Metrological traceability of holmium oxide solution

Science.gov (United States)

Gonçalves, D. E. F.; Gomes, J. F. S.; Alvarenga, A. P. D.; Borges, P. P.; Araujo, T. O.

2018-03-01

Holmium oxide solution was prepared as a candidate of certified reference material for spectrophotometer wavelength scale calibration. Here is presented the necessary steps for evaluation of the uncertainty and the establishment of metrological traceability for the production of this material. Preliminary results from the first produced batch are shown.

Wound repair in rat urinary bladder following electrocautery or holmium laser incision

Science.gov (United States)

Venzi, Giordano; Schmidlin, Franz R.; Gabbiani, Giulio; Delacretaz, Guy P.; Pittet, Brigitte; Leisinger, Hans-Juerg; Iselin, Christoph E.

1999-06-01

Woundhealing is a complex phenomenon which varies according the type of tissue but is also depending from the type of tissue injury. Electrocautery mainly induces coagulation necrosis while thermal damages induced by the Holmium laser primarily lead to tissue vaporization which may induce less tissue injury. The aim of this study was to evaluate the healing process of the Holmium laser induced lesions compared to electrocautery induced lesions in urothelial tissue by assessing the inflammatory response and myofibroblast behavior in sequential healing phases. A surgical wound was created in the urinary rat bladder of 32 rats either by electrocautery or by laser (N=16). The inflammatory response, the total lesion depth and the myofibroblast activity during woundhealing was then analyzed on a qualitative basis on days 0/2/4/8. The overall inflammatory response was comparable in both groups up to days two and four. However, at day eight less cellular inflammatory reaction and less myofibroblast activity was found in the specimen of lesions created by the Holmium laser. These results suggest that wound repair may be a less invasive process after Holmium laser than electrocautery.

Conduction and stability of holmium titanium oxide thin films grown by atomic layer deposition

Energy Technology Data Exchange (ETDEWEB)

Castán, H., E-mail: helena@ele.uva.es [Department of Electronic, University of Valladolid, 47011 Valladolid (Spain); García, H.; Dueñas, S.; Bailón, L. [Department of Electronic, University of Valladolid, 47011 Valladolid (Spain); Miranda, E. [Departament d' Enginyería Electrònica, Universitat Autónoma de Barcelona, 08193 Bellaterra (Spain); Kukli, K. [Department of Chemistry, University of Helsinki, FI-00014 Helsinki (Finland); Institute of Physics, University of Tartu, EE-50411,Tartu (Estonia); Kemell, M.; Ritala, M.; Leskelä, M. [Department of Chemistry, University of Helsinki, FI-00014 Helsinki (Finland)

2015-09-30

Holmium titanium oxide (HoTiO{sub x}) thin films of variable chemical composition grown by atomic layer deposition are studied in order to assess their suitability as dielectric materials in metal–insulator–metal electronic devices. The correlation between thermal and electrical stabilities as well as the potential usefulness of HoTiO{sub x} as a resistive switching oxide are also explored. It is shown that the layer thickness and the relative holmium content play important roles in the switching behavior of the devices. Cycled current–voltage measurements showed that the resistive switching is bipolar with a resistance window of up to five orders of magnitude. In addition, it is demonstrated that the post-breakdown current–voltage characteristics in HoTiO{sub x} are well described by a power-law model in a wide voltage and current range which extends from the soft to the hard breakdown regimes. - Highlights: • Gate and memory suitabilities of atomic layer deposited holmium titanium oxide. • Holmium titanium oxide exhibits resistive switching. • Layer thickness and holmium content influence the resistive switching. • Low and high resistance regimes follow a power-law model. • The power-law model can be extended to the hard breakdown regime.

Thermal Response to High-Power Holmium Laser Lithotripsy.

Science.gov (United States)

Aldoukhi, Ali H; Ghani, Khurshid R; Hall, Timothy L; Roberts, William W

2017-12-01

The aim of this study was to investigate "caliceal" fluid temperature changes during holmium laser activation/lithotripsy using settings up to 40 W power output with different irrigation flow rates. The experimental system consisted of a glass test tube (diameter 10 mm/length 75 mm) filled with deionized water, to mimic a calix. Real-time temperature was recorded using a thermocouple (Physitemp, NJ) positioned 5 mm from the bottom of the tube. A 200 μm laser fiber (Flexiva; Boston Scientific, MA) was introduced through the working channel of a disposable ureteroscope (LithoVue; Boston Scientific) and the laser fiber tip was positioned 15 mm above the bottom of the test tube. Deionized water irrigation (room temperature) through the working channel of the ureteroscope was delivered at flow rates of 0, 7-8, 14-15, and 38-40 mL/minute. A 120-W holmium laser (pulse 120; Lumenis, CA) was used. The following settings were explored: 0.5 J × 10 Hz, 1.0 J × 10 Hz, 0.5 J × 20 Hz, 1.0 J × 20 Hz, 0.5 J × 40 Hz, 1.0 J × 40 Hz, and 0.5 J × 80 Hz. During each experiment, the laser was activated continuously for 60 seconds. Temperature increased with increasing laser power output and decreasing irrigation flow rate. The highest temperature, 70.3°C (standard deviation 2.7), occurred with laser setting of 1.0 J × 40 Hz and no irrigation after 60 seconds of continuous laser firing. None of the tested laser settings and irrigation parameters produced temperature exceeding 51°C when activated for only 10 seconds of continuous laser firing. High-power holmium settings fired in long bursts with low irrigation flow rates can generate high fluid temperatures in a laboratory "caliceal" model. Awareness of this risk allows urologist to implement a variety of techniques (higher irrigation flow rates, intermittent laser activation, and potentially cooled irrigation fluid) to control and mitigate thermal

Safety of holmium laser prostatectomy in patients with cardiac pacemaker implant

Directory of Open Access Journals (Sweden)

Narmada P Gupta

2006-01-01

Full Text Available Objectives: The use of the standard monopolar electrocautery is associated with significant risks of implant malfunction in patients on a cardiac pacemaker. It is also associated with a risk of adverse cardiac events due to blood loss and fluid absorption. The properties of the holmium laser prevent the occurrence of these adverse events. We report the successful use of this technology in resecting the gland in patients on a permanent cardiac pacemaker implant. MATERIALS AND Methods: Six patients with permanent cardiac pacemaker implant were treated with holmium laser resection of prostate over a period of two years. Treated patients had bothersome prostatic symptoms and failed to respond to medical therapy. All patients were operated under spinal anesthesia using a high power VersaPulse ® PowerSuiteTM Holmium laser source. Normal saline was used as irrigant. Intravesical tissue morcellator was also used to remove the larger fragments in two of the patients. Results : Median patient age was 60 years (range 56-73 and median prostate volume was 40cc (range 20-48cc. None of the patient required blood transfusion or had significant hyponatremia or Transurethral resection syndrome. No patients had any pacemaker malfunction or hemodynamic instability during the procedure or in immediate postoperative period. Improvement in maximum urine flow rate was observed from an average of 7 ml/sec in preoperative period to 22 ml/sec postoperatively at 3 month followup. Conclusions: Holmium laser prostatectomy offers the ideal modality of surgery in patients on a cardiac pacemaker. It helps to avoid additional preparation and minimizes the risk of device malfunction and adverse post operative events.

Comparison of ESWL and ureteroscopic holmium laser lithotripsy in management of ureteral stones.

Science.gov (United States)

Cui, Yon; Cao, Wenzhou; Shen, Hua; Xie, Jianjun; Adams, Tamara S; Zhang, Yuanyuan; Shao, Qiang

2014-01-01

There are many options for urologists to treat ureteral stones that range from 8 mm to 15 mm, including ESWL and ureteroscopic holmium laser lithotripsy. While both ESWL and ureteroscopy are effective and minimally invasive procedures, there is still controversy over which one is more suitable for ureteral stones. To perform a retrospective study to compare the efficiency, safety and complications using ESWL vs. ureteroscopic holmium laser lithotripsy in management of ureteral stones. Between October 2010 and October 2012, 160 patients who underwent ESWL or ureteroscopic holmium laser lithotripsy at Suzhou municipal hospital for a single radiopaque ureteral stone (the size 8-15 mm) were evaluated. All patients were followed up with ultrasonography for six months. Stone clearance rate, costs and complications were compared. Similarity in stone clearance rate and treatment time between the two procedures; overall procedural time, analgesia requirement and total cost were significantly different. Renal colic and gross hematuria were more frequent with ESWL while voiding symptoms were more frequent with ureteroscopy. Both procedures used for ureteral stones ranging from 8 to 15 mm were safe and minimally invasive. ESWL remains first line therapy for proximal ureteral stones while ureteroscopic holmium laser lithotripsy costs more. To determining which one is preferable depends on not only stone characteristics but also patient acceptance and cost-effectiveness ratio.

Comparison of ESWL and ureteroscopic holmium laser lithotripsy in management of ureteral stones.

Directory of Open Access Journals (Sweden)

Yon Cui

Full Text Available BACKGROUND: There are many options for urologists to treat ureteral stones that range from 8 mm to 15 mm, including ESWL and ureteroscopic holmium laser lithotripsy. While both ESWL and ureteroscopy are effective and minimally invasive procedures, there is still controversy over which one is more suitable for ureteral stones. OBJECTIVE: To perform a retrospective study to compare the efficiency, safety and complications using ESWL vs. ureteroscopic holmium laser lithotripsy in management of ureteral stones. METHODS: Between October 2010 and October 2012, 160 patients who underwent ESWL or ureteroscopic holmium laser lithotripsy at Suzhou municipal hospital for a single radiopaque ureteral stone (the size 8-15 mm were evaluated. All patients were followed up with ultrasonography for six months. Stone clearance rate, costs and complications were compared. RESULTS: Similarity in stone clearance rate and treatment time between the two procedures; overall procedural time, analgesia requirement and total cost were significantly different. Renal colic and gross hematuria were more frequent with ESWL while voiding symptoms were more frequent with ureteroscopy. Both procedures used for ureteral stones ranging from 8 to 15 mm were safe and minimally invasive. CONCLUSION: ESWL remains first line therapy for proximal ureteral stones while ureteroscopic holmium laser lithotripsy costs more. To determining which one is preferable depends on not only stone characteristics but also patient acceptance and cost-effectiveness ratio.

Effect of silver nanoparticles on the dielectric properties of holmium doped silica glass

International Nuclear Information System (INIS)

Rejikumar, P.R.; Jyothy, P.V.; Mathew, Siby; Thomas, Vinoy; Unnikrishnan, N.V.

2010-01-01

The effect of silver nanoparticle co-doping on the dielectric properties of holmium doped silica glasses was studied. Silver nanoparticles of size between 20 and 22 nm were produced by the sol-gel technique. One of the samples showed an icosahedral morphology of the nanocrystal formed, along with spherical morphology. It was found that the tuning of the dielectric constant values could be accomplished by co-doping. The sample, with 1 wt% of Ho, had low dielectric constant values within the range 100 Hz-3 MHz due to the formation of quasi-molecular structures of holmium. This effect was evaded to some extent with silver co-doping as a result of the interdispersion of holmium complexes. Also it was found that the co-doping produced a higher dielectric loss which was calculated from the tan δ-log f graph. The Cole-Cole parameters and the Jonscher power law parameters were also calculated and are presented.

[Comparison of validity and safety between holmium: YAG laser and traditional surgery in partial nephrectomy].

Science.gov (United States)

Bi, Sheng; Xia, Ming

2015-08-11

To compare the validity and safety between holmium: YAG laser and traditional surgery in partial nephrectomy. A total of 28 patients were divided into two groups (holmium: YAG laser group without renal artery clamping and traditional surgery group with renal artery clamping). The intraoperative blood loss, total operative time, renal artery clamping time, postoperative hospital stay, separated renal function, postoperative complications and depth of tissue injury were recorded. The intraoperative blood loss, total operative time, renal artery clamping time, postoperative hospital stay, separated renal function, postoperative complications and depth of tissue injury were 80 ml, 77 min, 0 min, 7.4 days, 35 ml/min, 0, 0.9 cm, respectively, in holmium: YAG laser group. And in traditional surgery group were 69 ml, 111 min, 25.5 min, 7.3 days, 34 ml/min, 0, 2.0 cm, respectively. The differences of total operative time, renal artery clamping time and depth of tissue injury between two groups were statistically significant. The others were not statistically significant. Holmium: YAG laser is effective and safe in partial nephrectomy. It can decrease the total operative time, minimize the warm ischemia time and enlarge the extent of surgical excision.

Ocular brachytherapy with a holmium-166 irradiator device

International Nuclear Information System (INIS)

Mourao, Arnaldo P.; Campos, Tarcisio P.R.

2009-01-01

The ocular brachytherapy is a method that allows controlling ocular tumors. However, the irradiation of the ocular area in high doses can bring damages mainly to the surrounding healthy tissue, such as lens, retina and bone tissue of the orbital area in growth phase. Brachytherapy in comparison to teletherapy allows a large reduction of the absorbed doses in the adjacent tissues avoiding deleterious effects. Various types of radionuclides can be applied to ocular brachytherapy. Those radionuclides shall be encapsulated and placed juxtaposed to the sclera, back to the tumor. Herein, a new device was developed to encapsulate the radioactive material. It can easily place back of the eyeball. A computational model of the ocular area was developed in order to simulate the spatial dose distribution promoted by the holmium-166 nuclide distributed inside the irradiator device. The simulations addressed a device placed on the surface of the sclera, rotated 90 deg taken at the normal axis forward to the lens. The simulation was carried on the code Monte Carlo MCNP5. The computational simulation generates the spatial dose distribution in the treated volume. All continuous beta and the discrete gamma and X-ray spectra emitted by the holmium-166 were incorporated on simulations. The results allow comparing the space dose distribution to other types of sources used for the same end. The sclera absorbed dose, the maximum apical tumor dose, as well as on the tumor base were investigated. Indeed, the tumor thickness defines the conditions of irradiation. The holmium-166 dose distribution provides a tool to propose a better and optimized protocol for ocular brachytherapy. (author)

Ocular brachytherapy with a holmium-166 irradiator device

Energy Technology Data Exchange (ETDEWEB)

Mourao, Arnaldo P. [Centro Federal de Educacao Tecnoloica de Minas Gerais (CEFET-MG), Belo Horizonte, MG (Brazil). Nucleo de Engenharia Hospitalar], e-mail: aprata@des.cefetmg.br; Campos, Tarcisio P.R. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Programa de Pos-graduacao em Ciencias e Tecnicas Nucleares], e-mail: campos@nuclear.ufmg.br

2009-07-01

The ocular brachytherapy is a method that allows controlling ocular tumors. However, the irradiation of the ocular area in high doses can bring damages mainly to the surrounding healthy tissue, such as lens, retina and bone tissue of the orbital area in growth phase. Brachytherapy in comparison to teletherapy allows a large reduction of the absorbed doses in the adjacent tissues avoiding deleterious effects. Various types of radionuclides can be applied to ocular brachytherapy. Those radionuclides shall be encapsulated and placed juxtaposed to the sclera, back to the tumor. Herein, a new device was developed to encapsulate the radioactive material. It can easily place back of the eyeball. A computational model of the ocular area was developed in order to simulate the spatial dose distribution promoted by the holmium-166 nuclide distributed inside the irradiator device. The simulations addressed a device placed on the surface of the sclera, rotated 90 deg taken at the normal axis forward to the lens. The simulation was carried on the code Monte Carlo MCNP5. The computational simulation generates the spatial dose distribution in the treated volume. All continuous beta and the discrete gamma and X-ray spectra emitted by the holmium-166 were incorporated on simulations. The results allow comparing the space dose distribution to other types of sources used for the same end. The sclera absorbed dose, the maximum apical tumor dose, as well as on the tumor base were investigated. Indeed, the tumor thickness defines the conditions of irradiation. The holmium-166 dose distribution provides a tool to propose a better and optimized protocol for ocular brachytherapy. (author)

Microspheres with Ultrahigh Holmium Content for Radioablation of Malignancies

NARCIS (Netherlands)

Bult, W.; Seevinck, P.R.; Krijger, G.C.; Visser, T.; Kroon-Batenburg, L.M.J.; Bakker, C.J.G.; Hennink, W.E.; van het Schip, A.D.; Nijsen, J.F.W.

2009-01-01

The aim of this study was to develop microspheres with an ultra high holmium content which can be neutron activated for radioablation of malignancies. These microspheres are proposed to be delivered selectively through either intratumoral injections into solid tumors or administered via an

Ureteroscopic holmium laser cutting for inadvertently sutured drainage tube (report of five cases).

Science.gov (United States)

Gao, Xu; Lu, Xin; Ren, Shancheng; Xu, Chuanliang; Sun, Yinghao

2008-07-01

The aim of this paper is to report a simple solution for inadvertently sutured drainage tube after urological surgery and discuss the different managements according to different types of this embarrassing complication. From September 2001 to January 2007, five inadvertently sutured drainage tubes were treated with ureteroscopic holmium laser cutting for the suture. All drainage tubes were removed after the operation without other complications. Holmium laser cutting via ureteroscope is a simple solution for the embarrassing problem of inadvertently sutured drainage tube. It can save the patient from undergoing another open surgery.

Ethanolamine derivatives of dysprosium and holmium

International Nuclear Information System (INIS)

Gharia, K.S.; Singh, M.; Mathur, S.; Sankhla, B.S.

1981-01-01

The preparation and properties of dysprosium and holmium derivatives of mono-, di- and tri-ethanolamine derivatives are described. Compounds of general formulae: Ln(OPrsup(i)) 2 (mea), Ln(OPrsup(i))(mea) 2 , Ln(mea) 3 , Ln(OPrsup(i))(dea), Ln 2 (dea) 3 , Ln(dea)(deaH) and Ln(tea) (where Ln = Dy or Ho and mea, dea and tea are the anions of respective ethanolamine) were obtained and characterized by elemental analysis and IR spectra. (author)

Chitosan microspheres loaded with holmium-165 produced by spray dryer for liver cancer therapy: preliminary experiments

International Nuclear Information System (INIS)

Miyamoto, Douglas Massao; Pires, Geovanna; Lira, Raphael A. de; Melo, Vitor H.S.; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de; Osso Junior, Joao Alberto

2011-01-01

Chitosan is a biopolymer of 2-deoxy-2-amino-D-glucose that is obtained by deacetylation of chitin. It's biocompatible, biodegradable, non toxic and has antitumor activity. Chitosan has many applications, such as their microparticles that can be used to treat prostate cancer, rheumatoid arthritis, and for liver tumor brachytherapy treatment. Our group is developing different biodegradable polymer-based microspheres loaded with holmium-165 for this purpose. The Chitosan microspheres were produced loaded with holmium (III) chloride, and not loaded with it, by Mini Spray Dryer procedure. The microspheres were evaluated by scanning electron microscopy, energy dispersive spectroscopy (EDS), confocal laser scanning microscopy, thermogravimetric analysis, particle size, and X-ray diffraction. The EDS analysis confirmed the holmium chloride presence into the prepared chitosan microparticles. (author)

Chitosan microspheres loaded with holmium-165 produced by spray dryer for liver cancer therapy: preliminary experiments

Energy Technology Data Exchange (ETDEWEB)

Miyamoto, Douglas Massao; Pires, Geovanna; Lira, Raphael A. de; Melo, Vitor H.S.; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de, E-mail: douglas.miyamoto@usp.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Radiofarmacia

2011-07-01

Chitosan is a biopolymer of 2-deoxy-2-amino-D-glucose that is obtained by deacetylation of chitin. It's biocompatible, biodegradable, non toxic and has antitumor activity. Chitosan has many applications, such as their microparticles that can be used to treat prostate cancer, rheumatoid arthritis, and for liver tumor brachytherapy treatment. Our group is developing different biodegradable polymer-based microspheres loaded with holmium-165 for this purpose. The Chitosan microspheres were produced loaded with holmium (III) chloride, and not loaded with it, by Mini Spray Dryer procedure. The microspheres were evaluated by scanning electron microscopy, energy dispersive spectroscopy (EDS), confocal laser scanning microscopy, thermogravimetric analysis, particle size, and X-ray diffraction. The EDS analysis confirmed the holmium chloride presence into the prepared chitosan microparticles. (author)

Microspheres with ultrahigh holmium content for radioablation of malignancies

NARCIS (Netherlands)

Bult, W; Seevinck, P R; Krijger, G C; Visser, T; Kroon-Batenburg, L M J; Bakker, C J G; Hennink, W E; van het Schip, A D; Nijsen, J F W

PURPOSE: The aim of this study was to develop microspheres with an ultra high holmium content which can be neutron activated for radioablation of malignancies. These microspheres are proposed to be delivered selectively through either intratumoral injections into solid tumors or administered via an

Microspheres with Ultrahigh Holmium Content for Radioablation of Malignancies

NARCIS (Netherlands)

Bult, W.; Seevinck, P.R.; Krijger, G.C.; Visser, T.; Kroon-Batenburg, L.M.J.; Bakker, C.J.G.; Hennink, W.E.; Van het Schip, A.D.; Nijsen, J.F.W.

Purpose The aim of this study was to develop microspheres with an ultra high holmium content which can be neutron activated for radioablation of malignancies. These microspheres are proposed to be delivered selectively through either intratumoral injections into solid tumors or administered via an

Material science as basis for nuclear medicine: Holmium irradiation for radioisotopes production

Science.gov (United States)

Usman, Ahmed Rufai; Khandaker, Mayeen Uddin; Haba, Hiromitsu; Otuka, Naohiko

2018-05-01

Material Science, being an interdisciplinary field, plays important roles in nuclear science. These applications are seen in weaponry, armoured vehicles, accelerator structure and development, semiconductor detectors, nuclear medicine and many more. Present study presents the applications of some metals in nuclear medicine (radioisotope production). The charged-particle-induced nuclear reactions by using cyclotrons or accelerators have become a very vital feature of the modern nuclear medicine. Realising the importance of excitation functions for the efficient production of medical radionuclides, some very high purity holmium metals are generally prepared or purchased for bombardment in nuclear accelerators. In the present work, various methods to obtain pure holmium for radioisotope production have been discussed while also presenting details of our present studies. From the experimental work of the present studies, some very high purity holmium foils have been used in the work for a comprehensive study of residual radionuclides production cross-sections. The study was performed using a stacked-foil activation technique combined with γ-ray spectrometry. The stack was bombarded with 50.4 MeV alpha particle beam from AVF cyclotron of RI Beam Factory, Nishina Centre for Accelerator-Based Science, RIKEN, Japan. The work produced thulium radionuclides useful in nuclear medicine.

Holmium laser use in the treatment of selected dry eye syndrome complications

Science.gov (United States)

Kecik, Dariusz; Kecik, Tadeusz; Kasprzak, Jan; Kecik, Mariusz

1996-03-01

The authors present initial results of treatment selected complications of dry eye syndrome with holmium laser. The lacrimal puncta obliteration and coagulation of the corneal ulcer surface were done.

Assiut Experience in the Application of Holmium Laser in Treatment ...

African Journals Online (AJOL)

Assiut Experience in the Application of Holmium Laser in Treatment of Ureteral Calculi in Adults. A.M. Abdel Lateef, A.E. Abdel Moniem, M.I. Taha, M.A. Shalaby. Abstract. Internal Optical Urethrotomy at the National Medical Center of Sanou Souro in Bobo-Dioulasso: Feasibility, Safety and Short-Term Results Objective To ...

Evaluation of holmium laser versus cold knife in optical internal urethrotomy for the management of short segment urethral stricture.

Science.gov (United States)

Jain, Sudhir Kumar; Kaza, Ram Chandra Murthy; Singh, Bipin Kumar

2014-10-01

SACHSE COLD KNIFE IS CONVENTIONALLY USED FOR OPTICAL INTERNAL URETHROTOMY INTENDED TO MANAGE URETHRAL STRICTURES AND HO: YAG laser is an alternative to it. The aim of this study was to evaluate the role of urethral stricture treatment outcomes, efficacy, and complications using cold knife and Ho: YAG (Holmium laser) for optical internal urethrotomy. In this prospective study included, 90 male patients age >18 years, with diagnosis of urethral stricture admitted for internal optical urethrotomy during April 2010 to March 2012. The patients were randomized into two groups containing 45 patients each using computer generated random number. In group A (Holmium group), internal urethrotomy was done with Holmium laser and in group B (Cold knife group) Sachse cold knife was used. Patients were followed up for 6 months after surgery in Out Patient Department on 15, 30 and 180 post-operative days. At each follow up visit physical examination, and uroflowmetry was performed along with noting complaints, if any. The peak flow rates (PFR) were compared between the two groups on each follow up. At 180 days (6 month interval) the difference between mean of PFR for Holmium and Cold knife group was statistically highly significant (P knife urethrotomy.

Holmium laser enucleation versus laparoscopic simple prostatectomy for large adenomas.

Science.gov (United States)

Juaneda, R; Thanigasalam, R; Rizk, J; Perrot, E; Theveniaud, P E; Baumert, H

2016-01-01

The aim of this study is to compare Holmium laser enucleation of the prostate with another minimally invasive technique, the laparoscopic simple prostatectomy. We compared outcomes of a series of 40 patients who underwent laparoscopic simple prostatectomy (n=20) with laser enucleation of the prostate (n=20) for large adenomas (>100 grams) at our institution. Study variables included operative time and catheterization time, hospital stay, pre- and post-operative International Prostate Symptom Score and maximum urinary flow rate, complications and economic evaluation. Statistical analyses were performed using the Student t test and Fisher test. There were no significant differences in patient age, preoperative prostatic size, operating time or specimen weight between the 2 groups. Duration of catheterization (P=.0008) and hospital stay (P.99). Holmium enucleation of the prostate has similar short term functional results and complication rates compared to laparoscopic simple prostatectomy performed in large glands with the advantage of less catheterization time, lower economic costs and a reduced hospital stay. Copyright © 2015 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.

The evaluation of tissue mass loss in the incision line of prostate with benign hyperplasia performed using holmium laser and cutting electrode.

Science.gov (United States)

Szewczyk, Mariusz; Jesionek-Kupnicka, Dorota; Lipiński, Marek Ireneusz; Lipinski, Piotr; Różański, Waldemar

2014-01-01

The aim of this study is to compare the changes in the incision line of prostatic adenoma using a monopolar cutting electrode and holmium laser, as well as the assessment of associated tissue mass and volume loss of benign prostatic hyperplasia (BPH). The material used in this study consisted of 74 preparations of prostatic adenoma obtained via open retropubic adenomectomy, with an average volume of 120.7 ml. The material obtained cut in vitro before fixation in formaldehyde. One lobe was cut using holmium laser, the other using a monopolar cutting electrode. After the incision was made, tissue mass and volume loss were evaluated. Thermocoagulation changes in the incision line were examinedunder light microscope. In the case of the holmium laser incision, the average tissue mass loss was 1.73 g, tissue volume loss 3.57 ml and the depth of thermocoagulation was 1.17 mm. When the monopolar cutting electrode was used average tissue mass loss was 0.807 g, tissue volume loss 2.48 ml and the depth of thermocoagulation was 0.19 mm. Where holmium laser was used, it was observed that the layer of tissue with thermocoagulation changes was deeper than in the case of the monopolar cutting electrode. Moreover, it was noticed that holmium laser caused bigger tissue mass and volume loss than the cutting electrode.

Dielectric and conducting behaviour of polycrystalline holmium octa-molybdate

International Nuclear Information System (INIS)

Want, Basharat; Zahoor Ahmad, Bhat; Hamid Bhat, Bilal

2014-01-01

Polycrystalline holmium octa-molybdate spherulites have been obtained by using gel diffusion technique and characterized by different physio-chemical techniques. The surfaces of these spherulites are composed of nano-rod with an average diameter of about 80 nm. At room temperature the initial crystal structure is triclinic, space group P1. Thermal studies suggested a phase transition occurring in holmium octa-molybdate crystals at about 793 K. The electrical properties of the system have been studied as a function of frequency and temperature in the ranges of 20 Hz–3 MHz and 290–570 K, respectively. A giant dielectric constant and two loss peaks have been observed in the permittivity formalism. The conducting behaviour of the material is also discussed. The conductivity was found to be 1572 μ Ω −1 m −1 at room temperature and 3 MHz frequency. The conductivity of the polycrystalline material was attributed to the fact that it arises due to the migration of defects on the oxygen sub-lattice. Impedance studies were also performed in the frequency domain to infer the bulk and grain boundary contributions to the overall electric response of the material. The electrical responses have been attributed to the grain, grain-boundary, and interfacial effects. (paper)

Specific heat of holmium and YNi{sub 2}B{sub 2}C. Criticalbehaviour and superconducting properties; Spezifische Waerme von Holmium und YNi{sub 2}B{sub 2}C. Kritisches Verhalten und supraleitende Eigenschaften

Energy Technology Data Exchange (ETDEWEB)

Bekkali, Abdelhakim

2010-01-04

Object of the thesis is the study of the specific heat of holmium and YNi{sub 2}B{sub 2}C in the temperature ranges from 50 to 200 KI respectively from 380 mK to 20 K in magnetic fields up to 9 T. In the present thesis the criticalbehaviour of YNi{sub 2}B{sub 2}C and properties of the superconducting state of tne non-magnetic rare-earth nickel borocarbide YNi{sub 2}B{sub 2}C are studied by means of a self-developed measurement apparatur of the specific heat using the quasi-adiabatic heating-pulse method as well as of holmium by means of the relaxation method. In this thesis reliable statements about the critical exponents on monocrystalline holmium could be made. The study on holmium proves that the critical behaviour of the specific heats cannot be described in the framework of the predictions of the chiral universality classes. By means of measurements of the specific heat in this thesis could be confirmed that YNi{sub 2}B{sub 2}C is a multiband superconductor. The positive curvature of the boundary line below T{sub c} in the phase diagram yields a first hint to the many-band character of YNI{sub 2}B{sub 2}C. In the zero-field the electronic specific heat in the superconducting state c{sub es}(T) can be not explained in the framework of the pure BCS theory. At low temperatures a residual contribution by normally conducting electrons could be detected, which hints to a not completely opened energy gap. A possible explanation would be that a band (or several bands) with low charge-carrier concentration not contribute to the superconductivity. This result agrees with de Haas-van Alphen measurements on isostructural superconducting LuNi{sub 2}B{sub 2}C monocrystals, which suggest the many-band character of the superconductivity as well as a vanishing energy gap in one band. The fluctuation behaviour of the specific heat of YNi{sub 2}B{sub 2}C in the neighbourhood of the superconducting-normally conducting transition agrees well with that of the 3D-XY model. [German

Calcium phosphate holmium-166 ceramic to addition in bone cement: synthesis and characterization

Energy Technology Data Exchange (ETDEWEB)

Donanzam, Blanda A.; Campos, Tarcisio P.R., E-mail: campos@nuclear.ufmg.b [Universidade do Federal de Minas Gerais (DEN/UFMG), Belo Horizonte, MG (Brazil). Escola de Engenharia. Dept. de Engenharia Nuclear; Dalmazio, Ilza; Valente, Eduardo S., E-mail: id@cdtn.b, E-mail: valente@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

2011-07-01

Spine metastases are a common and painful complication of cancer. The treatment often consists of bone cement injection (vertebroplasty or kyphoplasty) within vertebral body for vertebrae stabilization, followed by external beam radiation therapy. Recently, researchers introduced the concept of radioactive bone cement for spine tumors therapy. Then, investigations about bioactive and radioactive materials became interesting. In this study, we present the synthesis of calcium phosphate incorporated holmium (CaP-Ho) via sol-gel technique, and its characterization by XRD, FT-IR, NA and SEM. Results showed a multiphasic bioceramic composed mainly of hydroxyapatite, {beta}-tricalcium phosphate, holmium phosphate and traces of calcium pyrophosphate. Furthermore, the nuclide Ho-166 was the major radioisotope produced. Despite that, the radioactive bioceramic CaP-{sup 166}Ho must be investigated in clinical trials to assure its efficacy and safety on spine tumors treatment (author)

Calcium phosphate holmium-166 ceramic to addition in bone cement: synthesis and characterization

International Nuclear Information System (INIS)

Donanzam, Blanda A.; Campos, Tarcisio P.R.

2011-01-01

Spine metastases are a common and painful complication of cancer. The treatment often consists of bone cement injection (vertebroplasty or kyphoplasty) within vertebral body for vertebrae stabilization, followed by external beam radiation therapy. Recently, researchers introduced the concept of radioactive bone cement for spine tumors therapy. Then, investigations about bioactive and radioactive materials became interesting. In this study, we present the synthesis of calcium phosphate incorporated holmium (CaP-Ho) via sol-gel technique, and its characterization by XRD, FT-IR, NA and SEM. Results showed a multiphasic bioceramic composed mainly of hydroxyapatite, β-tricalcium phosphate, holmium phosphate and traces of calcium pyrophosphate. Furthermore, the nuclide Ho-166 was the major radioisotope produced. Despite that, the radioactive bioceramic CaP- 166 Ho must be investigated in clinical trials to assure its efficacy and safety on spine tumors treatment (author)

Specific heat of holmium and YNi2B2C. Criticalbehaviour and superconducting properties

International Nuclear Information System (INIS)

Bekkali, Abdelhakim

2010-01-01

Object of the thesis is the study of the specific heat of holmium and YNi 2 B 2 C in the temperature ranges from 50 to 200 KI respectively from 380 mK to 20 K in magnetic fields up to 9 T. In the present thesis the criticalbehaviour of YNi 2 B 2 C and properties of the superconducting state of tne non-magnetic rare-earth nickel borocarbide YNi 2 B 2 C are studied by means of a self-developed measurement apparatur of the specific heat using the quasi-adiabatic heating-pulse method as well as of holmium by means of the relaxation method. In this thesis reliable statements about the critical exponents on monocrystalline holmium could be made. The study on holmium proves that the critical behaviour of the specific heats cannot be described in the framework of the predictions of the chiral universality classes. By means of measurements of the specific heat in this thesis could be confirmed that YNi 2 B 2 C is a multiband superconductor. The positive curvature of the boundary line below T c in the phase diagram yields a first hint to the many-band character of YNI 2 B 2 C. In the zero-field the electronic specific heat in the superconducting state c es (T) can be not explained in the framework of the pure BCS theory. At low temperatures a residual contribution by normally conducting electrons could be detected, which hints to a not completely opened energy gap. A possible explanation would be that a band (or several bands) with low charge-carrier concentration not contribute to the superconductivity. This result agrees with de Haas-van Alphen measurements on isostructural superconducting LuNi 2 B 2 C monocrystals, which suggest the many-band character of the superconductivity as well as a vanishing energy gap in one band. The fluctuation behaviour of the specific heat of YNi 2 B 2 C in the neighbourhood of the superconducting-normally conducting transition agrees well with that of the 3D-XY model. [de

A holmium(III)-based single-molecule magnet with pentagonal-bipyramidal geometry

Energy Technology Data Exchange (ETDEWEB)

Kajiwara, Takashi [Department of Chemistry, Faculty of Science, Nara Women' s University (Japan)

2017-09-11

The right environment: The remarkable properties of a recently reported holmium(III)-based single-ion magnet have been ascribed to the hyperfine interactions with the half-integer nuclear spin in combination with the pentagonal-bipyramidal coordination environment. These results provide insight into the complicated magnetic properties of nanosized magnetic materials. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Dynamics of pulsed holmium:YAG laser photocoagulation of albumen

International Nuclear Information System (INIS)

Pfefer, T.J.; Welch, A.J.

2000-01-01

The pulsed holmium:YAG laser (λ = 2.12 μm, τ p = 250 μs) has been investigated as a method for inducing localized coagulation for medical procedures, yet the dynamics of this process are not well understood. In this study, photocoagulation of albumen (egg white) was analysed experimentally and results compared with optical-thermal simulations to investigate a rate process approach to thermal damage and the role of heat conduction and dynamic changes in absorption. The coagulation threshold was determined using probit analysis, and coagulum dynamics were documented with fast flash photography. The nonlinear computational model, which included a Beer's law optical component, a finite difference heat transfer component and an Arrhenius equation-based damage calculation, was verified against data from the literature. Moderate discrepancies between simulation results and our experimental data probably resulted from the use of a laser beam with an irregular spatial profile. This profile produced a lower than expected coagulation threshold and an irregular damage distribution within a millisecond after laser onset. After 1 ms, heat conduction led to smoothing of the coagulum. Simulations indicated that dynamic changes in absorption led to a reduction in surface temperatures. The Arrhenius equation was shown to be effective for simulating transient albumen coagulation during pulsed holmium:YAG laser irradiation. Greater understanding of pulsed laser-tissue interactions may lead to improved treatment outcome and optimization of laser parameters for a variety of medical procedures. (author)

Holmium laser vs. conventional (cold knife) direct visual internal urethrotomy for short-segment bulbar urethral stricture: Outcome analysis.

Science.gov (United States)

Jhanwar, Ankur; Kumar, Manoj; Sankhwar, Satya Narayan; Prakash, Gaurav

2016-01-01

Our goal was to analyze the outcome between holmium laser and cold knife direct visual internal urethrotomy (DVIU) for short-segment bulbar urethral stricture. We conducted a prospective study comprised of 112 male patients seen from June 2013 to December 2014. Inclusion criterion was short-segment bulbar urethral stricture (≤1.5cm). Exclusion criteria were prior intervention/urethroplasty, pan-anterior urethral strictures, posterior stenosis, urinary tract infection, and those who lost to followup. Patients were divided into two groups; Group A (n=58) included cold knife DVIU and group B (n=54) included holmium laser endourethrotomy patients. Patient followup included uroflowmetry at postoperative Day 3, as well as at three months and six months. Baseline demographics were comparable in both groups. A total of 107 patients met the inclusion criteria and five patients were excluded due to inadequate followup. Mean stricture length was 1.31 ± 0.252 cm (p=0.53) and 1.34 ± 0.251 cm in Groups A and B, respectively. Mean operating time in Group A was 16.3 ± 1.78 min and in Group B was 20.96 ± 2.23 min (p=0.0001). Five patients in Group A had bleeding after the procedure that was managed conservatively by applying perineal compression. Three patients in Group B had fluid extravasation postoperatively. Qmax (ml/s) was found to be statistically insignificant between the two groups at all followups. Both holmium laser and cold knife urethrotomy are safe and equally effective in treating short-segment bulbar urethral strictures in terms of outcome and complication rate. However, holmium laser requires more expertise and is a costly alternative.

Bone dissemination of prostate cancer after holmium laser enucleation of the prostate: a case report and a review of the literature.

Science.gov (United States)

Koguchi, Dai; Nishi, Morihiro; Satoh, Takefumi; Shitara, Toshiya; Matsumoto, Kazumasa; Fujita, Tetsuo; Yoshida, Kazunari; Iwamura, Masatsugu

2014-02-01

We report a case of dissemination of prostate cancer after holmium laser enucleation of the prostate in an 80-year-old patient. The patient presented at hospital because of nocturia. Transrectal ultrasound-guided biopsy was carried out because of high serum prostate-specific antigen (3.55 ng/mL), but it showed no malignancies. Benign prostate hyperplasia was diagnosed, and he was started on an α1-blocker. Although the urinary symptom improved with silodosin, acute urinary retention occurred 3 years after therapy began. Holmium laser enucleation of the prostate for relief of bladder outlet obstruction enabled discharge of urine. Pathological examination of the resected tissue found adenocarcinoma with a high Gleason score, 4 + 5. Serum alkaline phosphatase increased rapidly after holmium laser enucleation, and bone scintigraphy confirmed multiple bone metastases. Prostate cancer, T1bN0M1b, was diagnosed. © 2013 The Japanese Urological Association.

Use of the Moses Technology to Improve Holmium Laser Lithotripsy Outcomes: A Preclinical Study.

Science.gov (United States)

Elhilali, Mostafa M; Badaan, Shadie; Ibrahim, Ahmed; Andonian, Sero

2017-06-01

To evaluate in vitro and in vivo effects of Moses technology in Holmium laser and to compare it with the Regular mode in terms of lithotripsy efficiency and laser-tissue interactions. The Lumenis ® Pulse™ P120H holmium laser system together with Moses D/F/L fibers were used to compare the Regular mode with the Moses modes in stone retropulsion by using a high-speed camera, and stone ablation efficiency. In addition, a porcine ureteroscopy model was used to assess stone fragmentation and dusting as well as laser-tissue interaction with the ureteral wall. After a laser pulse, in vitro stone displacement experiments showed a significant reduction in retropulsion when using the Moses mode. The stone movement was reduced by 50 times at 0.8 J and 10 Hz (p technology resulted in more efficient laser lithotripsy, in addition to significantly reduced stone retropulsion, and displayed a margin of safety that may result in a shorter procedural time and safer lithotripsy.

Laparoscopy-assisted micropercutaneous choledocholithotripsy with holmium laser in a cholecystectomized patient: an initial report.

Science.gov (United States)

Gökçen, Kaan; Atabey, Mustafa; Gökçen, Pınar; Gökçe, Gökhan

2017-12-01

We present a novel minimally invasive technique, laparoscopy-assisted micropercutaneous choledocholithotripsy, for choledocholithiasis that cannot be treated with other endoscopic techniques. This technique includes standard laparoscopic exploration of the common bile duct, combined with an all-seeing needle and holmium laser lithotripsy. As is known, an all-seeing needle is used in micropercutaneous nephrolithotomy for middle-sized renal stones. In this technique, an all-seeing needle was inserted into the dilatated common bile duct under laparoscopic vision and then a lithotripsy procedure was performed with a holmium laser behind the biliary stent. A cholecystectomized female patient with a 21-mm stone in the common bile duct who previously underwent an unsuccessful endoscopic retrograde cholangiopancreatography procedure was operated on in our service with laparoscopy-assisted micropercutaneous choledocholithotomy without a T-tube. This novel procedure was completed uneventfully and the patient was discharged without any complications. In the future, this procedure will hopefully be a treatment modality in choledocholithiasis that cannot be treated by other minimally invasive techniques.

Simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides by second order derivative spectrophotometry

International Nuclear Information System (INIS)

Anbu, M.; Prasada Rao, T.; Iyer, C. S. P.; Damodaran, A. D.

1996-01-01

High purity individual rare earth oxides are increasingly used as major components in lasers (Y 2 O 3 ), phosphors (YVO 3 , Eu 2 O 3 ), magnetic bubble memory films (Gd 2 O 3 ) and refractive-index lenses and fibre optics (La 2 O 3 ). The determination of individual lanthanides in high purity rare earth oxides is a more important and difficult task. This paper reports the utilization of higher order derivative spectrophotometry for the simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides. The developed procedure is simple, reliable and allows the determination of 0.001 to 0.2% of dysprosium, holmium and erbium in several rare earth. (author). 9 refs, 2 figs, 2 tabs

Synthesis, Characterization and Thermal Diffusivity of Holmium and Praseodymium Zirconates

OpenAIRE

Stopyra M.; Niemiec D.; Moskal G.

