohru [Miyazaki Medical Coll., Kiyotake (Japan)
1994-02-01
Tl-201 SPECT and Tc-99m-Human serum albumin (HSA) multigated radionuclide ventriculography were performed on 11 patients with progressive muscular dystrophy (Becker type 2, Fukuyama type 2, Limb-girdle type 7) to evaluate myocardial involvement. Hypoperfusion was detected in 8 patients on Tl-201 SPECT. Decreases in both systolic function (left ventricular ejection fraction; LVEF) and diastolic function (peak filling rate; PFR) were also seen in these patients. A high incidence of myocardial involvement of these kinds of progressive muscular dystrophy was suggested. (author).
DEFF Research Database (Denmark)
Winther, Johnni
Types in programming languages provide a powerful tool for the programmer to document the code so that a large aspect of the intent can not only be presented to fellow programmers but also be checked automatically by compilers. The precision with which types model the behavior of programs...... is crucial to the quality of these automated checks, and in this thesis we present three different improvements to the precision of types in three different aspects of the Java programming language. First we show how to extend the type system in Java with a new type which enables the detection of unintended...
Nelson, Melanie
2010-01-01
TypePad for Dummies will be on guiding readers through the technical tasks necessary for starting, using and customizing a TypePad blog. It will comprehensively explain choosing the right TypePad membership plan, singing up, configuring, using and customizing a blog using the TypePad system. It will also include: Illustrations from real-world blogs with screenshots and specific examples that bring the book's concepts and ideas to life.; Step-by-step tutorials that will walk readers through the process of signing up for a new TypePad blog and getting down the business of publishing their conten
... Red Cell Plasma Platelets Red Cells What blood donation type is best for me? **If you do ... type, a whole blood donation is recommended** Blood Donation Types: Volunteer Donations The standard or most common ...
Full Text Available ... En Español Type 1 Type 2 About Us Online Community Meal Planning Sign In Search: Search More ... Diagnosing Diabetes and Learning About Prediabetes Type 2 Diabetes Risk Test Lower ...
Alcorn wells bolster Philippines oil production
International Nuclear Information System (INIS)
Anon.
1992-01-01
This paper reports that Alcorn International Inc., Houston, is producing about 16,500 b/d of oil from West Linapacan A field in the South China Sea off the Philippines. The field's current production alone is more than fivefold the Philippines' total average oil flow of 3,000 b/d in 1991. It's part of a string of oil and gas strikes off Palawan Island that has made the region one of the hottest exploration/development plays in the Asia-Pacific theater
Caty Frenkel
2006-01-01
Call frequency and movements of the gecko Hemidactylus frenatus were studied in Punta Morales, Costa Rica from April 1999 through May 2000. Call activity of H. frenatus was positively related to air temperature at night and throughout the year. Higher activity was at dusk, dawn, and during the hottest months. Call frequency was related with gecko abundance per month, although not during the night. More males and females had a regenerated tail compared to juveniles, the last ones could have it...
Madyshev Ilnur; Dmitrieva Oksana; Dmitriev Andrey
2017-01-01
A device for cooling the oil-immersed transformer by means of thermoelectric transducers has been developed. Their operating principle is based on the fact that at night at minimum ambient temperature, the cold is accumulated inside of a vessel due to formation of water ice layer on the developed surfaces of thermoelectric transducers` ribs. Melting of this layer is used in the hottest time of a day for additional cooling of transformer oil in the cooling system of the transformer. Pre-coolin...
ASPEK PSIKOLOGI, SOSIAL-KULTURAL DAN SIKAP ISLAM TERHADAP PERILAKU TRANSEKSUAL DI INDONESIA
Widodo Winarso
2015-01-01
The aspect of social issues becomes one of the concerns of contemporary Islam. This aspect is usually discussed and became the hottest news in social life. One might feel having lack of unanimity in the provision of public attitudes towards him/her self. This is what happened to transsexual and genital surgery people. Those who have and do the things that feel cornered because people assume the actions carried out under the assumption that they have been violated. Transsexual is a person whos...
Aspek Psikologi, Sosial-Kultural dan Sikap Islam terhadap Perilaku Transeksual di Indonesia
Widodo Winarso
2015-01-01
The aspect of social issues becomes one of the concerns of contemporary Islam. This aspect is usually discussed and became the hottest news in social life. One might feel having lack of unanimity in the provision of public attitudes towards him/her self. This is what happened to transsexual and genital surgery people. Those who have and do the things that feel cornered because people assume the actions carried out under the assumption that they have been violated. Transsexual is a person whos...
A New Mobile Learning Adaptation Model
Mohamd Hassan Hassan; Jehad Al-Sadi
2009-01-01
This paper introduces a new model for m- Learning context adaptation due to the need of utilizing mobile technology in education. Mobile learning; m-Learning for short; in considered to be one of the hottest topics in the educational community, many researches had been done to conceptualize this new form of learning. We are presenting a promising design for a model to adapt the learning content in mobile learning applications in order to match the learner context, preferences and the educatio...
Payment, Simone
2017-01-01
This straightforward but fascinating book takes a close look at Venus and shows young people just how different our neighboring planet is from our own. Known as the hottest planet, Venus is an example of the greenhouse effect to the extreme. Young readers will take a tour beneath the sulfur dioxide clouds and see the planet's surface up close with images taken by the Magellan and the Venus Express missions. This book will surely fascinate any young person interested in alien worlds.
Vapor generator steam drum spray heat
International Nuclear Information System (INIS)
Fasnacht, F.A. Jr.
1978-01-01
A typical embodiment of the invention provides a combination feedwater and cooldown water spray head that is centrally disposed in the lower portion of a nuclear power plant steam drum. This structure not only discharges the feedwater in the hottest part of the steam drum, but also increases the time required for the feedwater to reach the steam drum shell, thereby further increasing the feedwater temperature before it contacts the shell surface, thus reducing thermal shock to the steam drum structure
Very High Frequency Switch-Mode Power Supplies.:Miniaturization of Power Electronics.
Madsen, Mickey Pierre; Andersen, Michael A. E.; Knott, Arnold
2015-01-01
The importance of technology and electronics in our daily life is constantly increasing. At the same time portability and energy efficiency are currently some of the hottest topics. This creates a huge need for power converters in a compact form factor and with high efficiency, which can supply these electronic devices. This calls for new technologies in order to miniaturize the power electronics of today. One way to do this is by increasing the switching frequency dramatically and develop ve...
Nustar: Bringing the High-Energy Universe into Focus
Fineberg, Larry
2016-01-01
This is a presentation to students at the University of Florida in the Small Satellite Design Club. The subject matter is the NuSTAR mission and covers topics about the spacecraft itself and the launch campaign. NASA's Nuclear Spectroscopic Telescope Array (NuSTAR) is the first focusing high-energy X-ray mission. Studies the hottest, densest, most energetic phenomena in the Universe. Purpose is to search for black holes, map the remnants of stellar explosions, and study the most extreme active galaxies.
Efficient assignment of the temperature set for Parallel Tempering
International Nuclear Information System (INIS)
Guidetti, M.; Rolando, V.; Tripiccione, R.