2016-01-01

A2B2O7 oxides with pyrochlore or defected fluorite structure are among the most promising candidates for insulation layer material in thermal barrier coatings. The present paper presents the procedure of synthesis of holmium zirconate Ho2Zr2O7 and praseodymium zirconate Pr2Zr2O7 via Polymerized-Complex Method (PCM). Thermal analysis of precursor revealed that after calcination at relatively low temperature (700°C) fine-crystalline, single-phase material is obtained. Thermal diffusivity was me...

Synthesis and Characterization of Holmium-Doped Iron Oxide Nanoparticles

Directory of Open Access Journals (Sweden)

Maarten Bloemen

2014-02-01

Full Text Available Rare earth atoms exhibit several interesting properties, for example, large magnetic moments and luminescence. Introducing these atoms into a different matrix can lead to a material that shows multiple interesting effects. Holmium atoms were incorporated into an iron oxide nanoparticle and the concentration of the dopant atom was changed in order to determine its influence on the host crystal. Its magnetic and magneto-optical properties were investigated by vibrating sample magnetometry and Faraday rotation measurements. The luminescent characteristics of the material, in solution and incorporated in a polymer thin film, were probed by fluorescence experiments.

Magnetic x-ray scattering studies of holmium using synchro- tron radiation

International Nuclear Information System (INIS)

Gibbs, D.; Moncton, D.E.; D'Amico, K.L.; Bohr, J.; Grier, B.H.

1985-01-01

We present the results of magnetic x-ray scattering experiments on the rare-earth metal holmium using synchrotron radiation. Direct high-resolution measurements of the nominally incommensurate magnetic satellite reflections reveal new lock-in behavior which we explain within a simple spin-discommensuration model. As a result of magnetoelastic coupling, the spin-discommensuration array produces additional x-ray diffraction satellites. Their observation further substantiates the model and demonstrates additional advantages of synchrotron radiation for magnetic-structure studies

Fine- and hyperfine structure investigations of the even-parity configuration system of the atomic holmium

Science.gov (United States)

Stefanska, D.; Ruczkowski, J.; Elantkowska, M.; Furmann, B.

2018-04-01

In this work new experimental results concerning the hyperfine structure (hfs) for the even-parity level system of the holmium atom (Ho I) were obtained; additionally, hfs data obtained recently as a by-product in investigations of the odd-parity level system were summarized. In the present work the values of the magnetic dipole and the electric quadrupole hfs constants A and B were determined for 24 even-parity levels, for 14 of them for the first time. On the basis of these results, as well as on available literature data, a parametric study of the fine structure and the hyperfine structure for the even-parity configurations of atomic holmium was performed. A multi-configuration fit of 7 configurations was carried out, taking into account second-order of the perturbation theory. For unknown electronic levels predicted values of the level energies and hfs constants are given, which can facilitate further experimental investigations.

The application of x-ray spectrometry to isotopic-source activation analysis of dysprosium and holmium

International Nuclear Information System (INIS)

Pillay, A.E.; Mboweni, R.C.M.

1990-01-01

A novel aspect of activation analysis is described for the determination of dysprosium and holmium at low concentrations. The method involves the measurement of K x-rays from radionuclides produced by thermal neutron activation using a 1 mg 252 Cf source. The basis for elemental selection depends largely on the demand for analysis and on the existence of favourable nuclear properties for the production of a practicable x-ray yield. A full appraisal of the analytical potential of the method is presented with particular emphasis on its application to geological matrices. The sensitivity was optimised by employing a detector that was particularly effective at photon energies below 150 keV. Analytical conditions are demonstrated for the elements of interest over a wide range of concentrations in small powdered samples. The investigation formed the basis of a feasibility study to establish if the application could be developed for the routine off-line determination of dysprosium and holmium using an isotopic-neutron source. (author)

Feasibility of Endovascular Radiation Therapy Using Holmium-166 Filled Balloon Catheter in a Swine Hemodialysis Fistula Model: Preliminary Results

Energy Technology Data Exchange (ETDEWEB)

Won, Jong Yun; Lee, Kwang Hun; Lee, Do Yun [Dept. of Radiology, Research Institute of Radiological Science, Yensei University College of Medicine, Seoul (Korea, Republic of); Kim, Myoung Soo [Dept. of Radiology, Yensei University College of Medicine, Seoul (Korea, Republic of); Kang, Byung Chul [Dept. of Radiology, Internal Medicine, EwhaWoman' s University School of Medicine, Seoul (Korea, Republic of); Kim, Seung Jung [Dept. of Internal Medicine, EwhaWoman' s University School of Medicine, Seoul (Korea, Republic of)

2011-08-15

To describe how to make a swine hemodialysis fistula model and report our initial experience to test the feasibility of endovascular radiation therapy with Holmium-166 filled balloon catheters. The surgical formation of arterio-venous fistula (AVF) was performed by end-to-side anastomosis of the bilateral jugular vein and carotid artery of 6 pigs. After 4 weeks, angiograms were taken and endovascular radiation was delivered to the venous side of AVF with Holmium-166 filled balloon catheters. Pigs were sacrificed 4 weeks after the radiation and AVFs were harvested for histological examination. All animals survived without any morbidity during the experimental periods. The formation of fistula on the sides of necks was successful in 11 of the 12 pigs (92%). One AVF failed from the small jugular vein. On angiograms, 4 of the 11 AVFs showed total occlusion or significant stenosis and therefore, endovascular radiation could not be performed. Of 7 eligible AVFs, five underwent successful endovascular radiation and two AVFs did not undergo radiation for the control. Upon histologic analysis, one non-radiated AVF showed total occlusion and others showed intimal thickening from the neointimal hyperplasia. Formation of the swine carotid artery-jugular vein hemodialysis fistula model was successful. Endovascular radiation using a Holmium-166 filled balloon catheter was safe and feasible.

Diode-Pumped Thulium (Tm)/Holmium (Ho) Composite Fiber 2.1-Micrometers Laser

Science.gov (United States)

2015-09-01

Schematic of the 800-nm diode pumped Tm/Ho composite fiber laser 8 Under quasi-continuous wave (Q- CW ) pumping conditions of 1-ms duration and a...Fig. 9 (Top) Schematic of the 800-nm diode -pumped Tm/Ho composite fiber laser with outcoupler. (Left) Q- CW laser performance of the Tm/Ho composite...ARL-TR-7452 ● SEP 2015 US Army Research Laboratory Diode -Pumped Thulium (Tm)/Holmium (Ho) Composite Fiber 2.1-μm Laser by G

Successful Treatment of Stent Knot in the Proximal Ureter Using Ureteroscopy and Holmium Laser

Directory of Open Access Journals (Sweden)

Masters M. Richards

2011-01-01

Full Text Available Knotted ureteral stent is rare yet tedious complication that might represent a treatment challenge to the endourologist. Only twelve cases of knotted stent have been reported. Different management options have been reported, including simple traction, ureteroscopy, percutaneous removal, and open surgery. In this paper, we present the successful untying of the knot using ureteroscopy with holmium laser.

2.05 µm holmium-doped all-fiber laser diode-pumped at 1.125 µm

Science.gov (United States)

Kir'yanov, A. V.; Barmenkov, Y. O.; Villegas Garcia, I.

2017-08-01

We report a holmium-doped all-fiber laser oscillating at ~2.05 µm in continuous wave at direct in-core pumping by a 1.125 µm laser diode. Two types of home-made holmium-doped alumino-germano-silicate fiber (HDF), differentiated in the Ho3+ doping level, were fabricated to implement the laser, for revealing the effect of Ho3+ concentration upon the laser output. Firstly, the fibers were characterized thoroughly from the material and optical viewpoints. Then, laser action with both HDFs was assessed using the simplest Fabry-Perot cavity, assembled by a couple of spectrally adjusted fiber Bragg gratings, also made-in-house. In the best case, when using the lower-doped HDF of proper length (1.4 m), low threshold (~370 mW) and moderate slope efficiency (~13%) of ~2.05 µm lasing were obtained at 1.125 µm diode pumping. Long-term stability, high brightness, low noise, and purely CW operation are shown to be the laser’s attractive features. Yet, when utilizing the heavier-doped HDF, laser output is revealed to be overall worse, with a possible reason being the deteriorating Ho3+ concentration-related effects.

Long-Term Outcomes of Laser Prostatectomy for Storage Symptoms: Comparison of Serial 5-Year Followup Data between High Performance System Photoselective Vaporization and Holmium Laser Enucleation of the Prostate.

Science.gov (United States)

Cho, Min Chul; Song, Won Hoon; Park, Juhyun; Cho, Sung Yong; Jeong, Hyeon; Oh, Seung-June; Paick, Jae-Seung; Son, Hwancheol

2018-01-09

We compared long-term storage symptom outcomes between photoselective laser vaporization of the prostate with a 120 W high performance system and holmium laser enucleation of the prostate. We also determined factors influencing postoperative improvement of storage symptoms in the long term. Included in our study were 266 men, including 165 treated with prostate photoselective laser vaporization using a 120 W high performance system and 101 treated with holmium laser enucleation of the prostate, on whom 60-month followup data were available. Outcomes were assessed serially 6, 12, 24, 36, 48 and 60 months postoperatively using the International Prostate Symptom Score, uroflowmetry and the serum prostate specific antigen level. Postoperative improvement in storage symptoms was defined as a 50% or greater reduction in the subtotal storage symptom score at each followup visit after surgery compared to baseline. Improvements in frequency, urgency, nocturia, subtotal storage symptom scores and the quality of life index were maintained up to 60 months after photoselective laser vaporization or holmium laser enucleation of the prostate. There was no difference in the degree of improvement in storage symptoms or the percent of patients with postoperative improvement in storage symptoms between the 2 groups throughout the long-term followup. However, the holmium laser group showed greater improvement in voiding symptoms and quality of life than the laser vaporization group. On logistic regression analysis a higher baseline subtotal storage symptom score and a higher BOOI (Bladder Outlet Obstruction Index) were the factors influencing the improvement in storage symptoms 5 years after prostate photoselective laser vaporization or holmium laser enucleation. Our serial followup data suggest that storage symptom improvement was maintained throughout the long-term postoperative period for prostate photoselective laser vaporization with a 120 W high performance system and holmium

Lumbar endoscopic percutaneous discolisis, with Holmium YAG laser - four years of experience

International Nuclear Information System (INIS)

Ramirez L, Jorge Felipe; Rugeles O, Jose G

2001-01-01

we have designed a prospective study over 220 patients with lumbar hernia. our purpose is to show the results that we have obtained with endoscopic percutaneous holmium YAG laser lumbar disc decompression. In all cases, ambulatory surgery was performed using local anesthesia, follow up based on Mac Nab criteria was made with excellent and good results in 75% of patients this is a useful safety outpatient procedure with good results, fewer complications, reduced costs and with the same or better results than traditional procedures

40 CFR 141.700 - General requirements.

Science.gov (United States)

2010-07-01

... described in §§ 141.721 through 141.722. (7) Systems must address significant deficiencies identified in... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements. 141.700 Section 141.700 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS...

18 CFR 284.141 - Applicability.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Applicability. 284.141 Section 284.141 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Sales by Intrastate Pipelines § 284.141 Applicability. This subpart implements section 311(b) of...

40 CFR 141.89 - Analytical methods.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.89 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Control of Lead and Copper § 141.89 Analytical methods. (a... shall be conducted with the methods in § 141.23(k)(1). (1) Analyses for alkalinity, calcium...

10 CFR 63.141 - Scope.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Scope. 63.141 Section 63.141 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Quality Assurance § 63.141 Scope. As used in this part, quality assurance comprises all those...

Alternative Treatment of Osteoma Using an Endoscopic Holmium-YAG Laser

Directory of Open Access Journals (Sweden)

Ba Leun Han

2012-07-01

Full Text Available Osteoma is one of the most common tumors of the cranial vault and the facial skeleton. For osteoma in the facial region, endoscopic resection is widely used to prevent surgical scarring. Tumors in a total of 14 patients were resected using an endoscopic holmium-doped yttrium aluminium garnet (Ho:YAG laser with a long flexible fiber. Aside from having the advantage of not leaving a scar due to the use of endoscopy, this procedure allowed resection at any position, was minimally invasive, and caused less postoperative pain. This method yielded excellent cosmetic results, so the endoscopic Ho:YAG laser is expected to emerge as a good treatment option for osteoma.

High power operation of cladding pumped holmium-doped silica fibre lasers.

Science.gov (United States)

Hemming, Alexander; Bennetts, Shayne; Simakov, Nikita; Davidson, Alan; Haub, John; Carter, Adrian

2013-02-25

We report the highest power operation of a resonantly cladding-pumped, holmium-doped silica fibre laser. The cladding pumped all-glass fibre utilises a fluorine doped glass layer to provide low loss cladding guidance of the 1.95 µm pump radiation. The operation of both single mode and large-mode area fibre lasers was demonstrated, with up to 140 W of output power achieved. A slope efficiency of 59% versus launched pump power was demonstrated. The free running emission was measured to be 2.12-2.15 µm demonstrating the potential of this architecture to address the long wavelength operation of silica based fibre lasers with high efficiency.

Microspheres of poly(ε-caprolactone) loaded Holmium-165: morphology and thermal degradation behavior

International Nuclear Information System (INIS)

Geraldes, Adriana Napoleao; Miyamoto, Douglas Massao; Lira, Raphael Arivar de; Osso Junior, Joao Alberto; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de

2011-01-01

Polycaprolactone (PCL), being one of the most important biocompatible and biodegradable aliphatic polyester, provides many potential biomedical. The preparation of biodegradable materials, polymer-based microspheres, is being developed by our group and the goal is to prepare and label with Ho-165 different polymer-based microspheres. The use of radionuclide-loaded microspheres is a promising treatment of liver malignancies. PCL microspheres can be loaded with holmium acetylacetonate (HoAcAc). PCL and PCL/HoAcAc microspheres were prepared by an emulsion solvent extraction/evaporation technique. The PCL/ HoAcAc microspheres were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP to radionuclide activation. Gamma irradiation was performed at 25 and 50 kGy doses. The microspheres were evaluated by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TG), Fourier transformed infrared spectroscopy (FTIR), scanning electron microscopy (SEM) and con focal laser scanning microscopy (CLSM). In the CLSM images were observed emission in 488 nm characteristic of holmium. The SEM surface image of PCL/HoAcAc microspheres showed more roughness than PCL microspheres. TG of PCL/HoAcAc microspheres showed a substantial weight loss above 200 degree C, indicating decomposition of HoAcAc. The residual weight indicates the presence of Ho 2 O 3 . Gamma irradiation at 25 and 50 kGy doses had no effect on the PCL/HoAcAc microspheres, which indicates that the chemical composition of the microspheres had not change. (author)

Microspheres of poly({epsilon}-caprolactone) loaded Holmium-165: morphology and thermal degradation behavior

Energy Technology Data Exchange (ETDEWEB)

Geraldes, Adriana Napoleao; Miyamoto, Douglas Massao; Lira, Raphael Arivar de; Osso Junior, Joao Alberto; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2011-07-01

Polycaprolactone (PCL), being one of the most important biocompatible and biodegradable aliphatic polyester, provides many potential biomedical. The preparation of biodegradable materials, polymer-based microspheres, is being developed by our group and the goal is to prepare and label with Ho-165 different polymer-based microspheres. The use of radionuclide-loaded microspheres is a promising treatment of liver malignancies. PCL microspheres can be loaded with holmium acetylacetonate (HoAcAc). PCL and PCL/HoAcAc microspheres were prepared by an emulsion solvent extraction/evaporation technique. The PCL/ HoAcAc microspheres were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP to radionuclide activation. Gamma irradiation was performed at 25 and 50 kGy doses. The microspheres were evaluated by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TG), Fourier transformed infrared spectroscopy (FTIR), scanning electron microscopy (SEM) and con focal laser scanning microscopy (CLSM). In the CLSM images were observed emission in 488 nm characteristic of holmium. The SEM surface image of PCL/HoAcAc microspheres showed more roughness than PCL microspheres. TG of PCL/HoAcAc microspheres showed a substantial weight loss above 200 degree C, indicating decomposition of HoAcAc. The residual weight indicates the presence of Ho{sub 2}O{sub 3}. Gamma irradiation at 25 and 50 kGy doses had no effect on the PCL/HoAcAc microspheres, which indicates that the chemical composition of the microspheres had not change. (author)

Outcome analysis of holmium laser and pneumatic lithotripsy in the endoscopic management of lower ureteric calculus in pediatric patients: a prospective study

Directory of Open Access Journals (Sweden)

Ankur Jhanwar

Full Text Available ABSTRACT Objective: To analyse outcomes of holmium laser and pneumatic lithotripsy in treatment of lower ureteric calculus in pediatric patients. Materials and methods: Prospective study conducted between August 2013 and July 2015. Inclusion criteria were lower ureteric calculus with stone size ≤1.5cms. Exclusion criteria were other than lower ureteric calculus, stone size ≥1.5cms, congenital renal anomalies, previous ureteral stone surgery. Patients were divided into two groups. Group A underwent pneumatic and group B underwent laser lithotripsy procedure. Patient's baseline demographic and peri-operative data were recorded and analysed. Post operatively X-ray/ultrasound KUB (Kidney, ureter and bladder was performed to assess stone free status. Results: A total of 76 patients who met the inclusion criteria to ureteroscopic intracorporeal lithotripsy were included. Group A and B included 38 patients in each. Mean age was 12.5±2.49 in Group A and 11.97±2.74 years in Group B respectively (p=0.38. Overall success rate was 94.73% in Group A and 100% in Group B, respectively (p=0.87. Conclusion: Holmium Laser lithotripsy is as efficacious as pneumatic lithotripsy and can be used safely for the endoscopic management of lower ureteric calculus in pediatric patients. However, holmium laser requires more expertise and it is a costly alternative.

Robotic Assisted Simple Prostatectomy versus Holmium Laser Enucleation of the Prostate for Lower Urinary Tract Symptoms in Patients with Large Volume Prostate: A Comparative Analysis from a High Volume Center.

Science.gov (United States)

Umari, Paolo; Fossati, Nicola; Gandaglia, Giorgio; Pokorny, Morgan; De Groote, Ruben; Geurts, Nicolas; Goossens, Marijn; Schatterman, Peter; De Naeyer, Geert; Mottrie, Alexandre

2017-04-01

We report a comparative analysis of robotic assisted simple prostatectomy vs holmium laser enucleation of the prostate in patients who had benign prostatic hyperplasia with a large volume prostate (greater than 100 ml). A total of 81 patients underwent robotic assisted simple prostatectomy and 45 underwent holmium laser enucleation of the prostate in a 7-year period. Patients were preoperatively assessed with transrectal ultrasound and uroflowmetry. Functional parameters were assessed postoperatively during followup. Perioperative outcomes included operative time, postoperative hemoglobin, catheterization time and hospitalization. Complications were reported according to the Clavien-Dindo classification. Compared to the holmium laser enucleation group, patients treated with prostatectomy were significantly younger (median age 69 vs 74 years, p = 0.032) and less healthy (Charlson comorbidity index 2 or greater in 62% vs 29%, p = 0.0003), and had a lower rate of suprapubic catheterization (23% vs 42%, p = 0.028) and a higher preoperative I-PSS (International Prostate Symptom Score) (25 vs 21, p = 0.049). Both groups showed an improvement in the maximum flow rate (15 vs 11 ml per second, p = 0.7), and a significant reduction in post-void residual urine (-73 vs -100 ml, p = 0.4) and I-PSS (-20 vs -18, p = 0.8). Median operative time (105 vs 105 minutes, p = 0.9) and postoperative hemoglobin (13.2 vs 13.8 gm/dl, p = 0.08) were similar for robotic assisted prostatectomy and holmium laser enucleation, respectively. Median catheterization time (3 vs 2 days, p = 0.005) and median hospitalization (4 vs 2 days, p = 0.0001) were slightly shorter in the holmium laser group. Complication rates were similar with no Clavien grade greater than 3 in either group. Our results from a single center suggest comparable outcomes for robotic assisted simple prostatectomy and holmium laser enucleation of the prostate in patients with a large volume prostate. These findings require

Dicty_cDB: VHI141 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

HOLMIUM LASER ENUCLEATION OF THE PROSTATE, FEATURES OF THE INTERVENTION

Directory of Open Access Journals (Sweden)

O. Y. Hublarov

2014-01-01

Full Text Available Holmium laser enucleation of the prostate (HoLEP is a minimally invasive procedure used for the treatment of benign prostatic hyperplasia. The method is as reliable performance with long-term monitoring, and high safety compared to conventional methods of surgical treatment of prostatic hyperplasia – suprapubic simple prostatectomy and transurethral resection of the prostate. Despite the complexity and duration of training for mastering HoLEP currently has a definite Frortage of references detailing the technical aspects of the method. The proposed article is detailed recommendations skilled mastering HoLEP. The material is based on a review of existing literature and my own experience and clinical material Latgale Urology Center in the development and conduct of HoLEP. 

Evidence for a devil's staircase in holmium produced by an applied magnetic field

International Nuclear Information System (INIS)

Cowley, R.A.; Jehan, D.A.; McMorrow, D.F.; McIntyre, G.J.

1991-01-01

The magnetic structure of holmium has been studied using neutron diffraction when a magnetic field is applied along the c axis. The field has the effect of suppressing the onset of the commensurate cone phase found at low temperatures in zero field, and instead produces a series of spin-slip structures. In contrast to the zero-field diffraction experiments, where a continuous variation of the magnetic wave vector q was observed, we find that below ∼15 K the wave vector q is always commensurate and forms a devil's staircase with increasing field

The effect and influence of lumen holmium laser lithotripsy on serum oxidative stress proteins and inflammatory factors of ureteral calculi patients

Directory of Open Access Journals (Sweden)

Fan Zhang

2016-09-01

Full Text Available Objective: To investigate the effect and influence of lumen holmium laser lithotripsy on treating serum oxidative stress proteins and inflammatory factors of patients with ureteral calculi. Methods: A total of 120 cases of patients with ureteral calculi treated in our hospital from May 2010 to Nov 2014 were enrolled in this research for an analysis study. The effect and influence on serum oxidative stress proteins and inflammatory factors of lumen holmium laser lithotripsy on ureteral calculi patients were assayed. Then 120 cases of healthy subjects in our hospital at the same period were taken as control. Results: Among the 120 cases of ureteral calculi patients, 113 cases of patients showed successful operation, with a success rate of 94.2%. The average calculi-discharged time was (28.4 ± 11.2 d and the average operation time was (58.9 ± 10.7 min, while the postoperative hospital stay is (3.8 ± 1.2 d. The results also showed that the levels of NOX1. NOX3, NOX4 and NOX5, and levels of interleukin-2 (IL-2, IL-6, IL-10 and TNF-α of patients with ureteral calculi were significantly higher, compared with the control group, and these parameters were normalized greatly after operation with that the levels of them were significantly different from those before operation. Conclusion: Lumen holmium laser lithotripsy exerts a significant effect on ureteral calculi patients and the oxidative stress parameters and inflammatory factor were normalized greatly.

40 CFR 141.76 - Recycle provisions.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Recycle provisions. 141.76 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.76 Recycle provisions. (a... recycle spent filter backwash water, thickener supernatant, or liquids from dewatering processes must meet...

40 CFR 141.70 - General requirements.

Science.gov (United States)

2010-07-01

...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.70 General requirements. (a... regulations establish criteria under which filtration is required as a treatment technique for public water... filtration requirements in § 141.73 and the disinfection requirements in § 141.72(b). (c) Each public water...

14 CFR 141.23 - Advertising limitations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 141.23 Section 141...) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.23 Advertising limitations. (a) The... certificate may not advertise that the school is certificated unless it clearly differentiates between courses...

Study of intraarticular application of 166-Holmium IHPP in healthy hares

International Nuclear Information System (INIS)

Szentesi, M.; Koernyei, J.; Antalffi, M.; Toerkoe, J.; Toth, G.Y.; Janoki, G.Y.; Balogh, L.

2002-01-01

Radiosynoviorthesis non invasive therapy in rheumatoid arthritis is an alternative of surgical synovectomy. This method was applied first by Fellinger in 1952, and since then it has been practiced all over the world. The leakage of traditionally applied isotopes is cca. 4-10%, and the whole body dose is 10 rads. The objective of our work is to produce a nuclear medication with a minimum radioactive load, of short half-life and ideal molecule size for the treatment of radiosynoviorthesis / 166- Holmium IHPP / and the study of its effect on healthy hares. The first results have been already reported on previously. 166-Holmium IHPP has the features of: half-life of 26.9 hr, the maximum soft-tissue penetration of a beta particle 1.84 MeV, emitted from 166-Ho 8.4 mm. With an average of 3.3 mm. Methods applied: Biodistribution analysis, gamma camera analysis, biochemical and histological tests with photo- and electro microscope were carried out on healthy New Zealand hares 6, 24, 72, 168 hours after radiosynoviorthesis. Results: All the testing methods applied showed that 97 /96,1-98,2/ % remained on the spot of the injection and the 2/3 of the small percentage released leakage: is excreted by the liver and the other 1/3 of it with the urine.The hematological and biochemical parameters did not show differences. During histological examination moderate level acute radioarthritis in the knee joint treated was observed (6-24 hours after the injection), then moderate level subacute radioarthritis with slight degeneration in the synovial membrane and in the synovial fluid. It was only the electro microscopic examination that did show a minimal degeneration in the cartilage and in the menisci, but it got regenerated in 168 hours. Conclusion: The examination carried out has proved that 166-Ho -IHPP can be effectively applied in radiosynoviorthesis. Clinical testing has started

Clinical effects of transcatheter hepatic arterial embolization with holmium-166 poly(l-lactic acid) microspheres in healthy pigs

Energy Technology Data Exchange (ETDEWEB)

Vente, M.A.D.; Nijsen, J.F.W.; Wit, T.C. de; Schip, A.D. van het [University Medical Center Utrecht, Department of Nuclear Medicine, P.O. Box 85500, Utrecht (Netherlands); Seppenwoolde, J.H.; Seevinck, P.R. [University Medical Center Utrecht, Image Sciences Institute, Utrecht (Netherlands); Krijger, G.C. [Delft University of Technology, Department of Radiation, Radionuclides and Reactors, Faculty of Applied Sciences, Delft (Netherlands); Huisman, A. [University Medical Center Utrecht, Department of Clinical Chemistry and Haematology, Utrecht (Netherlands); Zonnenberg, B.A. [University Medical Center Utrecht, Department of Internal Medicine, Utrecht (Netherlands); Ingh, T.S.G.A.M. van den [TCCI Consultancy B.V., P.O. Box 85032, Utrecht (Netherlands)

2008-07-15

The aim of this study is to evaluate the toxicity of holmium-166 poly(l-lactic acid) microspheres administered into the hepatic artery in pigs. Healthy pigs (20-30 kg) were injected into the hepatic artery with holmium-165-loaded microspheres ({sup 165}HoMS; n = 5) or with holmium-166-loaded microspheres ({sup 166}HoMS; n = 13). The microspheres' biodistribution was assessed by single-photon emission computed tomography and/or MRI. The animals were monitored clinically, biochemically, and ({sup 166}HoMS group only) hematologically over a period of 1 month ({sup 165}HoMS group) or over 1 or 2 months ({sup 166}HoMS group). Finally, a pathological examination was undertaken. After microsphere administration, some animals exhibited a slightly diminished level of consciousness and a dip in appetite, both of which were transient. Four lethal adverse events occurred in the {sup 166}HoMS group due either to incorrect administration or comorbidity: inadvertent delivery of microspheres into the gastric wall (n = 2), preexisting gastric ulceration (n = 1), and endocarditis (n = 1). AST levels were transitorily elevated post-{sup 166}HoMS administration. In the other blood parameters, no abnormalities were observed. Nuclear scans were acquired from all animals from the {sup 166}HoMS group, and MRI scans were performed if available. In pigs from the {sup 166}HoMS group, atrophy of one or more liver lobes was frequently observed. The actual radioactivity distribution was assessed through ex vivo {sup 166m}Ho measurements. It can be concluded that the toxicity profile of HoMS is low. In pigs, hepatic arterial embolization with {sup 166}HoMS in amounts corresponding with liver-absorbed doses of over 100 Gy, if correctly administered, is not associated with clinically relevant side effects. This result offers a good perspective for upcoming patient trials. (orig.)

47 CFR 101.141 - Microwave modulation.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Microwave modulation. 101.141 Section 101.141... SERVICES Technical Standards § 101.141 Microwave modulation. (a) Microwave transmitters employing digital modulation techniques and operating below 25.25 GHz (except for MVDDS stations in the 12,200-12,700 MHz band...

14 CFR 141.91 - Satellite bases.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Satellite bases. 141.91 Section 141.91... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.91 Satellite bases. The holder of a... assistant chief instructor is designated for each satellite base, and that assistant chief instructor is...

Holmium-doped fluorotellurite microstructured fibers for 2.1 μm lasing.

Science.gov (United States)

Yao, Chuanfei; He, Chunfeng; Jia, Zhixu; Wang, Shunbin; Qin, Guanshi; Ohishi, Yasutake; Qin, Weiping

2015-10-15

Holmium (Ho3+)-doped fluorotellurite microstructured fibers based on TeO2-BaF2-Y2O3 glasses are fabricated by using a rod-in-tube method. By using a 1.992 μm fiber laser as the pump source, lasing at 2.077 μm is obtained from a 27 cm long Ho3+-doped fluorotellurite microstructured fiber. The maximum unsaturated power is about 161 mW and the corresponding slope efficiency is up to 67.4%. The influence of fiber length on lasing at 2.1 μm is also investigated. Our results show that Ho3+-doped fluorotellurite microstructured fibers are promising gain media for 2.1 μm laser applications.

22 CFR 141.5 - Compliance information.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 141.5 Section 141.5... DEPARTMENT OF STATE-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 141.5 Compliance information... such information, as a responsible Departmental official or his designee may determine to be necessary...

19 CFR 141.88 - Computed value.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computed value. 141.88 Section 141.88 Customs... (CONTINUED) ENTRY OF MERCHANDISE Invoices § 141.88 Computed value. When the port director determines that information as to computed value is necessary in the appraisement of any class or kind of merchandise, he...

14 CFR 1264.141 - Judicial review.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1264.141 Section 1264.141... PENALTIES ACT OF 1986 § 1264.141 Judicial review. Section 3805 of Title 31, United States Code, authorizes judicial review by an appropriate United States District Court of a final decision of the authority head...

25 CFR 141.16 - Price marking.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Price marking. 141.16 Section 141.16 Indians BUREAU OF... AND ZUNI RESERVATIONS General Business Practices § 141.16 Price marking. The price of each article... visible to the customer and that affords the customer a reasonable opportunity to learn the price of the...

Percutaneous Transhepatic Endoscopic Holmium Laser Lithotripsy for Intrahepatic and Choledochal Biliary Stones

International Nuclear Information System (INIS)

Rimon, Uri; Kleinmann, Nir; Bensaid, Paul; Golan, Gil; Garniek, Alexander; Khaitovich, Boris; Winkler, Harry

2011-01-01

Purpose: To report our approach for treating complicated biliary calculi by percutaneous transhepatic endoscopic biliary holmium laser lithotripsy (PTBL). Patients and Methods: Twenty-two symptomatic patients (11 men and 11 women, age range 51 to 88 years) with intrahepatic or common bile duct calculi underwent PTBL. Nine patients had undergone previous gastrectomy and small-bowel anastomosis, thus precluding endoscopic retrograde cholangiopancreatography. In the other 13 patients, stone removal attempts by ERCP failed due to failed access or very large calculi. We used a 7.5F flexible ureteroscope and a 200-μm holmium laser fiber by way of a percutaneous transhepatic tract, with graded fluoroscopy, to fragment the calculi with direct vision. Balloon dilatation was added when a stricture was seen. The procedure was performed with the patient under general anaesthesia. A biliary drainage tube was left at the end of the procedure. Results: All stones were completely fragmented and flushed into the small bowel under direct vision except for one patient in whom the procedure was aborted. In 18 patients, 1 session sufficed, and in 3 patients, 2 sessions were needed. In 7 patients, balloon dilatation was performed for benign stricture after Whipple operation (n = 3), for choledochalenteric anastomosis (n = 3), and for recurrent cholangitis (n = 1). Adjunctive “balloon push” (n = 4) and “rendezvous” (n = 1) procedures were needed to completely clean the biliary tree. None of these patients needed surgery. Conclusion: Complicated or large biliary calculi can be treated successfully using PTBL. We suggest that this approach should become the first choice of treatment before laparoscopic or open surgery is considered.

Hyperfine structure investigations for the odd-parity configuration system in atomic holmium

Science.gov (United States)

Stefanska, D.; Furmann, B.

2018-02-01

In this work new experimental results of the hyperfine structure (hfs) in the holmium atom are reported, concerning the odd-parity level system. Investigations were performed by the method of laser induced fluorescence in a hollow cathode discharge lamp on 97 spectral lines in the visible part of the spectrum. Hyperfine structure constants: magnetic dipole - A and electric quadrupole - B for 40 levels were determined for the first time; for another 21 levels the hfs constants available in the literature were remeasured. Results for the A constants can be viewed as fully reliable; for B constants further possibilities of improving the accuracy are considered.

Holmium laser assisted ′anatomical′ enucleation of adenoma of benign hyperplasia of prostate

Directory of Open Access Journals (Sweden)

Shivadeo S Bapat

2006-01-01

Full Text Available Aims: To present our technique of Holmium Laser assisted "ANATOMICAL" enucleation of the benign prostatic adenoma (HoLEP in 219 patients. Procedure is based on the principle of digital enucleation of the adenoma from its surgical capsule, but performed entirely by perurethral endoscopic technique assisted by Holmium Laser. Materials and Methods: From March 2001 to November 2004, 219 patients under went HoLEP. After the initial cuts from bladder neck to verumontanum at 5 and 7 o′clock position, capsule is identified. The beak of the resectoscope sheath was inserted in the plane between the capsule and the adenoma and the adenoma was physically pushed away towards the urethra from the capsule. Laser was used to coagulate the bleeders, to cut the mucosal attachments and tough stromal tissue. Procedure was repeated for median and two lateral lobes. There was minimal bleeding and fluid absorption. Complications were few. Results: In 206 cases successful enucleation of the adenoma was carried out. First 13 cases formed part of the learning curve and were completed by standard transurethral resection of prostate (TURP. IPSS score dropped from average of 23 to 8 and peak flow improved from 20. No patient had postoperative urinary incontinence or stricture. Conclusions: HoLEP is an effective alternative to TURP. Ultimate end results replicate the end results of open enucleation of BPH without its morbidity and have all the advantages of endoscopic surgery. It offers distinct advantages over standard TURP as the incidence of blood transfusion and fluid absorption are greatly minimized.

Magneto-optical study of holmium iron garnet Ho3Fe5O12

Science.gov (United States)

Kalashnikova, A. M.; Pavlov, V. V.; Kimel, A. V.; Kirilyuk, A.; Rasing, Th.; Pisarev, R. V.

2012-09-01

Bulk holmium iron garnet Ho3Fe5O12 is a cubic ferrimagnet with Curie temperature TC = 567 K and magnetization compensation point in the range 130-140 K. The magneto-optical data are presented for a holmium iron garnet Ho3Fe5O12 film, ˜10 μm thick, epitaxially grown on a (111)-type gadolinium-gallium garnet Gd3Ga5O12 substrate. A specific feature of this structure is that the parameters of the bulk material, from which the film was grown, closely match the substrate ones. The temperature and field dependences of Faraday rotation as well as the temperature dependence of the domain structure in zero field were investigated. The compensation point of the structure was found to be Tcomp = 127 K. It was shown that the temperature dependence of the characteristic size of domain structure diverges at this point. Based on the obtained results we established that the magnetic anisotropy of the material is determined by both uniaxial and cubic contributions, each characterized by different temperature dependence. A complex shape of hysteresis loops and sharp changes of the domain pattern with temperature indicate the presence of collinear-noncollinear phase transitions. Study of the optical second harmonic generation was carried out using 100 fs laser pulses with central photon energy E = 1.55 eV. The electric dipole contribution (both crystallographic and magnetic) to the second harmonic generation was observed with high reliability despite a small mismatch of the film and substrate parameters.

Evaluation of samarium-153 and holmium-166-EDTMP in the normal baboon model

Energy Technology Data Exchange (ETDEWEB)

Louw, W.K.A.; Dormehl, I.C.; Rensburg, A.J. van; Hugo, N.; Alberts, A.S.; Forsyth, O.E.; Beverley, G.; Sweetlove, M.A.; Marais, J.; Loetter, M.G.; Aswegen, A. van

1996-11-01

Bone-seeking radiopharmaceuticals such as ethylenediaminetetramethylene phosphonate (EDTMP) complexes of samarium-153 and holmium-166 are receiving considerable attention for therapeutic treatment of bone metastases. In this study, using the baboon experimental model, multicompartmental analysis revealed that with regard to pharmacokinetics, biodistribution, and skeletal localisation, {sup 166}Ho-EDTMP was significantly inferior to {sup 153}Sm-EDTMP and {sup 99m}Tc-MDP. A more suitable {sup 166}Ho-bone-seeking agent should thus be sought for closer similarity to {sup 153}Sm-EDTMP to exploit fully the therapeutic potential of its shorter half-life and more energetic beta radiation.

Wideband thulium–holmium-doped fiber source with combined forward and backward amplified spontaneous emission at 1600–2300 nm spectral band

Czech Academy of Sciences Publication Activity Database

Honzátko, Pavel; Baravets, Yauhen; Kašík, Ivan; Podrazký, Ondřej

2014-01-01

Roč. 39, č. 12 (2014), s. 3650-3653 ISSN 0146-9592 R&D Projects: GA ČR(CZ) GAP205/11/1840 Institutional support: RVO:67985882 Keywords : Bandwidth * Spontaneous emission * Holmium Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.292, year: 2014

Magnetoresistance in terbium and holmium single crystals

International Nuclear Information System (INIS)

Singh, R.L.; Jericho, M.H.; Geldart, D.J.W.

1976-01-01

The longitudinal magnetoresistance of single crystals of terbium and holmium metals in their low-temperature ferromagnetic phase has been investigated in magnetic fields up to 80 kOe. Typical magnetoresistance isotherms exhibit a minimum which increases in depth and moves to higher fields as the temperature increases. The magnetoresistance around 1 0 K, where inelastic scattering is negligible, has been interpreted as the sum of a negative contribution due to changes in the domain structure and a positive contribution due to normal magnetoresistance. At higher temperatures, a phenomenological approach has been developed to extract the inelastic phonon and spin-wave components from the total measured magnetoresistance. In the temperature range 4--20 0 K (approximately), the phonon resistivity varies as T 3 . 7 for all samples. Approximate upper and lower bounds have been placed on the spin-wave resistivity which is also found to be described by a simple power law in this temperature range. The implications of this result for theoretical treatments of spin-wave resistivity due to s-f exchange interactions are considered. It is concluded that the role played by the magnon energy gap is far less transparent than previously suggested

14 CFR 141.93 - Enrollment.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Enrollment. 141.93 Section 141.93 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... limitations and simulated emergency landing instructions; and (x) A description of and instructions regarding...

36 CFR 406.141-406.148 - [Reserved

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.141-406.148 Section 406.141-406.148 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.141-406.148 [Reserved] ...

44 CFR 206.141 - Disaster unemployment assistance.

Science.gov (United States)

2010-10-01

... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

25 CFR 141.48 - Translation of disclosure statements.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Translation of disclosure statements. 141.48 Section 141.48 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Translation of disclosure statements. Disclosure required by §§ 141.46 and 141.47 shall be made in writing...

Separation of holmium (III) from aqueous chloride medium by Amberlite IRC748

International Nuclear Information System (INIS)

Vijayalakshmi, R.; Anitha, M.; Singh, D.K.; Chakravartty, J.K.

2016-01-01

High purity holmium finds applications in nuclear reactors as control rod, rare earth based magnetic alloys, lasers, medical applications, etc. Holmium belongs to the heavier group of rare earths and its content is very less (<0.5%) in Monazite mineral, hence its recovery from various potential sources becomes essential. Ion exchange technique is a well known method for effective separation, purification, recovery, and concentration of metal ions from lean aqueous solutions. It has also been widely used for separation and purification of rare earths. In the present investigation application of Amberlite IRC748, a chelating type of resin containing iminodiacetic acid functional group for separation of Ho(III) was explored. The effects of various parameters such as pH, contact time, weight of resin, initial metal concentration and temperature on the adsorption characteristics of Ho(III) were investigated in detail. The loading of Ho(III) ion onto resin increased with increasing the initial concentration. The adsorption was strongly dependent on pH of the medium with enhanced adsorption as the pH turned from 1 to 4. In the batch system, the Amberlite IRC748 resin exhibited the highest Ho(III) ion uptake as 180 mg/g at 298 K, at an initial pH value of 4. The adsorption data gave good fit with Langmuir isotherm which was better than the Freundlich curve. The thermodynamic parameters such as ΔH, ΔS and ΔG were evaluated from the temperature variation data. Negative value of ΔH (-11.5 kJ/mole), indicated that the adsorption of Ho(III) ion onto Amberlite resin was exothermic in nature. ΔS was found to be 5.52 J/mole/K. Kinetic study indicated that the adsorption data fitted the pseudo second order kinetic equation. (author)

5 CFR 185.141 - Stay pending appeal.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Stay pending appeal. 185.141 Section 185.141 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.141 Stay pending appeal. (a) An initial decision is stayed automatically pending...

45 CFR 2490.141-2490.148 - [Reserved

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.141-2490.148 Section 2490.141-2490.148 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.141-2490.148 [Reserved] ...

25 CFR 141.59 - Customer complaint procedures.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Customer complaint procedures. 141.59 Section 141.59... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.59 Customer complaint procedures. (a) Any customer of a licensee may file a complaint with the Commissioner alleging...

28 CFR 39.141-39.148 - [Reserved

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.141-39.148 Section 39.141-39.148 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.141-39.148 [Reserved] ...

19 CFR 141.43 - Delegation to subagents.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Delegation to subagents. 141.43 Section 141.43 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.43 Delegation to subagents. (a) Resident...

In vitro study of morphological and chemical modification threshold of bovine dental enamel irradiated by the holmium laser

International Nuclear Information System (INIS)

Eduardo, Patricia Lerro de Paula

2001-01-01

The aim of this study is to investigate the Ho:YLF laser effects on the dental enamel surface with regards to its morphology, thermal variations during its irradiation in the pulp chamber and its increased resistance to demineralization through quantitative analysis of calcium and phosphorous atoms reactive concentrations in samples. Twenty samples of bovine enamel were used and divided in four groups: control - acidulated phosphate fluoride (APF) application followed by demineralization treatment with lactic acid; irradiation with Ho:YLF laser (100 J/cm 2 ) followed by APF topic application and demineralization treatment with lactic acid; irradiation with Ho:YLF laser (350 J/cm 2 ) followed by APF topic application and demineralization treatment with lactic acid: and irradiation with Ho:YLF laser ( 450 J/cm 2 ) followed by APF topic application and demineralization treatment with lactic acid. Ali samples were quantified according to their calcium and phosphorous atoms relative concentrations before and after the treatments above. X-Ray fluorescence spectrochemical analysis and scanning electron microscopy were carried out. It was observed an increase on the calcium and phosphorous atoms concentration ratio and therefore the enamel demineralization reduction as a result of the lactic acid treatment in the samples irradiated with the holmium laser followed by the APF application. In order to evaluate the feasibility of this study for clinical purposes, morphological changes caused by the holmium laser irradiation were analyzed. Such modifications were characterized by melted and re-solidified regions of the enamel with consequent changes on its permeability and solubility. Temperature changes of ten human pre-molars teeth irradiated with 350 J/cm 2 and 450 J/cm 2 were also monitored in the pulp chamber in real time. Temperature increases over 4,20 C did not occur. The results obtained from this study along with the results from previous researches developed at

49 CFR 28.141-28.148 - [Reserved

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.141-28.148 Section 28.141-28.148 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.141-28.148 [Reserved] ...

18 CFR 141.500 - Cash management programs.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cash management... OF 1978 STATEMENTS AND REPORTS (SCHEDULES) § 141.500 Cash management programs. Public utilities and... and § 141.1 or § 141.2 of this title that participate in cash management programs must file these...

Safety analysis of holmium-166 microsphere scout dose imaging during radioembolisation work-up. A cohort study

Energy Technology Data Exchange (ETDEWEB)

Braat, Arthur J.A.T.; Prince, Jip F.; Rooij, Rob van; Bruijnen, Rutger C.G.; Bosch, Maurice A.A.J. van den; Lam, Marnix G.E.H. [University Medical Center Utrecht, Department of Radiology and Nuclear Medicine, Utrecht (Netherlands)

2018-03-15

Radioembolisation is generally preceded by a scout dose of technetium-99m-macroaggregated albumin to estimate extrahepatic shunting of activity. Holmium-166 microspheres can be used as a scout dose (±250 MBq) and as a therapeutic dose. The general toxicity of a holmium-166 scout dose ({sup 166}Ho-SD) and safety concerns of an accidental extrahepatic deposition of {sup 166}Ho-SD were investigated. All patients who received a {sup 166}Ho-SD in our institute were reviewed for general toxicity and extrahepatic depositions. The absorbed dose in extrahepatic tissue was calculated on SPECT/CT and correlated to clinical toxicities. In total, 82 patients were included. No relevant clinical toxicity occurred. Six patients had an extrahepatic deposition of {sup 166}Ho-SD (median administered activity 270 MBq). The extrahepatic depositions (median activity 3.7 MBq) were located in the duodenum (3x), gastric fundus, falciform ligament and the lesser curvature of the stomach, and were deposited in a median volume of 15.3 ml, which resulted in an estimated median absorbed dose of 3.6 Gy (range 0.3-13.8 Gy). No adverse events related to the extrahepatic deposition of the {sup 166}Ho-SD occurred after a median follow-up of 4 months (range 1-12 months). These results support the safety of 250 MBq {sup 166}Ho-SD in a clinical setting. (orig.)

7 CFR 1.41 - Service of process.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Service of process. 1.41 Section 1.41 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Judicial Proceedings § 1.41 Service of... of the General Counsel, in order that service of process may be made. In the event an officer of the...

经皮肾穿刺钬激光碎石术后疼痛的护理干预%Nursing intervention of postoperative pain after percutaneous nephrolithotomy holmium laser

Institute of Scientific and Technical Information of China (English)

白玫; 乔够梅; 杏玲芝; 陆皓

2012-01-01

目的:探讨护理干预对减轻经皮肾穿刺钬激光碎石术后疼痛的效果.方法:随机将264例经皮肾穿刺钬激光碎石术患者分成干预组和对照组各132例.对照组患者给予经皮肾穿刺钬激光碎石术后常规护理,干预组在对照组的基础上进行一系列的护理干预.结果:干预组术后疼痛明显低于对照组(P<0.05).结论:护理干预在经皮肾穿刺钬激光碎石术后应用能明显减轻患者疼痛,加速患者术后康复,有利于护理质量的提高.%Objective:To study the nursing intervention on reducing percutaneous holmium laser effect of postoperative pain. Methods:264 patients randomized to percutaneous nephrolithotomy with holmium laser lithotripsy were divided into intervention group and control group of 132 cases at radom. The control group conventional percutaneous holmium laser lithotripsy postoperative care, intervention group were based on a series of nursing intervention. Results postoperative pain of intervention group was significantly lower than control group ( P <0.05 ). Conclusion: Nursing intervention in percutaneous holmium laser lithotripsy in patients with significantly reduced postoperative pain,accelerated postoperative recovery, is conducive to improving quality of care.

26 CFR 1.141-13 - Refunding issues.

Science.gov (United States)

2010-04-01

... management contract and takes over the operation of the facility. In 2009, C issues bonds to refund the 1999... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Refunding issues. 1.141-13 Section 1.141-13...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-13 Refunding issues...

Holmium Laser Enucleation of the Prostate and Iatrogenic Arteriovenous Fistula Treated by Superselective Arterial Embolization

Directory of Open Access Journals (Sweden)

Anastasios D. Asimakopoulos

2016-01-01

Full Text Available Iatrogenic pelvic pseudoaneurysm with concomitant arteriovenous fistula has been described as a rare and challenging complication, which may occur during transurethral resection of the prostate. We provide the first report of this complication after holmium laser enucleation of the prostate for the treatment of benign prostatic hyperplasia. The attempt to control the bleeding by conversion to open surgery and placement of haemostatic stitches into the prostatic fossa failed. Angiography with superselective arterial embolization proved to be a modern, quick, safe, and efficient treatment of this uncommon complication.

21 CFR 146.141 - Canned orange juice.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned orange juice. 146.141 Section 146.141 Food... Beverages § 146.141 Canned orange juice. (a) Canned orange juice is the food prepared from orange juice as specified in § 146.135 or frozen orange juice as specified in § 146.137, or a combination of both, to which...

Distribution and Translocation of 141Ce (III) in Horseradish

Science.gov (United States)

Guo, Xiaoshan; Zhou, Qing; Lu, Tianhong; Fang, Min; Huang, Xiaohua

2007-01-01

Background and Aims Rare earth elements (REEs) are used in agriculture and a large amount of them contaminate the environment and enter foods. The distribution and translocation of 141Ce (III) in horseradish was investigated in order to help understand the biochemical behaviour and toxic mechanism of REEs in plants. Method The distribution and translocation of 141Ce (III) in horseradish were investigated using autoradiography, liquid scintillation counting (LSC) and electron microscopic autoradiography (EMARG) techniques. The contents of 141Ce (III) and nutrient elements were analysed using an inductively coupled plasma-atomic emission spectrometer (ICP-AES). Results The results from autoradiography and LSC indicated that 141Ce (III) could be absorbed by horseradish and transferred from the leaf to the leaf-stalk and then to the root. The content of 141Ce (III) in different parts of horseradish was as follows: root > leaf-stalk > leaf. The uptake rates of 141Ce (III) in horseradish changed with the different organs and time. The content of 141Ce (III) in developing leaves was greater than that in mature leaves. The results from EMARG indicated that 141Ce (III) could penetrate through the cell membrane and enter the mesophyll cells, being present in both extra- and intra-cellular deposits. The contents of macronutrients in horseradish were decreased by 141Ce (III) treatment. Conclusions 141Ce (III) can be absorbed and transferred between organs of horseradish with time, and the distribution was found to be different at different growth stages. 141Ce (III) can enter the mesophyll cells via apoplast and symplast channels or via plasmodesmata. 141Ce (III) can disturb the metabolism of macronutrients in horseradish. PMID:17921527

40 CFR 141.155 - Report delivery and recordkeeping.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Report delivery and recordkeeping. 141.155 Section 141.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Consumer Confidence Reports § 141.155...

Holmium:YAG laser stapedotomy: preliminary evaluation

Science.gov (United States)

Stubig, Ingrid M.; Reder, Paul A.; Facer, G. W.; Rylander, Henry G.; Welch, Ashley J.

1993-07-01

This study investigated the use of a pulsed Holmium:YAG ((lambda) equals 2.09 micrometers ) laser- fiber microsurgical system for laser stapedotomy. This system ablates human stapes bones effectively with minimal thermal damage. The study was designed to determine the effectiveness of the Ho:YAG laser (Schwartz Electro Optics, Inc., Orlando, FL) for stapedotomy and to evaluate temperature changes within the cochlea during the ablation process. Human cadaveric temporal bones were obtained and the stapes portion of the ossicular chain was removed. A 200 micrometers diameter low OH quartz fiber was used to irradiate these stapes bones in an air environment. The laser was pulsed at 2 Hz, 250 microsecond(s) ec pulse width and an irradiance range of 100 - 240 J/cm2 was used to ablate holes in the stapes footplate. The resultant stapedotomies created had smooth 300 micrometers diameter holes with a minimum of circumferential charring. Animal studies in-vivo were carried out in chinchillas to determine the caloric spread within the cochlea. A 0.075 mm Type T thermocouple was placed in the round window. Average temperature change during irradiation of the stapes footplate recorded in the round window was 3.6 degree(s)C. The data suggest that stapedotomy using the Ho:YAG laser can result in a controlled ablation of the stapes footplate with minimal thermal damage to the surrounding stapes. Optical coupling using fiberoptic silica fibers is an ideal method for delivering laser energy to the stapes during stapedotomy.

40 CFR 141.172 - Disinfection profiling and benchmarking.

Science.gov (United States)

2010-07-01

... benchmarking. 141.172 Section 141.172 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Disinfection-Systems Serving 10,000 or More People § 141.172 Disinfection profiling and benchmarking. (a... sanitary surveys conducted by the State. (c) Disinfection benchmarking. (1) Any system required to develop...

40 CFR 141.101 - Use of bottled water.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Use of bottled water. 141.101 Section 141.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Use of Non-Centralized Treatment Devices § 141.101...

Lande gJ factors for even-parity electronic levels in the holmium atom

Science.gov (United States)

Stefanska, D.; Werbowy, S.; Krzykowski, A.; Furmann, B.

2018-05-01

In this work the hyperfine structure of the Zeeman splitting for 18 even-parity levels in the holmium atom was investigated. The experimental method applied was laser induced fluorescence in a hollow cathode discharge lamp. 20 spectral lines were investigated involving odd-parity levels from the ground multiplet, for which Lande gJ factors are known with high precision, as the lower levels; this greatly facilitated the evaluation of gJ factors for the upper levels. The gJ values for the even-parity levels considered are reported for the first time. They proved to compare fairly well with the values obtained recently in a semi-empirical analysis for the even-parity level system of Ho I.

9 CFR 3.141 - Terminal facilities.

Science.gov (United States)

2010-01-01

... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.141 Section 3.141 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

40 CFR 141.704 - Analytical methods.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.704 Section... Monitoring Requirements § 141.704 Analytical methods. (a) Cryptosporidium. Systems must analyze for Cryptosporidium using Method 1623: Cryptosporidium and Giardia in Water by Filtration/IMS/FA, 2005, United States...

17 CFR 141.8 - Procedures for salary offset.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Procedures for salary offset. 141.8 Section 141.8 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION SALARY OFFSET § 141.8 Procedures for salary offset. (a) Deductions to liquidate an employee's debt will be by...

20 CFR 1001.141 - Functions of DVOP staff.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Functions of DVOP staff. 1001.141 Section 1001.141 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING... Veterans Outreach Program (DVOP) § 1001.141 Functions of DVOP staff. Each DVOP specialist shall carry out...

Synthesis, Characterization and Thermal Diffusivity of Holmium and Praseodymium Zirconates

Directory of Open Access Journals (Sweden)

Stopyra M.

2016-06-01

Full Text Available A2B2O7 oxides with pyrochlore or defected fluorite structure are among the most promising candidates for insulation layer material in thermal barrier coatings. The present paper presents the procedure of synthesis of holmium zirconate Ho2Zr2O7 and praseodymium zirconate Pr2Zr2O7 via Polymerized-Complex Method (PCM. Thermal analysis of precursor revealed that after calcination at relatively low temperature (700°C fine-crystalline, single-phase material is obtained. Thermal diffusivity was measured in temperature range 25-200°C, Ho2Zr2O7 exhibits lower thermal diffusivity than Pr2Zr2O7. Additionally, PrHoZr2O7 was synthesized. The powder in as-calcined condition is single-phase, but during the sintering decomposition of solid solution took place and Ho-rich phase precipitated. This material exhibited the best insulating properties among the tested ones.

19 CFR 141.41 - Surety on Customs bonds.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Surety on Customs bonds. 141.41 Section 141.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.41 Surety on Customs bonds. Powers of...

25 CFR 141.55 - Price monitoring and control.

Science.gov (United States)

2010-04-01

... be made a survey of the prices of flour, sugar, fresh eggs, lard, coffee, ground beef, bread, cheese... 25 Indians 1 2010-04-01 2010-04-01 false Price monitoring and control. 141.55 Section 141.55... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.55 Price...

Synthesis and optical properties of antimony oxide glasses doped with holmium trioxide

Energy Technology Data Exchange (ETDEWEB)

Raghunatha, S.; Eraiah, B., E-mail: eraiah@rediffmail.com [Department of physics, Bangalore University, Bengaluru – 560 056. India (India)

2016-05-06

Holmium doped lithium-antimony-lead borate glasses having 1 mol% AgNO{sub 3} with composition 50B{sub 2}O{sub 3}-20PbO-25Sb{sub 2}O{sub 3}-5Li{sub 2}O have been prepared using single step melt quenching technique. The XRD spectrum confirms amorphous nature of glasses. The optical absorbance studies were carried out on these glasses. The optical direct band gap energies were found to be in the range of 3.10 eV to 3.31 eV and indirect band gap energies were found to be in the range of 2.28 eV to 3.00 eV. The refractive indexes have been calculated by using Lorentz-Lorenz formula and the calculated values in the range of 2.31 to 2.37.

40 CFR 141.621 - Routine monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Routine monitoring. 141.621 Section....621 Routine monitoring. (a) Monitoring. (1) If you submitted an IDSE report, you must begin monitoring..., you must monitor at the location(s) and dates identified in your monitoring plan in § 141.132(f...

High spin states of 141Pm

Science.gov (United States)

Bhattacharyya, Sarmishtha; Chanda, Somen; Bhattacharjee, Tumpa; Basu, Swapan Kumar; Bhowmik, R. K.; Muralithar, S.; Singh, R. P.; Ghugre, S. S.

2004-01-01

The high spin states in the N=80 odd- A141Pm nucleus have been investigated by in-beam γ-spectroscopic techniques following the reaction 133Cs( 12C, 4n) 141Pm at E=65 MeV using a modest γ detector array, consisting of seven Compton-suppressed high purity germanium detectors and a multiplicity ball of 14 bismuth germanate elements. Thirty new γ rays have been assigned to 141Pm on the basis of γ-ray singles and γγ-coincidence data. The level scheme of 141Pm has been extended upto an excitation energy of 5.2 MeV and spin {35}/{2}ℏ and 16 new levels have been proposed. Spin-parity assignments for most of the newly proposed levels have been made on the basis of the deduced directional correlation orientation ratios for strong transitions. The meanlives of a few excited states have been determined from the pulsed beam- γγ coincidence data using the generalised centroid-shift method. The level structure is discussed in the light of known systematics of neighbouring N=80 isotonic nuclei.

Development of phosphate glass microspheres containing holmium for selective internal radiotherapy

International Nuclear Information System (INIS)

Barros Filho, Eraldo Cordeiro

2016-01-01

The selective internal radiotherapy is an alternative for some kinds of cancer as the hepatocellular carcinoma (HCC) or primary liver cancer treatment. In this treatment, glass or polymer microspheres containing radionuclides inside their structure are introduced in the liver through hepatic artery and trapped at the arterioles that feed the tumor. In this work, the development of phosphate glasses containing holmium for production of microspheres and their application in Brazil are proposed. The developed glasses presented suitable chemical durability, density of 2,7(3) g/cm 3 , high thermal stability and the impurities contained therein do not preclude the treatment. The microspheres were produced by the flame method and the gravitational fall method, and were characterized by means of several techniques to evaluate shape, average particle size, activity and biocompatibility suitable for selective internal radiotherapy. Based in the main results, the submission to in vivo tests is proposed. (author)

Optical and electrical doping of silicon with holmium

International Nuclear Information System (INIS)

Suyver, J.F.; Kik, P.G.; Kimura, T.; Polman, A.; Franzo, G.; Coffa, S.

1999-01-01

2 MeV holmium ions were implanted into Czochralski grown Si at a fluence of 5.5x10 14 Ho/cm 2 . Some samples were co-implanted with oxygen to a concentration of (7±1)x10 19 cm -3 . After recrystallization, strong Ho segregation to the surface is observed, which is fully suppressed by co-doping with O. After recrystallization, photoluminescence peaks are observed at 1.197, 1.96 and 2.06 μm, characteristic for the 5 I 6 → 5 I 8 and 5 I 7 → 5 I 8 transitions of Ho 3+ . The Ho 3+ luminescence lifetime at 1.197 μm is 14 ms at 12 K. The luminescence intensity shows temperature quenching with an activation energy of 11 meV, both with and without O co-doping. The observed PL quenching cannot be explained by free carrier Auger quenching, but instead must be due to energy backtransfer or electron hole pair dissociation. Spreading resistance measurements indicate that Ho exhibits donor behavior, and that in the presence of O the free carrier concentration is enhanced by more than two orders of magnitude. In the O co-doped sample 20% of the Ho 3+ was electrically active at room temperature

40 CFR 141.42 - Special monitoring for corrosivity characteristics.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for corrosivity characteristics. 141.42 Section 141.42 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations and Prohibition on Lead Use § 141.42 Special monitoring for corrosivity characteristics. (a)-(c...

Endoscopic removal of a proximal urethral stent using a holmium laser: Case report and literature review

Directory of Open Access Journals (Sweden)

Francisco Botelho

2012-01-01

Full Text Available Urethral stents were initially developed for the management of urethral strictures and obstructive voiding disorders in select patients. Urethral stent complications are common and may require stent explantation, which is often quite challenging. We present our experience with endoscopic removal of an encrusted UroLume proximal urethral stent in a 72-year-old male using a holmium laser. The literature on various management options and outcomes for urethral stent removal is reviewed. Endoscopic removal of proximal urethral stents is feasible and safe and should be considered as the primary treatment option in patients requiring stent extraction.

14 CFR 141.11 - Pilot school ratings.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot school ratings. 141.11 Section 141.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... rating course. (x) Aircraft type rating course. (2) Special preparation courses. (Appendix K). (i) Pilot...

14 CFR 121.141 - Airplane flight manual.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 121.141 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Manual Requirements § 121.141 Airplane flight manual. (a) Each certificate holder shall keep a current approved airplane flight manual for each type of...

37 CFR 1.41 - Applicant for patent.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Applicant for patent. 1.41 Section 1.41 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Who May Apply for A...

Bouveret's syndrome complicated by distal gallstone ileus after laser lithotropsy using Holmium: YAG laser

Directory of Open Access Journals (Sweden)

Rodgers John B

2002-06-01

Full Text Available Abstract Background Bouveret's syndrome is an unusual presentation of duodenal obstruction caused by the passage of a large gallstone through a cholecystoduodenal fistula. Endoscopic therapy has been used as first-line treatment, especially in patients with high surgical risk. Case presentation We report a 67-year-old woman who underwent an endoscopic attempt to fragment and retrieve a duodenal stone using a Holmium: Yttrium-Aluminum-Garnet Laser (Ho:YAG which resulted in small bowel obstruction. The patient successfully underwent enterolithotomy without cholecystectomy or closure of the fistula. Conclusion We conclude that, distal gallstone obstruction, due to migration of partially fragmented stones, can occur as a possible complication of laser lithotripsy treatment of Bouveret's syndrome and might require urgent enterolithotomy.

40 CFR 141.62 - Maximum contaminant levels for inorganic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for inorganic contaminants. 141.62 Section 141.62 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.62 Maximum...

40 CFR 141.61 - Maximum contaminant levels for organic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for organic contaminants. 141.61 Section 141.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.61 Maximum contaminant...

12 CFR 410.141-410.148 - [Reserved

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.141-410.148 Section 410.141-410.148 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

Datablock: hd141

Indian Academy of Sciences (India)

2016-01-15

Jan 15, 2016 ... checkCIF/PLATON page 2 http://checkcif.iucr.org/cgibin/checkcif_hkl.pl. 1/3. checkCIF (basic structural check) running. checkCIF/PLATON (basic structural check). Structure factors have been supplied for datablock(s) hd141. THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW.

40 CFR 141.171 - Criteria for avoiding filtration.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...

40 CFR 141.400 - General requirements and applicability.

Science.gov (United States)

2010-07-01

... system with fecally contaminated source water or with significant deficiencies subject to the treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements and applicability. 141.400 Section 141.400 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

25 CFR 141.27 - Trade in imitation Indian crafts prohibited.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Trade in imitation Indian crafts prohibited. 141.27 Section 141.27 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.27 Trade in imitation...

Transurethral lithotripsy with holmium-YAG laser of a large exogenous prostatic calculus.

Science.gov (United States)

Hasegawa, Masanori; Ohara, Rei; Kanao, Kent; Nakajima, Yosuke

2011-04-01

Prostatic calculi are classified into two types, endogenous and exogenous calculi, based on their origin. Endogenous calculi are commonly observed in elderly men; however, exogenous prostatic calculi are extremely rare. We report here the case of a 51-year-old man who suffered incontinence and pollakiuria with a giant exogenous prostatic calculus almost completely replacing the prostatic tissue. X-rays and computed tomography demonstrated a large calculus of 65 × 58 mm in the small pelvic cavity. The patient underwent a transurethral lithotripsy with a holmium-YAG laser and a total of 85 g of disintegrated stones was retrieved and chemical stone analysis revealed the presence of magnesium ammonium phosphate. The incontinence improved and the voiding volume increased dramatically, and no stone recurrence in the prostatic fossa occurred at the 2 years follow-up. The etiology of this stone formation seemed to be based on some exogenous pathways combined with urinary stasis and chronic urinary infection due to compression fracture of the lumbar vertebra.

Acute and chronic response of meniscal fibrocartilage to holmium:YAG laser irradiation

Science.gov (United States)

Horan, Patrick J.; Popovic, Neven A.; Islinger, Richard B.; Kuklo, Timothy R.; Dick, Edward J.

1997-05-01

The acute and chronic (10 week) histological effects of the holmium:YAG laser during partial meniscectomy in an in vivo rabbit model were investigated. Twenty-four adult male New Zealand rabbits underwent bilateral parapatellar medial knee arthrotomies. In the right knee, a partial medial meniscectomy was done through the avascular zone using a standard surgical blade. In the left knee, an anatomically similar partial medial meniscectomy was performed using a Ho:YAG laser (Coherent, USA). This study indicates that the laser creates two zones of damage in the meniscal fibrocartilage and that the zone of thermal change may act as a barrier to healing. The zone of thermal change which is eventually debrided was thought at the time of surgery to be viable. In the laser cut menisci, the synovium appears to have greater inflammation early and to be equivalent with the scalpel cut after three weeks. At all time periods there appeared more cellular damage in the laser specimens.

40 CFR 141.25 - Analytical methods for radioactivity.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods for radioactivity... § 141.25 Analytical methods for radioactivity. (a) Analysis for the following contaminants shall be conducted to determine compliance with § 141.66 (radioactivity) in accordance with the methods in the...

21 CFR 150.141 - Artificially sweetened fruit jelly.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit jelly. 150.141 Section 150.141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... locust bean gum), guar gum, gum karaya, gum tragacanth, algin (sodium alginate), sodium...

40 CFR 141.41 - Special monitoring for sodium.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for sodium. 141.41... and Prohibition on Lead Use § 141.41 Special monitoring for sodium. (a) Suppliers of water for... distribution system for the determination of sodium concentration levels; samples must be collected and...

40 CFR 141.134 - Reporting and recordkeeping requirements.

Science.gov (United States)

2010-07-01

... meeting the criterion in § 141.135(a)(2)(vi). (vi) The running annual average of source water alkalinity for systems meeting the criterion in § 141.135(a)(2)(iii) and of treated water alkalinity for systems...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Disinfectant Residuals...

7 CFR 58.141 - Alternate quality control program.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Alternate quality control program. 58.141 Section 58... Service 1 Quality Specifications for Raw Milk § 58.141 Alternate quality control program. When a plant has in operation an acceptable quality program, at the producer level, which is approved by the...

25 CFR 141.14 - Trade in livestock restricted.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Trade in livestock restricted. 141.14 Section 141.14... livestock restricted. (a) No person other than an enrolled member of the tribe or any association... livestock from tribal members without a special permit issued by the Commissioner. (b) The Commissioner...

40 CFR 141.63 - Maximum contaminant levels (MCLs) for microbiological contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels (MCLs) for microbiological contaminants. 141.63 Section 141.63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.63 Maximum...

40 CFR 141.403 - Treatment technique requirements for ground water systems.

Science.gov (United States)

2010-07-01

... ground water systems. 141.403 Section 141.403 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Ground Water Rule § 141... customer as follows: (i) Chemical disinfection—(A) Ground water systems serving greater than 3,300 people...

Fine Structure in Proton Emission from the Deformed 141g.sHo and 141mHo

International Nuclear Information System (INIS)

Karny, M.; Rykaczewski, Krzysztof Piotr; Grzywacz, R.; Batchelder, J.C.; Bingham, C.R.; Goodin, C. T.; Gross, Carl J.; Hamilton, J.H.; Korgul, A.; Krolas, W.; Liddick, S. N.; Li, K.; Maier, Karl; Mazzocchi, C.; Piechaczek, A.; Shapira, Dan; Simpson, D.; Tantawy, M.N.; Winger, J.A.; Yu, Chang-Hong; Zganjar, E. F.

2007-01-01

Fine structure in proton emission from the deformed states 141g.s Ho (T 1/2 = 4.1 ms) and 141 mHo (T 1/2 = 7.4 (micro)s) has been discovered at Oak Ridge by detecting fusion evaporation residues with the Recoil Mass Spectrometer, Si-detectors and digital signal processing electronics. The branching ratios to the first 2 + excited state in 140 Dy were measured to be I p g.s. (2 + ) = 0.9±0.1% and I p m (2 + ) = 1.7±0.5%. A comparison of the available calculations to the experimental values calls for further development of the theoretical models

Influence of crystallite size and temperature on the antiferromagnetic helices of terbium and holmium metal

Energy Technology Data Exchange (ETDEWEB)

Bick, Jens-Peter; Michels, Andreas [Universitaet des Saarlandes, D-66041 Saarbruecken (Germany); University of Luxembourg, L-1511 Luxembourg (Luxembourg); Ferdinand, Adrian; Birringer, Rainer [Universitaet des Saarlandes, D-66041 Saarbruecken (Germany); Baller, Joerg; Sanctuary, Roland [University of Luxembourg, L-1511 Luxembourg (Luxembourg); Philippi, Stefan [Leibniz Institute for Solid State and Materials Research, D-01069 Dresden (Germany); Lott, Dieter [GKSS Research Center, D-21502 Geesthacht (Germany); Balog, Sandor [Paul Scherrer Institute, CH-5232 Villigen (Switzerland); Rotenberg, Eli [Lawrence Berkeley National Laboratory, California 94720 (United States); Kaindl, Guenter [Freie Universitaet Berlin, D-14195 Berlin-Dahlem (Germany); Doebrich, Kristian M. [Freie Universitaet Berlin, D-14195 Berlin-Dahlem (Germany); Max-Born-Institut, D-12489 Berlin (Germany)

2011-07-01

We report on the results of grain-size and temperature-dependent magnetization, specific-heat, neutron-scattering, and angle-resolved photoelectron spectroscopy (ARPES) experiments on the heavy rare-earth metals terbium and holmium, with particular emphasis on the temperature regions where the helical antiferromagnetic phases exist. In contrast to Ho, we find that the helical structure in Tb is relative strongly affected by microstructural disorder, specifically, it can no longer be detected for the smallest studied grain size of D=18 nm. Moreover, in coarse-grained Tb a helical structure persists even in the ferromagnetic regime, down to about T=215 K, in agreement with the ARPES data, which reveal a nesting feature of the Fermi surface at the L point of the Brillouin zone at T=210 K.

40 CFR 141.13 - Maximum contaminant levels for turbidity.

Science.gov (United States)

2010-07-01

... turbidity. 141.13 Section 141.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Maximum contaminant levels for turbidity. The maximum contaminant levels for turbidity are applicable to... part. The maximum contaminant levels for turbidity in drinking water, measured at a representative...

Thermodynamic properties of the neutral and ionic components of the holmium trichloride vapor

International Nuclear Information System (INIS)

Kuznetsov, A.Yu.; Kudin, L.S.; Pogrebnoj, A.M.; Butman, M.F.; Burdukovskaya, G.G.

1999-01-01

The composition of saturated vapor above holmium trichloride in the temperature range of 887 - 1051 K is studied by the method of high-temperature mass spectrometry. Neutral components are presented by molecules of Ho n Cl 3n , n = 1 - 4 charged ones - by Cl - , HoCl 4 - , Ho 2 Cl 7 - ions. Sublimation enthalpies and formation enthalpies of gaseous molecules and ions (298 K): Δ s H Deg (HoCl 3 ) = 284 ±6, Δ s H Deg (Ho 2 Cl 6 ) = 352 ± 20; ΔH Deg (HoCl 3 ) = -722 ± 6; Δ f H Deg (Ho 2 Cl 6 ) = -1661 ± 20; Δ f H Deg (HoCl 4 - ) ≤ - 1191 ± 20, Δ f H Deg (Ho-2Cl 7 - ) ≤ -2127 ± 30 kJ/mol are determined. The value of electron affinity for HoCl 4 radical (A 0 ≥ 3.6 eV) is estimated [ru

26 CFR 1.141-6 - Allocation and accounting rules.

Science.gov (United States)

2010-04-01

... 1.141-6 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-6.... Thus, allocations generally may be made using any reasonable, consistently applied accounting method...

Hyperfine-Interaction-Driven Suppression of Quantum Tunneling at Zero Field in a Holmium(III) Single-Ion Magnet.

Science.gov (United States)

Chen, Yan-Cong; Liu, Jun-Liang; Wernsdorfer, Wolfgang; Liu, Dan; Chibotaru, Liviu F; Chen, Xiao-Ming; Tong, Ming-Liang

2017-04-24

An extremely rare non-Kramers holmium(III) single-ion magnet (SIM) is reported to be stabilized in the pentagonal-bipyramidal geometry by a phosphine oxide with a high energy barrier of 237(4) cm -1 . The suppression of the quantum tunneling of magnetization (QTM) at zero field and the hyperfine structures originating from field-induced QTMs can be observed even from the field-dependent alternating-current magnetic susceptibility in addition to single-crystal hysteresis loops. These dramatic dynamics were attributed to the combination of the favorable crystal-field environment and the hyperfine interactions arising from 165 Ho (I=7/2) with a natural abundance of 100 %. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Holmium laser lithotripsy (HoLL) of ureteral calculi

Science.gov (United States)

Kuntz, Rainer M.; Lehrich, Karin; Fayad, Amr

2001-05-01

The effectiveness and side effects of ureteroscopic HoLL of ureteral stones should be evaluated. In 63 patients (17 female, 46 males) a total of 75 stones of 3-20 mm diameter were treated with ureteroscopic HoLL. 18.7 percent of stones were located in the proximal third, 24.0 percent in the middle third and 57.3 percent in the distal third of the ureter. HoLL was performed with small diameter semirigid and flexible ureteroscopes, 220 or 365 nm flexible laser fibers and a holmium:YAG laser at a power of 5-15 W (0.5-1.0 J, 10- 15 Hz). 47 of 63 patients (74.6 percent) were immediately free of stones, and 8 others (12.6 percent) lost their residual fragments spontaneously within two weeks. Another 2 patients received additional chmolitholysis for uric acid stone fragments, i.e. 90.5 percent of patients were stone free by one sitting of ureterscopic HoLL. Of the remaining 6 patients (9.5 percent) who still had residual calculi 4 weeks after HoLL, 2 asymptomatic patients refused any additional treatment, 2 patients preferred treatment with ESWL, and 2 patients had a successful second HoLL, thereby raising the success rate of ureteroscopic HoLL to 93.7 percent. 2 patients showed contrast medium extravasation on retrograde ureterograms, due to guide wire perforation. No ureteral stricture occurred. In conclusion, transurethral ureteroscopic HoLL proved to be a safe and successful minimal invasive treatment of ureteral calculi.

40 CFR 141.205 - Content of the public notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Content of the public notice. 141.205 Section 141.205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS..., especially those who may not have received this notice directly (for example, people in apartments, nursing...

Hyperfine structure investigation of the first excited state 4Isub(13/2) (5,418-1) in Holmium-165 by the atomic beam resonance method

International Nuclear Information System (INIS)

Aldenhoven, R.

1976-01-01

By the method of atomic beam resonance the hyperfine structure of the first excited state 4 Isub(13/2) (5418 cm -1 ) of 165 Holmium was studied for the first time. Using a suitable ΔF = 0 transition, the gsub(J)-factor was measured. After a determination of estimates for the hyperfine constants A and B from two suitably chosen ΔF = 0 transitions, the hyperfine splittings have been measured. (orig./WL) [de

40 CFR 141.72 - Disinfection.

Science.gov (United States)

2010-07-01

... PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.72 Disinfection. A public water... the direct influence of surface water and provides filtration treatment must provide disinfection...) Disinfection requirements for public water systems which provide filtration. Each public water system that...

19 CFR 141.1 - Liability of importer for duties.

Science.gov (United States)

2010-04-01

... Customs by the broker. (c) Claim against estate of importer. The claim of the Government for unpaid duties... 19 Customs Duties 2 2010-04-01 2010-04-01 false Liability of importer for duties. 141.1 Section 141.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...

40 CFR 141.801 - Definitions.

Science.gov (United States)

2010-07-01

... aircraft that supply water for human consumption to passengers or crew. Aircraft water system operations... distribution and consumption without further treatment, except as treatment necessary to maintain water quality...). (40 CFR 141.2) Human consumption means drinking, bathing, showering, hand washing, teeth brushing...

Non-natives: 141 scientists object

NARCIS (Netherlands)

Simberloff, D.; Van der Putten, W.H.

2011-01-01

Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. dsimberloff@utk.edu Jake Alexander Institute of Integrative

Hyperfine-interaction-driven suppression of quantum tunneling at zero field in a holmium(III) single-ion magnet

Energy Technology Data Exchange (ETDEWEB)

Chen, Yan-Cong; Liu, Jun-Liang; Chen, Xiao-Ming; Tong, Ming-Liang [Key Lab. of Bioinorganic and Synthetic Chemistry of Ministry of Education, School of Chemistry, Sun Yat-Sen Univ., Guangzhou (China); Wernsdorfer, Wolfgang [Institut Neel, CNRS and Universite Joseph Fournier, Grenoble (France); Institute of Nanotechnology, Karlsruhe Institute of Technology (Germany); Physikalisches Institut, Karlsruhe Institute of Technology (Germany); Liu, Dan; Chibotaru, Liviu F. [Theory of Nanomaterials Group and INPAC-Institute of Nanoscale Physics and Chemistry, Katholieke Universiteit Leuven (Belgium)

2017-04-24

An extremely rare non-Kramers holmium(III) single-ion magnet (SIM) is reported to be stabilized in the pentagonal-bipyramidal geometry by a phosphine oxide with a high energy barrier of 237(4) cm{sup -1}. The suppression of the quantum tunneling of magnetization (QTM) at zero field and the hyperfine structures originating from field-induced QTMs can be observed even from the field-dependent alternating-current magnetic susceptibility in addition to single-crystal hysteresis loops. These dramatic dynamics were attributed to the combination of the favorable crystal-field environment and the hyperfine interactions arising from {sup 165}Ho (I=7/2) with a natural abundance of 100 %. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

40 CFR 141.401 - Sanitary surveys for ground water systems.

Science.gov (United States)

2010-07-01

... systems. 141.401 Section 141.401 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... an evaluation of the applicable components listed in paragraphs (c)(1) through (8) of this section... facilities, and controls, (6) Monitoring, reporting, and data verification, (7) System management and...

40 CFR 141.73 - Filtration.

Science.gov (United States)

2010-07-01

... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.73 Filtration. A public water system that uses a surface water source or a ground water source under the direct influence of surface water...

Radiopharmaceuticals of DTPA, DMSA and EDTA labeled with holmium-166

International Nuclear Information System (INIS)

Rahman, M.; Matsouka, H.; Takami, S.; Terunuma, K.

2001-01-01

DTPA, DMSA and EDTA were labelled with 166 Ho of low specific activity, 250-275mCi/mg of Ho, produced from holmium oxide by the 165 Ho(n, g) 166 Ho reaction at a neutron flux of about 10 14 n.cm -2 .s -1 . Three pH ranges were selected in the study, viz. 2-3, 3-3.5 and 5-6. The labelling reactions were studied as chloride and nitrate solutions in aqueous and saline media at 30 min and 20-24 h of reaction. DTPA was labelled over 99, DMSA at about 90 and EDTA at 100.0% with 166 Ho. The complexes were found stable at all times of investigation. A beta chromatogram scanner was used to study by TLC the labelling reactions of DTPA and DMSA with the nuclide and by PC those of EDTA. A biodistribution study in three rats injected intravenous with a saline solution of 166 HoCl 3 [DTPA] at pH5.1 showed an initial uptake in blood, kidney and lung after 30 minutes. After four hours the complex was found to have cleared from blood and lung, and localized 100% in kidney. It was stable in vivo in the kidney after 24 hours. The g spectrum analysis did not show the formation of any impurity except the four characteristic g energies of 166 Ho. (author)

40 CFR 141.173 - Filtration.

Science.gov (United States)

2010-07-01

... PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.173 Filtration. A public water system subject to the requirements of this subpart that does... treatment, direct filtration, slow sand filtration, or diatomaceous earth filtration. A public water system...

40 CFR 141.560 - Is my system subject to individual filter turbidity requirements?

Science.gov (United States)

2010-07-01

... filter turbidity requirements? 141.560 Section 141.560 Protection of Environment ENVIRONMENTAL PROTECTION... Filtration and Disinfection-Systems Serving Fewer Than 10,000 People Individual Filter Turbidity Requirements § 141.560 Is my system subject to individual filter turbidity requirements? If your system is a subpart...

40 CFR 141.170 - General requirements.

Science.gov (United States)

2010-07-01

... recontamination by surface water runoff and a point downstream before or at the first customer for filtered...) Compliance with the profiling and benchmark requirements under the provisions of § 141.172. (b) A public...

25 CFR 141.36 - Maximum finance charges on pawn transactions.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Maximum finance charges on pawn transactions. 141.36... PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS Pawnbroker Practices § 141.36 Maximum finance charges on pawn transactions. No pawnbroker may impose an annual finance charge greater than twenty-four percent...

26 CFR 1.381(c)(14)-1 - Dividend carryover to personal holding company.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Dividend carryover to personal holding company. 1.381(c)(14)-1 Section 1.381(c)(14)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(14)-1...

25 CFR 141.57 - Procedures to cancel liability on bond.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Procedures to cancel liability on bond. 141.57 Section 141.57 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Procedures to cancel liability on bond. (a) Any surety who wishes to be relieved from liability arising on a...

40 CFR 141.86 - Monitoring requirements for lead and copper in tap water.

Science.gov (United States)

2010-07-01

... copper in tap water. 141.86 Section 141.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... § 141.86 Monitoring requirements for lead and copper in tap water. (a) Sample site location. (1) By the... the water system can collect the number of lead and copper tap samples required in paragraph (c) of...

Molecular cloning and expression analysis of a zebrafish novel zinc finger protein gene rnf141

Directory of Open Access Journals (Sweden)

Wenqian Deng

2009-01-01

Full Text Available ZNF230 is a novel zinc finger gene cloned by our laboratory. In order to understand the potential functions of this gene in vertebrate development, we cloned the zebrafish orthologue of human ZNF230, named rnf141. The cDNA fragment of rnf141 was obtained by rapid amplification of cDNA ends (RACE. The open reading frame (ORF encodes a polypeptide of 222 amino acids which shares 75.65% identity with the human ZNF230. RT-PCR analysis in zebrafish embryo and adult tissues revealed that rnf141 transcripts are maternally derived and that rnf141 mRNA has a broad distribution. Zygotic rnf141 message is strongly localized in the central nervous system, as shown by whole-mount in situ hybridization. Knockdown and over expression of rnf141 can induce abnormal phenotypes, including abnormal development of brain, as well as yolk sac and axis extendsion. Marker gene analysis showed that rnf141 may play a role in normal dorsoventral patterning of zebrafish embryos, suggesting that rnf141 may have a broad function during early development of vertebrates.

26 CFR 1.141-3 - Definition of private business use.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Definition of private business use. 1.141-3...-3 Definition of private business use. (a) General rule—(1) In general. The private business use test relates to the use of the proceeds of an issue. The 10 percent private business use test of section 141(b...

Holmium-166-chico intracavitary radiation therapy for cystic brain tumors

Energy Technology Data Exchange (ETDEWEB)

Rhee, C. H.; Lee, S. H.; Jang, J. S.; Kim, E. H.; Choi, C. W.; Hong, S. W.; Lim, S. M. [Korea Cancer Center, Seoul (Korea, Republic of)

1997-07-01

Holmium-166-chitosan complex (Ho-166-chico) is injected into the unresectable seven cystic brain tumors (2 cases of metastatic brain tumors from lung cancer, 1 case of recurrent trigeminal neurinoma, 3 cases of recurrent low grade cystic astrocytomas, and 1 case of craniopharyngioma). The Ommaya reservoir was installed stereotactically. The cyst volume and wall thickness were measured by MRI before Ho-166-chico injection. The thickness of the cyst wall is up to 4 mm. Ho-166-chico (555-740 MBq) injected into the cyst to result in 25 Gy of dose to a cyst wall at a depth of 4 mm. Dose to the cyst wall was estimated by Monte Carlo simulation using the EGS4 code. All Ho-166-chico injected was assumed to be uniformly distributed in the spherical cyst. After Ho-166-chico injection, the distribution of isotopes was monitored by gamma camera. Two injections were administrated in two cases, and one injection in all the others. The response was evaluated with MRI. Four of 7 cases were shrunk in size with thinning of the cyst wall, 2 of 7 cases showed growth arrest, and one case showed progression. Estimated surface dose of cyst wall was between 78 and 2566 Gy. No one showed systemic absorption of Ho-166-chico, and specific complication associated with isotope injection. Ho-166-chico intracavitary radiation therapy for cystic brain tumor may be safe, and reliable method and deserves further evaluation.