2012-01-01
We propose a simple algorithm able to identify a set of temperatures for a Parallel Tempering Monte Carlo simulation, that maximizes the probability that the configurations drift across all temperature values, from the coldest to the hottest ones, and vice versa. The proposed algorithm starts from data gathered from relatively short Monte Carlo simulations and is straightforward to implement. We assess its effectiveness on a test case simulation of an Edwards–Anderson spin glass on a lattice of 12 3 sites.
Monitoring of full scale tensegrity skeletons under temperature change
KAWAGUCHI, Ken'ichi; OHYA, Shunji
2009-01-01
p. 224-231 Strain change in the members of full-scale tensegrity skeletons has been monitored for eight years. The one-day data of one of the tensegrity frame on the hottest and the coldest day in the record are reported and discussed. Kawaguchi, K.; Ohya, S. (2009). Monitoring of full scale tensegrity skeletons under temperature change. Symposium of the International Association for Shell and Spatial Structures. Editorial Universitat Politècnica de València. http://hdl.handle.net/10...
Mapping climate change in European temperature distributions
Stainforth, David A.; Chapman, Sandra C.; Watkins, Nicholas W.
2014-01-01
Climate change poses challenges for decision makers across society, not just in preparing for the climate of the future but even when planning for the climate of the present day. When making climate sensitive decisions, policy makers and adaptation planners would benefit from information on local scales and for user-specific quantiles (e.g. the hottest/coldest 5% of days) and thresholds (e.g. days above 28 ° C), not just mean changes. Here, we translate observations of weather into observatio...
Mapping climate change in European temperature distributions
Stainforth, David A; Chapman, Sandra C; Watkins, Nicholas W
2013-01-01
Climate change poses challenges for decision makers across society, not just in preparing for the climate of the future but even when planning for the climate of the present day. When making climate sensitive decisions, policy makers and adaptation planners would benefit from information on local scales and for user-specific quantiles (e.g. the hottest/coldest 5% of days) and thresholds (e.g. days above 28 ° C), not just mean changes. Here, we translate observations of weather into observatio...
Asad, Muhammad
2014-01-01
Import export businesses, also known as international trading, are one of the hottest commercial trends of this decade. Since the owner of an import export enterprise, can work as a distributor by focusing on exporting and importing goods and services that cannot be obtained on national soil. With a rapidly growing population of about 150 million, Pakistan is a major country, recognized by the international community, and is one of the most important actors in the Islamic world. Based on its ...
Implications of Big Data for cell biology
Dolinski, Kara; Troyanskaya, Olga G.
2015-01-01
“Big Data” has surpassed “systems biology” and “omics” as the hottest buzzword in the biological sciences, but is there any substance behind the hype? Certainly, we have learned about various aspects of cell and molecular biology from the many individual high-throughput data sets that have been published in the past 15–20 years. These data, although useful as individual data sets, can provide much more knowledge when interrogated with Big Data approaches, such as applying integrative methods ...
Behavioral economics survey of patients with type 1 and type 2 diabetes
Directory of Open Access Journals (Sweden)
Emoto N
2015-05-01
Full Text Available Naoya Emoto,1 Fumitaka Okajima,1 Hitoshi Sugihara,2 Rei Goto3,4 1Division of Endocrinology, Department of Medicine, Nippon Medical School Chiba Hokusoh Hospital, Chiba, 2Department of Endocrinology, Diabetes and Metabolism, Graduate School of Medicine, Nippon Medical School, Tokyo, 3Hakubi Center of Advanced Research, Kyoto University, Kyoto, 4Graduate School of Economics, Kyoto University, Kyoto, Japan Background: Adherence to treatment and the metabolic control of diabetes are challenging in many patients with diabetes. The theory of neuroeconomics can provide important clues for understanding unreasonable human behavior concerning decisions between outcomes occurring at different time points. Objective: We investigated patients with type 1 and type 2 diabetes to determine whether patients who are at a risk of developing complications are less risk averse. We also examined whether patients with type 1 and type 2 diabetes have different behavioral traits in decision making under risk. Methods: We conducted a behavioral economics survey of 219 outpatients, 66 with type 1 diabetes and 153 with type 2 diabetes. All patients had been referred by general practitioners or other departments in the hospital. At the time of the survey, levels of hemoglobin A1c were not significantly different between patients with type 1 and type 2 diabetes. Results: Patients with type 2 diabetes showed a lower response rate to the survey compared with patients with type 1 diabetes (71.9% vs 87.9%, P<0.01. Logistic regression analysis indicated that diabetic retinopathy was negatively associated with risk averse in pricing of hypothetical lotteries, myopic time preference, willingness to pay for preventive medicine, and levels of satisfaction with life. Diabetic nephropathy was also negatively associated with risk averse in pricing of hypothetical lotteries. Detailed analysis revealed that a lower proportion of patients with type 2 diabetes (22.7% were categorized
Human muscle fiber type-specific insulin signaling: Impact of obesity and type 2 diabetes
DEFF Research Database (Denmark)
Albers, Peter Hjorth; Pedersen, Andreas J T; Birk, Jesper Bratz
2015-01-01
Skeletal muscle is a heterogeneous tissue composed of different fiber types. Studies suggest that insulin-mediated glucose metabolism is different between muscle fiber types. We hypothesized that differences are due to fiber-type specific expression/regulation of insulin signaling elements and....../or metabolic enzymes. Pools of type I and II fibers were prepared from biopsies of the vastus lateralis muscles from lean, obese and type 2 diabetic subjects before and after a hyperinsulinemic-euglycemic clamp. Type I fibers compared to type II fibers have higher protein levels of the insulin receptor, GLUT4......, hexokinase II, glycogen synthase (GS), pyruvate dehydrogenase (PDH-E1α) and a lower protein content of Akt2, TBC1D4 and TBC1D1. In type I fibers compared to type II fibers, the phosphorylation-response to insulin was similar (TBC1D4, TBC1D1 and GS) or decreased (Akt and PDH-E1α). Phosphorylation...
Kelly, Janet
1997-01-01
Presents a blood type puzzle that provides a visual, hands-on mechanism by which students can examine blood group reactions. Offers students an opportunity to construct their own knowledge about blood types. (JRH)
Full Text Available ... a Member Donate Now! One Time Monthly In Memory In Honor Become a Member En Español Type 1 Type ... Diagnosing Diabetes and Learning About Prediabetes Type 2 Diabetes Risk Test Lower ...
Full Text Available ... Do I Begin With Type2? Living With Type 1 Diabetes Enroll in the Living WIth Type 2 Diabetes Program In It Together We Can Help ... Tips for Caregivers Health Insurance Health Insurance ...
Comparative study T-type and I-type layout of PWR nuclear power plants
International Nuclear Information System (INIS)
Eko Rudi Iswanto and Siti Alimah
2010-01-01
Determining plant layout is one of the five major stages during the life time of a nuclear power plant. Some important factors that affect in the selecting of plant layout are availability of infrastructure, economic aspects, social aspects, public and environment safety, and also easy to do. Another factor to be considered is requirements as seismic design, which refers to the principles of good security workers, communities and the environment of radiological risks. There are many layout types of nuclear power plant, two of them are T-type layout and I-type layout. Each type of the plant layout has advantage and disadvantage, therefore this study is to understand them. Good layout is able to provide a high level of security against earthquakes. In term of earthquake design, I-type layout has a higher security level than T-type layout. Therefore, I-type layout can be a good choice for PWR nuclear power plants 1000 MWe that will be built in Indonesia. (author)
Full Text Available ... Day Diabetes Basics Home Symptoms Diagnosis America's Diabetes Challenge Type 1 Type 2 Facts About Type 2 ... Planner, and tips from experts Let's Be Well: Products to help you thrive with diabetes - lets-be- ...
Full Text Available ... August 1, 2013 Last Edited: October 27, 2015 Articles from Diabetes Forecast® magazine: lp-type-2, . In this section Diabetes Basics Type 2 Facts About Type 2 Recently Diagnosed Treatment and Care Blood ...
Full Text Available ... Ways to Give Close Are You at Risk? Home Prevention Diagnosing Diabetes and Learning About Prediabetes Type ... To Know Your Risk Alert Day Diabetes Basics Home Symptoms Diagnosis America's Diabetes Challenge Type 1 Type ...
Types for DSP Assembler Programs
DEFF Research Database (Denmark)
Larsen, Ken
2006-01-01
for reuse, and a procedure that computes point-wise vector multiplication. The latter uses a common idiom of prefetching memory resulting in out-of-bounds reading from memory. I present two extensions to the baseline type system: The first extension is a simple modification of some type rules to allow out......-ofbounds reading from memory. The second extension is based on two major modifications of the baseline type system: • Abandoning the type-invariance principle of memory locations and using a variation of alias types instead. • Introducing aggregate types, making it possible to have different views of a block...... of memory, thus enabling type checking of programs that directly manage and reuse memory. I show that both the baseline type system and the extended type system can be used to give type annotations to handwritten DSP assembler code, and that these annotations precisely and succinctly describe...
Directory of Open Access Journals (Sweden)
Sara Capecchi
2010-02-01
Full Text Available The BioAmbients calculus is a process algebra suitable for representing compartmentalization, molecular localization and movements between compartments. In this paper we enrich this calculus with a static type system classifying each ambient with group types specifying the kind of compartments in which the ambient can stay. The type system ensures that, in a well-typed process, ambients cannot be nested in a way that violates the type hierarchy. Exploiting the information given by the group types, we also extend the operational semantics of BioAmbients with rules signalling errors that may derive from undesired ambients' moves (i.e. merging incompatible tissues. Thus, the signal of errors can help the modeller to detect and locate unwanted situations that may arise in a biological system, and give practical hints on how to avoid the undesired behaviour.
Schmidt, Katja; Garbe-Schönberg, Dieter; Hannington, Mark D.; Anderson, Melissa O.; Bühring, Benjamin; Haase, Karsten; Haruel, Christy; Lupton, John; Koschinsky, Andrea
2017-06-01
In 2013, high-temperature vent fluids were sampled in the Nifonea vent field. This field is located within the caldera of a large shield-type volcano of the Vate Trough, a young extensional rift in the New Hebrides back-arc. Hydrothermal venting occurs as clear and black smoker fluids with temperatures up to 368 °C, the hottest temperatures measured so far in the western Pacific. The physico-chemical conditions place the fluids within the two-phase field of NaCl-H2O, and venting is dominated by vapour phase fluids with Cl concentrations as low as 25 mM. The fluid composition, which differs between the individual vent sites, is interpreted to reflect the specific geochemical fluid signature of a hydrothermal system in its initial, post-eruptive stage. The strong Cl depletion is accompanied by low alkali/Cl ratios compared to more evolved hydrothermal systems, and very high Fe/Cl ratios. The concentrations of REY (180 nM) and As (21 μM) in the most Cl-depleted fluid are among the highest reported so far for submarine hydrothermal fluids, whereas the inter-element REY fractionation is only minor. The fluid signature, which has been described here for the first time in a back-arc setting, is controlled by fast fluid passage through basaltic volcanic rocks, with extremely high water-rock ratios and only limited water-rock exchange, phase separation and segregation, and (at least) two-component fluid mixing. Metals and metalloids are unexpectedly mobile in the vapour phase fluids, and the strong enrichments of Fe, REY, and As highlight the metal transport capacity of low-salinity, low-density vapours at the specific physico-chemical conditions at Nifonea. One possible scenario is that the fluids boiled before the separated vapour phase continued to react with fresh glassy lavas. The mobilization of metals is likely to occur by leaching from fresh glass and grain boundaries and is supported by the high water/rock ratios. The enrichment of B and As is further controlled
Full Text Available ... Home Prevention Diagnosing Diabetes and Learning About Prediabetes Type 2 Diabetes Risk Test Lower Your Risk Healthy Eating Overweight ... About Type 2 Enroll in the Living WIth Type 2 Diabetes Program Gestational What is Gestational Diabetes? How to ...
Analog insulin detemir for patients with type 1 and type 2 diabetes: a review
Directory of Open Access Journals (Sweden)
Gregory E Peterson
2009-05-01
Full Text Available Gregory E PetersonDepartment of Internal Medicine, Des Moines University, USAObjective: To review insulin detemir for clinical use to better manage patients with type 1 and type 2 diabetes.Methods: A MEDLINE search, in English, from June 30, 2006 to December 1, 2008, using the terms “insulin analogs,” “insulin detemir” and “long-acting insulin analog.”Results: Insulin detemir improves glycemic control, based on HbA1C reduction and fasting glucose levels, without increasing the risk of hypoglycemia and weight gain. Insulin detemir has lower glycemic variability, with less intra-subject variability in blood glucose levels in patients with type 1 and type 2 diabetes, without increasing the risk of hypoglycemia. When added to oral anti-diabetes agents (OADs in type 2 diabetes, insulin detemir demonstrates superiority to other basal insulin options.Conclusion: Insulin detemir appears to provide better glycemic control with a lower risk of hypoglycemia and less weight gain in the treatment of patients with type 1 and type 2 diabetes.Keywords: type 1 diabetes, type 2 diabetes, insulin analogs, insulin detemir
... this page: //medlineplus.gov/ency/patientinstructions/000910.htm Types of chemotherapy To use the sharing features on this page, ... cancer.org/treatment/treatments-and-side-effects/treatment-types/chemotherapy/how-chemotherapy-drugs-work.html . Updated February 15, ...
The Limitations of <i>In Vitro Experimentation in Understanding Biofilms and Chronic Infection
DEFF Research Database (Denmark)
Roberts, Aled E. L.; Kragh, Kasper N.; Bjarnsholt, Thomas
2015-01-01
a systematic review of the most widely used in vitro biofilm systems, and we discuss why they are not always representative of the in vivo biofilms found in chronic infections. We present examples of methods that will help us to bridge the gap between in vitro and in vivo biofilm work so that we can ultimately......We have become increasingly aware that, during infection, pathogenic bacteria often grow in multicellular biofilms that are often highly resistant to antibacterial strategies. In order to understand how biofilms form and contribute to infection, many research groups around the world have heavily...