40 CFR 141.51 - Maximum contaminant level goals for inorganic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for inorganic contaminants. 141.51 Section 141.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

40 CFR 141.50 - Maximum contaminant level goals for organic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for organic contaminants. 141.50 Section 141.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

40 CFR 141.52 - Maximum contaminant level goals for microbiological contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for microbiological contaminants. 141.52 Section 141.52 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

Details management in the application of percutaneous nephroscope holmium laser lithotripsy%细节管理在经皮肾镜钬激光碎石术中的应用研究

Institute of Scientific and Technical Information of China (English)

王地萍; 张红芹

2014-01-01

目的：观察细节管理在经皮肾镜钬激光碎石术中的应用效果。方法：通过对56例患者进行经皮肾镜钬激光碎石的手术配合和对其围手术期的护理，总结出手术各个环节的护理要点。结果：56例手术患者中，一例中转切开取石，其余55例均碎石成功，效果非常满意，无并发症发生。结论：经皮肾镜钬激光碎石术具有出血少，创伤小，痛苦少，住院时间短、病人恢复快等优点，做好护理细节管理是保证手术顺利完成的重要条件。%Objective:To observe the details of the management in the application of percutaneous nephroscope holmium laser lithotripsy. Methods:By means of 56 patients with percutaneous nephroscope holmium laser lithotrip-sy procedure and the perioperative nursing, sums up the operation nursing key points of each part. Results:56 pa-tients with surgery, in case of transit the stones cut, the remaining 55 cases of gravel, effect is very satisfactory, no complications occurred. Conclusion: Percutaneous nephroscope holmium laser lithotripsy with less bleeding, small trauma, less pain, shorter hospitalization time and patients recover fast, do a good job in nursing detail management is vital to ensure that operation is completed.

40 CFR 141.809 - Supplemental treatment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Supplemental treatment. 141.809... treatment. (a) Any supplemental drinking water treatment units installed onboard existing or new aircraft... the manufacturer's plans and specifications and FAA requirements. (b) Water supplemental treatment and...

40 CFR 141.803 - Coliform sampling.

Science.gov (United States)

2010-07-01

...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.803 Coliform sampling. (a... aircraft water system, the sampling frequency must be determined by the disinfection and flushing frequency... disinfection and flushing frequency recommended by the aircraft water system manufacturer, when available...

14 CFR Appendix B to Part 141 - Private Pilot Certification Course

Science.gov (United States)

2010-01-01

... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. B Appendix B to Part 141...) Accident reporting requirements of the National Transportation Safety Board; (3) Applicable subjects of the... checks and end-of-course tests in accordance with the school's approved training course, consisting of...

Polymorphisms at Amino Acid Residues 141 and 154 Influence Conformational Variation in Ovine PrP

Science.gov (United States)

Yang, Sujeong; Thackray, Alana M.; Hopkins, Lee; Monie, Tom P.; Burke, David F.; Bujdoso, Raymond

2014-01-01

Polymorphisms in ovine PrP at amino acid residues 141 and 154 are associated with susceptibility to ovine prion disease: Leu141Arg154 with classical scrapie and Phe141Arg154 and Leu141His154 with atypical scrapie. Classical scrapie is naturally transmissible between sheep, whereas this may not be the case with atypical scrapie. Critical amino acid residues will determine the range or stability of structural changes within the ovine prion protein or its functional interaction with potential cofactors, during conversion of PrPC to PrPSc in these different forms of scrapie disease. Here we computationally identified that regions of ovine PrP, including those near amino acid residues 141 and 154, displayed more conservation than expected based on local structural environment. Molecular dynamics simulations showed these conserved regions of ovine PrP displayed genotypic differences in conformational repertoire and amino acid side-chain interactions. Significantly, Leu141Arg154 PrP adopted an extended beta sheet arrangement in the N-terminal palindromic region more frequently than the Phe141Arg154 and Leu141His154 variants. We supported these computational observations experimentally using circular dichroism spectroscopy and immunobiochemical studies on ovine recombinant PrP. Collectively, our observations show amino acid residues 141 and 154 influence secondary structure and conformational change in ovine PrP that may correlate with different forms of scrapie. PMID:25126555

14 CFR Appendix A to Part 141 - Recreational Pilot Certification Course

Science.gov (United States)

2010-01-01

... rating for which the course applies. (b) Each student must demonstrate satisfactory proficiency prior to... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. A Appendix A to Part 141.... A person must hold a student pilot certificate prior to enrolling in the flight portion of the...

25 CFR 141.30 - Retaliation prohibited.

Science.gov (United States)

2010-04-01

... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.30 Retaliation prohibited. No licensee may refuse service to any customer for the purpose of retaliating against that customer for...

25 CFR 141.22 - Subleasing prohibited.

Science.gov (United States)

2010-04-01

... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.22 Subleasing prohibited. No licensee may lease, sublet, rent, or sell any building that the licensee occupies for any purpose to any person...

Closure report for underground storage tank 141-R3U1 and its associated underground piping

Energy Technology Data Exchange (ETDEWEB)

Mallon, B.J.; Blake, R.G.

1994-03-01

Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks.

Closure report for underground storage tank 141-R3U1 and its associated underground piping

International Nuclear Information System (INIS)

Mallon, B.J.; Blake, R.G.

1994-03-01

Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks

33 CFR 141.30 - Evidence of status as a resident alien.

Science.gov (United States)

2010-07-01

... alien. 141.30 Section 141.30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Evidence of status as a resident alien. For the purposes of this part, the employer may accept as sufficient evidence that a person is a resident alien any one of the following documents and no others: (a) A...

Our first clinical experience with radiosynoviorthesis by means of (166)Ho-holmium-boro-macroaggregates.

Science.gov (United States)

Kraft, Otakar; Kasparek, R; Ullmann, V; Melichar, F; Kropacek, M; Mirzajevov, M

2005-01-01

In this paper, we evaluate the therapeutic and adverse effects of the application of 166-holmium-boro-macroaggregates (HMBA) in radiosynovectomy (RSO) of the knees. We assessed the efficacy and safety of (166)Ho-HBMA in a prospective clinical trial in patients suffering from chronic synovitis. An effective component of radiopharmaceutical (166)Ho-boro-macroaggregates is radionuclide (166)Ho which has both beta-emission and gamma-emission. The physical half-life time of 166 Ho is 26.8 hours. After application of the radiopharmaceutical into a joint cavity, the effect of beta-emission causes radiation necrosis of pathologically changed (inflamed) synovial membrane. From 15th April 2005, we have started RSO of knees by means of new radiopharmaceutical (166)Ho-boro-macroaggregates in patients with gonarthrosis, rheumatoid arthritis, chronic synovitis, psoriatic arthritis, gout arthropathy. Seventeen intra-articular injections were performed in fifteen patients receiving a mean activity of 972 MBq (range: 904-1,057 MBq) (166)Ho-HMBA. The patients were hospitalized for three days. Side effects were evaluated during hospital stay and after 6-8 weeks. Static scintigraphy of knee joints and measurements of blood radioactivity were performed. Therapeutic effects were evaluated after 6-8 weeks. In 2 hours and 2 days after application, we proved, by means of knee and inguinal scintigraphy, only insignificant radiopharmaceutical leakage from the joint cavity to the inguinal lymph nodes in four patients. In treated patients, no serious adverse effects occurred. Nine patients were without complaints; 4 patients had slight knee exsudation and 2 patients had great exsudation. Therapeutic effects after 6-8 weeks were as follows: 2 patients were without pain, 9 with lower pain, 3 with the same pain and 1 patient with increased pain. Joint motion was improved in 7 patients, remained the same in 7 patients and was impaired in 1 patient. Analgesics consumption was lower in 5 patients

Contrasting roles of the ABCG2 Q141K variant in prostate cancer

Energy Technology Data Exchange (ETDEWEB)

Sobek, Kathryn M. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Cummings, Jessica L. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Critical Care Medicine, University of Pittsburgh, Pittsburgh, PA (United States); Bacich, Dean J. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States); O’Keefe, Denise S., E-mail: OKeefeD@uthscsa.edu [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States)

2017-05-01

ABCG2 is a membrane transport protein that effluxes growth-promoting molecules, such as folates and dihydrotestosterone, as well as chemotherapeutic agents. Therefore it is important to determine how variants of ABCG2 affect the transporter function in order to determine whether modified treatment regimens may be necessary for patients harboring ABCG2 variants. Previous studies have demonstrated an association between the ABCG2 Q141K variant and overall survival after a prostate cancer diagnosis. We report here that in patients with recurrent prostate cancer, those who carry the ABCG2 Q141K variant had a significantly shorter time to PSA recurrence post-prostatectomy than patients homozygous for wild-type ABCG2 (P=0.01). Transport studies showed that wild-type ABCG2 was able to efflux more folic acid than the Q141K variant (P<0.002), suggesting that retained tumoral folate contributes to the decreased time to PSA recurrence in the Q141K variant patients. In a seemingly conflicting study, it was previously reported that docetaxel-treated Q141K variant prostate cancer patients have a longer survival time. We found this may be due to less efficient docetaxel efflux in cells with the Q141K variant versus wild-type ABCG2. In human prostate cancer tissues, confocal microscopy revealed that all genotypes had a mixture of cytoplasmic and plasma membrane staining, with noticeably less staining in the two homozygous KK patients. In conclusion, the Q141K variant plays contrasting roles in prostate cancer: 1) by decreasing folate efflux, increased intracellular folate levels result in enhanced tumor cell proliferation and therefore time to recurrence decreases; and 2) in patients treated with docetaxel, by decreasing its efflux, intratumoral docetaxel levels and tumor cell drug sensitivity increase and therefore patient survival time increases. Taken together, these data suggest that a patient's ABCG2 genotype may be important when determining a personalized treatment

40 CFR 141.80 - General requirements.

Science.gov (United States)

2010-07-01

... service line replacement, and public education. These requirements are triggered, in some cases, by lead... requirements. (1) All water systems shall install and operate optimal corrosion control treatment as defined in... specified by the State under § 141.83. (f) Lead service line replacement requirements. Any system exceeding...

40 CFR 141.601 - Standard monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Standard monitoring. 141.601 Section... Standard monitoring. (a) Standard monitoring plan. Your standard monitoring plan must comply with paragraphs (a)(1) through (a)(4) of this section. You must prepare and submit your standard monitoring plan...

Non-natives: 141 scientists object

OpenAIRE

Simberloff, Daniel; Vilà, Montserrat

2011-01-01

Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. Jake Alexander Institute of Integrative Biology, Zurich, Switzerland. Fred Allendorf University of Montana, Missoula, Montana, USA. James Aronson CEFE/CNRS, Montpellier, France. Pedro M. Antunes Algoma University, Sault Ste. Marie, Onta...

40 CFR 141.808 - Audits and inspections.

Science.gov (United States)

2010-07-01

... (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.808 Audits and..., disinfection and flushing, and general maintenance and self-inspections of aircraft water system. (b) Air... delivery of safe drinking water. ...

40 CFR 141.551 - What strengthened combined filter effluent turbidity limits must my system meet?

Science.gov (United States)

2010-07-01

... effluent turbidity limits must my system meet? 141.551 Section 141.551 Protection of Environment... Effluent Requirements § 141.551 What strengthened combined filter effluent turbidity limits must my system meet? Your system must meet two strengthened combined filter effluent turbidity limits. (a) The first...

26 CFR 31.3401(a)(14)-1 - Group-term life insurance.

Science.gov (United States)

2010-04-01

...) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3401(a)(14)-1 Group-term life insurance. (a) The cost of... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Group-term life insurance. 31.3401(a)(14)-1...

40 CFR 60.141a - Definitions.

Science.gov (United States)

2010-07-01

... steel production cycle are also included when the hot metal transfer station or skimming station is an... Process Steelmaking Facilities for Which Construction is Commenced After January 20, 1983 § 60.141a... amended or in subpart A of this part. Basic oxygen process furnace (BOPF) means any furnace with a...

40 CFR 141.721 - Reporting requirements.

Science.gov (United States)

2010-07-01

... operational data for toolbox options. Microbial Toolbox Reporting Requirements Toolbox option Systems must... coagulant (iv) At least 0.5-log mean reduction of influent turbidity or compliance with alternative State... treatment compliance date in § 141.713. (ii) If monthly average of daily max turbidity is greater than 1 NTU...

14 CFR 141.41 - Flight simulators, flight training devices, and training aids.

Science.gov (United States)

2010-01-01

..., and training aids. 141.41 Section 141.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... aids. An applicant for a pilot school certificate or a provisional pilot school certificate must show that its flight simulators, flight training devices, training aids, and equipment meet the following...

40 CFR 141.174 - Filtration sampling requirements.

Science.gov (United States)

2010-07-01

... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection... water system subject to the requirements of this subpart that provides conventional filtration treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Filtration sampling requirements. 141...

19 CFR 141.14 - Deceased or insolvent consignees and court-appointed administrators.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Deceased or insolvent consignees and court-appointed administrators. 141.14 Section 141.14 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION... administrators. The executor or administrator of the estate of a deceased consignee, the receiver or other legal...

Laboratory investigation of the efficacy of holmium:YAG laser irradiation in removing intracanal debris

Science.gov (United States)

Nuebler-Moritz, Michael; Gutknecht, Norbert; Sailer, Hermann F.; Hering, Peter; Prettl, Wilhelm

1997-05-01

Current endodontic therapy involves debridement and disinfection of the root canal by means of mechanical instrumentation and chemical irrigation. However, several studies have shown that these techniques fail to achieve complete cleansing. Recently, lasers have been suggested for use within root canals. This study was conducted to determine the efficacy of Holmium:YAG laser irradiation in removing intracanal debris and smear layer. Root canal surfaces of freshly-extracted human teeth were exposed to pulsed Ho:YAG laser radiation. Subsequently, laser induced structural changes were investigated using scanning electron microscopy. Temperature measurements during irradiation were performed by means of thermocouples. The result of this survey give a preliminary indication of the ability of the Ho:YAG laser to improve current endodontic treatment survey give a preliminary indication of the ability of the Ho:YAG laser to improve current endodontic treatment modalities. However, limitations exist with regard to circumscribed and well-quantified irradiation of root canal surfaces, due to the lack of perpendicular delivery of the laser beam. Additional studies will be required to develop suitable optical transmission systems, in order to achieve complete cleansing and to avoid damage to the periradicular tissues, respectively.

The structure of cytomegalovirus immune modulator UL141 highlights structural Ig-fold versatility for receptor binding

Energy Technology Data Exchange (ETDEWEB)

Nemčovičová, Ivana [La Jolla Institute for Allergy and Immunology, 9420 Athena Circle, La Jolla, CA 92037 (United States); Slovak Academy of Sciences, Dúbravská cesta 9, SK 84505 Bratislava (Slovakia); Zajonc, Dirk M., E-mail: dzajonc@liai.org [La Jolla Institute for Allergy and Immunology, 9420 Athena Circle, La Jolla, CA 92037 (United States)

2014-03-01

The crystal structure of Human cytomegalovirus immune modulator UL141 was solved at 3.25 Å resolution. Here, a detailed analysis of its intimate dimerization interface and the biophysical properties of its receptor (TRAIL-R2 and CD155) binding interactions are presented. Natural killer (NK) cells are critical components of the innate immune system as they rapidly detect and destroy infected cells. To avoid immune recognition and to allow long-term persistence in the host, Human cytomegalovirus (HCMV) has evolved a number of genes to evade or inhibit immune effector pathways. In particular, UL141 can inhibit cell-surface expression of both the NK cell-activating ligand CD155 as well as the TRAIL death receptors (TRAIL-R1 and TRAIL-R2). The crystal structure of unliganded HCMV UL141 refined to 3.25 Å resolution allowed analysis of its head-to-tail dimerization interface. A ‘dimerization-deficient’ mutant of UL141 (ddUL141) was further designed, which retained the ability to bind to TRAIL-R2 or CD155 while losing the ability to cross-link two receptor monomers. Structural comparison of unliganded UL141 with UL141 bound to TRAIL-R2 further identified a mobile loop that makes intimate contacts with TRAIL-R2 upon receptor engagement. Superposition of the Ig-like domain of UL141 on the CD155 ligand T-cell immunoreceptor with Ig and ITIM domains (TIGIT) revealed that UL141 can potentially engage CD155 similar to TIGIT by using the C′C′′ and GF loops. Further mutations in the TIGIT binding site of CD155 (Q63R and F128R) abrogated UL141 binding, suggesting that the Ig-like domain of UL141 is a viral mimic of TIGIT, as it targets the same binding site on CD155 using similar ‘lock-and-key’ interactions. Sequence alignment of the UL141 gene and its orthologues also showed conservation in this highly hydrophobic (L/A)X{sub 6}G ‘lock’ motif for CD155 binding as well as conservation of the TRAIL-R2 binding patches, suggesting that these host�

The structure of cytomegalovirus immune modulator UL141 highlights structural Ig-fold versatility for receptor binding

International Nuclear Information System (INIS)

Nemčovičová, Ivana; Zajonc, Dirk M.

2014-01-01

The crystal structure of Human cytomegalovirus immune modulator UL141 was solved at 3.25 Å resolution. Here, a detailed analysis of its intimate dimerization interface and the biophysical properties of its receptor (TRAIL-R2 and CD155) binding interactions are presented. Natural killer (NK) cells are critical components of the innate immune system as they rapidly detect and destroy infected cells. To avoid immune recognition and to allow long-term persistence in the host, Human cytomegalovirus (HCMV) has evolved a number of genes to evade or inhibit immune effector pathways. In particular, UL141 can inhibit cell-surface expression of both the NK cell-activating ligand CD155 as well as the TRAIL death receptors (TRAIL-R1 and TRAIL-R2). The crystal structure of unliganded HCMV UL141 refined to 3.25 Å resolution allowed analysis of its head-to-tail dimerization interface. A ‘dimerization-deficient’ mutant of UL141 (ddUL141) was further designed, which retained the ability to bind to TRAIL-R2 or CD155 while losing the ability to cross-link two receptor monomers. Structural comparison of unliganded UL141 with UL141 bound to TRAIL-R2 further identified a mobile loop that makes intimate contacts with TRAIL-R2 upon receptor engagement. Superposition of the Ig-like domain of UL141 on the CD155 ligand T-cell immunoreceptor with Ig and ITIM domains (TIGIT) revealed that UL141 can potentially engage CD155 similar to TIGIT by using the C′C′′ and GF loops. Further mutations in the TIGIT binding site of CD155 (Q63R and F128R) abrogated UL141 binding, suggesting that the Ig-like domain of UL141 is a viral mimic of TIGIT, as it targets the same binding site on CD155 using similar ‘lock-and-key’ interactions. Sequence alignment of the UL141 gene and its orthologues also showed conservation in this highly hydrophobic (L/A)X 6 G ‘lock’ motif for CD155 binding as well as conservation of the TRAIL-R2 binding patches, suggesting that these host–receptor interactions

Use of the Stone Cone for prevention of calculus retropulsion during holmium:YAG laser lithotripsy: case series and review of the literature.

Science.gov (United States)

Eisner, Brian H; Dretler, Stephen P

2009-01-01

Stone retropulsion during ureteroscopic lithotripsy leads to additional procedures for residual calculi. The Stone Cone (Boston Scientific, Natick, Mass., USA) is a device designed to prevent stone migration. To determine the incidence of calculus retropulsion and additional procedures after ureteroscopy with intracorporeal lithotripsy while using the Stone Cone. A retrospective review of patients with obstructing ureteral calculi who underwent ureteroscopy and holmium:YAG laser lithotripsy using the Stone Cone as a backstop over a 3-year period at an academic medical center was performed. 133 patients underwent ureteroscopy with holmium:YAG laser lithotripsy using the Stone Cone to prevent calculus retroplusion. Success was defined as no residual fragments >2 mm in size, no changes from semirigid to flexible ureteroscope, and no additional procedures. Post-operative imaging was abdominal plain radiography or computed tomography. A MEDLINE search was performed to indentify all English clinical studies of the Stone Cone. Of the 133 uses of the Stone Cone, there were 2 (1.5%) residual retropulsed fragments >2 mm which required an additional procedure. There were no changes to flexible ureteroscope secondary to stone retropulsion in 105 cases of semirigid ureteroscopy. There was no instance of ureteral obstruction from residual 2-mm fragments. There were no ureteral strictures or hydronephrosis among 91 patients with long-term follow-up imaging. A review of the literature was performed which yielded 4 clinical publications and 90 reported cases using the Stone Cone with 100% success. Two of these studies showed statistically significant improvement when compared with control patients. The Stone Cone minimized stone retropulsion during ureteroscopic laser lithotripsy. The Stone Cone offers the urologist greater certainty during ureteroscopy and may decrease the number of clinically significant residual calculi. Copyright 2009 S. Karger AG, Basel.

9 CFR 319.141 - Fresh pork sausage.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Fresh pork sausage. 319.141 Section... AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Sausage Generally: Fresh...

Decay mechanism of the fsub(7/2) isobaric analog state of 141Pr, (2)

International Nuclear Information System (INIS)

Uegaki, Junichi; Shoda, Katsufusa

1975-01-01

Experimental results on the f7/2 IAR(isobaric analog resonance) by 141 Pr (e, e'p) reaction were reported previously. This paper presents the results of further measurement on this reaction. The energy spectra of protons emitted by the 141 Pr (e, e'p) reaction, obtained at the electron energy Ee of 16.3, 15.5, 14.8 and 14.1 MeV, are shown. A peak seen at the proton energy Ep of 9.5 MeV in the spectrum taken at Ee=16.3 MeV shows the proton group decaying from the f7/2 isobaric analog state (IAS) to 140 Ce ground state, and the excitation energy of the f7/2 IAS was calculated as Ex=14.8 MeV. The cross-section of the reaction 141 Pr (γ, p 0 ) can be estimated from the spectra obtained, and was compared with that estimated from the 140 Ce (p, γ 0 ) reaction. The cross-section of the 141 Pr (e, e'p) reaction is shown as a function of incident electron energy, and the resonance intensity of the f7/2 IAR was estimated as (2.7 +- 1.3) x 10 -28 cm 2 MeV. The radiation width of the f7/2 IAR of 141 Pr was 25.8 eV, and this value is not in agreement with that obtained from 141 Pr (p, γ 0 ). The proton spectra of 141 Pr (γ, p) reaction can be obtained from the proton spectra of 141 Pr (e, e'p) reaction by assuming virtual photon spectra. The result was compared with the result of 140 Ce (p, p') reaction. The one particle-one hole state of neutrons distributed over the energy range between 5.3 and 6.3 MeV, and the first excited 2 + state was seen at Esub(p)=7.9 MeV. In the range between 6.3 and 7.8 MeV, a proton group existed, which did not agree with the data of proton scattering. More precise study is under consideration. (Kato, T.)

MicroRNA-141 inhibits migration of gastric cancer by targeting zinc finger E-box-binding homeobox 2.

Science.gov (United States)

Du, Ying; Wang, Lingfei; Wu, Honghai; Zhang, Yiyin; Wang, Kan; Wu, Dingting

2015-09-01

Human microRNA (miR)-141 is a member of the miR‑200 family, which has been reported to be downregulated in gastric cancer, and involved in the proliferation of gastric cancer cells. However, little is currently known regarding its role in the migration of gastric cancer. The present study investigated the function of miR‑141 in gastric cancer cell migration, and evaluated the contribution of zinc finger E‑box‑binding homeobox 1 and 2 (ZEB1/2) in miR‑141 mediated migration of gastric cancer cells. The expression levels of miR‑141 and its potential ZEB1/2 targets were examined by quantitative polymerase chain reaction (qPCR) and western blotting, respectively. The migration of SGC‑7901 and HGC‑27 gastric cancer cells, which had been transfected with an miRNA precursor, was examined by cell migration and wound healing assays. A luciferase activity assay was used to validate whether ZEB1/2 was a direct target of miR‑141. The results demonstrated that overexpression of miR‑141 markedly inhibited the migration of gastric cancer cells in vitro. Forced overexpression of miR‑141 significantly reduced the luciferase activity of the 3'‑untranslated region of ZEB2 in gastric cancer cells. Furthermore, the mRNA and protein expression levels of ZEB2 were reduced in cells overexpressing miR‑141, whereas the protein expression levels of E‑cadherin were increased. In gastric tumor samples the expression levels of ZEB2 were inversely correlated with the expression of miR‑141. These results suggest that miR‑141 may be involved in the inhibition of gastric cancer cell migration, and that ZEB2 is a target gene of miR-141.

33 CFR 209.141 - Coordination of hydroelectric power operations with power marketing agencies.

Science.gov (United States)

2010-07-01

... Commanders will develop, in coordination with their respective power marketing agency, a system for exchanging operating information. The system will include general operating information and information on... power operations with power marketing agencies. 209.141 Section 209.141 Navigation and Navigable Waters...

Our first clinical experience with radiosynoviorthesis by means of 166Ho-holmium-boro-macroaggregates

International Nuclear Information System (INIS)

Kraft, O.; Ullmann, V.; Kasparek, R.; Melichar, F.; Kropacek, M.; Mirzajevova, M.

2005-01-01

In this paper, we evaluate the therapeutic and adverse effects of the application of 166- holmium-boro-macroaggregates (HMBA) in radiosynovectomy (RSO) of the knees. We assessed the efficacy and safety of 166H o-HBMA in a prospective clinical trial in patients suffering from chronic synovitis. An effective component of radiopharmaceutical 166H o-boro-macroaggregates is radionuclide 166H o which has both b-emission and g-emission. The physical half-life time of 166H o is 26.8 hours. After application of the radiopharmaceutical into a joint cavity, the effect of b-emission causes radiation necrosis of pathologically changed (inflamed) synovial membrane. From 15 april 2005, we have started RSO of knees by means of new radiopharmaceutical 166H o-boro-macroaggregates in patients with gonarthrosis, rheumatoid arthritis, chronic synovitis, psoriatic arthritis, gout arthropathy. Seventeen intra-articular injections were performed in fifteen patients receiving a mean activity of 972 MBq (range: 904.1057 MBq) 166H o-HMBA. The patients were hospitalized for three days. Side effects were evaluated during hospital stay and after 6.8 weeks. Static scintigraphy of knee joints and measurements of blood radioactivity were performed. Therapeutic effects were evaluated after 6.8 weeks. In 2 hours and 2 days after application, we proved, by means of knee and inguinal scintigraphy, only insignificant radiopharmaceutical leakage from the joint cavity to the inguinal lymph nodes in four patients. In treated patients, no serious adverse effects occurred. Nine patients were without complaints; 4 patients had slight knee exudation and 2 patients had great exudation. Therapeutic effects after 6.8 weeks were as follows: 2 patients were without pain, 9 with lower pain, 3 with the same pain and 1 patient with increased pain. Joint motion was improved in 7 patients, remained the same in 7 patients and was impaired in 1 patient. Analgesics consumption was lower in 5 patients, the same in 9

An i{sub 13/2} neutron intruder band in {sup 141}Gd

Energy Technology Data Exchange (ETDEWEB)

Mullins, S M; Omar, A; Persson, L; Prevost, D; Waddington, J C [McMaster Univ., Hamilton, ON (Canada); Andrews, H R; Ball, G C; Galindo-Uribarri, A; Janzen, V P; Radford, D C; Ward, D [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.; Drake, T E [Toronto Univ., ON (Canada). Dept. of Physics; Fossan, D B; Lafosse, D; Vaska, P; Waring, M [State Univ. of New York, Stony Brook, NY (United States). Dept. of Physics; Wadsworth, R [York Univ. (United Kingdom). Dept. of Physics

1992-08-01

The nucleus {sup 141}Gd has been investigated at high spins for the first time following the reactions {sup 112}Sn({sup 32}S,2pn){sup 141}Gd at 155 MeV and {sup 112}Sn({sup 33}S,2p2n){sup 141}Gd at 170 MeV. The methods of in-beam {gamma}-ray spectroscopy were used to establish a number of different structures, including a band which has been assigned as being based on the {nu}i{sub 13/2}[660]1/2{sup +} Nilsson intruder orbital. This is the heaviest nucleus thus far in which this type of intruder band has been identified. (author). 11 refs., 3 figs.

40 CFR 141.623 - Reduced monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Reduced monitoring. 141.623 Section....623 Reduced monitoring. (a) You may reduce monitoring to the level specified in the table in this paragraph (a) any time the LRAA is ≤0.040 mg/L for TTHM and ≤0.030 mg/L for HAA5 at all monitoring locations...

40 CFR 141.802 - Coliform sampling plan.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Coliform sampling plan. 141.802... sampling plan. (a) Each air carrier under this subpart must develop a coliform sampling plan covering each... required actions, including repeat and follow-up sampling, corrective action, and notification of...

Schostakowitsch: Sinfonie N15, Op. 141 / Hanspeter Krellmann

Index Scriptorium Estoniae

Krellmann, Hanspeter

1990-01-01

Uuest heliplaadist "Schostakowitsch: Sinfonie N15, Op. 141, Oktober, Op. 131, Ouvertüre über russische und kirgisische Volksthemen, Op. 115. Göteborger Sinfonie-Orchester, Neeme Järvi". DG CD 427 616-2

40 CFR 141.571 - What records does subpart T require my system to keep?

Science.gov (United States)

2010-07-01

... records does subpart T require my system to keep? Your system must keep several types of records based on... Benchmarking(§§ 141.540-141.544) Benchmark (including raw data and analysis) Indefinitely. ...

14 CFR 141.18 - Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances. 141.18 Section 141.18 Aeronautics and Space FEDERAL AVIATION... General § 141.18 Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances...

27 CFR 24.141 - Bonded wine warehouse.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bonded wine warehouse. 24..., DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Permanent Discontinuance of Operations § 24.141 Bonded wine warehouse. Where all operations at a bonded wine warehouse are to be permanently...

Efficacy and Safety of Semirigid Ureteroscopy Combined with Holmium: YAG Laser in the Treatment of Upper Urinary Tract Calculi: Is it a Good Alternative Treatment Option of Flexible Ureteroscopy for Developing Countries

International Nuclear Information System (INIS)

Bibi, S.; Siddiqui, T. R.; Ahmed, W.; Alam, S. E.; Shah, S. A.; Soomro, I. A.; Qureshi, S.

2015-01-01

Objective: To assess the success rates of endoscopic management of upper ureteral stones using semirigid ureterorenoscopy and holmium: YAG laser lithotripters. Method: A total of 74 patients with an established diagnosis of upper ureteric stone and scheduled for endoscopic ureteral stone treatment were retrospectively evaluated. Failure was defined as the inability to contact or fragment the stone, migration of the stone into the renal pelvis and difficulty in visualizing the stone for the second time. Success rates and influencing factors as for stone-free state were investigated. Results: Mean age of our patients was 45.99±15.00 (range: 24-82) years. In 14 of 74 patients procedural failure was observed. Double J stents were implanted in 65 percent of the patients and ureteral catheterization was performed on 20 percent of them. The total success rate was 81.1 percent. Major complication rate was 1.1 percent. Factors effecting the success rate as gender, age, body mass index, grade of hydronephrosis and stone size were evaluated and only age was found to be statistically significant. Conclusion: Despite some potential risks, semirigid ureterorenoscopic stone extraction and holmium: YAG laser lithotripters are still safe and effective treatment alternatives for management of upper ureteral stones. (author)

41 CFR 105-71.141 - Financial reporting.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Financial reporting. 105... GOVERNMENTS 71.14-Post-Award Requirements/Reports, Records, Retention, and Enforcement § 105-71.141 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this section, grantees will...

Development and evaluation of holmium doped phosphate glass microspheres for selective internal radiotherapy

International Nuclear Information System (INIS)

Barros Filho, Eraldo C.; Martinelli, Jose Roberto; Squair, Peterson L; Osso Junior, Joao A.; Sene, Frank Ferrer

2013-01-01

Selective Internal Radiotherapy is used to treat hepatocellular carcinoma. In this treatment 90 Y -doped aluminosilicate glass microspheres are introduced in the hepatic artery and they migrate to the liver near to the tumor where they are trapped in the arterioles. The radiation β- emitted by the decay of 90 Y annihilates the cancer cells. A macroaggregate of albumin containing technetium is previously used to monitor the lung shunt and to prevent the spreading of 90 Y during the treatment. In the present work, 165 Ho- doped phosphate glass microspheres were developed aiming that application. 165 Ho has high cross section for neutron capture (64 bars) and 166 Ho decays emitting β- radiation with appropriate energy for killing cancer cells, and gamma rays with low energy which can be used to obtain images of the microspheres location and to check possible occurrence of lung shunt. Holmium also is highly paramagnetic and can be used to obtain images whereby NMR. The glass matrix consists of (P 2 O 5 ) tetrahedrons and can be produced by a relatively lower melting temperature of chemical compounds. The 31 P decays by emitting β- radiation and contributes to the absorbed dose, helping to annihilate the cancer cells. The microspheres were produced by using two methods: the flame and the gravitation falling methods to obtain microspheres with appropriate properties. (author)

40 CFR 141.701 - Source water monitoring.

Science.gov (United States)

2010-07-01

... (a)(4) of this section based on the E. coli level that applies to the nearest surface water body. If no surface water body is nearby, the system must comply based on the requirements that apply to... Monitoring Requirements § 141.701 Source water monitoring. (a) Initial round of source water monitoring...

14 CFR 141.55 - Training course: Contents.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Training course: Contents. 141.55 Section... Training course: Contents. (a) Each training course for which approval is requested must meet the minimum... trained in the room at one time; (2) A description of each type of audiovisual aid, projector, tape...

Performance and safety of holmium: YAG laser optical fibers.

Science.gov (United States)

Knudsen, Bodo E; Glickman, Randolph D; Stallman, Kenneth J; Maswadi, Saher; Chew, Ben H; Beiko, Darren T; Denstedt, John D; Teichman, Joel M H

2005-11-01

Lower-pole ureteronephroscopy requires transmission of holmium:YAG energy along a deflected fiber. Current ureteroscopes are capable of high degrees of deflection, which may stress laser fibers beyond safe limits during lower-pole use. We hypothesized that optical fiber and safety measures differ among manufacturers. Small (200-273-microm) and medium-diameter (300-400-microm) Ho:YAG fibers were tested in a straight and 180 degrees bent configuration. Energy transmission was measured by an energy detector. Fiber durability was assessed by firing the laser in sequentially tighter bending diameters. The fibers were bent to 180 degrees with a diameter of 6 cm and run at 200- to 4000-mJ pulse energy to determine the minimum energy required to fracture the fiber. The bending diameter was decreased by 1-cm increments and testing repeated until a bending diameter of 1 cm was reached. The maximum deflection of the ACMI DUR-8E ureteroscope with each fiber in the working channel was recorded. The flow rate through the working channel of the DUR-8E was measured for each fiber. The mean energy transmission differed among fibers (P < 0.001). The Lumenis SL 200 and the InnovaQuartz 400 were the best small and medium-diameter fibers, respectively, in resisting thermal breakdown (P < 0.01). The Dornier Lightguide Super 200 fractured repeatedly at a bend diameter of 2 cm and with the lowest energy (200 mJ). The other small fibers fractured only at a bend diameter of 1 cm. The Sharplan 200 and InnovaQuartz Sureflex 273T were the most flexible fibers, the Lumenis SL 365 the least. The flow rate was inversely proportional to four times the power of the diameter of the fiber. Optical performance and safety differ among fibers. Fibers transmit various amounts of energy to their cladding when bent. During lower-pole nephroscopy with the fiber deflected, there is a risk of fiber fracture from thermal breakdown and laser-energy transmission to the endoscope. Some available laser fibers

27 CFR 70.141 - Lien for taxes.

Science.gov (United States)

2010-04-01

... intangible, belonging to such person. The lien attaches to all property and rights to property belonging to such person at any time during the period of the lien, including any property or rights to property... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Lien for taxes. 70.141...

In vitro study of morphological and chemical modification threshold of bovine dental enamel irradiated by the holmium laser; Estudo in vitro das alteracoes morfologicas e quimicas do esmalte dental bovino irradiado pelo laser de holmio

Energy Technology Data Exchange (ETDEWEB)

Eduardo, Patricia Lerro de Paula

2001-07-01

The aim of this study is to investigate the Ho:YLF laser effects on the dental enamel surface with regards to its morphology, thermal variations during its irradiation in the pulp chamber and its increased resistance to demineralization through quantitative analysis of calcium and phosphorous atoms reactive concentrations in samples. Twenty samples of bovine enamel were used and divided in four groups: control - acidulated phosphate fluoride (APF) application followed by demineralization treatment with lactic acid; irradiation with Ho:YLF laser (100 J/cm{sup 2}) followed by APF topic application and demineralization treatment with lactic acid; irradiation with Ho:YLF laser (350 J/cm{sup 2}) followed by APF topic application and demineralization treatment with lactic acid: and irradiation with Ho:YLF laser ( 450 J/cm{sup 2}) followed by APF topic application and demineralization treatment with lactic acid. Ali samples were quantified according to their calcium and phosphorous atoms relative concentrations before and after the treatments above. X-Ray fluorescence spectrochemical analysis and scanning electron microscopy were carried out. It was observed an increase on the calcium and phosphorous atoms concentration ratio and therefore the enamel demineralization reduction as a result of the lactic acid treatment in the samples irradiated with the holmium laser followed by the APF application. In order to evaluate the feasibility of this study for clinical purposes, morphological changes caused by the holmium laser irradiation were analyzed. Such modifications were characterized by melted and re-solidified regions of the enamel with consequent changes on its permeability and solubility. Temperature changes of ten human pre-molars teeth irradiated with 350 J/cm{sup 2} and 450 J/cm{sup 2} were also monitored in the pulp chamber in real time. Temperature increases over 4,20 C did not occur. The results obtained from this study along with the results from previous

7 CFR 1703.141 - Approved purposes for loans.

Science.gov (United States)

2010-01-01

..., DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Loan Program § 1703.141... the project, including vehicles utilizing distance learning and telemedicine technology to deliver...) Providing links between teachers and students or medical professionals who are located at the same facility...

40 CFR 141.203 - Tier 2 Public Notice-Form, manner, and frequency of notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Tier 2 Public Notice-Form, manner, and frequency of notice. 141.203 Section 141.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...., house renters, apartment dwellers, university students, nursing home patients, prison inmates, etc...

40 CFR 141.204 - Tier 3 Public Notice-Form, manner, and frequency of notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Tier 3 Public Notice-Form, manner, and frequency of notice. 141.204 Section 141.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...., house renters, apartment dwellers, university students, nursing home patients, prison inmates, etc...

18 CFR 141.51 - FERC Form No. 714, Annual Electric Balancing Authority Area and Planning Area Report.

Science.gov (United States)

2010-04-01

..., Annual Electric Balancing Authority Area and Planning Area Report. 141.51 Section 141.51 Conservation of...) § 141.51 FERC Form No. 714, Annual Electric Balancing Authority Area and Planning Area Report. (a) Who... Policies Act, 16 U.S.C. 2602, operating a balancing authority area, and any group of electric utilities...

miR-141-3p inhibits human stromal (mesenchymal) stem cell proliferation and differentiation

DEFF Research Database (Denmark)

Qiu, Weimin; Kassem, Moustapha

2014-01-01

Wnt signaling determines human stromal (mesenchymal) stem cell (hMSC) differentiation fate into the osteoblast or adipocyte lineage. microRNAs (miRNAs) are small RNA molecules of 21-25 nucleotides that regulate many aspects of osteoblast biology. Thus, we examined miRNAs regulated by Wnt signaling...... in hMSC. We identified miRNA (miR)-141-3p as a Wnt target which in turn inhibited Wnt signaling. Moreover, miR-141-3p inhibited hMSC proliferation by arresting cells at the G1 phase of the cell cycle. miR-141-3p inhibited osteoblast differentiation of hMSC as evidenced by reduced alkaline phosphatase...... activity, gene expression and in vitro mineralized matrix formation. Bioinformatic studies, Western blot analysis and 3'UTR reporter assay demonstrated that cell division cycle 25A (CDC25A) is a direct target of miR-141-3p. siRNA-mediated knock-down of CDC25A inhibited hMSC proliferation and osteoblast...

40 CFR 141.75 - Reporting and recordkeeping requirements.

Science.gov (United States)

2010-07-01

... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.75... reporting requirements, as appropriate, until filtration is in place. A public water system that uses a ground water source under the direct influence of surface water and does not provide filtration treatment...

40 CFR 141.175 - Reporting and recordkeeping requirements.

Science.gov (United States)

2010-07-01

...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and... representative samples of filtered water in a system using conventional filtration treatment or direct filtration... addition to the reporting and recordkeeping requirements in § 141.75, a public water system subject to the...

Gene-Targeted Mice with the Human Troponin T R141W Mutation Develop Dilated Cardiomyopathy with Calcium Desensitization.

Directory of Open Access Journals (Sweden)

Mohun Ramratnam

Full Text Available Most studies of the mechanisms leading to hereditary dilated cardiomyopathy (DCM have been performed in reconstituted in vitro systems. Genetically engineered murine models offer the opportunity to dissect these mechanisms in vivo. We generated a gene-targeted knock-in murine model of the autosomal dominant Arg141Trp (R141W mutation in Tnnt2, which was first described in a human family with DCM. Mice heterozygous for the mutation (Tnnt2R141W/+ recapitulated the human phenotype, developing left ventricular dilation and reduced contractility. There was a gene dosage effect, so that the phenotype in Tnnt2R141W/+mice was attenuated by transgenic overexpression of wildtype Tnnt2 mRNA transcript. Male mice exhibited poorer survival than females. Biomechanical studies on skinned fibers from Tnnt2R141W/+ hearts showed a significant decrease in pCa50 (-log[Ca2+] required for generation of 50% of maximal force relative to wildtype hearts, indicating Ca2+ desensitization. Optical mapping studies of Langendorff-perfused Tnnt2R141W/+ hearts showed marked increases in diastolic and peak systolic intracellular Ca2+ ([Ca2+]i, and prolonged systolic rise and diastolic fall of [Ca2+]i. Perfused Tnnt2R141W/+ hearts had slower intrinsic rates in sinus rhythm and reduced peak heart rates in response to isoproterenol. Tnnt2R141W/+ hearts exhibited a reduction in phosphorylated phospholamban relative to wildtype mice. However, crossing Tnnt2R141W/+ mice with phospholamban knockout (Pln-/- mice, which exhibit increased Ca2+ transients and contractility, had no effect on the DCM phenotype. We conclude that the Tnnt2 R141W mutation causes a Ca2+ desensitization and mice adapt by increasing Ca2+-transient amplitudes, which impairs Ca2+ handling dynamics, metabolism and responses to β-adrenergic activation.