Methodology of the On-Iine FoIIow Simulation of Pebble-bed High-temperature Reactors
International Nuclear Information System (INIS)
Xia Bing; Li Fu; Wei Chunlin; Zheng Yanhua; Chen Fubing; Zhang Jian; Guo Jiong
2014-01-01
The on-line fuel management is an essential feature of the pebble-bed high-temperature reactors (PB-HTRs), which is strongly coupled with the normal operation of the reactor. For the purpose of on-line analysis of the continuous shuffling scheme of numerous fuel pebbles, the follow simulation upon the real operation is necessary for the PB-HTRs. In this work, the on-line follow simulation methodology of the PB-HTRs’ operation is described, featured by the parallel treatments of both neutronics analysis and fuel cycling simulation. During the simulation, the operation history of the reactor is divided into a series of burn-up cycles according to the behavior of operation data, in which the steady-state neutron transport equations are solved and the diffusion theory is utilized to determine the physical features of the reactor core. The burn-up equations of heavy metals, fission products and neutron poisons including B-10, decoupled from the pebble flow term, are solved to analyze the burn-up process within a single burn-up cycle. The effect of pebble flow is simulated separately through a discrete fuel shuffling pattern confined by curved pebble flow channels, and the effect of multiple pass of the fuel is represented by logical batches within each spatial region of the core. The on-line thermal-hydraulics feedback is implemented for each bur-up cycle by using the real thermal-hydraulics data of the core operation. The treatment of control rods and absorber balls is carried out by utilizing a coupled neutron transport-diffusion calculation along with discontinuity factors. The physical models mentioned above are established mainly by using a revised version of the V.S.O.P program system. The real operation data of HTR-10 is utilized to verify the methodology presented in this work, which gives good agreement between simulation results and operation data. (author)
An <i>in vitro Method for Predicting Inhalation Toxicity of Impregnation Spray Products
DEFF Research Database (Denmark)
Sørli, Jorid B.; Hansen, Jitka S.; Nørgaard, Asger Wisti
2015-01-01
Impregnation spray products are used for making surfaces water and dirt repellent. The products are composed of one or more active film-forming components dissolved or suspended in an appropriate solvent mixture. Exposure to impregnation spray products may cause respiratory distress and new cases...
International Nuclear Information System (INIS)
Mun, K. H.; Seok, S. D.; Song, K. D.; Kim, I. C.
1999-01-01
A preliminary economic comparison study was performed for KALIMER(Korea Advanced LIquid MEtal Reactor)between a modular plant type with 8 150MWe modules and a 1200MWe monolithic plant type. In both cases of FOAK (First-Of-A-Kind) Plant and NOAK (Nth-Of-A-Kind) Plant, the result says that the economics of monolithic plant is superior to its modular plant. In case of NOAK plant comparison, however, the cost difference is not significant. It means that modular plant can compete with monolithic plant in capital cost if it makes efforts of cost reduction and technical progress on the assumption that the same type of NOAK plant will be constructed continuously
The nurses role in preventing type 2 diabetes mellitus type 2
Kittilsen, Jannike Granum; Lerfaldet, Hanne Nyhus; Norhaug, Anikken Thomassen; Tangen, Emmy Helene
2016-01-01
Innledning: Diabetes mellitus type 2 er et økende problem både i Norge og internasjonalt. Forekomsten av diabetes mellitus type 2 er firedoblet fra 1980 til 2014. Hensikt: Undersøke hvordan livsstilsendringer kan forebygge utviklingen av diabetes mellitus type 2, og hva sykepleiers rolle er i forebyggingen. Metode: Det har blitt benyttet litteraturstudie som metode. Systematiske søk ble gjort i databasene: Cinahl Complete, Ovid Nursing Database og Medline. Resultat: Gjennom systematisk søk er...
The Role of MIF in Type 1 and Type 2 Diabetes Mellitus
Directory of Open Access Journals (Sweden)
Yuriko I. Sánchez-Zamora
2014-01-01
Full Text Available Autoimmunity and chronic low-grade inflammation are hallmarks of diabetes mellitus type one (T1DM and type two (T2DM, respectively. Both processes are orchestrated by inflammatory cytokines, including the macrophage migration inhibitory factor (MIF. To date, MIF has been implicated in both types of diabetes; therefore, understanding the role of MIF could affect our understanding of the autoimmune or inflammatory responses that influence diabetic pathology. This review highlights our current knowledge about the involvement of MIF in both types of diabetes in the clinical environment and in experimental disease models.
Simulating US Agriculture in a Modern Dust Bowl Drought
Glotter, Michael; Elliott, Joshua
2016-01-01
Drought-induced agricultural loss is one of the most costly impacts of extreme weather, and without mitigation, climate change is likely to increase the severity and frequency of future droughts. The Dust Bowl of the 1930s was the driest and hottest for agriculture in modern US history. Improvements in farming practices have increased productivity, but yields today are still tightly linked to climate variation and the impacts of a 1930s-type drought on current and future agricultural systems remain unclear. Simulations of biophysical process and empirical models suggest that Dust-Bowl-type droughts today would have unprecedented consequences, with yield losses approx.50% larger than the severe drought of 2012. Damages at these extremes are highly sensitive to temperature, worsening by approx.25% with each degree centigrade of warming. We find that high temperatures can be more damaging than rainfall deficit, and, without adaptation, warmer mid-century temperatures with even average precipitation could lead to maize losses equivalent to the Dust Bowl drought. Warmer temperatures alongside consecutive droughts could make up to 85% of rain-fed maize at risk of changes that may persist for decades. Understanding the interactions of weather extremes and a changing agricultural system is therefore critical to effectively respond to, and minimize, the impacts of the next extreme drought event.
Harnessing type I and type III CRISPR-Cas systems for genome editing
DEFF Research Database (Denmark)
Li, Yingjun; Pan, Saifu; Zhang, Yan
2016-01-01
CRISPR-Cas (clustered regularly interspaced short palindromic repeats-CRISPR-associated) systems are widespread in archaea and bacteria, and research on their molecular mechanisms has led to the development of genome-editing techniques based on a few Type II systems. However, there has not been any...... report on harnessing a Type I or Type III system for genome editing. Here, a method was developed to repurpose both CRISPR-Cas systems for genetic manipulation in Sulfolobus islandicus, a thermophilic archaeon. A novel type of genome-editing plasmid (pGE) was constructed, carrying an artificial mini-CRISPR...... and selectively retained as transformants. Using this strategy, different types of mutation were generated, including deletion, insertion and point mutations. We envision this method is readily applicable to different bacteria and archaea that carry an active CRISPR-Cas system of DNA interference provided...
The brass-type texture and its deviation from the copper-type texture
DEFF Research Database (Denmark)
Leffers, Torben; Ray, R.K.
2009-01-01
Our basic aim with the present review is to address the classical problem of the “fcc rolling texture transition” – the fact that fcc materials may, depending on material parameters and rolling conditions, develop two different types of rolling textures, the copper-type texture and the brass...... the subject and sketch our approach for dealing with it. We then recapitulate the decisive progress made during the nineteen sixties in the empirical description of the fcc rolling texture transition and in lining up a number of possible explanations. Then follows a section about experimental investigations...... of the brass-type texture after the nineteen sixties covering texture measurements and microstructural investigations. The main observations are: (1) The brass-type texture deviates from the copper-type texture from an early stage of texture development. (2) Deformation twinning has a decisive effect...
Suicidal ideation reported by adults with Type 1 or Type 2 diabetes
DEFF Research Database (Denmark)
Handley, T E; Ventura, A D; Browne, Jessica L
2016-01-01
factor for a suicide attempt, the findings have implications for healthcare professionals, pointing to the importance of adequate screening and action plans for appropriate follow-up of those reporting depression. Our findings are also indicative of the psychological toll of diabetes more generally......AIMS: To examine the prevalence and correlates of suicidal ideation (SI) in a community-based sample of adults with Type 1 or Type 2 diabetes. METHODS: Participants were 3338 adults aged 18-70 years with Type 1 diabetes (n = 1376) or Type 2 diabetes (non-insulin: n = 1238; insulin: n = 724) from...... a national survey administered to a random sample registered with the National Diabetes Services Scheme. Depression and SI were assessed using the Patient Health Questionnaire, and diabetes-specific distress with the Problem Areas In Diabetes scale. Separate logistic regression analyses by diabetes type...
DEFF Research Database (Denmark)
Green, Anders; Kyvik, Kirsten Ohm
2001-01-01
Prediction of Type 1 diabetes at individual level is relevant for any possible intervention before clinical disease develops. Currently available markers of Type 1 diabetes include genetic specificities and immune markers, in addition to a positive family history. This chapter reviews the measures...... and methods of importance in predicting Type 1 diabetes. Based on numerical examples it is demonstrated that available markers have a low level of performance, even when combined. Even so, combined marker information may allow for the identification of the large majority of the general population who...... is at very low disease risk. The impact at population level of predicting Type 1 diabetes varies between societies because the performance of markers depends on levels of disease risk and distribution of markers within a population. The incorporation of the influence of non-genetic etiological factors may...
Maternal and Neonatal Outcomes in Korean Women with Type 1 and Type 2 Diabetes
Directory of Open Access Journals (Sweden)
Hee-Sook Kim
2015-08-01
Full Text Available BackgroundThe purpose of this study was to evaluate maternal and neonatal outcomes in Korean women with type 1 diabetes and type 2 diabetes.MethodsWe performed a retrospective survey of 163 pregnancies in women with type 1 diabetes (n=13 and type 2 diabetes (n=150 treated from 2003 to 2010 at Cheil General Hospital & Women's Healthcare Center, Korea. We compared maternal characteristics as well as maternal and neonatal outcomes between groups.ResultsDifferences in glycosylated hemoglobin between type 1 and type 2 diabetes were not significant. Birth weight (3,501±689.6 g vs. 3,366±531.4 g and rate of major congenital malformations (7.7% vs. 5.6% were not significantly different. However, women with type 1 diabetes had higher rates of preeclampsia (38.5% vs. 8.2%, P=0.006, large for gestational age (LGA; 46.2% vs. 20.4%, P=0.004, macrosomia (38.5% vs. 13.4%, P=0.032, and admission for neonatal care (41.7% vs. 14.8%, P=0.03 than women with type 2 diabetes.ConclusionMaternal and neonatal outcomes for women with type 1 diabetes were poorer than for women with type 2 diabetes, especially preeclampsia, LGA, macrosomia and admission to the neonatal intensive care unit.
Scintigraphic Evaluation of Multiple Endocrine Neoplasia Type 2 ( MEN Type 2 )
International Nuclear Information System (INIS)
Lee, Jae Tae; Lee, Kyu Bo; Whang, Kee Suk; Kim, Bo Wan; Lee, In Kyu
1991-01-01
Multiple endocrine neoplasia type 2 (MEN type 2, Sipple's syndrome) is a rare disorder characterized by the association of medullary carcinoma of the thyroid, parathyroid hyperplasia and can be diagnosed in early stage of the disease by meticulous screening tests of the family. This case report describes the location and categorization of tumors using 99m Tc-pertechnetate, I -NaI, 99m Tc-pentavalent(V) DMSA, 131 I -MIBG scans in two cases of MEN type 2 occurred in a 32 year old women and her 29-year old brother. In MEN type 2, we think, combined use of 99m Tc-(V)-DMSA, 99m Tc-pertechnetate and 1 '3 1 I -MIBG may be useful for the categorization of tumor mass lesions and planning appropriate therapy.
Zampini, Valeria; Valli, Paolo; Zucca, Giampiero; Masetto, Sergio
2006-08-01
Few data are available concerning single Ca channel properties in inner ear hair cells and particularly none in vestibular type I hair cells. By using the cell-attached configuration of the patch-clamp technique in combination with the semicircular canal crista slice preparation, we determined the elementary properties of voltage-dependent Ca channels in chicken embryo type I and type II hair cells. The pipette solutions included Bay K 8644. With 70 mM Ba(2+) in the patch pipette, Ca channel activity appeared as very brief openings at -60 mV. Ca channel properties were found to be similar in type I and type II hair cells; therefore data were pooled. The mean inward current amplitude was -1.3 +/- 0.1 (SD) pA at - 30 mV (n = 16). The average slope conductance was 21 pS (n = 20). With 5 mM Ba(2+) in the patch pipette, very brief openings were already detectable at -80 mV. The mean inward current amplitude was -0.7 +/- 0.2 pA at -40 mV (n = 9). The average slope conductance was 11 pS (n = 9). The mean open time and the open probability increased significantly with depolarization. Ca channel activity was still present and unaffected when omega-agatoxin IVA (2 microM) and omega-conotoxin GVIA (3.2 microM) were added to the pipette solution. Our results show that types I and II hair cells express L-type Ca channels with similar properties. Moreover, they suggest that in vivo Ca(2+) influx might occur at membrane voltages more negative than -60 mV.
... Videos for Educators Search English Español Types of Anesthesia KidsHealth / For Teens / Types of Anesthesia What's in ... Get? Print en español Tipos de anestesia About Anesthesia Anesthesia is broken down into three main categories: ...
Full Text Available ... from Diabetes Forecast® magazine: lp-type-2, . In this section Diabetes Basics Type 2 Facts About Type ... ensureArray(data.submitSurveyResponse.errors); $.each(surveyErrors, function () { if (this.errorField) { $('input[name="' + this.errorField + '"]').closest('.form-group') . ...
Full Text Available ... or insulin to help you meet your target blood glucose levels. Type 2 usually gets worse over time – even if ... About Type 2 Recently Diagnosed Treatment and Care Blood Glucose ... Living With Type 2 Diabetes Program donate en -- A Future Without ...
Diabetes means your blood glucose, or blood sugar, levels are too high. With type 1 diabetes, your pancreas does not make insulin. Insulin is ... kidneys, nerves, and gums and teeth. Type 1 diabetes happens most often in children and young adults ...
Liquid-type Botulinum Toxin Type A in Adductor Spasmodic Dysphonia: A Prospective Pilot Study.