25 CFR 141.23 - Posted statement of ownership.

Science.gov (United States)

2010-04-01

... legible to customers stating the form of the business entity, the names and addresses of all other... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.23 Posted statement of...

25 CFR 141.17 - Health and sanitation requirements.

Science.gov (United States)

2010-04-01

... handling any food sold by a reservation business. (d) Any person whom the Service Unit Director of the... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.17 Health and sanitation...

27 CFR 25.141 - Barrels and kegs.

Science.gov (United States)

2010-04-01

... OF THE TREASURY LIQUORS BEER Marks, Brands, and Labels § 25.141 Barrels and kegs. (a) General... shown on the bung or on the tap cover, or on a label securely affixed to each barrel or keg, the place... production: (i) May be shown as the only location on the bung, or on the tap cover, or on a separate label...

Line Identification of Atomic and Ionic Spectra of Holmium in the Near-UV. Part I. Spectrum of Ho i

Energy Technology Data Exchange (ETDEWEB)

Al-Labady, N.; Özdalgiç, B. [Graduate School of Engineering and Sciences, Istanbul University, TR-34452 Beyazıt, Istanbul (Turkey); Er, A.; Güzelçimen, F.; Öztürk, I. K.; Başar, Gö. [Faculty of Science, Department of Physics, Istanbul University, TR-34134 Vezneciler, Istanbul (Turkey); Kröger, S. [Hochschule für Technik und Wirtschaft Berlin, Wilhelminenhofstr. 75A, D-12459 Berlin (Germany); Kruzins, A.; Tamanis, M.; Ferber, R., E-mail: ikanat@istanbul.edu.tr [Laser Centre, The University of Latvia, Rainis Boulevard 19, LV-1586 Riga (Latvia)

2017-02-01

The Fourier Transform spectra of a Holmium hollow cathode discharge lamp have been investigated in the UV spectral range from 25,000 up to 31,530 cm{sup −1} (317 to 400 nm). Two Ho spectra have been measured with neon and argon as buffer gases. Based on the intensity ratios from these two spectra, a distinction was made between atomic and ionic lines (ionic lines are discussed in an accompanying paper). Using the known Ho i energy levels, 71 lines could be classified as transitions of atomic Ho, 34 of which have not been published previously. Another 32 lines, which could not be classified, are listed in the literature and assigned as atomic Ho. An additional 370 spectral lines have been assigned to atomic Ho based on the signal-to-noise ratio in the two spectra measured under different discharge conditions, namely with buffer gases argon and neon, respectively. These 370 lines have not been previously listed in the literature.

40 CFR 141.71 - Criteria for avoiding filtration.

Science.gov (United States)

2010-07-01

... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.71 Criteria for avoiding filtration. A public water system that uses a surface water source must meet all of...)(C)(iii), that filtration is required. A public water system that uses a ground water source under...

40 CFR 141.81 - Applicability of corrosion control treatment steps to small, medium-size and large water systems.

Science.gov (United States)

2010-07-01

... treatment steps to small, medium-size and large water systems. 141.81 Section 141.81 Protection of... WATER REGULATIONS Control of Lead and Copper § 141.81 Applicability of corrosion control treatment steps...). (ii) A report explaining the test methods used by the water system to evaluate the corrosion control...

Microspheres of polyester loaded with Holmium-165: effect of gamma irradiation on the polymeric structure

International Nuclear Information System (INIS)

Azevedo, Mariangela de Burgos M. de; Pires, Geovanna; Lira, Rafael A. de; Geraldes, Adriana N.; Nascimento, Nanci; Melo, Vitor Hugo Soares de; Kodama, Yasko

2011-01-01

Biodegradable polymers containing radioactive isotopes have potential applications as delivery vehicles of beta radiation to the cancer tumors by brachytherapy. 166-Ho is an example of such radioisotope emitting high-energy beta particles, and also its gamma rays allow nuclear imaging in everywhere is applied. Among the biodegradable polymers, different types of poly(lactide) have been investigated in our laboratory, and poly(L-lactide) (PLLA) was used as substrate to prepare microparticles loaded with holmium acetylacetonate HoAcAc (PLLA-HoAcAc-MP). The aim of this study was to evaluate the stability of these microparticles to gamma radiation. The PLLA-HoAcAc-MP were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP, and their stability studied out with gamma radiation of 25, 50 and 100 kGy doses. MP were characterized before and after irradiation by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TGA), scanning electron microscopy (SEM), X-ray diffraction (XRD) and con focal laser scanning microscopy (CLSM). Preliminary results showed that gamma radiation did not damage morphologically the prepared PLLA-HoAcAc-MP in the dose range studied, and this procedure may be an important tool for knowing the stabilities of the polymers studied as MP for possible application in brachytherapy. (author)

40 CFR 141.26 - Monitoring frequency and compliance requirements for radionuclides in community water systems.

Science.gov (United States)

2010-07-01

... identified in the finished water. (iii) Annual monitoring for strontium-90 and tritium shall be conducted by... requirements for radionuclides in community water systems. 141.26 Section 141.26 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER...

N-acetylcysteine Ameliorates Prostatitis via miR-141 Regulating Keap1/Nrf2 Signaling.

Science.gov (United States)

Wang, Liang-Liang; Huang, Yu-Hua; Yan, Chun-Yin; Wei, Xue-Dong; Hou, Jian-Quan; Pu, Jin-Xian; Lv, Jin-Xing

2016-04-01

Chronic prostatitis was the most common type of prostatitis and oxidative stress was reported to be highly elevated in prostatitis patients. In this study, we determined the effect of N-acetylcysteine (NAC) on prostatitis and the molecular mechanism involved in it. Male Sprague-Dawley rats were divided into three groups: control group (group A, n = 20), carrageenan-induced chronic nonbacterial prostatitis (CNP) model group (group B, n = 20), and carrageenan-induced CNP model group with NAC injection (group C, n = 20). Eye score, locomotion score, inflammatory cell count, cyclooxygenase 2 (COX2) expression, and Evans blue were compared in these three groups. The expression of miR-141 was determined by quantitative real-time PCR (qRT-PCR). Moreover, protein expressions of Kelch-like ECH-associated protein-1 (Keap1) and nuclear factor erythroid-2 related factor 2 (Nrf2) and its target genes were examined by Western blot. Luciferase reporter assay was performed in RWPE-1 cells transfected miR-141 mimic or inhibitor and the plasmid carrying 3'-UTR of Keap1. The value of eye score, locomotion score, inflammatory cell count, and Evans blue were significantly decreased in group C, as well as the expression of COX2, when comparing to that of group B. These results indicated that NAC relieved the carrageenan-induced CNP. Further, we found that NAC increased the expression of miR-141 and activated the Keap1/Nrf2 signaling. Luciferase reporter assay revealed that miR-141 mimic could suppress the activity of Keap1 and stimulate the downstream target genes of Nrf2. In addition, miR-141 inhibitor could reduce the effect of NAC on prostatitis. NAC ameliorates the carrageenan-induced prostatitis and prostate inflammation pain through miR-141 regulating Keap1/Nrf2 signaling.

40 CFR 80.141 - Interim detergent gasoline program.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Interim detergent gasoline program. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.141 Interim detergent gasoline... apply to: (i) All gasoline sold or transferred to a party who sells or transfers gasoline to the...

19 CFR 141.18 - Entry by nonresident corporation.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Entry by nonresident corporation. 141.18 Section....18 Entry by nonresident corporation. A nonresident corporation (i.e., one which is not incorporated... entry is located who is authorized to accept service of process against that corporation or, in the case...

Brachytherapy using holmium-166 liquid balloon system for in-stent restenosis: 6 months clinical and angiographic follow-up

Energy Technology Data Exchange (ETDEWEB)

Kim, M. H.; Kim, S. K.; Cha, K. S.; Kim, Y. D.; Lee, H. S.; Kang, D. Y. [Donga University College of Medicine, Busan (Korea, Republic of)

2002-07-01

In western country, 3 systems of brachytherapy using commercial radioactive source has been established. However, brachytherapy using holmium-166 liquid balloon system (HLBS) for the patient with stent restenosis has not been studied enough. 30 patients (male 23, mean age 58.9 7.7) were enrolled. Target dose was 15 Gy at 1 mm distance from the intimal surface. Clinical diagnoses of the study patients included stable angina 10 and unstable angina 20 patients. Target lesion included LAD 19, LCx 5 and RCA 6 arteries. Pre-brachytherapy treatment included cutting balloon angioplasty in 25, rotational atherectomy in 5 patients. Fractionation and stepping was done in 6 patients each. Follow-up angiography was done in 19 patients. Of them, 4 cases developed angiographic restenosis (21%) including 3 cases of total occlusion. 6 month MACE (major adverse cardiac event) occurred in 5 patients including one sudden cardiac death in a patient with 80 year-old, triple-vessel diseased patient. Vascular brachytherapy using HLBS is a safe and effective treatment modality for in-stent restenosis showing acceptable angiographic and clinical result.

Influence of Pelvicaliceal Anatomy on Stone Clearance After Flexible Ureteroscopy and Holmium Laser Lithotripsy for Large Renal Stones.

Science.gov (United States)

Inoue, Takaaki; Murota, Takashi; Okada, Shinsuke; Hamamoto, Shuzo; Muguruma, Kouei; Kinoshita, Hidefumi; Matsuda, Tadashi

2015-09-01

This study was performed to evaluate the impact of pelvicaliceal anatomy on stone clearance in patients with remnant fragments in the lower pole after flexible ureteroscopy and holmium laser lithotripsy (fURSL) for renal stones >15 mm. This retrospective study included 67 patients with radiopaque residual fragments (>2 mm) in the lower pole after fURSL for large renal stones (>15 mm). The preoperative infundibular length (IL), infundibular width (IW), infundibulopelvic angle (IPA), and caliceal pelvic height (CPH) were measured using intravenous urography. Multivariate analysis was performed to determine whether any of these measurements affected stone clearance. Of the 67 patients, 55 (82.1%) were stone free (SF) 3 months after fURSL. The anatomic factors significantly favorable for an SF status were a short IL, broad IW, wide IPA, and low CPH. On multivariate analysis, the IPA had a significant influence on an SF status after fURSL (p=0.010). An IPA renal stones according to our multivariate analysis. Additional studies are required to further evaluate the characteristics of the pelvicaliceal anatomy influencing stone clearance.

Flexible ureterorenoscopy (F-URS) with holmium laser versus extracorporeal shock wave lithotripsy (ESWL) for treatment of renal stone <2 cm: a meta-analysis.

Science.gov (United States)

Mi, Yuanyuan; Ren, Kewei; Pan, Haiyan; Zhu, Lijie; Wu, Sheng; You, Xiaoming; Shao, Hongbao; Dai, Feng; Peng, Tao; Qin, Feng; Wang, Jian; Huang, Yi

2016-08-01

The objective of the study was to systematically review the efficacy and safety of flexible ureterorenoscopy (F-URS) with holmium laser versus extracorporeal shock wave lithotripsy (ESWL) for the treatment of renal stone ESWL (WMD = 2.13, 95 % CI 1.13-4.00, P = 0.02). F-URS is associated with higher SFR, lower APR and RR than ESWL. F-URS is a safe and effective procedure. It can successfully treat patients with stones for 1-2 cm, especially for lower pole stone, without increasing complications, operative time and hospital stay. F-URS can be used as an alternative treatment to ESWL in selected cases with larger renal stones. However, further randomized trials are needed to confirm these findings.

40 CFR 141.563 - What follow-up action is my system required to take based on continuous turbidity monitoring?

Science.gov (United States)

2010-07-01

... required to take based on continuous turbidity monitoring? 141.563 Section 141.563 Protection of... Individual Filter Turbidity Requirements § 141.563 What follow-up action is my system required to take based on continuous turbidity monitoring? Follow-up action is required according to the following tables...

41 CFR 105-53.141 - Office of Policy Analysis.

Science.gov (United States)

2010-07-01

... Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 53-STATEMENT OF ORGANIZATION AND FUNCTIONS Central Offices § 105-53.141 Office of Policy Analysis. The Office of Policy Analysis, headed by..., independent, objective information concerning management policies and programs, and technical and analytical...

Rebuttal of the existence of solid rare earth bicarbonates and the crystal structure of holmium nitrate pentahydrate

Energy Technology Data Exchange (ETDEWEB)

Rincke, Christine; Schmidt, Horst; Voigt, Wolfgang [Institute for Inorganic Chemistry, TU Bergakademie Freiberg (Germany)

2017-03-16

The synthesis routes of Gd(HCO{sub 3}){sub 3}.5H{sub 2}O and Ho(HCO{sub 3}){sub 3}.6H{sub 2}O, which are the only known bicarbonates of rare earth metals, were refuted and the published crystal structures were discussed. Because of the structural relationship of Ho(HCO{sub 3}){sub 3}.6H{sub 2}O to rare earth nitrate hexahydrates,[] the synthesis of holmium nitrate hydrate was considered and the crystal structure of Ho(NO{sub 3}){sub 3}.5H{sub 2}O was solved by single crystal X-ray diffraction measurements. Ho(NO{sub 3}){sub 3}.5H{sub 2}O was determined to crystallize in the triclinic space group P1 (no. 2) with a = 6.5680(14) Aa, b = 9.503(2) Aa, c = 10.462(2) Aa, α = 63.739(14) , β = 94.042(2) and γ = 76.000(16) . The crystal structure consists of isolated [Ho(H{sub 2}O){sub 4}(NO{sub 3}){sub 3}] polyhedra and non-coordinating water molecules. It is isotypic to other rare earth nitrate pentahydrates. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

14 CFR Appendix J to Part 141 - Aircraft Type Rating Course, For Other Than an Airline Transport Pilot Certificate

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft Type Rating Course, For Other Than an Airline Transport Pilot Certificate J Appendix J to Part 141 Aeronautics and Space FEDERAL... PILOT SCHOOLS Pt. 141, App. J Appendix J to Part 141—Aircraft Type Rating Course, For Other Than an...

Role of DNA methylation in miR-200c/141 cluster silencing in invasive breast cancer cells

Directory of Open Access Journals (Sweden)

Wernet Peter

2010-08-01

Full Text Available Abstract Background The miR-200c/141 cluster has recently been implicated in the epithelial to mesenchymal transition (EMT process. The expression of these two miRNAs is inversely correlated with tumorigenicity and invasiveness in several human cancers. The role of these miRNAs in cancer progression is based in part on their capacity to target the EMT activators ZEB1 and ZEB2, two transcription factors, which in turn repress expression of E-cadherin. Little is known about the regulation of the mir200c/141 cluster, whose targeting has been proposed as a promising new therapy for the most aggressive tumors. Findings We show that the miR-200c/141 cluster is repressed by DNA methylation of a CpG island located in the promoter region of these miRNAs. Whereas in vitro methylation of the miR-200c/141 promoter led to shutdown of promoter activity, treatment with a demethylating agent caused transcriptional reactivation in breast cancer cells formerly lacking expression of miR-200c and miR-141. More importantly, we observed that DNA methylation of the identified miR-200c/141 promoter was tightly correlated with phenotype and the invasive capacity in a panel of 8 human breast cancer cell lines. In line with this, in vitro induction of EMT by ectopic expression of the EMT transcription factor Twist in human immortalized mammary epithelial cells (HMLE was accompanied by increased DNA methylation and concomitant repression of the miR-200c/141 locus. Conclusions The present study demonstrates that expression of the miR-200c/141 cluster is regulated by DNA methylation, suggesting epigenetic regulation of this miRNA locus in aggressive breast cancer cell lines as well as untransformed mammary epithelial cells. This epigenetic silencing mechanism might represent a novel component of the regulatory circuit for the maintenance of EMT programs in cancer and normal cells.

Role of DNA methylation in miR-200c/141 cluster silencing in invasive breast cancer cells.

Science.gov (United States)

Neves, Rui; Scheel, Christina; Weinhold, Sandra; Honisch, Ellen; Iwaniuk, Katharina M; Trompeter, Hans-Ingo; Niederacher, Dieter; Wernet, Peter; Santourlidis, Simeon; Uhrberg, Markus

2010-08-03

The miR-200c/141 cluster has recently been implicated in the epithelial to mesenchymal transition (EMT) process. The expression of these two miRNAs is inversely correlated with tumorigenicity and invasiveness in several human cancers. The role of these miRNAs in cancer progression is based in part on their capacity to target the EMT activators ZEB1 and ZEB2, two transcription factors, which in turn repress expression of E-cadherin. Little is known about the regulation of the mir200c/141 cluster, whose targeting has been proposed as a promising new therapy for the most aggressive tumors. We show that the miR-200c/141 cluster is repressed by DNA methylation of a CpG island located in the promoter region of these miRNAs. Whereas in vitro methylation of the miR-200c/141 promoter led to shutdown of promoter activity, treatment with a demethylating agent caused transcriptional reactivation in breast cancer cells formerly lacking expression of miR-200c and miR-141. More importantly, we observed that DNA methylation of the identified miR-200c/141 promoter was tightly correlated with phenotype and the invasive capacity in a panel of 8 human breast cancer cell lines. In line with this, in vitro induction of EMT by ectopic expression of the EMT transcription factor Twist in human immortalized mammary epithelial cells (HMLE) was accompanied by increased DNA methylation and concomitant repression of the miR-200c/141 locus. The present study demonstrates that expression of the miR-200c/141 cluster is regulated by DNA methylation, suggesting epigenetic regulation of this miRNA locus in aggressive breast cancer cell lines as well as untransformed mammary epithelial cells. This epigenetic silencing mechanism might represent a novel component of the regulatory circuit for the maintenance of EMT programs in cancer and normal cells.

Studies on therapeutic method of liver cancer(hapatocellular carcinome)by Holmium-166 radionuclide

Energy Technology Data Exchange (ETDEWEB)

Lee, Jong Tae; Yoo, H. S.; Kim, M. J.; Han, K. H.; Park, C. I. [Yonsei University Medical College, Seoul (Korea, Republic of)

1997-07-01

As the study of radioactive nuclide, Holmium-166 in the treatment of liver cancer(hepatocellular carcinoma), this study was performed under the base of animal experimental. Using dog liver, percutaneous injection of Ho-166 MAA or chitosan with premade dose was done under the ultrasound guidance. Continuously the same procedure as previous one was performed in the skin hapatoma, which was developed by the injection of hepatocellular carcinoma cell in the nude mouse, In case of injected normal liver of dog, imaging study including ultrasound, CT and MRI was done in order to evaluate effect of Ho-166 and pathologic reaction. The result showed well defined nectosis of normal liver as well as skin hepatoma. The area of nectosis is dependent on the dose of injected Ho-166. Generally, pathologic reaction is tissue coagulation nectosis, Ho-166 particles, fibrosis and hemorrhage. In the clinical study, 50 patients with hapatoma was selected for this study under the agreement of patient. Under ultrasound guidance percutaneous injection of Ho-166 Maa or chitosan to tumor was performed and follow-up study was extended from 6 to 12 month. The result showed that 64% of patient were completely treated. Overall, the effect of treatment could be obtained in 41 patient (82%) among 50 hepatoma patient. Conclusively Ho-166 is thought to be a compromising agent in the treatment of hepatocellular carcinoma and one of therapeutic modality, if it is established internally and world-wide. In the future, the popular percutaneous ethanol injection method will be replaced to this method. 19 refs., 1 tabs., 14 figs. (author)

Factors affecting de novo urinary retention after Holmium laser enucleation of the prostate.

Directory of Open Access Journals (Sweden)

Sung Han Kim

Full Text Available OBJECTIVE: Patients can experience urinary retention (UR after Holmium laser enucleation of the prostate (HoLEP that requires bladder distension during the procedure. The aim of this retrospective study is to identify factors affecting the UR after HoLEP. MATERIALS AND METHODS: 336 patients, which underwent HoLEP for a symptomatic benign prostatic hyperplasia between July 2008 and March 2012, were included in this study. Urethral catheters were routinely removed one or two days after surgery. UR was defined as the need for an indwelling catheter placement following a failure to void after catheter removal. Demographic and clinical parameters were compared between the UR (n = 37 and the non-urinary retention (non-UR; n = 299 groups. RESULTS: The mean age of patients was 68.3 (±6.5 years and the mean operative time was 75.3 (±37.4 min. Thirty seven patients (11.0% experienced a postoperative UR. UR patients voided catheter free an average of 1.9 (±1.7 days after UR. With regard to the causes of UR, 24 (7.1% and 13 (3.9% patients experienced a blood clot-related UR and a non-clot related UR respectively. Using multivariate analysis (p0.05. CONCLUSIONS: De novo UR after HoLEP was found to be self-limited and it was not related to learning curve, patient age, diabetes, or operative time. Efficient morcellation and careful control of bleeding, which reduces clot formation, decrease the risk of UR after HoLEP.

40 CFR 141.717 - Pre-filtration treatment toolbox components.

Science.gov (United States)

2010-07-01

... surface water or GWUDI source. (c) Bank filtration. Systems receive Cryptosporidium treatment credit for... paragraph. Systems using bank filtration when they begin source water monitoring under § 141.701(a) must... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Pre-filtration treatment toolbox...

40 CFR 141.22 - Turbidity sampling and analytical requirements.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Turbidity sampling and analytical... § 141.22 Turbidity sampling and analytical requirements. The requirements in this section apply to... the water distribution system at least once per day, for the purposes of making turbidity measurements...

42 CFR 410.141 - Outpatient diabetes self-management training.

Science.gov (United States)

2010-10-01

... 42 Public Health 2 2010-10-01 2010-10-01 false Outpatient diabetes self-management training. 410...-Management Training and Diabetes Outcome Measurements § 410.141 Outpatient diabetes self-management training... Part B covers outpatient diabetes self-management training for a beneficiary who has been diagnosed...

Medium-spin states in the N=80 nuclei 139Pr and 141Pm

International Nuclear Information System (INIS)

Piiparinen, M.; Kortelahti, M.; Pakkanen, A.; Komppa, T.; Komu, R.

1979-10-01

The level structures of 139 Pr and 141 Pm have been investigated using (p,2n), ( 3 He,3n) and (α,4n) reactions and methods of in-beam γ-ray and electron spectroscopy. Fourteen new levels with spins up to (23 + /2) were observed in 139 Pr and seventeen new levels with spins up to 19 - /2 in 141 Pm. The level structures in both nuclei can be described by coupling the odd-proton intrinsic states to the excitations of the doubly even core. The ordering of the levels in the πhsub(11/2)x2 + multiplet is discussed on the basis of the triaxial rotor-plus-particle model calculations. The calculations suggest that a transition from a basically prolate to an oblate triaxial shape takes place between the neutron numbers N = 78 and N = 80. A γ deformation of 34 was deduced for both 139 Pr and 141 Pm. (author)

Spectroscopic studies of the energy transfer processes important to obtain holmium laser action in the Er:Tm:Ho:YLF

International Nuclear Information System (INIS)

Tarelho, Luiz Vicente Gomes

1995-01-01

There are several processes of energy transfer between Er, Tm and Ho ions in YLF crystal that could be evaluated using the Foerster-Dexter method. Energy transfer processes, important to understand Holmium laser action, were studied, specially involving the energy transfer between the first excited states of Er and Tm donors and Ho acceptor. The back-transfer processes were evaluated too in order to minimize the system losses. Another important process to understand Ho laser action in the host is the energy diffusion mechanism between donor ions due to excitation migration processes which take place before the energy transfer to Ho. The proposed model of energy transfer was developed to include the diffusion mechanism between donors in the absence and presence of the acceptors. The energy transfer probability was evaluated including the back-transfer processes besides the diffusion assistance. A laser medium model based on the fundamental spectroscopic parameters was used in order to determine the ideal donor acceptor concentrations in order to maximize the laser action of Ho at 2,1 μm. (author)

A primary exploration to quasi-two-dimensional rare-earth ferromagnetic particles: holmium-doped MoS2 sheet as room-temperature magnetic semiconductor

Science.gov (United States)

Chen, Xi; Lin, Zheng-Zhe

2018-05-01

Recently, two-dimensional materials and nanoparticles with robust ferromagnetism are even of great interest to explore basic physics in nanoscale spintronics. More importantly, room-temperature magnetic semiconducting materials with high Curie temperature is essential for developing next-generation spintronic and quantum computing devices. Here, we develop a theoretical model on the basis of density functional theory calculations and the Ruderman-Kittel-Kasuya-Yoshida theory to predict the thermal stability of two-dimensional magnetic materials. Compared with other rare-earth (dysprosium (Dy) and erbium (Er)) and 3 d (copper (Cu)) impurities, holmium-doped (Ho-doped) single-layer 1H-MoS2 is proposed as promising semiconductor with robust magnetism. The calculations at the level of hybrid HSE06 functional predict a Curie temperature much higher than room temperature. Ho-doped MoS2 sheet possesses fully spin-polarized valence and conduction bands, which is a prerequisite for flexible spintronic applications.

40 CFR 141.111 - Treatment techniques for acrylamide and epichlorohydrin.

Science.gov (United States)

2010-07-01

... (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Treatment Techniques § 141.111 Treatment techniques for acrylamide and epichlorohydrin. Each public water system must certify... and epichlorohydrin are used in drinking water systems, the combination (or product) of dose and...

14 CFR 141.25 - Business office and operations base.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Business office and operations base. 141.25... operations base. (a) Each holder of a pilot school or a provisional pilot school certificate must maintain a... or the operations base, each certificate holder must notify the FAA Flight Standards District Office...

Loss of miR-141/200c ameliorates hepatic steatosis and inflammation by reprogramming multiple signaling pathways in NASH

Science.gov (United States)

Tran, Melanie; Lee, Sang-Min; Shin, Dong-Ju

2017-01-01

Accumulation of lipid droplets and inflammatory cell infiltration is the hallmark of nonalcoholic steatohepatitis (NASH). The roles of noncoding RNAs in NASH are less known. We aim to elucidate the function of miR-141/200c in diet-induced NASH. WT and miR-141/200c–/– mice were fed a methionine and choline deficient (MCD) diet for 2 weeks to assess markers of steatosis, liver injury, and inflammation. Hepatic miR-141 and miR-200c RNA levels were highly induced in human patients with NASH fatty liver and in WT MCD mice. miR-141/200c–/– MCD mice had reduced liver weights and triglyceride (TG) levels, which was associated with increased microsomal TG transfer protein (MTTP) and PPARα but reduced SREBP1c and FAS expression. Inflammation was attenuated and F4/80 macrophage activation was suppressed in miR-141/200c–/– mice, as evidenced by decreased serum aminotransferases and IL-6 and reduced hepatic proinflammatory, neutrophil, and profibrotic genes. Treatment with LPS in BM-derived macrophages isolated from miR-200c/141–/– mice polarized macrophages toward the M2 antiinflammatory state by increasing Arg1 and IL-10 levels while decreasing the M1 marker iNOS. In addition, elevated phosphorylated AMPK (p-AMPK), p-AKT, and p-GSK3β and diminished TLR4 and p-mTOR/p-4EBP1 proteins were observed. Lipidomics and metabolomics revealed alterations of TG and phosphatidylcholine (PC) lipid species by miR-141/200c deficiency. In summary, miR-141/200c deficiency diminished NASH-associated hepatic steatosis and inflammation by reprogramming lipid and inflammation signaling pathways. PMID:29093267

40 CFR 141.723 - Requirements to respond to significant deficiencies identified in sanitary surveys performed by EPA.

Science.gov (United States)

2010-07-01

... deficiencies identified in sanitary surveys performed by EPA. 141.723 Section 141.723 Protection of Environment... performed by EPA, systems must respond in writing to significant deficiencies identified in sanitary survey... will address significant deficiencies noted in the survey. (d) Systems must correct significant...

26 CFR 1.141-5 - Private loan financing test.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Private loan financing test. 1.141-5 Section 1... loan financing test. (a) In general. Bonds of an issue are private activity bonds if more than the... determining whether the private loan financing test is met. In determining whether the proceeds of an issue...

How angry was the ancient Greek god Poseidon in 141/142 A.D.?

Science.gov (United States)

Şahin, Murat; Elitez, İrem; Yaltırak, Cenk

2017-04-01

Poseidon, also known as "God of Sea" or "Earth-Shaker", was one of the Olympian's Gods in the Greek mythology. It was a common belief that Poseidon shows his rage by tsunamis and earthquakes. So, the how angry Poseidon in 141/142 A.D.? According to the historical records, the whole area including Lycian cities and Rhodes was affected by a destructive earthquake and a following tsunami in 141/142. After these events the emperor of Greeks made donations to the Lycian cities and Rhodes for their recovery with relative to the damage and importance of the city. 141/142 earthquake had a considerable amount of damage on 28 ancient cities. With respect to the historical catalogues, this earthquake had at least 9-10 intensity and caused a tsunami in Rhodes and harbour of the ancient city of Patara. In this study, we try to restrict the magnitude of the event by using PGA (peak ground acceleration), MMI (Modified Mercalli Intensity), tsunami modelling and amount of aids. Our preliminary results suggest that this event has to be bigger or equal magnitude 8.

Role for DNA methylation in the regulation of miR-200c and miR-141 expression in normal and cancer cells

Energy Technology Data Exchange (ETDEWEB)

Vrba, Lukas; Jensen, Taylor J.; Garbe, James C.; Heimark, Ronald L.; Cress, Anne E.; Dickinson, Sally; Stampfer, Martha R.; Futscher, Bernard W.

2009-12-23

BACKGROUND: The microRNA-200 family participates in the maintenance of an epithelial phenotype and loss of its expression can result in epithelial to mesenchymal transition (EMT). Furthermore, the loss of expression of miR-200 family members is linked to an aggressive cancer phenotype. Regulation of the miR-200 family expression in normal and cancer cells is not fully understood. METHODOLOGY/ PRINCIPAL FINDINGS: Epigenetic mechanisms participate in the control of miR-200c and miR-141 expression in both normal and cancer cells. A CpG island near the predicted mir-200c/mir-141 transcription start site shows a striking correlation between miR-200c and miR-141 expression and DNA methylation in both normal and cancer cells, as determined by MassARRAY technology. The CpG island is unmethylated in human miR-200/miR-141 expressing epithelial cells and in miR-200c/miR-141 positive tumor cells. The CpG island is heavily methylated in human miR-200c/miR-141 negative fibroblasts and miR-200c/miR-141 negative tumor cells. Mouse cells show a similar inverse correlation between DNA methylation and miR-200c expression. Enrichment of permissive histone modifications, H3 acetylation and H3K4 trimethylation, is seen in normal miR-200c/miR-141-positive epithelial cells, as determined by chromatin immunoprecipitation coupled to real-time PCR. In contrast, repressive H3K9 dimethylation marks are present in normal miR-200c/miR-141-negative fibroblasts and miR-200c/miR-141 negative cancer cells and the permissive histone modifications are absent. The epigenetic modifier drug, 5-aza-2'-deoxycytidine, reactivates miR-200c/miR-141 expression showing that epigenetic mechanisms play a functional role in their transcriptional control. CONCLUSIONS/ SIGNIFICANCE: We report that DNA methylation plays a role in the normal cell type-specific expression of miR-200c and miR-141 and this role appears evolutionarily conserved, since similar results were obtained in mouse. Aberrant DNA methylation

40 CFR 141.87 - Monitoring requirements for water quality parameters.

Science.gov (United States)

2010-07-01

... § 141.87 Monitoring requirements for water quality parameters. All large water systems, and all small- and medium-size systems that exceed the lead or copper action level shall monitor water quality... methods. (i) Tap samples shall be representative of water quality throughout the distribution system...

Resident CD141 (BDCA3)+ dendritic cells in human skin produce IL-10 and induce regulatory T cells that suppress skin inflammation.

Science.gov (United States)

Chu, Chung-Ching; Ali, Niwa; Karagiannis, Panagiotis; Di Meglio, Paola; Skowera, Ania; Napolitano, Luca; Barinaga, Guillermo; Grys, Katarzyna; Sharif-Paghaleh, Ehsan; Karagiannis, Sophia N; Peakman, Mark; Lombardi, Giovanna; Nestle, Frank O

2012-05-07

Human skin immune homeostasis, and its regulation by specialized subsets of tissue-residing immune sentinels, is poorly understood. In this study, we identify an immunoregulatory tissue-resident dendritic cell (DC) in the dermis of human skin that is characterized by surface expression of CD141, CD14, and constitutive IL-10 secretion (CD141(+) DDCs). CD141(+) DDCs possess lymph node migratory capacity, induce T cell hyporesponsiveness, cross-present self-antigens to autoreactive T cells, and induce potent regulatory T cells that inhibit skin inflammation. Vitamin D(3) (VitD3) promotes certain phenotypic and functional properties of tissue-resident CD141(+) DDCs from human blood DCs. These CD141(+) DDC-like cells can be generated in vitro and, once transferred in vivo, have the capacity to inhibit xeno-graft versus host disease and tumor alloimmunity. These findings suggest that CD141(+) DDCs play an essential role in the maintenance of skin homeostasis and in the regulation of both systemic and tumor alloimmunity. Finally, VitD3-induced CD141(+) DDC-like cells have potential clinical use for their capacity to induce immune tolerance.

40 CFR 141.709 - Developing the disinfection profile and benchmark.

Science.gov (United States)

2010-07-01

... Cryptosporidium Disinfection Profiling and Benchmarking Requirements § 141.709 Developing the disinfection profile...) of the water before or at the first customer and prior to each additional point of disinfectant...) before or at the first customer during peak hourly flow. (ii) Determine successive CTcalc/CT99.9 values...

26 CFR 1.141-7 - Special rules for output facilities.

Science.gov (United States)

2010-04-01

.... (b) Definitions. For purposes of this section and § 1.141-8, the following definitions and rules... legislature in State X to own and operate certain power generating facilities, sells all of the power from its... generation, transmission and distribution facilities. In 2003, D transfers operating control of its...

Predictive risk factors of postoperative urinary incontinence following holmium laser enucleation of the prostate during the initial learning period

Directory of Open Access Journals (Sweden)

Shuichiro Kobayashi

Full Text Available ABSTRACT Purpose: To determine the predictive factors for postoperative urinary incontinence (UI following holmium laser enucleation of the prostate (HoLEP during the initial learning period. Patients and Methods: We evaluated 127 patients with benign prostatic hyperplasia who underwent HoLEP between January 2011 and December 2013. We recorded clinical variables, including blood loss, serum prostate-specific antigen levels, and the presence or absence of UI. Blood loss was estimated as a decline in postoperative hemoglobin levels. The predictive factors for postoperative UI were determined using a multivariable logistic regression analysis. Results: Postoperative UI occurred in 31 patients (24.4%, but it cured in 29 patients (93.5% after a mean duration of 12 weeks. Enucleation time >100 min (p=0.043 and blood loss >2.5g/dL (p=0.032 were identified as significant and independent risk factors for postoperative UI. Conclusions: Longer enucleation time and increased blood loss were independent predictors of postoperative UI in patients who underwent HoLEP during the initial learning period. Surgeons in training should take care to perform speedy enucleation maneuver with hemostasis.

MIR141 expression differentiates Hashimoto Thyroiditis from PTC and benign thyrocytes in Irish archival thyroid tissues

Directory of Open Access Journals (Sweden)

Emma R Dorris

2012-09-01

Full Text Available MicroRNAs (miRNAs are small non-coding RNAs approximately 22 nucleotides in length that function as regulators of gene expression. Dysregulation of miRNAs has been associated with initiation and progression of oncogenesis in humans. Our group has previously described a unique miRNA expression signature, including the MIR200 family member MIR141, which can differentiate papillary thyroid cancer (PTC cell lines from a control thyroid cell line. An investigation into the expression of MIR141 in a series of archival thyroid malignancies (n=140; classic PTC, follicular variant PTC, follicular thyroid carcinoma (FTC, Hashimoto thyroiditis (HT, or control thyrocytes was performed. Each cohort had a minimum of 20 validated samples surgically excised within the period 1980 - 2009. A subset of the HT and cPTC cohorts (n=3 were also analysed for expression of TGFβR1, a key member of the TGFβ pathway and known target of MIR141. Laser capture microdissection was used to specifically dissect target cells from formalin-fixed paraffin-embedded archival tissue. Thyrocyte- and lymphocyte-specific markers (TSHR and LSP1 respectively confirmed the integrity of cell populations in the HT cohort. RNA was extracted and quantitative RT-PCR was performed using comparative CT (ΔΔCT analysis. Statistically significant (p<0.05 differential expression profiles of MIR141 were found between tissue types. HT samples displayed significant downregulation of MIR141 compared to both classic PTC and control thyrocytes. Furthermore, TGFβR1 expression was detected in cPTC samples but not in HT thyrocytes. It is postulated that the down-regulation of this miRNA is due, at least in part, to its involvement in regulating the TGFβ pathway. This pathway is exquisitely involved in T-cell autoimmunity and has previously been linked with HT. In conclusion, HT epithelium can be distinguished from cPTC epithelium and control epithelium based on the relative expression of MIR141.

Ugilec 141, PCB's en dioxinen in paling uit de Roer

NARCIS (Netherlands)

Wammes JIJ; Linders SHMA; Liem AKD; Velde EG van der; LOC

1997-01-01

Questions about the health risk of consumption of eel from the river Rur for anglers, were the reason for an investigation into the occurrence of PCBs, dioxins and Ugilec 141 in this eel. Methods developed at the Laboratory of Organic-analytical Chemistry have been used for the analysis of Ugilec

Surface alloy formation by adsorption of holmium on Ag/Mo(112) bimetallic surfaces

Science.gov (United States)

Kołaczkiewicz, Jan; Oleksy, Czesław

2018-03-01

Work function change measurements, low energy electron diffraction (LEED) and density functional theory (DFT) are used to determine the structures formed on Ag/Mo(112) bimetallic surfaces upon deposition of 0.5 monolayer (ML) of holmium. As the bimetallic surfaces, we have chosen the Mo(112) substrate covered with 1 or 2 ML of Ag. Such surfaces have the same symmetry as the Mo(112) face but different electronic properties. LEED experiment indicates that the c(2 × 2) structure is formed on (1 ML Ag)/Mo(112) bimetallic surface upon deposition of 0.5 ML of Ho. DFT calculations show that a type of Ag-Ho surface alloy is formed, with Ho atoms 0.6 Å below the distorted layer of Ag. This is neither a substitutional nor a subsurface alloy. It is found that the adsorption structure formed on the (2 ML Ag)/Mo(112) bimetallic surface depends on the annealing temperature. After deposition of 0.5 ML of Ho at 300 K, the LEED pattern of p(2 × 2) symmetry is observed. Annealing of the overlayer at 640 K irreversibly changes the p(2 × 2) pattern into a pattern of c(2 × 2) type. The results of DFT computations show that the c(2 × 2) structure of the Ag-Ho surface alloy is energetically most favorable. In this structure, 0.5 ML of Ho is between the two monolayers of Ag, and the symmetry of the topmost layer is changed. The work function change calculated for the c(2 × 2) structure is in a good agreement with the measured value (0.22 eV). The results show that adsorption of Ho on the Ag/Mo(112) bimetallic surfaces is substantially different than on the clean Mo(112).

18 CFR 141.100 - Original cost statement of utility property.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Original cost statement... POLICIES ACT OF 1978 STATEMENTS AND REPORTS (SCHEDULES) § 141.100 Original cost statement of utility... predecessors of an electric operating unit or system, the original cost, estimated, if not known, the cost of...

26 CFR 31.3121(b)(14)-1 - Services in delivery or distribution of newspapers, shopping news, or magazines.

Science.gov (United States)

2010-04-01

... newspapers, shopping news, or magazines. 31.3121(b)(14)-1 Section 31.3121(b)(14)-1 Internal Revenue INTERNAL... distribution of newspapers, shopping news, or magazines. (a) Services of individuals under age 18. Services... the time of, the sale of newspapers or magazines to ultimate consumers under an arrangement under...

Comparison of cold-knife optical internal urethrotomy and holmium:YAG laser internal urethrotomy in bulbar urethral strictures

Science.gov (United States)

Yenice, Mustafa Gurkan; Sam, Emre; Colakoglu, Yunus; Atar, Feyzi Arda; Sahin, Selcuk; Simsek, Abdulmuttalip; Tugcu, Volkan

2017-01-01

Introduction To compare the results of cold-knife optical internal urethrotomy (OIU) and Holmium:YAG laser internal urethrotomy (HIU) in primary bulbar urethral strictures. Material and methods A total of 63 patients diagnosed with primary bulbar urethral stricture between August 2014 and September 2015 were assigned to the OIU (n = 29) and HIU (n = 34) groups. The demographic variables, biochemistry panels, and preoperative and postoperative uroflowmetry results including the maximum flow rate (Qmax) and mean flow rate (Qmean) values, retrograde urethrography, and diagnostic flexible urethroscopy findings were recorded prospectively. Demographic features and preoperative values were not statistically different between groups (p >0.05). Mean surgical times were 18.4 ±2.3 min for OIU and 21.9 ±3.8 min for HIU groups, which was statistically significant (p 0.05). There was no recurrence in the first 3 months in either group. The urethral stricture recurrence rate up to month 12 was not statistically significant for the OIU group (n = 6, 20.7%) as compared to the HIU group (n = 11, 32.4%; p = 0.299). At follow-up, the SFR and IFR was 96% and 88% at 3-months, and 82% and 71% at 12-months, respectively (p method to OIU, and it has similar success rates in the treatment of short segment bulbar urethral strictures. PMID:29732217

14 CFR Appendix F to Part 141 - Flight Instructor Certification Course

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight Instructor Certification Course F Appendix F to Part 141 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION...) Takeoffs, landings, and go-arounds; (viii) Fundamentals of flight; (ix) Performance maneuvers; (x) Ground...

18 CFR 141.400 - FERC Form No. 3-Q, Quarterly financial report of electric utilities, licensees, and natural gas...

Science.gov (United States)

2010-04-01

..., Quarterly financial report of electric utilities, licensees, and natural gas companies. 141.400 Section 141..., licensees, and natural gas companies. (a) Prescription. The quarterly report of electric utilities, licensees, and natural gas companies, designated as FERC Form No. 3-Q, is prescribed for the reporting...

40 CFR 141.562 - My system only has two or fewer filters-is there any special provision regarding individual...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false My system only has two or fewer filters-is there any special provision regarding individual filter turbidity monitoring? 141.562 Section 141.562 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS...

Completion summary for boreholes USGS 140 and USGS 141 near the Advanced Test Reactor Complex, Idaho National Laboratory, Idaho

Science.gov (United States)

Twining, Brian V.; Bartholomay, Roy C.; Hodges, Mary K.V.