Cha, Wonjae; Jang, Jeon Yeob; Wang, Soo-Geun; Kang, Ji-Heon; Jo, Min-Gyu
2017-05-01
Botulinum toxin (BTX) has been widely used to treat adductor spasmodic dysphonia (ADSD). Most commercially available forms of BTX require reconstitution before use, which may increase the risk of contamination and requires careful titration. Recently, a liquid-type BTX type A (BTX-A) has been developed, which should simplify the procedure and enhance its efficacy. Herein, we present a prospective pilot study to investigate the efficacy and safety of liquid-type BTX-A in the treatment of ADSD. Twenty-six consecutive liquid-type BTX-A injections were performed in 12 patients with ADSD. We included as a control group 34 consecutive patients with ADSD who had previously undergone 52 vocal fold injection procedures with freeze-dried-type BTX-A. All patients in both groups had improvement of symptoms related to ADSD and period of normal voice. Most patients experienced breathiness, and the onset time, the peak response time, and the duration of breathiness were similar in both groups. The duration of effect (days) was 96.96 ± 18.91 and 77.38 ± 18.97 in the freeze-dried-type and the liquid-type groups, and the duration of benefit (days) was 80.02 ± 18.24 and 62.69 ± 19.73 in the freeze-dried-type and the liquid-type groups. To compare the efficacy between the freeze-dried-type and the liquid-type BTX-A, the sessions of the unilateral vocal fold injection were included and were categorized as group A (1 ~ 2 units BTX-A) and group B (2 ~ 3 units BTX-A), according to the dose per vocal fold. There was no significant difference of effect time between freeze-dried-type and liquid-type BTX-A groups. No adverse events related to BTX or vocal fold injection were reported. Liquid-type BTX-A is safe and effective for the treatment of spasmodic dysphonia. With the advantages of simple preparation, storage, and reuse and animal protein-free constituents, liquid-type BTX-A may be a good option in the treatment of spasmodic dysphonia. Copyright © 2017 The
Pediatric obesity & type 2 diabetes.
Dea, Tara L
2011-01-01
This article focuses on (a) identifying obesity and other risk factors for developing type 2 diabetes, (b) differentiating between pediatric type 1 diabetes and type 2 diabetes, and (c) treating pediatric type 2 diabetes. Obesity has significant implications on a child's health, including an increased risk for insulin resistance and progression to type 2 diabetes. Type 2 diabetes in children, characterized by insulin resistance and relative pancreatic b-cell failure due to the increased demand for insulin production, has now reached epidemic proportions. Longitudinal research on pediatric type 2 diabetes, however, is lacking because this epidemic is relatively new. Treatment of type 2 diabetes in children is focused on lifestyle modification with weight management/increased physical activity, and pharmacological management through oral medication or insulin therapy. Because children with type 2 diabetes are at risk for developing diabetes-related complications earlier in life, they need to be closely monitored for comorbidities.
Directory of Open Access Journals (Sweden)
José Luis Graña
Full Text Available This study explores the existence of different types of batterers in a sample of 266 men who had been court referred for intimate partner violence. The data collected in the assessment that have been used to perform a hierarchical and a two-step cluster analysis fall into three areas: aggression towards the partner, general aggression and presence of psychopathology and personality traits, more specifically, alcohol use, borderline and antisocial personality traits, psychopathy traits, state anger and trait anger, anger expression and control, anger, hostility, and, finally, impulsivity. The results show a typology consisting of 3 types of batterers on the basis of violence level and psychopathology: low (65%, moderate (27.8% and high (7.1%. This study provides empirical support for the development of batterer typologies. These typologies will help achieve early detection of different types of batterers, allowing us to tailor interventions on the basis of the needs of each of the types.
Full Text Available ... or insulin to help you meet your target blood glucose levels. Type 2 usually gets worse over time – even if ... About Type 2 Recently Diagnosed Treatment and Care Blood Glucose ... the Living With Type 2 Diabetes Program donate en -- A Future Without ...
Coevolution of patch-type dependent emigration and patch-type dependent immigration.
Weigang, Helene C
2017-08-07
The three phases of dispersal - emigration, transfer and immigration - are affecting each other and the former and latter decisions may depend on patch types. Despite the inevitable fact of the complexity of the dispersal process, patch-type dependencies of dispersal decisions modelled as emigration and immigration are usually missing in theoretical dispersal models. Here, I investigate the coevolution of patch-type dependent emigration and patch-type dependent immigration in an extended Hamilton-May model. The dispersing population inhabits a landscape structured into many patches of two types and disperses during a continuous-time season. The trait under consideration is a four dimensional vector consisting of two values for emigration probability from the patches and two values for immigration probability into the patches of each type. Using the adaptive dynamics approach I show that four qualitatively different dispersal strategies may evolve in different parameter regions, including a counterintuitive strategy, where patches of one type are fully dispersed from (emigration probability is one) but individuals nevertheless always immigrate into them during the dispersal season (immigration probability is one). I present examples of evolutionary branching in a wide parameter range, when the patches with high local death rate during the dispersal season guarantee a high expected disperser output. I find that two dispersal strategies can coexist after evolutionary branching: a strategy with full immigration only into the patches with high expected disperser output coexists with a strategy that immigrates into any patch. Stochastic simulations agree with the numerical predictions. Since evolutionary branching is also found when immigration evolves alone, the present study is adding coevolutionary constraints on the emigration traits and hence finds that the coevolution of a higher dimensional trait sometimes hinders evolutionary diversification. Copyright © 2017
Energy Technology Data Exchange (ETDEWEB)
Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B. [University Medical Center of the Johannes Gutenberg University Mainz, Department of Diagnostic and Interventional Radiology, Mainz (Germany)
2011-11-15
To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)
International Nuclear Information System (INIS)
Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B.
2011-01-01
To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)
DEFF Research Database (Denmark)
Elsborg, Ebbe; Hildebrandt, Thomas; Sangiorgi, Davide
of controls and a set of reaction rules, collectively a bigraphical reactive system (BRS). Possible advantages of developing bigraphical type systems include: a deeper understanding of a type system itself and its properties; transfer of the type systems to the concrete family of calculi that the BRS models...
Directory of Open Access Journals (Sweden)
Luca Padovani
2009-12-01
Full Text Available We (redefine session types as projections of process behaviors with respect to the communication channels they use. In this setting, we give session types a semantics based on fair testing. The outcome is a unified theory of behavioral types that shares common aspects with conversation types and that encompass features of both dyadic and multi-party session types. The point of view we provide sheds light on the nature of session types and gives us a chance to reason about them in a framework where every notion, from well-typedness to the subtyping relation between session types, is semantically -rather than syntactically- grounded.
Personality types of entrepreneurs.
Müller, Günter F; Gappisch, Cathrin
2005-06-01
85 German entrepreneurs were psychometrically assessed on 12 primary trait characteristics. The sample consisted of 49 men and 36 women whose mean age was 45.6 yr. (SD= 10.3). Occupational domains were production (40%) and services (60%). The mean duration of entrepreneurship within these domains was 13.1 yr. (SD=9.3). By factor analysis five personality types of entrepreneurs could be identified: Creative Acquisitor, Controlled Perseverator, Distant Achiever, Rational Manager, and Egocentric Agitator. These types correspond with types found in research by Miner and with the Myer-Briggs Indicator. In addition, correlations between general type potential and both job and life satisfaction of entrepreneurs were found. The results are discussed with regard to intercultural stability of personality types and implications for research and application.
TypeSan : Practical type confusion detection
Haller, Istvan; Jeon, Yuseok; Peng, Hui; Payer, Mathias; Giuffrida, Cristiano; Bos, Herbert; Van Der Kouwe, Erik
2016-01-01
The low-level C++ programming language is ubiquitously used for its modularity and performance. Typecasting is a fundamental concept in C++ (and object-oriented programming in general) to convert a pointer from one object type into another. However, downcasting (converting a base class pointer to a
A Kantorovich Type of Szasz Operators Including Brenke-Type Polynomials
Directory of Open Access Journals (Sweden)
Fatma Taşdelen
2012-01-01
convergence properties of these operators by using Korovkin's theorem. We also present the order of convergence with the help of a classical approach, the second modulus of continuity, and Peetre's -functional. Furthermore, an example of Kantorovich type of the operators including Gould-Hopper polynomials is presented and Voronovskaya-type result is given for these operators including Gould-Hopper polynomials.
Electrothermally-Actuated Micromirrors with Bimorph Actuators—Bending-Type and Torsion-Type
Directory of Open Access Journals (Sweden)
Cheng-Hua Tsai
2015-06-01
Full Text Available Three different electrothermally-actuated MEMS micromirrors with Cr/Au-Si bimorph actuators are proposed. The devices are fabricated with the SOIMUMPs process developed by MEMSCAP, Inc. (Durham, NC, USA. A silicon-on-insulator MEMS process has been employed for the fabrication of these micromirrors. Electrothermal actuation has achieved a large angular movement in the micromirrors. Application of an external electric current 0.04 A to the bending-type, restricted-torsion-type, and free-torsion-type mirrors achieved rotation angles of 1.69°, 3.28°, and 3.64°, respectively.
Parasitic helminths and their beneficial impact on type 1 and type 2 diabetes.
Berbudi, Afiat; Ajendra, Jesuthas; Wardani, Ajeng P F; Hoerauf, Achim; Hübner, Marc P
2016-03-01
It is estimated that by the year 2035 almost 600 million people will suffer from diabetes. In the case of type 2 diabetes, the strongest increase of diabetes incidence occurs in developing and newly industrialized countries. This increase correlates not only with a progressing sedentary lifestyle and nutritional changes, but also environmental changes. Similarly, the increase of type 1 diabetes incidence in industrialized countries over the past decades cannot be explained by genetic factors alone, suggesting that environmental changes are also involved. One such environmental change is a reduced exposure to pathogens because of improved hygiene. Parasitic helminths modulate the immune system of their hosts and induce type 2 as well as regulatory immune responses. As pro-inflammatory immune responses are crucial for the onset of both type 1 and type 2 diabetes, helminth-induced immunomodulation may prevent diabetes onset and ameliorate insulin sensitivity. Several epidemiological studies in human and experimental animal models support such a protective effect of helminths for autoimmune diabetes. Recent studies further suggest that helminths may also provide such a beneficial effect for type 2 diabetes. In this review we summarize studies that investigated parasitic helminths and helminth-derived products and their impact on both type 1 and type 2 diabetes highlighting potential protective mechanisms. Copyright © 2015 John Wiley & Sons, Ltd.
Rust types from JSON samples - Approximating type providers with procedural macros in Rust
Vesteraas, Erik Andreas
2017-01-01
When programmers access external data in a statically typed programming language, they are often faced with a dilemma between convenient and type-safe access to the data. In the programming language F#, a concept called type providers has been proposed as a solution to this problem by having compiler support for libraries with the capability to generate types at compile time. This thesis presents "json_typegen", a project which aims to show the feasibility of similar solutions in the Rust pro...
Desta, Semere Tekeste
2017-01-01
Høgskulen på Vestlandet Avdeling for helsefag for sykepleiere Tittel: Diabetes type 1 Bakgrunn for val av tema: I 2000 var det ca. 130 000 personer i Norge med diabetes, av disse hadde ca. 20 000 diabetes type 1. I dag er det ca. 230 000 personer som har diabetes i Norge. Av disse ca. 28 000 type 1 diabetes. Tallet viser hvor alvorlig sykdommen er, fordi det har vært og fortsatt er, en økning av antall diabetikere i Norge. Type 1 diabetes kan komme i alle aldersgrupper, men vanligvis...
Leibundgut, B.; Sullivan, M.
2018-03-01
The primary agent for Type Ia supernova cosmology is the uniformity of their appearance. We present the current status, achievements and uncertainties. The Hubble constant and the expansion history of the universe are key measurements provided by Type Ia supernovae. They were also instrumental in showing time dilation, which is a direct observational signature of expansion. Connections to explosion physics are made in the context of potential improvements of the quality of Type Ia supernovae as distance indicators. The coming years will see large efforts to use Type Ia supernovae to characterise dark energy.
DEFF Research Database (Denmark)
Rhiger, Morten
2009-01-01
Macros still haven't made their way into typed higher-order programming languages such as Haskell and Standard ML. Therefore, to extend the expressiveness of Haskell or Standard ML, one must express new linguistic features in terms of functions that fit within the static type systems of these lan...... of these languages. This is particularly challenging when introducing features that span across multiple types and that bind variables. We address this challenge by developing, in a step by step manner, mechanisms for encoding patterns and pattern matching in Haskell in a type-safe way....
Type-D personality is a stable taxonomy in post-MI patients over an 18-month period
DEFF Research Database (Denmark)
Martens, Elisabeth J; Kupper, Nina; Pedersen, Susanne S.
2007-01-01
type-D personality comprises a risk factor for adverse prognosis in patients with cardiovascular disease (CVD). However, concerns that type-D personality may not be a stable personality taxonomy and that progression of CVD may contribute to the manifestation of type-D personality have been voiced...
Chunlüe Zhou; Kaicun Wang
2016-01-01
Most studies on global warming rely on global mean surface temperature, whose change is jointly determined by anthropogenic greenhouse gases (GHGs) and natural variability. This introduces a heated debate on whether there is a recent warming hiatus and what caused the hiatus. Here, we presented a novel method and applied it to a 5????5? grid of Northern Hemisphere land for the period 1900 to 2013. Our results show that the coldest 5% of minimum temperature anomalies (the coldest deviation) ha...
Subset selection from Type-I and Type-II generalized logistic populations
Laan, van der M.J.; Laan, van der P.
1996-01-01
We give an introduction to the logistic and generalized logistic distributions. We obtain exact results for the probability of correct selection from Type-I and Type-II generalized logistic populations which only differ in their location parameter. Some open problems are formulated.
No evidence for increased self-reported cognitive failure in Type 1 and Type 2 diabetes
DEFF Research Database (Denmark)
Wessels, A M; Pouwer, F; Geelhoed-Duijvestijn, P H L M
2007-01-01
in adult out-patients with Type 1 and Type 2 diabetes. METHODS: Subjective cognitive functioning was measured in 187 diabetic patients using the Cognitive Failures Questionnaire (CFQ). Demographic and clinical characteristics were retrieved from the medical records. The Patient Health Questionnaire 9 items...... (PHQ-9) was self-administered along with the CFQ to correct for the confounding effect of depression. RESULTS: Analyses were based on 55 patients with Type 1 diabetes and 100 patients with Type 2 diabetes. No difference in mean CFQ score was observed between Type 1 and Type 2 diabetic patients...... or between Type 1 diabetic patients and healthy control subjects. Female patients with Type 2 diabetes reported significantly fewer cognitive complaints compared with female healthy control subjects. None of the demographic variables and diabetes-related complications was associated with subjective cognitive...
Comparison of osteoporosis in US adults with type 1 and type 2 diabetes mellitus.