2014-01-01

In 2013, the U.S. Geological Survey, in cooperation with the U.S. Department of Energy, drilled and constructed boreholes USGS 140 and USGS 141 for stratigraphic framework analyses and long-term groundwater monitoring of the eastern Snake River Plain aquifer at the Idaho National Laboratory in southeast Idaho. Borehole USGS 140 initially was cored to collect continuous geologic data, and then re-drilled to complete construction as a monitor well. Borehole USGS 141 was drilled and constructed as a monitor well without coring. Boreholes USGS 140 and USGS 141 are separated by about 375 feet (ft) and have similar geologic layers and hydrologic characteristics based on geophysical and aquifer test data collected. The final construction for boreholes USGS 140 and USGS 141 required 6-inch (in.) diameter carbon-steel well casing and 5-in. diameter stainless-steel well screen; the screened monitoring interval was completed about 50 ft into the eastern Snake River Plain aquifer, between 496 and 546 ft below land surface (BLS) at both sites. Following construction and data collection, dedicated pumps and water-level access lines were placed to allow for aquifer testing, for collecting periodic water samples, and for measuring water levels. Borehole USGS 140 was cored continuously, starting from land surface to a depth of 543 ft BLS. Excluding surface sediment, recovery of basalt and sediment core at borehole USGS 140 was about 98 and 65 percent, respectively. Based on visual inspection of core and geophysical data, about 32 basalt flows and 4 sediment layers were collected from borehole USGS 140 between 34 and 543 ft BLS. Basalt texture for borehole USGS 140 generally was described as aphanitic, phaneritic, and porphyritic; rubble zones and flow mold structure also were described in recovered core material. Sediment layers, starting near 163 ft BLS, generally were composed of fine-grained sand and silt with a lesser amount of clay; however, between 223 and 228 ft BLS, silt

Radiosynoviorthesis of knees by means of 166Ho-holmium-boro-macroaggregates.

Science.gov (United States)

Kraft, Otakar; Kaspárek, Richard; Ullmann, Vojtech; Melichar, Frantisek; Kropácek, Martin; Mirzajevova, Marcela

2007-04-01

The aim of this study was to evaluate adverse and therapeutic effects of applicated holmium-boro-macroaggregates (HBMAs) in the radiosynoviorthesis (RSO) of knees in patients suffering from chronic synovitis. We started RSO of the knees by means of a new radiopharmaceutical (RF) HBMA in patients with gonarthrosis, rheumatoid arthritis, chronic synovitis, psoriatic arthritis, and gout arthropathy. Seventeen (17) intra-articular injections were performed in 15 patients who were receiving a mean activity of 972 MBq (range, 904-1057) of 166Ho-HBMA. Patient inclusion to the study followed a series of inclusion and exclusion criterions. The patients were hospitalized for 3 days. Side-effects were evaluated during their hospital stay and again after 6-8 weeks. Static scintigraphy of knee joints and measurements of blood radioactivity were performed. Therapeutic effects were evaluated after 6-8 weeks and at 6 months. In 2 hours and 2 days following the application, we proved, by means of knee and inguinal scintigraphy, only insignificant radiopharmaceutical leakage from the joint cavity to the inguinal lymph nodes in 4 patients. In the treated patients, no serious adverse effects occurred. Nine (9) patients were without complaints, 4 patients had slight knee exudation, and 2 patients had great exudation. Therapeutic effects were as follows: 2 patients were without pain, 9 were with lower pain, 3 were with the same pain, and 1 patient was with increased pain. Joint motion was improved in 7 patients, remained the same in 7 patients, and was impaired in 1 patient. Analgesics consumption was lower in 5 patients, the same in 9 patients, and greater in 1 patient. Knee exudation was absent in 2 patients, lower in 4 patients, the same in 6 patients, and greater in 3 patients. In 3 patients it was necessary to do surgical RSO. This RF can extend the range of clinically used radiopharmaceuticals for RSO and to supplement space between 90Y with high energy and 186Re with 169Er with

Development of phosphate glass microspheres containing holmium for selective internal radiotherapy; Desenvolvimento de microesferas de vidro fosfato contendo holmio para uso em radioterapia interna seletiva

Energy Technology Data Exchange (ETDEWEB)

Barros Filho, Eraldo Cordeiro

2016-11-01

The selective internal radiotherapy is an alternative for some kinds of cancer as the hepatocellular carcinoma (HCC) or primary liver cancer treatment. In this treatment, glass or polymer microspheres containing radionuclides inside their structure are introduced in the liver through hepatic artery and trapped at the arterioles that feed the tumor. In this work, the development of phosphate glasses containing holmium for production of microspheres and their application in Brazil are proposed. The developed glasses presented suitable chemical durability, density of 2,7(3) g/cm{sup 3}, high thermal stability and the impurities contained therein do not preclude the treatment. The microspheres were produced by the flame method and the gravitational fall method, and were characterized by means of several techniques to evaluate shape, average particle size, activity and biocompatibility suitable for selective internal radiotherapy. Based in the main results, the submission to in vivo tests is proposed. (author)

41 CFR 302-9.141 - What is the “authorized point of origin” when I transport a POV to my post of duty?

Science.gov (United States)

2010-07-01

... point of originâ when I transport a POV to my post of duty? 302-9.141 Section 302-9.141 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND... Transportation Pov Transportation at Time of Assignment § 302-9.141 What is the “authorized point of origin” when...

25 CFR 141.18 - Availability of employee authorized to transact business.

Science.gov (United States)

2010-04-01

... hours an employee authorized in writing to engage in all business transactions that the licensee... 25 Indians 1 2010-04-01 2010-04-01 false Availability of employee authorized to transact business... ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.18...

Sierra Leone Journal of Biomedical Research Vol. 2 (2) pp. 135-141 ...

African Journals Online (AJOL)

Owner

135-141, December, 2010. ISSN 2219-3170(Online) ... 72 hours of unprotected sex to prevent unwanted pregnancy. ... purchase it from pharmacies since it is sold as an over-counter ..... However 65.9% signified their intention to participate if ...

Generation of 70-fs pulses at 286 μm from a mid-infrared fiber laser

Science.gov (United States)

Woodward, R. I.; Hudson, D. D.; Fuerbach, A.; Jackson, S. D.

2017-12-01

We propose and demonstrate a simple route to few-optical-cycle pulse generation from a mid-infrared fiber laser through nonlinear compression of pulses from a holmium-doped fiber oscillator using a short length of chalcogenide fiber and a grating pair. Pulses from the oscillator with 265-fs duration at 2.86 {\\mu}m are spectrally broadened through self-phase modulation in step-index As2S3 fiber to 141-nm bandwidth and then re-compressed to 70 fs (7.3 optical cycles). These are the shortest pulses from a mid-infrared fiber system to date, and we note that our system is compact, robust, and uses only commercially available components. The scalability of this approach is also discussed, supported by numerical modeling.

Holmium laser urethrotomy for treatment of traumatic stricture urethra: a review of 78 patients.

Science.gov (United States)

Hussain, Manzoor; Lal, Murli; Askari, Syed Hasan; Hashmi, Altaf; Rizvi, Syed Adibul Hasan

2010-10-01

To evaluate the efficacy and long-term results of laser urethrotomy as minimally invasive treatment for traumatic stricture urethra. Between January 2006 and June 2008, 78 male patients were treated with Holmium Laser urethrotomy. 16 Fr urethroscope was used through which 600um laser fiber was introduced through side channel. Stricture was visualized and incised at 12 o'clock position with energy set at 1500-2000 MJ at pulse rate of 10-12. Two other incisions were given at 2 and 10 o'clock positions. Further ablation was done till 16Fr Foley's catheter was passed. Patients were followed in a stricture clinic. Patients age ranged from 15-73 years. All strictures were due to trauma, Road traffic accident in 40 (52%) post catheter trauma 4 (5%), fall as ride 27 (35%) and failed urethroplasty 7 (8%). Site of stricture was bulbar 57 (73%), bulbomembranous 16 (20%) and membranoprostatic 5 (2.5%). Length of stricture ranged from 0.8-2.5 cms. At 3 months follow-up, 60 (77%) patients remained catheter and symptoms free while 18 (23%) developed recurrence of stricture but at the end of 36 months follow-up success rate decreased to 47 (60%). Among those who developed re-strictures, 6 ( 7.6%) had 2nd sitting laser while 4 (5.1%) had urethroplasty, and others were on intermittent dilatation. Immediate complications were sepsis 10 (13%), extravasation 2 (4%), failed urethrotomy 2 (4%) and mild haematuria 3 (5.8%). Hospital stay ranged from day care to 3 days. Laser urethrotomy is minimally invasive and an effective treatment for short strictures in bulbarurethra. The recurrence rate is 40% in the long-term follow-up and is more commonly seen in completely obliterated strictures.

Holmium laser urethrotomy for treatment of traumatic stricture urethra: A review of 78 patients

International Nuclear Information System (INIS)

Hussain, M.; Lal, M.; Askari, S.H.; Hashmi, A.; Rizvi, S.A.H.

2010-01-01

To evaluate the efficacy and long-term results of laser urethrotomy as minimally invasive treatment for traumatic stricture urethra. Methods: Between January 2006 and June 2008, 78 male patients were treated with Holmium Laser urethrotomy. 16 Fr urethroscope was used through which 600um laser fiber was introduced through side channel. Stricture was visualized and incised at 12 o'clock position with energy set at 1500-2000 MJ at pulse rate of 10-12. Two other incisions were given at 2 and 10 o'clock positions. Further ablation was done till 16 Fr Foley's catheter was passed. Patients were followed in a stricture clinic. Results: Patients age ranged from 15-73 years. All strictures were due to trauma, Road traffic accident in 40(52%) post catheter trauma 4(5%), fall as ride 27(35%) and failed urethroplasty 7(8%). Site of stricture was bulbar 57(73%), bulbomembranous 16(20%) and membranoprostatic 5(2.5%). Length of stricture ranged from 0.8-2.5 cms. At 3 months follow-up, 60(77%) patients remained catheter and symptoms free while 18(23%) developed recurrence of stricture but at the end of 36 months follow-up success rate decreased to 47 (60%). Among those who developed re-strictures, 6(7.6%) had second sitting laser while 4(5.1%) had urethroplasty, and others were on intermittent dilatation. Immediate complications were sepsis 10(13%), extravasation 2(4%), failed urethrotomy 2(4%) and mild haematuria 3(5.8%). Hospital stay ranged from day care to 3 days. Conclusion: Laser urethrotomy is minimally invasive and an effective treatment for short strictures in bulbar urethra. The recurrence rate is 40% in the long-term follow-up and is more commonly seen in completely obliterated strictures. (author)

7 CFR 400.141 - Internal Revenue Service (IRS) Tax Refund Offset.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Internal Revenue Service (IRS) Tax Refund Offset. 400...-Regulations for the 1986 and Succeeding Crop Years § 400.141 Internal Revenue Service (IRS) Tax Refund Offset... debt owing to any Federal agency by offset against a taxpayer's Federal income tax refund. This section...

[The importance of C-terminal aspartic acid residue (D141) to the antirestriction activity of the ArdB (R64) protein].

Science.gov (United States)

Kudryavtseva, A A; Osetrova, M S; Livinyuk, V Ya; Manukhov, I V; Zavilgelsky, G B

2017-01-01

Antirestriction proteins of the ArdB/KlcA family are specific inhibitors of restriction (endonuclease) activity of type-I restriction/modification enzymes. The effect of conserved amino acid residues on the antirestriction activity of the ArdB protein encoded by the transmissible R64 (IncI1) plasmid has been investigated. An analysis of the amino acid sequences of ArdB homologues demonstrated the presence of four groups of conserved residues ((1) R16, E32, and W51; (2) Y46 and G48; (3) S81, D83 and E132, and (4) N77, L(I)140, and D141) on the surface of the protein globule. Amino acid residues of the fourth group showed a unique localization pattern with the terminal residue protruding beyond the globule surface. The replacement of two conserved amino acids (D141 and N77) located in the close vicinity of each other on the globule surface showed that the C-terminal D141 is essential for the antirestriction activity of ArdB. The deletion of this residue, as well as replacement by a hydrophobic threonine residue (D141T), completely abolished the antirestriction activity of ArdB. The synonymous replacement of D141 by a glutamic acid residue (D141E) caused an approximately 30-fold decrease of the antirestriction activity of ArdB, and the point mutation N77A caused an approximately 20-fold decrease in activity. The residues D141 and N77 located on the surface of the protein globule are presumably essential for the formation of a contact between ArdB and a currently unknown factor that modulates the activity of type-I restriction/modification enzymes.

Holmium laser enucleation of the prostate and retropubic prostatic adenomectomy: morbidity analysis and anesthesia considerations.

Science.gov (United States)

Soto-Mesa, D; Amorín-Díaz, M; Pérez-Arviza, L; Fernández-Pello Montes, S; Martín-Huéscar, A

2015-11-01

Holmium laser enucleation of the prostate (HoLEP) is an alternative to prostatic adenomectomy for the surgical treatment of benign prostatic hypertrophy. We analyzed our learning curve for this technique, and we compared it in a secondary manner with prostatic adenomectomy. A retrospective comparative study was conducted that included the first 100 cases of HoLEP performed in our center and the latest 50 cases of retropubic adenomectomy. We collected data on the patients, the surgery, the anesthesia, the perioperative variables, the anesthesia complications and the postoperative variables, with a 6-month follow-up. We analyzed the learning curve without mentors for HoLEP and compared the characteristics of HoLEP in 2 separate phases (learning and stabilization phases) with the latest retropubic prostatic adenomectomies performed. Intradural anesthesia was the most common technique. The transfusion needs, length of stay (P<.01) and postoperative morbidity were lower for HoLEP than for adenomectomy. However, the retropubic adenomectomy group had larger initial prostate volumes (P<.001) and shorter surgical times (P<.001). Better surgical performance (P<.001) and a lower incidence of complications were observed in the HoLEP-B group (once the learning curve had been overcome) compared with the HoLEP-A group. In our center, HoLEP was introduced as a valid alternative to open retropubic adenomectomy, with excellent results in terms of morbidity and reduced hospital stay. In terms of the learning curve, we consider that approximately 50 patients (without mentor) is an appropriate cutoff. Local anesthesia is a good choice for the anesthesia technique. Copyright © 2014 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.

Suppression of SIK1 by miR-141 in human ovarian cancer cell lines and tissues.

Science.gov (United States)

Chen, Jin-Long; Chen, Fang; Zhang, Ting-Ting; Liu, Nai-Fu

2016-06-01

Epithelial ovarian cancer (EOC), the sixth most common cancer in women worldwide, is the most commonly fatal gynecologic malignancy in developed countries. One of the main reasons for this is that relatively little was known about the molecular events responsible for the development of this highly aggressive disease. In the present study, we demonstrated that salt‑inducible kinase 1 (SIK1; which is also known as MSK/SIK/SNF1LK) was downregulated in ovarian cancer tissue samples. Using HEY ovarian cancer cells, we noted that SIK1 overexpression inhibited proliferation as well as cancer stem cell-associated traits. Silencing SIK1 promoted the proliferation of the EG ovarian cancer cell line. We performed an analysis of potential microRNAs (miRNAs or miRs) target sites using three commonly used prediction algorithms: miRanda, TargetScan and PicTar. All three algorithms predicted that miR-141 targets the 3'UTR of SIK1. Subsequent experiments not only confirmed this prediction, but also showed that miR-141 was associated with the progression of this disease. Finally, we found that miR-141 promoted proliferation of EG cells, whereas silencing miR-141 restored SIK1 expression and inhibited the proliferation of the HEY cells. Elucidating the molecular mechanism of ovarian cancer not only enables us to further understand the pathogenesis and progression of the disease, but also provides new targets for effective therapies.

The Impact of Increased Bladder Blood Flow on Storage Symptoms after Holmium Laser Enucleation of the Prostate.

Directory of Open Access Journals (Sweden)

Keisuke Saito

Full Text Available In order to investigate how holmium laser enucleation of the prostate (HoLEP improves urinary storage symptoms, we assessed blood flow in the urinary bladder mucosa of patients with benign prostatic hyperplasia (BPH before and after laser surgery. Seventy-four consecutive patients with BPH (median age 69 years, range; 53-88 underwent HoLEP at our institution and are included in this study. We prospectively assessed the International Prostate Symptom Score (IPSS, IPSS-QOL Score, the Overactive Bladder Symptom Score (OABSS, uroflowmetry, and blood flow in the urinary bladder, before and after surgery. Blood flow in the bladder mucosa was measured using the OMEGA FLOW (OMEGAWAVE, Tokyo, Japan laser Doppler flowmeter. The median volume of the enucleated adenomas was 45.0 g (range: 25.0 to 83.2. The median IPSS improved significantly from 20 (range: 6-35 to 3 (0-22 (p < 0.001; Wilcoxon signed-rank test, as did the storage symptoms score, which decreased from 13 (2-20 to 3 (1-8 (p < 0.001. Median bladder blood flow increased at the trigone from 9.57 ± 0.83 ml/sec to 17.60 ± 1.08 ml/sec. Multiple regression analysis for the improved storage symptom score eliminated all explanatory variables except increased bladder perfusion. The data suggest that HoLEP improves blood flow in the bladder mucosa, which independently leads to the improvement of storage symptoms.

The Impact of Increased Bladder Blood Flow on Storage Symptoms after Holmium Laser Enucleation of the Prostate

Science.gov (United States)

Ide, Hisamitsu; Aoki, Hiroaki; Muto, Satoru; Yamaguchi, Raizo; Tsujimura, Akira; Horie, Shigeo

2015-01-01

In order to investigate how holmium laser enucleation of the prostate (HoLEP) improves urinary storage symptoms, we assessed blood flow in the urinary bladder mucosa of patients with benign prostatic hyperplasia (BPH) before and after laser surgery. Seventy-four consecutive patients with BPH (median age 69 years, range; 53–88) underwent HoLEP at our institution and are included in this study. We prospectively assessed the International Prostate Symptom Score (IPSS), IPSS-QOL Score, the Overactive Bladder Symptom Score (OABSS), uroflowmetry, and blood flow in the urinary bladder, before and after surgery. Blood flow in the bladder mucosa was measured using the OMEGA FLOW (OMEGAWAVE, Tokyo, Japan) laser Doppler flowmeter. The median volume of the enucleated adenomas was 45.0 g (range: 25.0 to 83.2). The median IPSS improved significantly from 20 (range: 6–35) to 3 (0–22) (p<0.001; Wilcoxon signed-rank test), as did the storage symptoms score, which decreased from 13 (2–20) to 3 (1–8) (p<0.001). Median bladder blood flow increased at the trigone from 9.57±0.83 ml/sec to 17.60±1.08 ml/sec. Multiple regression analysis for the improved storage symptom score eliminated all explanatory variables except increased bladder perfusion. The data suggest that HoLEP improves blood flow in the bladder mucosa, which independently leads to the improvement of storage symptoms. PMID:26090819

Targeting of liver tumour in rats by selective delivery of holmium-166 loaded microspheres: a biodistribution study

Energy Technology Data Exchange (ETDEWEB)

Nijsen, F.; Rook, D.; Zonnenberg, B.; Klerk, J. de; Rijk, P. van; Schip, F. van het [Dept. of Nuclear Medicine, University Medical Center, Utrecht (Netherlands); Brandt, C. [Animal Inst., Utrecht Univ. (Netherlands); Meijer, R. [Dept. of Radiology, Univ. Medical Center, Utrecht (Netherlands); Dullens, H. [Dept. of Pathology, Univ. Medical Center, Utrecht (Netherlands); Hennink, W. [Dept. of Pharmaceutics, Utrecht Univ. (Netherlands)

2001-06-01

Intra-arterial administration of beta-emitting particles that become trapped in the vascular bed of a tumour and remain there while delivering high doses, represents a unique approach in the treatment of both primary and metastatic liver tumours. Studies on selective internal radiation therapy of colorectal liver metastases using yttrium-90 glass microspheres have shown encouraging results. This study describes the biodistribution of 40-{mu}m poly lactic acid microspheres loaded with radioactive holmium-166, after intra-arterial administration into the hepatic artery of rats with implanted liver tumours. Radioactivity measurements showed >95% retention of injected activity in the liver and its resident tumour. The average activity detected in other tissues was {<=}0.1%ID/g, with incidental exceptions in the lungs and stomach. Very little {sup 166}Ho activity was detected in kidneys (<0.1%ID/g), thereby indicating the stability of the microspheres in vivo. Tumour targeting was very effective, with a mean tumour to liver ratio of 6.1{+-}2.9 for rats with tumour (n=15) versus 0.7{+-}0.5 for control rats (n=6; P<0.001). These ratios were not significantly affected by the use of adrenaline. Histological analysis showed that five times as many large (>10) and medium-sized (4-9) clusters of microspheres were present within tumour and peritumoural tissue, compared with normal liver. Single microspheres were equally dispersed throughout the tumour, as well as normal liver parenchyma. (orig.)

Has modernization gone too far? Happiness and modernity in 141 contemporary nations

NARCIS (Netherlands)

R. Veenhoven (Ruut); M.C. Berg (Maarten)

2013-01-01

textabstractModern society comes in for a great deal of criticism, such as about increasing individualisation, globalisation and technologisation, which is seen to reduce the quality of life. This claim was investigated in a comparative study of 141 present-day countries. Eight aspects of modernity

Effects of Intraluminal Irradiation with Holmium-166 for TIPS Stenosis: Experimental Study in a Swine Model

Energy Technology Data Exchange (ETDEWEB)

Park, Ji Seon; Oh, Joo Hyeong; Kim, Deog Yoon; Park, Yong Koo; Kim, Soo Joong [Kyung Hee University Medical Center, Seoul (Korea, Republic of); Park, Sang Joon [Kang Dong Sacred Heart Hospital, Hallym University, Seoul (Korea, Republic of)

2007-04-15

We wanted to evaluate the effectiveness of intraluminal irradiation with Holmium-166 ({sup 166}Ho) for reducing the pseudointimal hyperplasia (PIH) in the transjugular intrahepatic portosystemic shunt (TIPS) tract in a swine model. TIPS was performed in 12 domestic pigs, after the creation of portal hypertension by intraportal injection of a mixture of N-butyl-2- cyanoacrylate (NBCA) and lipiodol. Five pigs first underwent intraluminal irradiation (30 Gy) in the parenchymal tract with using a {sup 166}Ho solution-filled balloon catheter, and this was followed by the placement of a nitinol stent in the TIPS tract. For the seven control pigs, the balloon was filled with saline and contrast media mixture. Two weeks later, follow-up portography and histological analysis were performed. TIPS was successfully performed in all twelve pigs with achieving artificially induced portal hypertension. Portography performed two weeks after TIPS showed the patent tracts in the TIPS tracts that were irradiated with {sup 166}Ho (5/5, 100%), whereas either completely (5/6, 83.3%) or partially (1/6, 16.7%) occluded TIPS were seen in the seven pigs of the nonirradiated control group, except in one pig that experienced periprocedural death due to bleeding. Histological analysis showed a statistically significant difference for the maximal PIH (irradiated: 32.8%, nonirradiated: 76.0%, p < 0.001) between the two groups. Intraluminal irradiation with 30 Gy of {sup 166}Ho for TIPS significantly improved the TIPS patency in a swine model of portal hypertension during a 2- week period of follow-up.

EpiNet : Revue électronique de l'EPI, Année 2012, n° 141-150

OpenAIRE

Archambault, Jean-Pierre

2012-01-01

Accès aux articles et documents dans le fichier attaché index.html. EPI, Archambault, J.-P. (2012). Éditorial : Une commission de l'Académie des Sciences sur l'enseignement de l'informatique. EpiNet : Revue électronique de l'EPI (Enseignement Public & Informatique), jan. 2012, (141). a1201a Archambault, J.-P. (2012). Au bout de dix ans de pratique du B2i, nous constatons un échec. EpiNet : Revue électronique de l'EPI (Enseignement Public & Informatique), jan. 2012, (141). a1201b Karsenti, ...

Radiative β-decay in 141Ce

International Nuclear Information System (INIS)

Rao, K.S.G.; Sanjeeviah, H.

1982-01-01

The spectral distribution of the continuous gamma radiation accompanying non-unique first forbidden β-decay of 32 d 141 Ce has been measured in the energy range 200-560 keV with a 4.5 cm x 5.08 cm NaI(Tl) scintillation spectrometer. The source electrons were eliminated using an electromagnet. The raw spectrum was corrected for pile-up, finite energy resolution, Compton electron distribution and geometrical γ-detection efficiency using the method of Liden and Starfelt. The corrected distribution is compared with the direct and detour theories of Lewis and Ford, and Ford and Martin, respectively. Total disagreement between experiment and theory was observed over the entire region of the investigated spectrum. In the energy region from 200 to 350 keV, however, the measured spectrum lies between the direct and detour theories. (orig.)

Genome Sequence of Bacillus velezensis S141, a New Strain of Plant Growth-Promoting Rhizobacterium Isolated from Soybean Rhizosphere.

Science.gov (United States)

Sibponkrung, Surachat; Kondo, Takahiko; Tanaka, Kosei; Tittabutr, Panlada; Boonkerd, Nantakorn; Teaumroong, Neung; Yoshida, Ken-Ichi

2017-11-30

Bacillus velezensis strain S141 is a plant growth-promoting rhizobacterium isolated from soybean ( Glycine max ) rhizosphere that enhances soybean growth, nodulation, and N 2 fixation efficiency by coinoculation with Bradyrhizobium diazoefficiens USDA110. The S141 genome was identified to comprise a 3,974,582-bp-long circular DNA sequence encoding at least 3,817 proteins. Copyright © 2017 Sibponkrung et al.

Association between the DRD2-141C Insertion/Deletion polymorphism and schizophrenia Associação entre o polimorfismo -141C Ins/Del do gene do DRD2 e esquizofrenia

Directory of Open Access Journals (Sweden)

Quirino Cordeiro

2009-06-01

Full Text Available Epidemiological studies have demonstrated that the genetic component is an important risk factor for the development of schizophrenia. The genes that codify the different compounds of the dopaminergic system have created interest for molecular investigations in patients with schizophrenia because the antipsychotic drugs, especially those of first generation, act on this cerebral system. Thus the aim of the present study was to investigate the possible association between the -141 Ins/Del (rs1799732 polymorphism of the dopamine receptor type 2 (DRD2 and schizophrenia. The distribution of the alleles and genotypes of the studied polymorphism was investigated in a sample of 229 patients and 733 controls. There were statistical differences in the allelic (χ2=9.78; p=0.001 and genotypic genotypic (χ2=12.74; p=0.001 distributions between patients and controls. Thus the -141C Ins/Del polymorphism of the DRD2 gene (allele Ins was associated to the SCZ phenotype in the investigated sample.Estudos epidemiológicos têm demonstrado que o componente genético é um importante fator de risco para o desenvolvimento de esquizofrenia. Os genes que codificam os diferentes componentes do sistema dopaminérgico passaram a despertar interesse para os estudos moleculares em pacientes com esquizofrenia, devido ao fato dos antipsicóticos, em especial os de primeira geração, exercerem sua ação nesse sistema. Assim, o objetivo do presente estudo foi investigar a possível associação entre polimorfismo -141C Ins/Del (rs1799732 do gene do receptor dopaminérgico tipo 2 (DRD2 e esquizofrenia. Um total de 229 pacientes e 733 controles pareados para sexo e idade foi selecionado com o objetivo de investigar a distribuição dos alelos e genótipos do polimorfismo investigado entre os grupos de pacientes e controles. Houve diferença estatisticamente significante nas distribuições alélica (χ2=9,78; p=0,001 e genotípica (χ2=12,74; p=0,001 entre pacientes e

40 CFR 261.141 - Definitions of terms as used in this subpart.

Science.gov (United States)

2010-07-01

...) SOLID WASTES (CONTINUED) IDENTIFICATION AND LISTING OF HAZARDOUS WASTE Financial Requirements for Management of Excluded Hazardous Secondary Materials § 261.141 Definitions of terms as used in this subpart... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Definitions of terms as used in this...

14 CFR Appendix E to Part 141 - Airline Transport Pilot Certification Course

Science.gov (United States)

2010-01-01

... which the course applies. (b) Each student must demonstrate satisfactory proficiency prior to receiving... TRANSPORTATION (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. E Appendix E to... procedures. 5. Stage checks and end-of-course tests. (a) Each student enrolled in an airline transport pilot...

Use of /sup 141/Ce as a particulate digesta flow tracer in ruminants. II. Behavior of the tracer at the duodenum and in the feces

Energy Technology Data Exchange (ETDEWEB)

Poncet, C [INRA Centre de Recherches Zootechniques et Veterinaires, Theix, 63 - Beaumont (France)

1976-01-01

A ration of 600 g chopped hay and 150 g ground sorghum is given twice daily to sheep fitted with a rumen cannula and a duodenal reentrant cannula. /sup 141/Ce flow rate at the duodenum and in the feces is compared to flow rate of stained hay particles after ingestion of a single labelled meal. After an adaptation period during which both daily meals are labelled, variations in /sup 141/Ce concentration are then measured in the duodenal and fecal dry matter. The tracer is used to estimate dry mater digestibility indirectly. Duodenal data show that the mean retention time of /sup 141/Ce in the rumen is about 15% less than that of stained particles. The meal after the radioactive one momentarily depresses /sup 141/Ce excretion rate while it accelerates that of the stained particles. Mean retention time in the whole gastro-intestinal tract of a meal of 600 g chopped hay 150 g ground sorghum is 40.4+-3.8 h or 32.4+-3.7 h, depending on whether stained particles or /sup 141/Ce is used. All the /sup 141/Ce ingested is recovered in the feces. Mean recovery of /sup 141/Ce in the feces excreted during 200 hours after dosage is 100.2+-5.0%. After a period of adaptation where all meals are radioactive, feces of 2 sheep are sampled either by total collection or directly in the rectum. Dry matter digestibility does not differ whether calculated from total collection or by the indirect method using /sup 141/Ce.

Expanding rare-earth oxidation state chemistry to molecular complexes of holmium(II) and erbium(II).

Science.gov (United States)

MacDonald, Matthew R; Bates, Jefferson E; Fieser, Megan E; Ziller, Joseph W; Furche, Filipp; Evans, William J

2012-05-23

The first molecular complexes of holmium and erbium in the +2 oxidation state have been generated by reducing Cp'(3)Ln [Cp' = C(5)H(4)SiMe(3); Ln = Ho (1), Er (2)] with KC(8) in the presence of 18-crown-6 in Et(2)O at -35 °C under argon. Purification and crystallization below -35 °C gave isomorphous [(18-crown-6)K][Cp'(3)Ln] [Ln = Ho (3), Er (4)]. The three Cp' ring centroids define a trigonal-planar geometry around each metal ion that is not perturbed by the location of the potassium crown cation near one ring with K-C(Cp') distances of 3.053(8)-3.078(2) Å. The metrical parameters of the three rings are indistinguishable within the error limits. In contrast to Ln(2+) complexes of Eu, Yb, Sm, Tm, Dy, and Nd, 3 and 4 have average Ln-(Cp' ring centroid) distances only 0.029 and 0.021 Å longer than those of the Ln(3+) analogues 1 and 2, a result similar to that previously reported for the 4d(1) Y(2+) complex [(18-crown-6)K][Cp'(3)Y] (5) and the 5d(1) La(2+) complex [K(18-crown-6)(Et(2)O)][Cp″(3)La] [Cp″ = 1,3-(Me(3)Si)(2)C(5)H(3)]. Surprisingly, the UV-vis spectra of 3 and 4 are also very similar to that of 5 with two broad absorptions in the visible region, suggesting that 3-5 have similar electron configurations. Density functional theory calculations on the Ho(2+) and Er(2+) species yielded HOMOs that are largely 5d(z(2)) in character and supportive of 4f(10)5d(1) and 4f(11)5d(1) ground-state configurations, respectively.

Gamma spectrometry and chemical characterization of bioactive glass seeds with Holmium-166 for oncological implants

International Nuclear Information System (INIS)

Valente, Eduardo S.

2009-01-01

Bioactive glass seeds synthesized by the sol-gel technique with Si:Ho:Ca composition with natural holmium incorporated were irradiated in the TRIGA type nuclear reactor IPR-R1 at 100kW, in the central thimble where the thermal neutron flux is 2.8x10 12 n/cm 2 .s and the epithermal neutron flux is 2.6 X 10 11 n/cm 2 .s . After an 8 hour irradiation time, with an induced activity close to 110MBq/seed, a set of seeds was submitted to Gamma Spectrometry Analysis in a counting system with an HPGe detector, ORTEC electronic instrumentation and a Camberra Multichannel Analyser, to determine all radionuclides present on the sample as well as its individual activities. Special attention was paid on the discrimination of Si, 40 Ca, 44 Ca, C and Ho as the other expected elements like 48 Ca, 2 H and 18 O were present in traces or have very short half-lives. The second sample was submitted to Plasma spectrometry to determine the 166 Ho concentration in weight. The third sample was submitted to an X-ray spectrometry in a JEOL-JXA-8900RL equipment to determine its qualitative chemical composition, in order to evaluate impurities and nominal composition. It was determined that most of the activity, after decaying of short half-life elements, was due to 166 Ho present on the sample, with a well characterized β and gamma spectra. The homogeneity of the seeds was tested on the X-ray spectrometry, and verified that there is no discrepancy in composition from distinct seeds or in a same seed. The results are relevant on the investigation of the viability of producing 166 Ho radioactive seeds for oncological implants. (author)

Activity coefficients in (hydrogen chloride+holmium chloride) (aq) from T=(278.15 to 328.15) K

International Nuclear Information System (INIS)

Roy, Rabindra N.; Roy, Lakshmi N.; Tabor, Bennett J.; Richards, Sarah J.; Cummins, Mason P.; Himes, Curtis A.; Gibbs, Stephanie N.; Christiansen, Edward B.

2005-01-01

Activity coefficients of HCl in (hydrogen chloride+holmium chloride) (aq) have been calculated from the observed e.m.f.s using the Nernst equation. The temperatures ranged from (278.15 to 328.15) K at 5 K intervals and at constant total ionic strengths of (0.01, 0.025, 0.05, 0.1, 0.25, 0.5, 1.0, and 1.5) mol.kg -1 . Electromotive-force measurements were made on the cell without liquid junction of the type:Pt vertical bar H 2 (g,p=101.325kPa) vertical bar HCl(m A ),HoCl 3 (m B ) vertical bar AgCl(s), vertical bar Ag(s) The results of the activity coefficients of HCl for this mixed electrolyte mixture have been interpreted in terms of the simpler Harned's equations and the ion-interaction model of Pitzer. Results show that the quadratic term is sufficient for the full range of Y B (the ionic strength fraction of the salt) to 0.9 at all the ionic strengths studied. The Pitzer's mixing parameters S θH,Ho and Ψ H,Ho,Cl (including higher order electrostatic effects) and θ H,Ho and Ψ H,Ho,Cl (excluding higher order electrostatic effects) have been determined. These values at T=298.15 K are: S θH , Ho =0.115, Ψ H,Ho,Cl =-.071; and θ H,Ho =-.663, Ψ H,Ho,Cl =0.165. The parameters obtained in this study reproduce the activity coefficients of HCl in the mixtures within 0.015 over the entire range of ionic strengths and within 0.009 for I>=0.05 mol.kg -1 over the entire temperature range

Combined retrograde flexible ureteroscopic lithotripsy with holmium YAG laser for renal calculi associated with ipsilateral ureteral stones.

Science.gov (United States)

Cocuzza, Marcello; Colombo, Jose R; Ganpule, Arvind; Turna, Burak; Cocuzza, Antonio; Dhawan, Divyar; Santos, Bruno; Mazzucchi, Eduardo; Srougi, Miguel; Desai, Mahesh; Desai, Mihir

2009-02-01

The purpose of this study was to evaluate the effectiveness of combined ureteroscopic holmium YAG lithotripsy for renal calculi associated with ipsilateral ureteral stones. Between August 2002 and March 2007, retrograde flexible ureteroscopic stone treatment was attempted in 351 cases. Indication for treatment was concurrent symptomatic ureteral stones in 63 patients (group I). Additional operative time and perioperative complication rates were compared to a group of 39 patients submitted to ureteroscopic treatment for ureteral calculi exclusively (group II). Mean ureteral stone size was 8.0 +/- 2.6 mm and 8.1 +/- 3.4 mm for groups I and II, respectively. Mean operative time for group I was 67.9 +/- 29.5 minutes and for group 2 was 49.3 +/- 13.2 minutes (p stone size was 10.7 +/- 6.4 mm, overall stone free rate in group I was 81%. However, considering only patients with renal stones smaller than 15 mm, the stone free rate was 88%. Successful treatment occurred in 81% of patients presenting lower pole stones, but only 76% of patients with multiple renal stones became stone free. As expected, stone free rate showed a significant negative correlation with renal stone size (p = 0.03; r = -0.36). Logistic regression model indicated an independent association of renal stones smaller than 15 mm and stone free rate (OR = 13.5; p = 0.01). Combined ureteroscopic treatment for ureteral and ipsilateral renal calculi is a safe and attractive option for patients presenting for symptomatic ureteral stone and ipsilateral renal calculi smaller than 15 mm.

Initial Clinical Experience with a Modulated Holmium Laser Pulse—Moses Technology: Does It Enhance Laser Lithotripsy Efficacy?

Directory of Open Access Journals (Sweden)

Michael Mullerad

2017-10-01

Full Text Available Objective The Lumenis® High-power Holmium Laser (120H has a unique modulated pulse mode, Moses™ technology. Moses technology modulates the laser pulse to separate the water (vapor bubble, then deliver the remaining energy through the bubble. Proprietary laser fibers were designed for the Moses technology. Our aim was to compare stone lithotripsy with and without the Moses technology. Methods We designed a questionnaire for the urologist to fill immediately after each ureteroscopy in which the Lumenis 120H was used. We compared procedures with (n=23 and without (n=11 the use of Moses technology. Surgeons ranked the Moses technology in 23 procedures, in comparison to regular lithotripsy (worse, equivalent, better, much better. Laser working time and energy use were collected from the Lumenis 120H log. Results During 4 months, five urologists used the Lumenis 120H in 34 ureteroscopy procedures (19 kidney stones, 15 ureteral stones; 22 procedures with a flexible ureteroscope, and 12 with a semi-rigid ureteroscope. Three urologists ranked Moses technology as much better or better in 17 procedures. In 2 cases, it was ranked equivalent, and in 4 cases ranking was not done. Overall, laser lithotripsy with Moses technology utilized laser energy in less time to achieve a satisfying stone fragmentation rate of 95.8 mm3/min versus 58.1 mm3/min, P=0.19. However, this did not reach statistical significance. Conclusion The new Moses laser technology demonstrated good stone fragmentation capabilities when used in everyday clinical practice.

L-3-n-Butylphthalide Protects HSPB8 K141N Mutation-Induced Oxidative Stress by Modulating the Mitochondrial Apoptotic and Nrf2 Pathways

Directory of Open Access Journals (Sweden)

Xiao-Dong Yang

2017-07-01

Full Text Available Charcot–Marie–Tooth disease (CMT, also known as hereditary motor and sensory neuropathy, is the most common inherited peripheral nerve disorder. Missense mutations, such as K141N, in the small heat shock protein HSPB8 are known to cause distal hereditary motor neuropathy 2A (dHMN2A or Charcot-Marie-Tooth neuropathy type 2L (CMT2L. However, of critical clinical significance, very few specific therapies for this disease exist. In the present study, we investigated the impact of mutant K141N HSPB8 on mitochondrial distribution and function in a cellular model of CMT2L. Our results indicate that K141N HSPB8 induced mitochondrial aggregation and caused increased oxidative stress injury. As an extraction from Chinese celery Apium graveolens Linn seeds, L-3-n-Butylphthalide (NBP, has been reported to exert many neuroprotective effects, we interrogated whether NBP could elicit a protective effect on the cell injury typically caused by HSPB8 K141N mutations. We found NBP could reverse the pathological processes induced by HSPB8 K141N mutation via an antioxidant effect, modulation of the Bax/Bcl-2 mitochondrial apoptotic and Nrf2 pathways. We propose a novel function of HSPB8, highlighting the consequence of the K141N pathogenic mutation. Furthermore, we suggest NBP may have promising therapeutic potential in the treatment of CMT2L.

Determinants of holmium:yttrium-aluminum-garnet laser time and energy during ureteroscopic laser lithotripsy.

Science.gov (United States)

Molina, Wilson R; Marchini, Giovanni S; Pompeo, Alexandre; Sehrt, David; Kim, Fernando J; Monga, Manoj

2014-04-01

To evaluate the association of preoperative noncontrast computed tomography stone characteristics, laser settings, and stone composition with cumulative holmium:yttrium-aluminum-garnet (Ho:YAG) laser time/energy. We retrospectively reviewed patients who underwent semirigid/flexible ureteroscopy and Ho:YAG laser lithotripsy (200 or 365 μm laser fiber; 0.8-1.0 J energy; and 8-10 Hz rate) at 2 tertiary care centers (April 2010-May 2012). Studied parameters were as follows: patient's characteristics; stone characteristics (location, burden, hardness, and composition); total laser time and energy; and surgical outcomes. One hundred patients met our inclusion criteria. Mean stone size was 1.01 ± 0.42 cm and volume 0.33 ± 0.04 cm(3). Mean stone radiodensity was 990 ± 296 HU, and Hounsfield units density 13.8 ± 6.0 HU/mm. All patients were considered stone free. Stone size and volume had a significant positive correlation with laser energy (R = 0.516, P R = 0.621, P R = 0.477, P R = 0.567, P stone size, only the correlation between HU and laser time was significant (R = 0.262, P = .011). In the multivariate analysis, with exception of stone composition (P = .103), all parameters significantly increased laser energy (R(2) = 0.524). Multivariate analysis revealed a positive significant association of laser time with stone volume (P R(2) = 0.512). In multivariate analysis for laser energy, only calcium phosphate stones required less energy to fragment compared with uric acid stones. No significant differences were found in the multivariate laser time model. Ho:YAG laser cumulative energy and total time are significantly affected by stone dimensions, hardness location, fiber size, and power. Kidney location, laser fiber size, and laser power have more influence on the final laser energy than on the total laser time. Calcium phosphate stones require less laser energy to fragment. Copyright © 2014 Elsevier Inc. All rights reserved.

Pb(n,2n) cross section at 14.1 MeV

International Nuclear Information System (INIS)

Zhou Delin

1991-01-01

Pb is a potential candidate for the neutron multiplier of the fusion reactor, so its (n, 2n) cross section at 14 MeV is of importance. This work is carried out to get a new evaluation of Pb (n,2n) cross section at 14.1 MeV for checking the angle-integrated neutron emission cross section. The equal weight averaged value 2252 +- 40 Mb is adopted in the evaluation

Preparation of Na4UO2(CO3)3 in presence of Ce-141. I, Influence of the post-reaction time in the concentration of anion species of Ce-141

International Nuclear Information System (INIS)

Lopez M, B.E.; Rodriguez S, A.; Iturbe G, J.L.

1991-10-01

An effective condition to minimize the presence of Ce-141, in the final product of recovery like hexa hydrated uranyl nitrate has been obtained. It is considered to this condition like a pre purification stage in the recovery process of the non-fissioned residual uranium in the fission production of Mo-99. (Author)

Paeonol Suppresses Chondrosarcoma Metastasis through Up-Regulation of miR-141 by Modulating PKCδ and c-Src Signaling Pathway

Science.gov (United States)

Horng, Chi-Ting; Shieh, Po-Chuen; Tan, Tzu-Wei; Yang, Wei-Hung; Tang, Chih-Hsin

2014-01-01

Chondrosarcoma, a primary malignant bone cancer, has potential for local invasion and distant metastasis, especially to the lungs. Patients diagnosed with it show poor prognosis. Paeonol (2'-hydroxy-4'-methoxyacetophenone), the main active compound of traditional Chinese remedy Paeonia lactiflora Pallas, exhibits anti-inflammatory and anti-tumor activity; whether paeonol regulates metastatic chondrosarcoma is largely unknown. Here, we find paeonol do not increase apoptosis. By contrast, at non-cytotoxic concentrations, paeonol suppresses migration and invasion of chondrosarcoma cells. We also demonstrate paeonol enhancing miR-141 expression and miR-141 inhibitor reversing paeonol-inhibited cell motility; paeonol also reduces protein kinase C (PKC)δ and c-Src kinase activity. Since paeonol inhibits migration and invasion of human chondrosarcoma via up-regulation of miR-141 via PKCδ and c-Src pathways, it thus might be a novel anti-metastasis agent for treatment of metastatic chondrosarcoma. PMID:24992595

40 CFR 141.561 - What happens if my system's turbidity monitoring equipment fails?

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false What happens if my system's turbidity... Disinfection-Systems Serving Fewer Than 10,000 People Individual Filter Turbidity Requirements § 141.561 What happens if my system's turbidity monitoring equipment fails? If there is a failure in the continuous...

Craniopharyngioma: a clinicopathological study of 141 cases.

Science.gov (United States)

Tavangar, Seyed Mohammad; Larijani, Bagher; Mahta, Ali; Hosseini, Seyed Mehdi Abdolahzadeh; Mehrazine, Masoud; Bandarian, Fatemeh

2004-01-01

Craniopharyngioma is a tumor of the suprasellar region that histologically has two distinct variants with some differences in clinical behavior. The papillary type is almost always seen in adults and has a more indolent course compared with the adamantinomatous type, which is more common in childhood. In the present study, surgical specimens of craniopharyngiomas from 141 patients were reviewed. Their histomorphologic types were determined and the clinical features and prognosis of each group were assessed. The sizes of papillary type tumors were smaller and during the follow-up period there was no recurrence in the squamous papillary group. Aside from surgical resection (total vs subtotal), the recurrence rate for papillary type craniopharyngioma was lower than for adamantinomatous type. Histologic typing of craniopharyngioma especially in adults is useful for decision making with regard to treatment and follow-up.

Activity coefficients in (hydrogen chloride+holmium chloride) (aq) from T=(278.15 to 328.15) K

Energy Technology Data Exchange (ETDEWEB)

Roy, Rabindra N. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States)]. E-mail: rroy@drury.edu; Roy, Lakshmi N. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Tabor, Bennett J. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Richards, Sarah J. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Cummins, Mason P. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Himes, Curtis A. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Gibbs, Stephanie N. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Christiansen, Edward B. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States)

2005-07-15

Activity coefficients of HCl in (hydrogen chloride+holmium chloride) (aq) have been calculated from the observed e.m.f.s using the Nernst equation. The temperatures ranged from (278.15 to 328.15) K at 5 K intervals and at constant total ionic strengths of (0.01, 0.025, 0.05, 0.1, 0.25, 0.5, 1.0, and 1.5) mol.kg{sup -1}. Electromotive-force measurements were made on the cell without liquid junction of the type:Pt vertical bar H{sub 2}(g,p=101.325kPa) vertical bar HCl(m{sub A}),HoCl{sub 3}(m{sub B}) vertical bar AgCl(s), vertical bar Ag(s) The results of the activity coefficients of HCl for this mixed electrolyte mixture have been interpreted in terms of the simpler Harned's equations and the ion-interaction model of Pitzer. Results show that the quadratic term is sufficient for the full range of Y{sub B} (the ionic strength fraction of the salt) to 0.9 at all the ionic strengths studied. The Pitzer's mixing parameters S{sub {theta}}{sub H,Ho} and {psi}{sub H,Ho,Cl} (including higher order electrostatic effects) and {theta}{sub H,Ho} and {psi}{sub H,Ho,Cl} (excluding higher order electrostatic effects) have been determined. These values at T=298.15 K are: S{sub {theta}}{sub H},{sub Ho}=0.115, {psi}{sub H,Ho,Cl}=-.071; and {theta}{sub H,Ho}=-.663, {psi}{sub H,Ho,Cl}=0.165. The parameters obtained in this study reproduce the activity coefficients of HCl in the mixtures within 0.015 over the entire range of ionic strengths and within 0.009 for I>=0.05 mol.kg{sup -1} over the entire temperature range.

Co-existence of t(6;13)(p21;q14.1) and trisomy 12 in chronic lymphocytic leukemia.

Science.gov (United States)

de Oliveira, Fábio Morato; de Figueiredo Pontes, Lorena Lobo; Bassi, Sarah Cristina; Dalmazzo, Leandro Felipe Figueiredo; Falcão, Roberto Passetto

2012-06-01

We report a case of a 57-year-old man diagnosed with chronic lymphocytic leukemia (CLL) and presence of a rare t(6;13)(p21;q14.1) in association with an extra copy of chromosome 12. Classical cytogenetic analysis using the immunostimulatory combination of DSP30 and IL-2 showed the karyotype 47,XY,t(6;13)(p21;q14.1), +12 in 75% of the metaphase cells. Spectral karyotype analysis (SKY) confirmed the abnormality previously seen by G-banding. Additionally, interphase fluorescence in situ hybridization using an LSI CEP 12 probe performed on peripheral blood cells without any stimulant agent showed trisomy of chromosome 12 in 67% of analyzed cells (134/200). To the best of our knowledge, the association of t(6;13)(p21;q14.1) and +12 in CLL has never been described. The prognostic significance of these new findings in CLL remains to be elucidated. However, the patient has been followed up since 2009 without any therapeutic intervention and has so far remained stable.

Measured neutron carbon kerma factors from 14.1 MeV to 18 MeV

International Nuclear Information System (INIS)

Deluca, P.M.; Barschall, H.H.; McDonald, J.C.

1985-01-01

For A-150 tissue-equivalent plastic, the total neutron kerma is dominated by the hydrogen kerma. Tissue kerma is inferred with reasonable accuracy by normalization to the kerma factor ratio between tissue and A-150 plastic. Because of the close match in the hydrogen abundance in these materials, the principal uncertainty is due to the kerma factors of carbon and oxygen. We have measured carbon kerma factor values of 0.183+-0.015 10 -8 cGy cm 2 and 0.210+-0.016 10 -8 cGy cm 2 at 14.1-MeV and 15-MeV neutron energy, respectively. A preliminary value of 0.297+-0.03 10 -8 cGy cm 2 has been determined at 17.9 MeV. A recent microscopic cross section measurement of the (n,n'3α) reaction in carbon at 14.1-MeV energy gives a kerma factor of 0.184+-0.019 10 -8 cGy cm 2 in agreement with the present result

40 CFR 141.135 - Treatment technique for control of disinfection byproduct (DBP) precursors.

Science.gov (United States)

2010-07-01

...), is less than 4.0 mg/L, calculated quarterly as a running annual average; the source water alkalinity... treated water alkalinity to less than 60 mg/L (as CaCO3), measured monthly according to § 141.131(d)(1... Step 1 TOC reductions in the far-right column (Source water alkalinity >120 mg/L) for the specified...

Preparation of Na{sub 4}UO{sub 2}(CO{sub 3}){sub 3} in presence of Ce-141. I, Influence of the post-reaction time in the concentration of anion species of Ce-141; Preparacion del Na{sub 4}UO{sub 2}(CO{sub 3}){sub 3} en presencia de Ce-141. I, Influencia del tiempo de post-reaccion en la concentracion de especies anionicas de Ce-141

Energy Technology Data Exchange (ETDEWEB)

Lopez M, B.E.; Rodriguez S, A.; Iturbe G, J.L

1991-10-15

An effective condition to minimize the presence of Ce-141, in the final product of recovery like hexa hydrated uranyl nitrate has been obtained. It is considered to this condition like a pre purification stage in the recovery process of the non-fissioned residual uranium in the fission production of Mo-99. (Author)

Human CD141+ Dendritic Cell and CD1c+ Dendritic Cell Undergo Concordant Early Genetic Programming after Activation in Humanized Mice In Vivo

Directory of Open Access Journals (Sweden)

Yoshihito Minoda

2017-10-01

Full Text Available Human immune cell subsets develop in immunodeficient mice following reconstitution with human CD34+ hematopoietic stem cells. These “humanized” mice are useful models to study human immunology and human-tropic infections, autoimmunity, and cancer. However, some human immune cell subsets are unable to fully develop or acquire full functional capacity due to a lack of cross-reactivity of many growth factors and cytokines between species. Conventional dendritic cells (cDCs in mice are categorized into cDC1, which mediate T helper (Th1 and CD8+ T cell responses, and cDC2, which mediate Th2 and Th17 responses. The likely human equivalents are CD141+ DC and CD1c+ DC subsets for mouse cDC1 and cDC2, respectively, but the extent of any interspecies differences is poorly characterized. Here, we exploit the fact that human CD141+ DC and CD1c+ DC develop in humanized mice, to further explore their equivalency in vivo. Global transcriptome analysis of CD141+ DC and CD1c+ DC isolated from humanized mice demonstrated that they closely resemble those in human blood. Activation of DC subsets in vivo, with the TLR3 ligand poly I:C, and the TLR7/8 ligand R848 revealed that a core panel of genes consistent with DC maturation status were upregulated by both subsets. R848 specifically upregulated genes associated with Th17 responses by CD1c+ DC, while poly I:C upregulated IFN-λ genes specifically by CD141+ DC. MYCL expression, known to be essential for CD8+ T cell priming by mouse DC, was specifically induced in CD141+ DC after activation. Concomitantly, CD141+ DC were superior to CD1c+ DC in their ability to prime naïve antigen-specific CD8+ T cells. Thus, CD141+ DC and CD1c+ DC share a similar activation profiles in vivo but also have induce unique signatures that support specialized roles in CD8+ T cell priming and Th17 responses, respectively. In combination, these data demonstrate that humanized mice provide an attractive and tractable model to study

The PLAU P141L single nucleotide polymorphism is associated with collateral circulation in patients with coronary artery disease.

Science.gov (United States)

Duran, Joan; Sánchez-Olavarría, Pilar; Mola, Marina; Götzens, Víctor; Carballo, Julio; Martín-Pelegrina, Eva; Petit, Màrius; García Del Blanco, Bruno; García-Dorado, David; de Anta, Josep M

2014-07-01

Urokinase-type plasminogen activator, which is encoded by the PLAU gene, plays a prominent role during collateral arterial growth. We investigated whether the PLAU P141L (C > T) polymorphism, which causes a mutation in the kringle domain of the protein, is associated with coronary collateral circulation in a cohort of 676 patients with coronary artery disease. The polymorphism was genotyped in blood samples using a TaqMan-based genotyping assay, and collateral circulation was assessed by the Rentrop method. Multivariate logistic regression models adjusted by clinically relevant variables to estimate odds ratios were used to examine associations of PLAU P141L allelic variants and genotypes with collateral circulation. Patients with poor collateral circulation (Rentrop 0-1; n = 547) showed a higher frequency of the TT genotype than those with good collateral circulation (Rentrop 2-3; n = 129; P = .020). The T allele variant was also more common in patients with poor collateral circulation (P = .006). The odds ratio of having poorly developed collaterals in patients bearing the T allele (adjusted for clinically relevant variables) was statistically significant under the dominant model (odds ratio = 1.83 [95% confidence interval, 1.16-2.90]; P = .010) and the additive model (odds ratio = 1.73 [95% confidence interval, 1.14-2.62]; P = .009). An association was found between coronary collateral circulation and the PLAU P141L polymorphism. Patients with the 141L variant are at greater risk of developing poor coronary collateral circulation. Copyright © 2013 Sociedad Española de Cardiología. Published by Elsevier Espana. All rights reserved.

Serial Changes in Sexual Function Following Holmium Laser Enucleation of the Prostate: A Short-term Follow-up Study.

Science.gov (United States)

Jeong, Min Su; Ha, Seung Beom; Lee, Chang Ju; Cho, Min Chul; Kim, Soo Woong; Paick, Jae-Seung

2012-02-01

To evaluate the serial changes in sexual function in the short-term period after holmium laser enucleation of the prostate (HoLEP) for benign prostatic hyperplasia (BPH) and to investigate whether a change in each domain of the International Index of Erectile Function (IIEF) is associated with improvement of micturition. Thirty-eight potent men who underwent HoLEP and in whom complete 12-month follow-up data on the IIEF were available were included in this retrospective study. All patients underwent a baseline evaluation for BPH. The surgical outcome was evaluated at 1, 3, 6, and 12 months postoperatively by use of the International Prostate Symptom Score, IIEF, and uroflowmetry. The mean age and body mass index of the patients was 64.5±6.2 years and 24.2±2.6 kg/m(2), respectively. Mean total prostate volume and transitional zone volume were 48.8±18.8 ml and 24.2±16.1 ml, respectively. Most IIEF domain scores showed a slight decrease at 1, 3, and 6 months after surgery but recovered to the baseline or showed a marginal but nonsignificant increase at 12 months postoperatively compared with baseline. Orgasmic function and the overall sexual satisfaction domain score remained slightly reduced up to 12 months postoperatively. There was no significant correlation between improvement of micturition and change in sexual function throughout the follow-up period after surgery. Although HoLEP achieves significant improvements in micturition, overall sexual function decreases slightly in the early postoperative period, but recovers to the baseline at 12 months postoperatively. Our data suggest that changes in sexual function after HoLEP are not associated with improvement of micturition.

Pulsed liquid jet dissector using holmium: YAG laser - a novel neurosurgical device for brain incision without imparing vessels

International Nuclear Information System (INIS)

Hirano, T.; Nakagawa, A.; Jokura, H.; Shirane, R.; Uenohara, H.; Ohyama, H.; Takayama, K.

2003-01-01

Neurosurgery has long required a method for dissecting brain tissue without damaging principal vessels and adjacent tissue, so as to prevent neurological complications after operation. In this study we constructed a prototype of such a device and used it in an attempt to resect beagle brain cortex. The prototype device consisted of an optical fiber, a Y adapter, and a nozzle whose internal exit diameter was 100 μm. Cold physiological saline (4 o C) was supplied to it at a rate of 40 ml/h. Pulsed liquid jets were ejected from the nozzle by a pulsed Holmium:YAG) (Ho:YAG) laser at an irradiation energy of 300 mJ/pulse. The profile of the liquid jet was observed with a high-speed camera while changing the distance between the optical fiber end and nozzle exit (equivalent to the Standoff distance). With this device (3 Hz operation), brain dissection of anesthetized beagles was attempted while measuring the local temperature of the target. A histological study of the incised parts was also performed. When the Standoff distance was 24 mm, the liquid jet was emitted straight from the nozzle at a maximum initial velocity of 50 m/s. The brain parenchyma was cut with this device while preserving vessels larger than 200 μm in diameter and keeping the operative field clear. The local temperature rose to no more than 41 o C, below the functional heat damage threshold of brain tissue. Histological findings showed no signs of thermal tissue damage around the dissected margin. The Ho:YAG laser-induced liquid jet dissector can be applied to neurosurgery after incorporating some minor improvements. (author)

Proteus mirabilis viability after lithotripsy of struvite calculi

Science.gov (United States)

Prabakharan, Sabitha; Teichman, Joel M. H.; Spore, Scott S.; Sabanegh, Edmund; Glickman, Randolph D.; McLean, Robert J. C.

2000-05-01

Urinary calculi composed of struvite harbor urease-producing bacteria within the stone. The photothermal mechanism of holmium:YAG lithotripsy is uniquely different than other lithotripsy devices. We postulated that bacterial viability of struvite calculi would be less for calculi fragmented with holmium:YAG irradiation compared to other lithotripsy devices. Human calculi of known struvite composition (greater than 90% magnesium ammonium phosphate hexahydrate) were incubated with Proteus mirabilis. Calculi were fragmented with no lithotripsy (controls), or shock wave, intracorporeal ultrasonic, electrohydraulic, pneumatic, holmium:YAG or pulsed dye laser lithotripsy. After lithotripsy, stone fragments were sonicated and specimens were serially plated for 48 hours at 38 C. Bacterial counts and the rate of bacterial sterilization were compared. Median bacterial counts (colony forming units per ml) were 8 X 106 in controls and 3 X 106 in shock wave, 3 X 107 in ultrasonic, 4 X 105 in electrohydraulic, 8 X 106 in pneumatic, 5 X 104 in holmium:YAG and 1 X 106 in pulsed dye laser lithotripsy, p less than 0.001. The rate of bacterial sterilization was 50% for holmium:YAG lithotripsy treated stones versus 0% for each of the other cohorts, p less than 0.01. P. mirabilis viability is less after holmium:YAG irradiation compared to other lithotripsy devices.

De novo microdeletions of chromosome 6q14.1-q14.3 and 6q12.1-q14.1 in two patients with intellectual disability - further delineation of the 6q14 microdeletion syndrome and review of the literature

DEFF Research Database (Denmark)

Becker, Kerstin; Di Donato, Nataliya; Holder-Espinasse, Muriel

2012-01-01

with broad nasal tip, anteverted nares, long philtrum, and thin upper lip. In this study we describe two patients with overlapping 6q14 deletions presenting with developmental delay and characteristic dysmorphism. Molecular karyotyping using array CGH analysis revealed a de novo 8.9 Mb deletion at 6q14.1-q14.......3 and a de novo 11.3 Mb deletion at 6q12.1-6q14.1, respectively. We provide a review of the clinical features of twelve other patients with 6q14 deletions detected by array CGH analysis. By assessing all reported data we could not identify a single common region of deletion. Possible candidate genes in 6q14...

Effect of mass concentration of composite phase change material CA-DE on HCFC-141b hydrate induction time and system stability

Science.gov (United States)

Li, Juan; Sun, Zhigao; Liu, Chenggang; Zhu, Minggui

2018-03-01

HCFC-141b hydrate is a new type of environment-friendly cold storage medium which may be adopted to balance energy supply and demand, achieve peak load shifting and energy saving, wherein the hydrate induction time and system stability are key factors to promote and realize its application in industrial practice. Based on step cooling curve measurement, two kinds of aliphatic hydrocarbon organics, n-capric acid (CA) and lauryl alcohol (DE), were selected to form composite phase change material and to promote the generation of HCFC-141b hydrate. Five kinds of CA-DE mass concentration were chosen to compare the induction time and hydration system stability. In order to accelerate temperature reduction rate, the metal Cu with high heat conductivity performance was adopted to conduct out the heat generated during phase change. Instability index was introduced to appraise system stability. Experimental results show that phase change temperature and sub-cooling degree of CA-DE is 11.1°C and 3.0°C respectively, which means it is a preferable medium for HCFC-141b hydrate formation. For the experimental hydration systems, segmented emulsification is achieved by special titration manner to avoid rapid layering under static condition. Induction time can achieve up to 23.3min with the densest HCFC-141b hydrate and the lowest instability index, wherein CA-DE mass concentration is 3%.

Measured neutron carbon kerma factors from 14.1 MeV to 18 MeV

International Nuclear Information System (INIS)

Deluca, P.M. Jr.; Barschall, H.H.; Haight, R.C.; McDonald, J.C.

1984-01-01

For A-150 tissue-equivalent plastic, the total neutron kerma is dominated by the hydrogen kerma. Tissue kerma is inferred with reasonable accuracy by normalization to the kerma factor ratio between tissue and A-150 plastic. Because of the close match in the hydrogen abundance in these materials, the principal uncertainty is due to the kerma factors of carbon and oxygen. We have measured carbon kerma factor values of 0.183 +- 0.015 10 -8 cGy cm 2 and 0.210 +- 0.16 10 -8 cGy cm 2 at 14.1-MeV and 15-MeV neutron energy, respectively. A preliminary value of 0.297 +- 0.03 10 -8 cGy cm 2 has been determined at 17.9 MeV. A recent microscopic cross section measurement of the (n,n'3α) reaction in carbon at 14.1-MeV energy gives a kerma factor of 0.184 +- 0.019 10 8 cGy cm 2 in agreement with the present result. 9 refs., 4 figs., 2 tabs

MicroRNA-200c-141 and ∆Np63 are required for breast epithelial differentiation and branching morphogenesis.

Science.gov (United States)

Hilmarsdóttir, Bylgja; Briem, Eirikur; Sigurdsson, Valgardur; Franzdóttir, Sigrídur Rut; Ringnér, Markus; Arason, Ari Jon; Bergthorsson, Jon Thor; Magnusson, Magnus Karl; Gudjonsson, Thorarinn

2015-07-15

The epithelial compartment of the breast contains two lineages, the luminal- and the myoepithelial cells. D492 is a breast epithelial cell line with stem cell properties that forms branching epithelial structures in 3D culture with both luminal- and myoepithelial differentiation. We have recently shown that D492 undergo epithelial to mesenchymal transition (EMT) when co-cultured with endothelial cells. This 3D co-culture model allows critical analysis of breast epithelial lineage development and EMT. In this study, we compared the microRNA (miR) expression profiles for D492 and its mesenchymal-derivative D492M. Suppression of the miR-200 family in D492M was among the most profound changes observed. Exogenous expression of miR-200c-141 in D492M reversed the EMT phenotype resulting in gain of luminal but not myoepithelial differentiation. In contrast, forced expression of ∆Np63 in D492M restored the myoepithelial phenotype only. Co-expression of miR-200c-141 and ∆Np63 in D492M restored the branching morphogenesis in 3D culture underlining the requirement for both luminal and myoepithelial elements for obtaining full branching morphogenesis in breast epithelium. Introduction of a miR-200c-141 construct in both D492 and D492M resulted in resistance to endothelial induced EMT. In conclusion, our data suggests that expression of miR-200c-141 and ∆Np63 in D492M can reverse EMT resulting in luminal- and myoepithelial differentiation, respectively, demonstrating the importance of these molecules in epithelial integrity in the human breast. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Growth and laser characterization of a mixed laser crystal Nd: Lu 0.141Y 0.855VO 4

Science.gov (United States)

Zhao, Bin; Zhuang, Naifeng; Li, Tao; Guo, Feiyun; Zhuo, Zhuang; Ye, Jing; Chen, Jianzhong

2011-11-01

A new Nd: Lu 0.141Y 0.855VO 4 mixed laser crystal had been successfully grown by the Czochralski method. The reason of the crystal boule appearing additionally yellowish at the bottom was discussed. The X-ray powder diffraction analysis showed that the as-grown mixed crystal possesses the ZrSiO 4 structure. The effective segregation coefficients of Nd 3+ and Lu 3+ ions in the crystal were measured to be about 0.51 and 0.76, respectively. The room temperature fluorescence spectrum of the mixed crystal showed that the FWHM (full-width at half-maximum) of the 1064.9 nm fluorescence band was 5.1 nm, broader than that of Nd: YVO 4. A continuous-wave (CW) laser output was achieved with the Nd: Lu 0.141Y 0.855VO 4 crystal at 1.06 μm using laser diode pumping. The maximum CW output power of 1.7 W was obtained with the pump power of 7.6 W, higher than the 1.38 W achieved with the 0.5 at% Nd: LuVO 4 crystal under the same experimental conditions. All the results above show that the Nd: Lu 0.141Y 0.855VO 4 crystal is a promising laser material.

An Ultra-short Period Rocky Super-Earth with a Secondary Eclipse and a Neptune-like Companion around K2-141

DEFF Research Database (Denmark)

Malavolta, Luca; Mayo, Andrew W.; Louden, Tom

2018-01-01

of USP planets, and it is therefore extremely important to increase the still limited sample of USP planets with precise and accurate mass and density measurements. We report here the characterization of a USP planet with a period of 0.28 days around K2-141 (EPIC 246393474), and the validation...... of an outer planet with a period of 7.7 days in a grazing transit configuration. We derived the radii of the planets from the K2 light curve and used high-precision radial velocities gathered with the HARPS-N spectrograph for mass measurements. For K2-141b, we thus inferred a radius of 1.51 ± 0.05 R......⊕ and a mass of 5.08 ± 0.41 M ⊕, consistent with a rocky composition and lack of a thick atmosphere. K2-141c is likely a Neptune-like planet, although due to the grazing transits and the non-detection in the RV data set, we were not able to put a strong constraint on its density. We also report the detection...

Rate constant for the reaction of OH with CH3CCl2F (HCFC-141b) determined by relative rate measurements with CH4 and CH3CCl3

Science.gov (United States)

Huder, Karin; Demore, William B.

1993-01-01

Determination of accurate rate constants for OH abstraction is of great importance for the calculation of lifetimes for HCFCs and their impact on the atmosphere. For HCFC-141b there has been some disagreement in the literature for absolute measurements of this rate constant. In the present work rate constant ratios for HCFC-141b were measured at atmospheric pressure in the temperature range of 298-358 K, with CH4 and CH3CCl3 as reference gases. Ozone was photolyzed at 254 nm in the presence of water vapor to produce OH radicals. Relative depletions of 141b and the reference gases were measured by FTIR. Arrhenius expressions for 141b were derived from each reference gas and found to be in good agreement with each other. The combined expression for HCFC-141b which we recommend is 1.4 x 10 exp -12 exp(-1630/T) with k at 298 K being 5.9 x 10 exp -15 cu cm/molec-s. This value is in excellent agreement with the JPL 92-20 recommendation.

Comparison of Surgical Outcomes Between Holmium Laser Enucleation and Transurethral Resection of the Prostate in Patients With Detrusor Underactivity

Directory of Open Access Journals (Sweden)

Myeong Jin Woo

2017-03-01

Full Text Available Purpose Currently, holmium laser enucleation of the prostate (HoLEP and transurethral resection of the prostate (TURP are the standard surgical procedures used to treat benign prostatic hyperplasia (BPH. Several recent studies have demonstrated that the surgical management of BPH in patients with detrusor underactivity (DU can effectively improve voiding symptoms, but comparative data on the efficacy of HoLEP and TURP are insufficient. Therefore, we compared the short-term surgical outcomes of HoLEP and TURP in patients with DU. Methods From January 2010 to May 2015, 352 patients underwent HoLEP or TURP in procedures performed by a single surgeon. Of these patients, 56 patients with both BPH and DU were enrolled in this study (HoLEP, n=24; TURP, n=32. Surgical outcomes were retrospectively compared between the 2 groups. DU was defined as a detrusor pressure at maximal flow rate of <40 cm H2O as measured by a pressure flow study. Results The preoperative characteristics of patients and the presence of comorbidities were comparable between the 2 groups. The TURP group showed a significantly shorter operative time than the HoLEP group (P=0.033. The weight of the resected prostate was greater in the HoLEP group, and postoperative voiding parameters, including peak flow rate and postvoid residual urine volume were significantly better in the HoLEP group than in the TURP group. Conclusions HoLEP can be effectively and safely performed in patients with DU and can be expected to have better surgical outcomes than TURP in terms of the improvement in lower urinary tract symptoms.

Enucleation ratio efficacy might be a better predictor to assess learning curve of holmium laser enucleation of the prostate

Directory of Open Access Journals (Sweden)

Chang Wook Jeong

2012-06-01

Full Text Available PURPOSE: To appraise the evaluation methods for learning curve and to analyze the non-mentor-aided learning curve and early complications following the holmium laser enucleation of the prostate. MATERIALS AND METHODS:One-hundred and forty (n=140 consecutive patients who underwent HoLEP from July 2008 to July 2010 by a single surgeon (SJO were enrolled. Perioperative clinical variables, including enucleation time, morcellation time, enucleation ratio (enucleation weight/transitional zone volume, enucleation efficacy (enucleated weight/enucleation time, enucleation ratio efficacy (enucleation ratio/enucleation time, and early complication rate were analyzed. RESULTS: Mean prostate volume was 62.7 mL (range 21-162 and preoperative International Prostate Symptom Score (IPSS was 19.0 (4-35. Mean enucleation time and morcellation time were 49.9±23.8 (S.D. min and 11.0±9.7 min, respectively. Median duration of postoperative indwelling catheter was 1 (1-7 day and median hospital stay was 1 (1-6 day. There were a total of 31 surgery-related complications in 27 patients (19.3%, and all were manageable. There was an increasing trend of enucleation efficacy in the first 50 cases. However, enucleation efficacy was linearly correlated with the prostate size (correlation coefficients, R=0.701, p<0.001. But, enucleation ratio efficacy could eliminate the confounding effect of the prostate size (R=-0.101, p=0.233. The plateau of enucleation ratio efficacy was reached around the twenty-fifth case. CONCLUSIONS: Our results demonstrated that the operative learning curve plateau is reached after about 25 cases. We propose that a more appropriate parameter for estimating the operative learning curve is enucleation ratio efficacy, rather than enucleation efficacy.

G141.2+5.0, A NEW PULSAR WIND NEBULA DISCOVERED IN THE CYGNUS ARM OF THE MILKY WAY

Energy Technology Data Exchange (ETDEWEB)

Kothes, R.; Foster, T. J. [National Research Council Herzberg, Dominion Radio Astrophysical Observatory, P.O. Box 248, Penticton, British Columbia, V2A 6J9 (Canada); Sun, X. H. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Reich, W., E-mail: roland.kothes@nrc-cnrc.gc.ca [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany)

2014-04-01

We report the discovery of the new pulsar wind nebula (PWN) G141.2+5.0 in data observed with the Dominion Radio Astrophysical Observatory's Synthesis Telescope at 1420 MHz. The new PWN has a diameter of about 3.'5, which translates to a spatial extent of about 4 pc at a distance of 4.0 kpc. It displays a radio spectral index of α ≈ –0.7, similar to the PWN G76.9+1.1. G141.2+5.0 is highly polarized up to 40% with an average of 15% in the 1420 MHz data. It is located in the center of a small spherical H I bubble, which is expanding at a velocity of 6 km s{sup –1} at a systemic velocity of v {sub LSR} = –53 km s{sup –1}. The bubble could be the result of the progenitor star's mass loss or the shell-type supernova remnant (SNR) created by the same supernova explosion in a highly advanced stage. The systemic LSR velocity of the bubble shares the velocity of H I associated with the Cygnus spiral arm, which is seen across the second and third quadrants and an active star-forming arm immediately beyond the Perseus arm. A kinematical distance of 4 ± 0.5 kpc is found for G141.2+5.0, similar to the optical distance of the Cygnus arm (3.8 ± 1.1 kpc). G141.2+5.0 represents the first radio PWN discovered in 17 years and the first SNR discovered in the Cygnus spiral arm, which is in stark contrast with the Perseus arm's overwhelming population of shell-type remnants.

Delineation of the 3p14.1p13 microdeletion associated with syndromic distal limb contractures

DEFF Research Database (Denmark)

Thevenon, Julien; Monnier, Nicole; Callier, Patrick

2014-01-01

, but not associated with a specific phenotype. We report on four patients with syndromic DLC presenting with a de novo 3p14.1p13 microdeletion. The clinical features associated multiple contractures, feeding problems, developmental delay, and intellectual disability. Facial dysmorphism was constant with low...

Copy number variations in 6q14.1 and 5q13.2 are associated with alcohol dependence.

Science.gov (United States)

Lin, Peng; Hartz, Sarah M; Wang, Jen-Chyong; Agrawal, Arpana; Zhang, Tian-Xiao; McKenna, Nicholas; Bucholz, Kathleen; Brooks, Andrew I; Tischfield, Jay A; Edenberg, Howard J; Hesselbrock, Victor M; Kramer, John R; Kuperman, Samuel; Schuckit, Marc A; Goate, Alison M; Bierut, Laura J; Rice, John P

2012-09-01

Excessive alcohol use is the third leading cause of preventable death and is highly correlated with alcohol dependence, a heritable phenotype. Many genetic factors for alcohol dependence have been found, but many remain unknown. In search of additional genetic factors, we examined the association between Diagnostic and StatisticalManual of Mental Disorders, Fourth Edition (DSM-IV) alcohol dependence and all common copy number variations (CNVs) with good reliability in the Study of Addiction: Genetics and Environment (SAGE). All participants in SAGE were interviewed using the Semi-Structured Assessment for the Genetics of Alcoholism, as a part of 3 contributing studies. A total of 2,610 non-Hispanic European American samples were genotyped on the Illumina Human 1M array. We performed CNV calling by CNVPartition, PennCNV, and QuantiSNP, and only CNVs identified by all 3 software programs were examined. Association was conducted with the CNV (as a deletion/duplication) as well as with probes in the CNV region. Quantitative polymerase chain reaction (qPCR) was used to validate the CNVs in the laboratory. CNVs in 6q14.1 (p = 1.04 × 10(-6)) and 5q13.2 (p = 3.37 × 10(-4)) were significantly associated with alcohol dependence after adjusting multiple tests. On chromosome 5q13.2, there were multiple candidate genes previously associated with various neurological disorders. The region on chromosome 6q14.1 is a gene desert that has been associated with mental retardation and language delay. The CNV in 5q13.2 was validated, whereas only a component of the CNV on 6q14.1 was validated by qPCR. Thus, the CNV on 6q14.1 should be viewed with caution. This is the first study to show an association between DSM-IV alcohol dependence and CNVs. CNVs in regions previously associated with neurological disorders may be associated with alcohol dependence. Copyright © 2012 by the Research Society on Alcoholism.

A Study of the 190 keV Transition in {sup 141}La

Energy Technology Data Exchange (ETDEWEB)

Berg, V; Hoeglund, Aa [Inst. of Physics, Univ. of Stockholm (Sweden); [AB Atome nergi, Nykoping (Sweden); Fogelberg, B [Inst. of Physics, Uppsala Univ. (Sweden)

1970-05-15

The gamma-ray spectrum from the decay of 18 min 141 Ba has been studied. Seventeen transitions were found below 900 keV, with energies and (intensities) as follows: 112.9{+-}0.2(3.0), 163.1{+-}0.3 (1.0), 165.7{+-}0.4(0.7), 180.5{+-}0.2(0.9), 190.3{+-}0.1(100), 276.9{+-}0.1 (52.2), 304.2{+-}0.1(55.8), 343.6{+-}0.1(30.8), 364.4{+-}0.6(1.6), 389.7{+-}0.2(2.8), 457.7{+-}0.2(10.4), 462.3{+-}0.2(10.5), 467.3{+-}0.1(11.4), 625.1{+-}0.2(6.1), 647.9{+-}0.2(10.7), 739.1{+-}0.3(8.7), 876.5{+-}0.3(6.7). K- and L-shell conversion coefficients have been measured for the 190. 3 keV transition, yielding a multipolarity of M1 + < 8 % E2. Half-life measurements using delayed coincidence technique have given the following results: T{sub 1/2} (190 keV level) = 1.27 {sup +0.06}{sub -0.10} ns, T{sub 1/2} (304 keV level) < 200 ps, T{sub 1/2} (467 keV level) < 120 ps. A level scheme of {sup 141}La has been constructed, and the spin-parity assignments of the ground state and first excited state are discussed in terms of the shell model.

Therapeutic application of new holmium-166 chitosan complex in malignant and benign diseases

International Nuclear Information System (INIS)

Park, K.B.; Kim, Y.M.; Shin, B.C.; Kim, J.R.; Ryu, J.M.; Lim, S.M.

1998-01-01

The new holmium-166 chitosan complex ( 166 Ho-CHICO, DW- 166 HC) was prepared by reacting the aqueous acidic solution of chitosan with 166 Ho(NO 3 ) 3 at room temperature with quantitative labelling yield. The progress of the reaction and labelling yield were determined by instant this layer chromatography using silicic acid impregnated glass fiber (ITLC-SA) and developing solvent of MeOH:H 2 O:HAC (49:49:2). The high labelling yield of more than 99% was obtained by reacting chitosan solution (35 mg/4 ml) with 166 Ho(NO 3 ) 3 in which 7 mg of 165 Ho+ 166 Ho were contained as a maximum content. The labelling yield was highly dependent on the pH of the chitosan solution. The optimal labelling could be obtained at pH 2.5∼3.5 The characteristics of 166 Ho-CHICO were similar to those of chitosan, which is biocompatible, biodegradable, non-toxic, soluble and viscous in acidic condition but geltatinuous at pH 6.0 and precipitating in alkaline conditions. 166 Ho-CHICO can be easily prepared by reconstituting freeze-dried chitosan (kit A) with 166 Ho(NO 3 ) 3 solution (kit B) just prior to use. After intrahepatic administration of 166 Ho-CHICO to male rats, the radioactivity concentrations in blood were low and the cumulative urinary and fecal excretion over a period of 0 to 72 hours were 0.53% and 0.54%, respectively. the radioactivity concentration in tissues and the whole-body autoradiography images showed that most of the administered radioactivity was localized at the administered site, and only slight radioactivity was detected from the liver, spleen, lungs, and bones. An autoradiograph after intratumoral administration of 166 Ho-CHICO showed that radioactivity was localized at the administered site of the lesion without distribution to other organs and tissues. A biodistribution study in normal rabbits with 166 Ho-CHICO showed that most of the radioactivities were retained in the knee joint with negligible extra leakage at 72 hours after intra

Remaining Sites Verification Package for the 1607-F7, 141-M Building Septic Tank. Attachment to Waste Site Reclassification Form 2006-040

International Nuclear Information System (INIS)

Dittmer, L.M.

2006-01-01

The 1607-F7, 141-M Building Septic Tank waste site was a septic tank and drain field that received sanitary sewage from the former 141-M Building. Remedial action was performed in August and November 2005. The results of verification sampling demonstrate that residual contaminant concentrations support future unrestricted land uses that can be represented by a rural-residential scenario. These results also show that residual concentrations support unrestricted future use of shallow zone soil and that contaminant levels remaining in the soil are protective of groundwater and the Columbia River

Dietary treatment for decreasing 141Ce body burden in immature rats

International Nuclear Information System (INIS)

Kargacin, B.; Kostial, K.; Landeka, M.

1987-01-01

The purpose of this work was to evaluate the effect of prolonged (immediate or delayed) administration of dietary additives to suckling rats on the absorption and retention of radioactive cerium in the body. The experiment was performed on 6-day-old suckling rats. According to dietary treatment the animals were divided into three groups. Each group was artificially fed over 8 h for 6 or 12 days on one of the diets: the first group of animals was fed milk, the second group was given ingredients of rat diet and the third received milk during the first 2 days of the experiment and the ingredients of rat diet afterwards. At the end of the artificial feeding period the pups returned to their mothers and suckled overnight. On the 1st day of the experiment the food was labelled with 141 Ce. Whole body radioactivity was determined in a double crystal scintillation counter every 48 h over a 12-day period. Half of the animals from each group were killed 6 days after 141 Ce administration and the other half after 12 days. At these intervals retention was determined in the gut, liver, kidneys and femur. The early and delayed administration of rat diet ingredients - fish meal, sunflower meal, alfalfa, cane molasses and premix - greatly reduced whole body retention. The early treatment was more efficacious than the delayed one. The reduction was mostly due to decreased gut retention but organ retentions were also lower. The results obtained indicate that by prolonged (immediate or delayed) administration of some dietary means the retention of radioactive cerium in sucklings can be significantly decreased. (orig.)

Low-power holmium:YAG laser urethrotomy for treatment of urethral strictures: functional outcome and quality of life.

Science.gov (United States)

Kamp, Stefan; Knoll, Thomas; Osman, Mahmoud M; Köhrmann, Kai Uwe; Michel, Maurice S; Alken, Peter

2006-01-01

To evaluate the efficacy of endourethrotomy with the holmium:YAG laser as a minimally invasive treatment for urethral stricture. Between January 2002 and January 2004, 32 male patients with symptomatic urethral strictures (8 bulbar, 9 penile, 9 combined) were treated with Ho:YAG-laser urethrotomy in our department. The stricture was iatrogenic in 60% (N = 18), inflammatory in 16.6% (N = 5), traumatic in 13.3% (N = 4), and idiopathic in 7% (N = 3). The stricture was incised under vision at the 12 o'clock location or the site of maximum scar tissue or narrowing in asymmetric strictures. Laser energy was set on 1200 to 1400 mJ with a frequency of 10 to 13 Hz. Postoperatively, drainage of the bladder was performed for 4 days using a 18F silicone catheter. Triamcinolone was instilled intraurethrally after removal of the catheter in all patients. Patients were followed up by mailed questionnaire, including International Prostate Symptom Score and quality of life. Retrograde endoscopic Ho:YAG laser urethrotomy could be performed in all 32 patients. Most patients (22; 68.7%) did not need any reintervention. Ten patients developed recurrent strictures that were treated by another laser urethrotomy in 4 patients (12.5%), while 6 patients (18.7%) needed open urethroplasty with buccal mucosa. Including 2 patients treated with repeat laser urethrotomy, 24 patients (75%) were considered successful after a mean follow-up of 27 months (range 13-38 months). No intraoperative complications were encountered, although in 5% of patients, a urinary-tract infection was diagnosed postoperatively. No gross hematuria occurred. The Ho:YAG laser urethrotomy is a safe and effective minimally invasive therapeutic modality for urethral stricture with results comparable to those of conventional urethrotomy. Further data from long-time follow-up are necessary to compare the success rate with that of conventional urethrotomy and urethroplasty. Nevertheless, the Ho:YAG laser urethrotomy might at

Measurement of fission cross-section for the {sup 232}Th(n,f){sup 141}Ba reaction induced by neutrons around 14 MeV

Energy Technology Data Exchange (ETDEWEB)

Lan, Chang-Lin; Fang, Kai-Hong [Lanzhou University, School of Nuclear Science and Technology, Lanzhou, Gansu Province (China); Lanzhou University, Engineering Research Center for Neutron Application, Ministry of Education, Lanzhou, Gansu Province (China); Liu, Shuang-Tong; Lv, Tao; Wang, Qiang; Zhang, Zheng-Wei [Lanzhou University, School of Nuclear Science and Technology, Lanzhou, Gansu Province (China); Lai, Cai-Feng [Chinese Academy of Engineering Physics, Institute of Nuclear Physics and Chemistry, Mianyang, Sichuan Province (China)

2016-11-15

The fission cross-section of the {sup 232}Th(n,f){sup 141}Ba reaction induced by neutrons around 14 MeV was measured precisely with the neutron activation and off-line gamma-ray spectrometric technique. Neutron fluence was monitored on-line using the accompanying α-particles from the {sup 3}H({sup 2}H,n){sup 4}He reaction, whereas the neutron energies were measured by the method of cross-section ratios of {sup 90}Zr(n,2n){sup 89}Zr to {sup 93}Nb(n,2n){sup 92m}Nb reactions. The experimentally determined {sup 232}Th(n,f){sup 141}Ba reaction cross-sections were 12.2 ± 0.4 mb at E{sub n} = 14.1 ± 0.3 MeV, 13.0 ± 0.5 mb at E{sub n} = 14.5 ± 0.3 MeV and 13.3 ± 0.5 mb at E{sub n} = 14.7 ± 0.3 MeV, respectively. (orig.)