DeShields, S C; Cunningham, T D
2018-01-20
We examined bone mineral density (BMD) and osteoporosis prevalence in those with type 1 compared to type 2 diabetes derived from a nationally representative sample from the civilian community in the United States. Data from the National Health and Nutrition Examination Survey (NHANES) for 2005-2006, 2007-2008, 2009-2010, and 2013-2014 were merged to obtain a large sample of diabetics at least 20 years of age with participation in the interview and medical examination. Osteoporosis status was defined by BMD at the total femur, femoral neck, or total lumbar spine. Self-reported diabetics that were prescribed insulin within the first year of diagnosis, are currently taking insulin, and reported no prescriptions for any diabetic pills were classified as type 1. Remaining self-reported diabetics were deemed as having type 2. A total of 2050 diabetics were included in which 87 (4%) were classified as type 1. Type 1 diabetics were found to have a significantly lower BMD at the total femur and femoral neck, but not at the lumbar spine in the adjusted models. Diabetics with type 1 were 4.7 times more likely to have osteoporosis than those with type 2. There was no significant relationship between diabetes type and BMD or osteoporosis prior to adjustment for confounders. Although our results show an increased likelihood of osteoporosis among those with type 1 diabetes, future studies including a larger sample from a community population are needed. It may benefit diabetics, especially those with type 1, to initiate osteoporosis screening methods including evaluation of fracture risk, bone quality, and BMD measurements at multiple sites earlier than recommended.
Osteogenesis imperfecta type V
DEFF Research Database (Denmark)
Rauch, Frank; Moffatt, Pierre; Cheung, Moira
2013-01-01
Osteogenesis imperfecta (OI) type V is an autosomal dominant bone fragility disorder that we had described a decade ago. Recent research has shown that OI type V is caused by a recurrent c.-14C>T mutation in IFITM5. In the present study, we assessed all patients diagnosed with OI type V at our...
International Nuclear Information System (INIS)
1967-01-01
In the midst of Vienna's hottest weather spell this year, members of the Agency's headquarters laboratory staff found themselves unpacking a consignment of fresh snow from the Antarctic. It had been sent by air through Los Angeles, not for cooling purposes, but to assist in making more accurate measurements as part of the study of the world's water distribution and movement. The same research also involves SMOW (Standard Mean Ocean Water) and samples of water from the mid-Pacific will also soon arrive for scientific examination
Crash testing the largest experiment on Earth
Cauchi, Marija
2015-01-01
Under Europe lies a 27 km tunnel that is both the coldest and hottest place on Earth. The Large Hadron Collider (LHC) has already found out what gives mass to all the matter in the Universe. It is now trying to go even deeper into what makes up everything we see around us. Dr Marija Cauchi writes about her research that helped protect this atom smasher from itself. Photography by Jean Claude Vancell. http://www.um.edu.mt/think/crash-testing-the-largest-experiment-on-earth/
Koshak, William J.
2010-01-01
This viewgraph presentation describes the significant progress made in the flash-type discrimination algorithm development. The contents include: 1) Highlights of Progress for GLM-R3 Flash-Type discrimination Algorithm Development; 2) Maximum Group Area (MGA) Data; 3) Retrieval Errors from Simulations; and 4) Preliminary Global-scale Retrieval.
Cardiovascular responses in type A and type B men to a series of stressors.
Ward, M M; Chesney, M A; Swan, G E; Black, G W; Parker, S D; Rosenman, R H
1986-02-01
Fifty-six healthy adult males were administered the Type A Structured Interview and assessed as exhibiting either Type A (N = 42) or Type B (N = 14) behavior pattern. They were monitored for systolic (SBP) and diastolic blood pressure (DBP) and heart rate (HR) responses during a series of six challenging tasks: Mental Arithmetic, Hypothesis Testing, Reaction Time, Video Game, Handgrip, and Cold Pressor. The results indicated that Type A subjects exhibited greater cardiovascular responses than did Type B subjects during some (Hypothesis Testing, Reaction Time, Video Game and Mental Arithmetic) but not all (Handgrip and Cold Pressor) of the tasks. These results are discussed in terms of previously reported findings on conditions that do and do not produce differences in Type A/B cardiovascular stress responses.
International Nuclear Information System (INIS)
Yu Dagan
2001-01-01
The Mesozoic uranium ore-formation process in South China resulted from the intense volcanic magmatism, the crust-mantle interaction and the fluidization in Yanshanian period, and there is great prospect for large-scale uranium concentration and ore-formation. Therefore, during the prospecting for Mesozoic granite-type, volcanics-type and exo-contact-type uranium deposits it is necessary to introduce deep-source metallogenic theory, to 'desalt' metallogenic theory of epithermal activation, to fully realize that uranium deposits may be formed not only at shallow depth, but also in conditions of deep-source, great depth and high temperature, as well as in environments of deep-source, shallow depth and median temperature, to give emphasis to the early-stage (130-95 Ma) uranium mineralization, to break the man-made boundary in prospecting for uranium only based on host rock type, to strengthen the research on Cretaceous magmatic system
[Diagnostic values of serum type III procollagen N-terminal peptide in type IV gastric cancer].
Akazawa, S; Fujiki, T; Kanda, Y; Kumai, R; Yoshida, S
1985-04-01
Since increased synthesis of collagen has been demonstrated in tissue of type IV gastric cancer, we attempted to distinguish type IV gastric cancer from other cancers by measuring serum levels of type III procollagen N-terminal peptide (type III-N-peptide). Mean serum levels in type IV gastric cancer patients without metastasis were found to be elevated above normal values and developed a tendency to be higher than those in types I, II and III gastric cancer patients without metastasis. Highly positive ratios were found in patients with liver diseases including hepatoma and colon cancer, biliary tract cancer, and esophageal cancer patients with liver, lung or bone metastasis, but only 2 out of 14 of these cancer patients without such metastasis showed positive serum levels of type III-N-peptide. Positive cases in patients with type IV gastric cancer were obtained not only in the group with clinical stage IV but also in the groups with clinical stages II and III. In addition, high serum levels of type III-N-peptide in patients with type IV gastric cancer were seen not only in the cases with liver, lung or bone metastasis but also in cases with disseminated peritoneal metastasis alone. These results suggest that if the serum level of type III-N-peptide is elevated above normal values, type IV gastric cancer should be suspected after ruling out liver diseases, myelofibrosis and liver, lung or bone metastasis.
Getting “Inside” Type I IFNs: Type I IFNs in Intracellular Bacterial Infections
Directory of Open Access Journals (Sweden)
Deann T. Snyder
2017-01-01
Full Text Available Type I interferons represent a unique and complex group of cytokines, serving many purposes during innate and adaptive immunity. Discovered in the context of viral infections, type I IFNs are now known to have myriad effects in infectious and autoimmune disease settings. Type I IFN signaling during bacterial infections is dependent on many factors including whether the infecting bacterium is intracellular or extracellular, as different signaling pathways are activated. As such, the repercussions of type I IFN induction can positively or negatively impact the disease outcome. This review focuses on type I IFN induction and downstream consequences during infection with the following intracellular bacteria: Chlamydia trachomatis, Listeria monocytogenes, Mycobacterium tuberculosis, Salmonella enterica serovar Typhimurium, Francisella tularensis, Brucella abortus, Legionella pneumophila, and Coxiella burnetii. Intracellular bacterial infections are unique because the bacteria must avoid, circumvent, and even co-opt microbial “sensing” mechanisms in order to reside and replicate within a host cell. Furthermore, life inside a host cell makes intracellular bacteria more difficult to target with antibiotics. Because type I IFNs are important immune effectors, modulating this pathway may improve disease outcomes. But first, it is critical to understand the context-dependent effects of the type I IFN pathway in intracellular bacterial infections.