40 CFR 141.521 - What updated watershed control requirements must my unfiltered system implement to continue to...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false What updated watershed control... People Additional Watershed Control Requirements for Unfiltered Systems § 141.521 What updated watershed control requirements must my unfiltered system implement to continue to avoid filtration? Your system must...

Activation of human CD141+ and CD1c+ dendritic cells in vivo with combined TLR3 and TLR7/8 ligation.

Science.gov (United States)

Pearson, Frances E; Chang, Karshing; Minoda, Yoshihito; Rojas, Ingrid M Leal; Haigh, Oscar L; Daraj, Ghazal; Tullett, Kirsteen M; Radford, Kristen J

2018-04-01

Mice reconstituted with human hematopoietic stem cells are valuable models to study aspects of the human immune system in vivo. We describe a humanized mouse model (hu mice) in which fully functional human CD141 + and CD1c + myeloid and CD123 + plasmacytoid dendritic cells (DC) develop from human cord blood CD34 + cells in immunodeficient mice. CD141 + DC are the human equivalents of murine CD8 + /CD103 + DC which are essential for the induction of tumor-inhibitory cytotoxic T lymphocyte responses, making them attractive targets to exploit for the development of new cancer immunotherapies. We used CD34 + -engrafted NSG-A2 mice to investigate activation of DC subsets by synthetic dsRNA or ssRNA analogs polyinosinic-polycytidylic acid/poly I:C and Resiquimod/R848, agonists for TLR3 and TLR8, respectively, both of which are expressed by CD141 + DC. Injection of hu mice with these agonists resulted in upregulation of costimulatory molecules CD80, CD83 and CD86 by CD141 + and CD1c + DC alike, and their combination further enhanced expression of these molecules by both subsets. When combined, poly I:C and R848 enhanced serum levels of key cytokines associated with cross-presentation and the induction of cytotoxic T lymphocyte responses including IFN-α, IFN-β, IL-12 and CXCL10. These data advocate a combination of poly I:C and R848 TLR agonists as means of activating human DC for immunotherapy. © 2018 Australasian Society for Immunology Inc.

Adsorção dos corantes RO16, RR2 e RR141 utilizando lodo residual da indústria têxtil Adsorption of dyes RO16, RR2 and RR141 using residual sludge of textile industry

Directory of Open Access Journals (Sweden)

Andressa Regina Vasques

2011-09-01

Full Text Available A adsorção é uma das técnicas empregadas com sucesso para remoção efetiva da cor presente em efluentes têxteis. Com o objetivo de avaliar os diferentes parâmetros adsortivos, bem como determinar a eficiência de um adsorvente alternativo desenvolvido a partir de lodo residual têxtil na remoção de corantes, foram determinadas curvas de cinética de adsorção e isotermas. Por meio dos dados cinéticos e de equilíbrio obtidos, verificou-se que a 25ºC a adsorção foi favorável para todos os corantes, sendo esta a melhor condição para os corantes RO16 e RR2 na ausência de sais. Para o corante RR141, a adição de NaCl aumentou a capacidade de adsorção do adsorvente no equilíbrio e a adição de Na2SO4 favoreceu a adsorção para o corante RO16, ao contrário do que se observou para os outros dois corantes. A quantidade máxima de corante adsorvida por unidade de massa de adsorvente (q max nas melhores condições adsortivas para os corantes RO16, RR2 e RR141 foi de 81,30, 53,48 e 78,74 mg.g-1, respectivamente.The adsorption is one of the techniques that have been successfully used for effective removal of the dyes present in textile effluents. With the objective to evaluate the different adsorptive parameters, as well as determining the efficiency of one alternative adsorbent in the removal of dyes, kinetics and equilibrium data of adsorption were determined. By the kinetic data and of equilibrium, it was verified that the adsorption was favorable for all the dyes in 25ºC, being the best condition for the dye RO16 and RR2 in the total absence of salt. For the dye RR141, the addition of NaCl increased the adsorption capacity of adsorbent in the equilibrium and the addition of Na2SO4 favored the adsorption for the dye RO16, in contrast to what was observed for the two other dyes. The maximum quantity of dye adsorbed per unit mass of adsorbent (q max in the best adsorptive conditions for the dyes RO16, RR2 and RR141 was of 81

Use of 141Ce as a particulate digesta flow tracer in ruminants. I. Determination of uptake on feed and behavior in rumen digesta in vivo

International Nuclear Information System (INIS)

Poncet, C.

1976-01-01

The suitability of 141 Ce as a particulate digesta flow tracer is studied in sheep. The amount and the factors of cerium uptake on feed particles by incubating alfalfa hay and sorghum seeds in water containing 141 Ce in solution are determined. After soaking one hour, 80% radioactivity is retained on the hay 17% on the sorghum. Incubation time is the main factor determining uptake rate. This uptake is solid on the hay and more fragile on the sorghum. The evolution of 141 Ce distribution among the different physical constituents of rumen digesta is studied on two sheep given a single radioactive meal (10μCi). These sheep are fitted with a rumen cannula and fed twice daily with hay (80%) and sorghum (20%). There is little 141 Ce in solution in the supernatant liquid after centrifugation of digesta. At the end of the 'labelled' meal, specific radioactivity (RAS) of liquid-phase digesta, separated by filtering on two layers of gauze, is equal to or higher than the RAS of the solid phase. It increases up to the next unlabelled meal and then decreases. Microorganisms may cause this transfer of liquid-phase radioactivity to the large particles. Specific radioactivity of the microorganisms remains very high after the 'labelled' meal as compared to that of different granulometric fractions of solid digesta [fr

10 CFR 455.141 - Grant awards for units of local government, public care institutions, and coordinating agencies.

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Grant awards for units of local government, public care... CONSERVATION GRANT PROGRAMS FOR SCHOOLS AND HOSPITALS AND BUILDINGS OWNED BY UNITS OF LOCAL GOVERNMENT AND PUBLIC CARE INSTITUTIONS Grant Awards § 455.141 Grant awards for units of local government, public care...

Dietary treatment for decreasing /sup 141/Ce body burden in immature rats

Energy Technology Data Exchange (ETDEWEB)

Kargacin, B; Kostial, K; Landeka, M

1987-02-01

The purpose of this work was to evaluate the effect of prolonged (immediate or delayed) administration of dietary additives to suckling rats on the absorption and retention of radioactive cerium in the body. The experiment was performed on 6-day-old suckling rats. According to dietary treatment the animals were divided into three groups. Each group was artificially fed over 8 h for 6 or 12 days on one of the diets: the first group of animals was fed milk, the second group was given ingredients of rat diet and the third received milk during the first 2 days of the experiment and the ingredients of rat diet afterwards. At the end of the artificial feeding period the pups returned to their mothers and suckled overnight. On the 1st day of the experiment the food was labelled with /sup 141/Ce. Whole body radioactivity was determined in a double crystal scintillation counter every 48 h over a 12-day period. Half of the animals from each group were killed 6 days after /sup 141/Ce administration and the other half after 12 days. At these intervals retention was determined in the gut, liver, kidneys and femur. The early and delayed administration of rat diet ingredients - fish meal, sunflower meal, alfalfa, cane molasses and premix - greatly reduced whole body retention. The early treatment was more efficacious than the delayed one. The reduction was mostly due to decreased gut retention but organ retentions were also lower. The results obtained indicate that by prolonged (immediate or delayed) administration of some dietary means the retention of radioactive cerium in sucklings can be significantly decreased.

Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations

NARCIS (Netherlands)

M. Kolz (Melanie); T. Johnson (Toby); S. Sanna (Serena); A. Teumer (Alexander); V. Vitart (Veronique); M. Perola (Markus); M. Mangino (Massimo); E. Albrecht (Eva); C. Wallace (Chris); M. Farrall (Martin); A. Johansson (Åsa); A.S. Dimas (Antigone); Y.S. Aulchenko (Yurii); J.S. Beckmann (Jacques); S.M. Bergmann (Sven); M. Bochud (Murielle); M.J. Brown (Morris); H. Campbell (Harry); J. Connell (John); A. Dominiczak (Anna); G. Homuth (Georg); C. Lamina (Claudia); M.I. McCarthy (Mark); T. Meitinger (Thomas); V. Mooser (Vincent); P. Munroe (Patricia); M. Nauck (Matthias); J. Peden (John); H. Prokisch (Holger); P. Salo (Perttu); V. Salomaa (Veikko); N.J. Samani (Nilesh); D. Schlessinger (David); M. Uda (Manuela); G. Waeber (Gérard); D. Waterworth (Dawn); R. Wang-Sattler (Rui); A.F. Wright (Alan); J. Adamski (Jerzy); J.B. Whitfield (John); U. Gyllensten (Ulf); J.F. Wilson (James); I. Rudan (Igor); P.P. Pramstaller (Peter Paul); H. Watkins (Hugh); A. Doering (Angela); H.E. Wichmann (Erich); T.D. Spector (Tim); L. Peltonen (Leena Johanna); H. Völzke (Henry); R. Nagaraja (Ramaiah); P. Vollenweider (Peter); M. Caulfield (Mark); T. Illig (Thomas); C. Gieger (Christian); U. Völker (Uwe)

2009-01-01

textabstractElevated serum uric acid levels cause gout and are a risk factor for cardiovascular disease and diabetes. To investigate the polygenetic basis of serum uric acid levels, we conducted a meta-analysis of genome-wide association scans from 14 studies totalling 28,141 participants of

40 CFR 141.564 - My system practices lime softening-is there any special provision regarding my individual filter...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false My system practices lime softening-is... People Individual Filter Turbidity Requirements § 141.564 My system practices lime softening—is there any special provision regarding my individual filter turbidity monitoring? If your system utilizes lime...

40 CFR 141.553 - My system practices lime softening-is there any special provision regarding my combined filter...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false My system practices lime softening-is... Filter Effluent Requirements § 141.553 My system practices lime softening—is there any special provision regarding my combined filter effluent? If your system practices lime softening, you may acidify...

Response of LR-115 type II and CR-39 plastic track detectors to Am-Be and 14.1-MeV neutrons

International Nuclear Information System (INIS)

Bradley, D.A.; Chong, C.S.; Saat, Ahmat; Sidik, A.G.; Ghose, A.M.

1987-01-01

The fast-neutron response of the plastic LR-115 type II and CR-39 track detectors have been compared, using a 14.1-MeV neutron generator and a radionuclide Am-Be neutron source (effective primary neutron energy 4.5-MeV). The distribution of track diameters for a range of etching times has been evaluated, taking into account track registration efficiency and the relevant fast neutron scattering cross-sections. The efficiency of etched-track formation in LR-115 type II due to neutron irradiation is approximately double that in CR-39. The 14.1-MeV neutrons also tend to produce tracks in both materials with somewhat greater efficiency than do the lower energy neutrons from the radionuclide source, for a given etching time. (author)

PHIP – a novel candidate breast cancer susceptibility locus on 6q14.1

OpenAIRE

Jiao, X; Easton, Douglas Frederick

2017-01-01

Most non-BRCA1/2 breast cancer families have no identified genetic cause. We used linkage and haplotype analyses in familial and sporadic breast cancer cases to identify a susceptibility locus on chromosome 6q. Two independent genome-wide linkage analysis studies suggested a 3 Mb locus on chromosome 6q and two unrelated Swedish families with a LOD >2 together seemed to share a haplotype in 6q14.1. We hypothesized that this region harbored a rare high-risk founder allele contributing to breast...

40 CFR 141.209 - Special notice for nitrate exceedances above MCL by non-community water systems (NCWS), where...

Science.gov (United States)

2010-07-01

... Water Violations § 141.209 Special notice for nitrate exceedances above MCL by non-community water... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special notice for nitrate exceedances above MCL by non-community water systems (NCWS), where granted permission by the primacy agency under Â...

Ultrasensitive Faraday cage-type electrochemiluminescence assay for femtomolar miRNA-141 via graphene oxide and hybridization chain reaction-assisted cascade amplification.

Science.gov (United States)

Lu, Jing; Wu, Lin; Hu, Yufang; Wang, Sui; Guo, Zhiyong

2018-06-30

In this study, a novel electrochemiluminescence (ECL) biosensor for sensitive detection of femtomolar miRNA-141 was constructed on the basis of Faraday cage-type strategy via graphene oxide (GO) and hybridization chain reaction (HCR)-assisted cascade amplification. A capture probe (CP) was immobilized on Fe 3 O 4 @SiO 2 @Au nanoparticles as capture unit, which could catch the miRNA-141, and the immobilization of the signal unit (Ru(phen) 3 2+ -HCR/GO) was allowed via nucleic acid hybridization. The prepared biosensor exhibited two advantages for signal amplification: firstly, GO could lap on the electrode surface directly, extending Outer Helmholtz Plane (OHP) of the sensor due to the large surface area and good electronic transport property; secondly, HCR-assisted cascade amplification was designed by anchoring all HCR products on the GO surface, then embedding Ru(phen) 3 2+ as a signal readout pathway. All these signal molecules could take part in electrochemical reactions, thus further enhancing the ECL signal drastically. Therefore, the proposed sensor constructed by integrating HCR with Faraday cage-type strategy displayed an ultrasensitive detection platform for the miRNA-141 with a low detection limit of 0.03 fM. In addition, this proposed biosensor provides a universal platform for analysis of other microRNAs. Copyright © 2018 Elsevier B.V. All rights reserved.

Efficacy of holmium. Yttrium-aluminium-garnet (Ho: YAG) laser therapy for arthroscopic synovectomy of rheumatoid arthritis

International Nuclear Information System (INIS)

Inoue, Yasuo; Inoue, Kazuhiko; Kanbe, Katsuaki

2008-01-01

To clarify the efficacy of holmium: yttrium-aluminium-garnet (Ho: YAG) laser therapy for arthroscopic synovectomy of rheumatoid arthritis (RA), we treated 13 shoulders of 11 RA patients of whom 1 was stage I, 7 stage II, 2 stage III, and 1 stage IV. The duration of RA is 4.6 years on average and the follow-up period is an average of 14 months. The Ho: YAG laser was set at 10 Watt (W) to treat the bone erosion areas so as to reach the deep zones of the pannus in order to resect the synovium. We compared C-reactive protein (CRP), Disease activity score (DAS) 28 and magnetic resonance image (MRI) findings before and after surgery. We cultured primary synovial cells to assay cytokine production of interleukin (IL)-1β, IL-6 and tumor necrosis factor (TNF)-α. Morphological examination was performed after treatment with the Ho: YAG laser at 0, 1, 5, 10, 15 and 20 W. We found villous synovium proliferation with vascularity in the rotator interval and supra spinatus tendon in the shoulder joints. In the subacromial bursa, yellow fat tissue and white fibrous soft tissue were detected in almost all shoulders. After synovectomy using the Ho: YAG laser, CRP decreased from an average of 3.6 to 0.8 and DAS28 also decreased from an average of 5.4 to 3.7 at 14 months after surgery. MRI showed decreased panni with synovium and did not precede joint destruction after 14 months in 10 shoulders out of 13 (77%). At 20 W of the Ho: YAG laser treatment, the synovial cells shrank as in apoptosis and the number of cells also decreased. Laser treatment also resulted in the following significant changes: TNF-α production increased at 1, 10, 15 and 20 W (compared with 0 W) but not dose dependently; IL-1β and IL-6 increased up to 10 W (compared with 0 W) but decreased at 15 and 20 W (compared with 10 W). In morphological examination, after treatment with the Ho: YAG laser at 15 W, the synovial cells expanded and the number of cells decreased. Therefore, Ho: YAG laser therapy is effective

Nonspecific genitourinary pain improves after prostatectomy using holmium laser enucleation of prostate in patients with benign prostatic hyperplasia: a prospective study.

Directory of Open Access Journals (Sweden)

Sung Han Kim

Full Text Available OBJECTIVE: To investigate changes in nonspecific genitourinary discomfort or pain (GUDP before and after holmium laser enucleation of prostate (HoLEP. GUDP associated with lower urinary tract symptoms (LUTS is a common complaint among benign prostatic hyperplasia (BPH patients, but very little is known about this clinical entity. METHODS: From February 2010 to August 2011, 100 HoLEP patients with complete clinical data at a single institution were enrolled in the study to analyze the degree of GUDP with a visual analog scale (VAS from 0 to 10 points at baseline and at 3 and 6 months postoperatively, and to investigate any relationships between GUDP and urodynamics, uroflowmetry, and scores from the International Prostate Symptom Score (IPSS questionnaire. RESULTS: Fifty-six patients had LUTS only, while the remaining 44 had both LUTS and GUDP. Pain was located in the suprapubic (42.0%, perineal/penile (33.0%, back (17.0%, and perianal (8.0% regions. During the post-operative period, at six months, the VAS, IPSS, peak flow rate and post-void residual volume had improved significantly in 44 GUDP patients (p<0.010. GUDP had completely resolved in 40 (90.9% patients and had decreased in four (9.1% patients, while seven (12.5% patients developed GUDP with voiding in the urethral and perineal areas by the third month postoperatively. When compared to patients with complete resolution, those with persistent GUDP were found to have a significantly higher preoperative presence of bladder outlet obstruction (BOO as an independent risk factor (OR 6.173, 95% CI 1.132-1.323. CONCLUSION: Both GUDP and LUTS improved significantly after HoLEP. Patients with significant preoperative BOO tended to have persistent GUDP after surgery.

Comparison of Predictive Factors for Postoperative Incontinence of Holmium Laser Enucleation of the Prostate by the Surgeons' Experience During Learning Curve.

Science.gov (United States)

Shigemura, Katsumi; Tanaka, Kazushi; Yamamichi, Fukashi; Chiba, Koji; Fujisawa, Masato

2016-03-01

To detect predictive factors for postoperative incontinence following holmium laser enucleation of the prostate (HoLEP) according to surgeon experience (beginner or experienced) and preoperative clinical data. Of 224 patients, a total of 203 with available data on incontinence were investigated. The potential predictive factors for post-HoLEP incontinence included clinical factors, such as patient age, and preoperative urodynamic study results, including detrusor overactivity (DO). We also classified the surgeons performing the procedure according to their HoLEP experience: beginner (predictive factor at the super-short period (the next day of catheter removal: odds ratio [OR], 3.375; P=0.000). Additionally, patient age, surgeon mentorship (inverse correlation), and prostate volume were significant predictive factors at the 1-month interval after HoLEP (OR, 1.072; P=0.004; OR, 0.251; P=0.002; and OR, 1.008; P=0.049, respectively). With regards to surgeon experience, DO and preoperative International Prostate Symptom Score (inverse) at the super-short period, and patient age and mentorship (inverse correlation) at the 1-month interval after HoLEP (OR, 3.952; P=0.002; OR, 1.084; P=0.015; and OR,1.084; P=0.015; OR, 0.358; P=0.003, respectively) were significant predictive factors for beginners, and first desire to void (FDV) at 1 month after HoLEP (OR, 1.009; P=0.012) was a significant predictive factor for experienced surgeons in multivariate analysis. Preoperative DO, IPSS, patient age, and surgeon mentorship were significant predictive factors of postoperative patient incontinence for beginner surgeons, while FDV was a significant predictive factors for experienced surgeons. These findings should be taken into account by surgeons performing HoLEP to maximize the patient's quality of life with regards to urinary continence.

Study of Polymorphism of the DRD2 Gene (-141C Ins/Del, rs1799732 with Attention Deficit Hyperactivity Disorder a Population Sample of Children in Iranian-Azeri

Directory of Open Access Journals (Sweden)

Leila Mehdizadeh Fanid

2017-03-01

Full Text Available BackgroundAttention deficit hyperactivity disorder (ADHD, is a multifactorial disorder and converging evidence has implicated abnormalities of dopamine neurotransmission. The aim of this study was to examine the association of -141 polymorphisms in DRD2 gene with ADHA among Iranian-Azeri population.Materials and Methods A case–control association study included 153 patients with attention deficit hyper activity disorder (case group, and 133 healthy subjects (control group. Genomic DNA was extracted peripheral blood samples by salting-out method. Single nucleotide polymorphism (SNP genotyping was performed by Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP technique. The data analysis was performed through Chi-square, with a significance level of 0.05.Results: There was not significant difference in the allele and genotype frequencies between ADHD and -141C Ins/Del polymorphism in cases and controls (P>0.05. Ins/Ins homozygous dominants were more frequent in control group than the case group, but there was not significant difference observed (P>0.05. Del/Del homozygous dominants were not observed. No significant difference was detected in the allele and genotype frequencies between ADHD and -141 Insertion/Deletion polymorphism in cases and control groups (P>0.05.ConclusionOur results do not detected association between the -141C Ins/Del, rs1799732, polymorphism and ADHD disorder in population of Children in Iranian-Azeri.

Comparison on Promotion Effect of Various Types of Surfactants on HCFC-141b Hydrate Induction Time

Science.gov (United States)

Li, Juan; Sun, Zhigao; Liu, Chenggang; Zhu, Minggui

2018-03-01

Cold storage in air conditioning based on refrigerant hydrate is a new-type energy saving technology to reduce initial investment and running cost of air conditioning equipments and improve system stability. Refrigerant hydrate is generated under critical temperature and pressure condition, while surfactant is an effective medium to promote its phase equilibrium. In this paper, in order to research such promotion effect, different type of surfactants with unique mechanism, SDS, Tween80 and Span80, n-BA were selected to compare the respective impact on HCFC141b hydrate induction time based on temperature curve. Experimental results showed that no obvious change had been discovered when no surfactant was added into pure water system, which coincided with phase equilibrium diagram of HCFC141b. All the four kinds of surfactants had realized promotion effect to various degrees. For each hydration system, a large gap existed between the longest and the shortest induction time in 6 groups of parallel experiments, meaning relatively poor system stability. Under the combined effect of Tween80 (2wt%), Span80 (0.1wt%) and n-BA (0.1wt%), average and the shortest induction time was 20.9min and 17.5min respectively, corresponding to the best promotion effect.

Delineation of the 3p14.1p13 microdeletion associated with syndromic distal limb contractures.

Science.gov (United States)

Thevenon, Julien; Monnier, Nicole; Callier, Patrick; Dieterich, Klaus; Francoise, Michel; Montgomery, Tara; Kjaergaard, Susanne; Neas, Katherine; Dixon, Joanne; Dahm, Thomas Lee; Huet, Frédéric; Ragon, Clémence; Mosca-Boidron, Anne-Laure; Marle, Nathalie; Duplomb, Laurence; Aubriot-Lorton, Marie-Hélène; Mugneret, Francine; Vokes, Steve A; Tucker, Haley W; Lunardi, Joël; Faivre, Laurence; Jouk, Pierre Simon; Thauvin-Robinet, Christel

2014-12-01

Distal limb contractures (DLC) represent a heterogeneous clinical and genetic condition. Overall, 20-25% of the DLC are caused by mutations in genes encoding the muscle contractile apparatus. Large interstitial deletions of the 3p have already been diagnosed by standard chromosomal analysis, but not associated with a specific phenotype. We report on four patients with syndromic DLC presenting with a de novo 3p14.1p13 microdeletion. The clinical features associated multiple contractures, feeding problems, developmental delay, and intellectual disability. Facial dysmorphism was constant with low-set posteriorly rotated ears and blepharophimosis. Review of previously reported cases with a precise mapping of the deletions, documented a 250 kb smallest region of overlap (SRO) necessary for DLC. This region contained one gene, EIF4E3, the first three exons of the FOXP1 gene, and an intronic enhancer of FOXP1 named hs1149. Sanger sequencing and locus quantification of hs1149, EIF4E3, and FOXP1 in a cohort of 11 French patients affected by DLC appeared normal. In conclusion, we delineate a new microdeletion syndrome involving the 3p14.1p13 locus and associated with DLC and severe developmental delay. © 2014 Wiley Periodicals, Inc.

K2-141 b. A 5-M⊕ super-Earth transiting a K7 V star every 6.7 h

Science.gov (United States)

Barragán, O.; Gandolfi, D.; Dai, F.; Livingston, J.; Persson, C. M.; Hirano, T.; Narita, N.; Csizmadia, Sz.; Winn, J. N.; Nespral, D.; Prieto-Arranz, J.; Smith, A. M. S.; Nowak, G.; Albrecht, S.; Antoniciello, G.; Bo Justesen, A.; Cabrera, J.; Cochran, W. D.; Deeg, H.; Eigmuller, Ph.; Endl, M.; Erikson, A.; Fridlund, M.; Fukui, A.; Grziwa, S.; Guenther, E.; Hatzes, A. P.; Hidalgo, D.; Johnson, M. C.; Korth, J.; Palle, E.; Patzold, M.; Rauer, H.; Tanaka, Y.; Van Eylen, V.

2018-05-01

We report on the discovery of K2-141 b (EPIC 246393474 b), an ultra-short-period super-Earth on a 6.7 h orbit transiting an active K7 V star based on data from K2 campaign 12. We confirmed the planet's existence and measured its mass with a series of follow-up observations: seeing-limited MuSCAT imaging, NESSI high-resolution speckle observations, and FIES and HARPS high-precision radial-velocity monitoring. K2-141 b has a mass of 5.31 ± 0.46 M⊕ and radius of 1.54-0.09+0.10 R⊕, yielding a mean density of 8.00-1.45+1.83 g cm-3 and suggesting a rocky-iron composition. Models indicate that iron cannot exceed 70% of the total mass. With an orbital period of only 6.7 h, K2-141 b is the shortest-period planet known to date with a precisely determined mass. Based on observations obtained with (a) the Nordic Optical Telescope (NOT), operated on the island of La Palma jointly by Denmark, Finland, Iceland, Norway, and Sweden, in the Spanish Observatorio del Roque de los Muchachos (ORM) of the Instituto de Astrofisica de Canarias (IAC); (b) the 3.6m ESO telescope at La Silla Observatory under program ID 099.C-0491; (c) the Kepler space telescope in its extended mission K2.Tables of the light curve data and the radial velocities are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/612/A95

The environmental toxicology of rare earth elements (147Pm, 141Ce, 147Nd) and their safety evaluation in environment

International Nuclear Information System (INIS)

Chen Zuyi; Liu Yu; Cheng Wei; Zhang Ligan; Li Huixin; Wang Yuanxing

2001-01-01

The environmental behaviour, bioconcentration of rare earth elements and their effects on the animal gonadial hormone secretion were studied using the radioisotope tracer. The results were as follows: (1) The 147 Pm, 141 Ce and 147 Nd have strong adsorption in soil. They accumulated in soil easily and belonged to the matter which was difficult to move. When in water body, they concentrated in the bottom mud. (2) The authors tested bioconcentration factors (BCF) of 5 aquatics and absorption coefficients of 3 aquatic vegetables on 147 Pm, and their concentration in edible organ-stems. The materials for study showed apparent concentrating capabilities. (3) The distribution of 147 Pm, 141 Ce and 147 Nd residues were uneven in the animal's viscera and tissue. But, the higher residues were in bone, marrow, eye, brain, heart, adipose and testis, and their accumulation increased with dosage and time, which showed selective accumulation. There were much higher accumulation of RE in bone than in other viscera and tissues, and 141 Ce was highest in eye. (4) With the Nd or Ce of dose 200 mg/kg by once intraperitoneally, gonadial hormone (testosterone or progesterone) concentration in the serum decreased significantly compared with the control. This showed apparent inhibition on gonadial hormone secretion in mice; however with different dosages of Ce (200 and 800 mg/kg · d) in feed, the testosterone concentration of serum made no significant difference, but, the misshape rate of spermatozoon proved higher, and the misshape rate increased with feeding time and dosage. Rudimentary exploration on safety of agricultural use of Re for eco-environment are made, and some suggestions are proposed

Investigation of the influence of nuclear charge on the internal Bremsstrahlung accompanying the β-decay of 45Ca and 141Ce

International Nuclear Information System (INIS)

Khalil, E.I.; Basha, A.M.

1995-01-01

The internal Bremsstrahlung (IB) spectrum accompanying the allowed β-decay of 141 Ce was measured using NaI (TI) scintillation spectrometer. The corrected IB distribution was compared with the theories for allowed β-transition of Knipp and Uhlenbeck as well as of Bloch (KUB), Lewis and Ford and Nilsson. Further, for 141 Ce isotope the corrected IB distribution was compared with the Ford and Martin theory (for detour β-transition) and modified KUB theory (where the shape correction factor suggested by Konopinski and Uhlenbeck on the Fermi β-decay theory was applied to the calculated IB based on Nilsson theory). This comparison between experiment and theory, and between the measurements of the two isotopes reflects the role played by the nuclear charge and the degree of forbiddenness on the IB spectrum. (author). 26 refs., 5 figs., 1 tab

Immediate haemodynamic effects of a novel partial agonist, beta 1-adrenoceptor blocking drug ICI 141,292 after intravenous administration to healthy young volunteers and patients with ischaemic heart disease

DEFF Research Database (Denmark)

Bonde, J; Svendsen, T L; Lyngborg, K

1987-01-01

administration of four sequential doses (0.5, 0.5, 1.0 and 2.0 mg) of ICI 141,292 was examined. HR decreased 7% (P less than 0.05) following ICI 141,292 1 mg with no further decrease following the succeeding doses. Cardiac output decreased 5.2% (P less than 0.05) following a cumulative dose of 4 mg...... as atenolol) beta 1-adrenoceptor blocking agent possessing moderate intrinsic sympathomimetic activity....

Preparation of Na4UO2(CO3)3 in presence of Ce-141. II, Treatment of uranium decontamination

International Nuclear Information System (INIS)

Lopez M, B.E.; Rodriguez S, A.

1992-02-01

It was settled down that the coexistence of chemical species structurally different of cerium, is a consequence of the preparation time; whose practical application, for the purification of the uranium, it can constitute the technological aspect but important in the ion exchange process, to separate the Ce-141 from the uranium. (Author)

Efficacy of holmium laser enucleation of the prostate (HoLEP) in men with bladder outlet obstruction (BOO) and non-neurogenic bladder dysfunction.

Science.gov (United States)

Pyun, Jong Hyun; Kang, Sung Gu; Kang, Seok Ho; Cheon, Jun; Kim, Je Jong; Lee, Jeong Gu

2017-09-01

We aimed to compare the short-term outcomes of men who had urodynamic evidence of detrusor underactivity (DU) or detrusor overactivity (DO) of a non-neurogenic etiology as well as bladder outlet obstruction (BOO) and who underwent Holmium Laser Enucleation of the prostate (HoLEP). A database of 322 patients who underwent HoLEP between 2010 and 2014 was analyzed. Patients were classified into three groups according to the results of a preoperative urodynamic study. Preoperative parameters such as International Prostate Symptom Score (IPSS), Quality of Life (QoL) index, IPSS grade, uroflowmetry were compared with postoperative parameters measured at 6 months. There were 138 patients with BOO-only and 89 patients with BOO and detrusor dysfunction including 56 with DO and 33 with DU. The degree of improvement in IPSS-total (BOO: 10.7, DO: 8.3, DU: 7.0; p = 0.023) was greater in the BOO-only group than in the DU group. There were more patients whose IPSS grade improved in the BOO-only group (71%) than in the detrusor dysfunction group (DO: 53.6% and DU: 45.5%). Postoperative IPSS-voiding (4.5 vs 7.0), and Qmax (18 vs 13.7) in the BOO-only group were significantly better than those in the DU group. Additionally, postoperative IPSS-storage (4.7 vs 6.7), and IPSS-total (9.1 vs 12.3) in the BOO-only group were significantly better than in the DO group (all p < 0.05). In conclusion, early surgical management for men with severe LUTS and associated BPH before secondary degeneration occurs may be beneficial for preserving detrusor function and yield better treatment outcomes. Copyright © 2017. Published by Elsevier Taiwan.

Holmium:YAG Laser Ablation for the Management of Lower Urinary Tract Foreign Bodies Following Incontinence Surgery: A Case Series and Systematic Review.

Science.gov (United States)

Chan, Garson; Mamut, Adiel; Martin, Paul; Welk, Blayne

2016-11-01

The objective of this study was to determine the outcomes associated with the endoscopic removal of foreign bodies (such as mesh or permanent suture) in the lower urinary tract after female stress incontinence surgery with the Holmium:YAG (Ho:YAG) laser, and to systematically review the literature on this topic. A retrospective chart review of 18 consecutive women found to have mesh or suture exposure was performed. All patients underwent Ho:YAG laser ablation. A systematic review was performed to identify literature addressing the endoscopic management of mesh/suture exposure after stress incontinence surgery. Between November 2011 and February 2016, 18 women underwent Ho:YAG laser ablation of exposed mesh or suture. Presenting symptoms included lower urinary tract symptoms, pelvic pain, incontinence, or recurrent urinary tract infections. Thirteen women had a previous synthetic midurethral sling and five had a prior retropubic suspension. The median age was 58 years (interquartile range [IQR] 50-60) and median follow-up was 2 years (IQR 1-2). Four patients (22%) had residual mesh after the first procedure, requiring a repeat endoscopic procedure. Only one patient had a small amount of asymptomatic residual mesh on cystoscopy after the final procedure. Only minor postoperative complications were observed. Eight patients had stress incontinence and four underwent operative treatment for this. In our systematic review, we identified 16 case series, which described a total of 158 patients. Women most commonly presented with voiding symptoms or incontinence. Based on the synthesis of these data, repeat procedures were necessary in 16% and vesicovaginal fistula occurred in 2%. Recurrent/persistent stress incontinence was present in 20%, and of these patients, 3/4 underwent a new stress incontinence procedure. Both our case series and the systematic review of the literature demonstrated that endoscopic treatment of lower urinary tract foreign bodies after stress

Agreement Between Michigan State University and Lodge 141, Fraternal Order of Police, Michigan State University Division, July 1, 1974.

Science.gov (United States)

Michigan State Univ., East Lansing.

This agreement, entered into July 1, 1974, is between the Board of Trustees of Michigan State University and Lodge 141 of the Fraternal Order of Police, Michigan State University Division. It is the intent and purpose of this agreement to assure sound and mutually beneficial working and economic relationships between the parties, to provide an…

In Vitro Comparison of Holmium Lasers: Evidence for Shorter Fragmentation Time and Decreased Retropulsion Using a Modern Variable-pulse Laser.

Science.gov (United States)

Bell, John Roger; Penniston, Kristina L; Nakada, Stephen Y

2017-09-01

To compare the performance of variable- and fixed-pulse lasers on stone phantoms in vitro. Seven-millimeter stone phantoms were made to simulate calcium oxalate monohydrate stones using BegoStone plus. The in vitro setting was created with a clear polyvinyl chloride tube. For each trial, a stone phantom was placed at the open end of the tubing. The Cook Rhapsody H-30 variable-pulse laser was tested on both long- and short-pulse settings and was compared to the Dornier H-20 fixed-pulse laser; 5 trials were conducted for each trial arm. Fragmentation was accomplished with the use of a flexible ureteroscope and a 273-micron holmium laser fiber using settings of 1 J × 12 Hz. The treatment time (in minute) for complete fragmentation was recorded as was the total retropulsion distance (in centimeter) during treatment. Laser fibers were standardized for all repetitions. The treatment time was significantly shorter with the H-30 vs the H-20 laser (14.3 ± 2.5 vs 33.1 ± 8.9 minutes, P = .008). There was no difference between the treatment times using the long vs short pulse widths of the H-30 laser (14.4 ± 3.4 vs 14.3 ± 1.7 minutes, P = .93). Retropulsion differed by laser type and pulse width, H-30 long pulse (15.8 ± 5.7 cm), H-30 short pulse (54.8 ± 7.1 cm), and H-20 (33.2 ± 12.5 cm) (P laser fragmented stone phantoms in half the time of the H-20 laser regardless of the pulse width. Retropulsion effects differed between the lasers, with the H-30 causing the least retropulsion. Longer pulse widths result in less stone retropulsion. Copyright © 2017 Elsevier Inc. All rights reserved.

NEUTRON-PROTON ANALYZING POWER DATA AT 7.6, 12.0, 14.1, 16.0, 18.5 MeV

OpenAIRE

Weisel , G.; Tornow , W.; Howell , C.; Felsher , P.; Alohali , M.; Chen , Z.; Walter , R.; Lambert , J.; Treado , P.

1990-01-01

Neutron-Proton Ay(θ) measurements have been made at 7.6, 12.0, 14.1, 16.0, and 18.5 MeV. A sensitivity study establishes the importance of Ay(θ) in determining the 3P0, 1, 2 phase shifts in n-p scattering. The data are compared to the predictions of two phase-shift studies (one of which incorporates CIB effects), and the Paris and Bonn NN potenials.

Comparison of Predictive Factors for Postoperative Incontinence of Holmium Laser Enucleation of the Prostate by the Surgeons’ Experience During Learning Curve

Directory of Open Access Journals (Sweden)

Katsumi Shigemura

2016-03-01

Full Text Available Purpose: To detect predictive factors for postoperative incontinence following holmium laser enucleation of the prostate (HoLEP according to surgeon experience (beginner or experienced and preoperative clinical data. Methods: Of 224 patients, a total of 203 with available data on incontinence were investigated. The potential predictive factors for post-HoLEP incontinence included clinical factors, such as patient age, and preoperative urodynamic study results, including detrusor overactivity (DO. We also classified the surgeons performing the procedure according to their HoLEP experience: beginner (<21 cases and experienced (≥21 cases. Results: Our statistical data showed DO was a significant predictive factor at the super-short period (the next day of catheter removal: odds ratio [OR], 3.375; P=0.000. Additionally, patient age, surgeon mentorship (inverse correlation, and prostate volume were significant predictive factors at the 1-month interval after HoLEP (OR, 1.072; P=0.004; OR, 0.251; P=0.002; and OR, 1.008; P=0.049, respectively. With regards to surgeon experience, DO and preoperative International Prostate Symptom Score (inverse at the super-short period, and patient age and mentorship (inverse correlation at the 1-month interval after HoLEP (OR, 3.952; P=0.002; OR, 1.084; P=0.015; and OR,1.084; P=0.015; OR, 0.358; P=0.003, respectively were significant predictive factors for beginners, and first desire to void (FDV at 1 month after HoLEP (OR, 1.009; P=0.012 was a significant predictive factor for experienced surgeons in multivariate analysis. Conclusions: Preoperative DO, IPSS, patient age, and surgeon mentorship were significant predictive factors of postoperative patient incontinence for beginner surgeons, while FDV was a significant predictive factors for experienced surgeons. These findings should be taken into account by surgeons performing HoLEP to maximize the patient’s quality of life with regards to urinary continence.

Neutron-proton analyzing power data at 7.6, 12.0, 14.1, 16.0, 18.5 MeV

International Nuclear Information System (INIS)

Weisel, G.J.; Tornow, W.; Howell, C.R.; Felsher, P.D.; Alohali, M.; Chen, Z.P.; Walter, R.L.; Lambert, J.M.; Treado, P.A.

1990-01-01

Neutron-Proton A y (θ) measurements have been made at 7.6, 12.0, 14.1, 16.0, and 18.5 MeV. A sensitivity study establishes the importance of A y (θ) in determining the 3 P 0,1,2 phase shifts in n-p scattering. The data are compared to the predictions of two phase-shift studies (one of which incorporates CIB effects), and the Paris and Bonn NN potentials

Inner Bremsstrahlung accompanying the non-unique first forbidden β-decay of 141Ce

International Nuclear Information System (INIS)

Khalil, E.I.

1993-01-01

The inner Bremsstrahlung (I.B.) spectrum accompanying the β-decay of 141 Ce (non-unique first forbidden β-transition) was measured using a single channel scintillation spectrometer. The measured I.B. was analyzed by the variable width peeling-off method. This analyzed and corrected I.B. was compared with those calculated according to the original theories of Knipp and Uhlenbeck as well as of Bloch (KUB), the coulomb corrected theories of Lewis and Ford and of Nilsson, and according to detour-transition calculations of the Ford and Martin theory. Ths shape correction factor suggested by Konopinski and Uhlenbeck on the Fermi β-decay theory was applied to the calculated I.B. based on Nilsson's theory (modified KUB theory). The experimental results are in better agreement with the modified KUB theory than the other theories. (orig.)

The small-molecule Bcl-2 inhibitor HA14-1 sensitizes cervical cancer cells, but not normal fibroblasts, to heavy-ion radiation

International Nuclear Information System (INIS)

Hamada, Nobuyuki; Kataoka, Keiko; Sora, Sakura; Hara, Takamitsu; Omura-Minamisawa, Motoko; Funayama, Tomoo; Sakashita, Tetsuya; Nakano, Takashi; Kobayashi, Yasuhiko

2008-01-01

This is the first study to demonstrate that the small-molecule Bcl-2 inhibitor HA14-1 renders human cervical cancer cells and their Bcl-2 overexpressing radioresistant counterparts, but not normal fibroblasts, more susceptible to heavy ions. Thus, Bcl-2 may be an attractive target for improving the efficacy of heavy-ion therapy

Role of DNA methylation in miR-200c/141 cluster silencing in invasive breast cancer cells

OpenAIRE

Neves, Rui; Scheel, Christina; Weinhold, Sandra; Honisch, Ellen; Iwaniuk, Katharina M; Trompeter, Hans-Ingo; Niederacher, Dieter; Wernet, Peter; Santourlidis, Simeon; Uhrberg, Markus

2010-01-01

Abstract Background The miR-200c/141 cluster has recently been implicated in the epithelial to mesenchymal transition (EMT) process. The expression of these two miRNAs is inversely correlated with tumorigenicity and invasiveness in several human cancers. The role of these miRNAs in cancer progression is based in part on their capacity to target the EMT activators ZEB1 and ZEB2, two transcription factors, which in turn repress expression of E-cadherin. Little is known about the regulation of t...

Visual internal urethrotomy for management of urethral strictures in boys: a comparison of short-term outcome of holmium laser versus cold knife.

Science.gov (United States)

Aboulela, Waseem; ElSheemy, Mohammed S; Shoukry, Mahmoud; Shouman, Ahmed M; Shoukry, Ahmed I; Ghoneima, Waleed; El Ghoneimy, Mohamed; Morsi, Hany A; Mohsen, Mostafa Abdel; Badawy, Hesham

2018-04-01

To compare efficacy and safety of visual internal urethrotomy (VIU) using holmium laser (Ho:YAG) (group A) versus cold knife (group B) in children with urethral strictures. It may be the first comparative study on this issue in children. This study compared Ho:YAG group, which was evaluated prospectively from January 2014 till January 2016, versus cold knife group, which was a historical control performed from March 2008 till February 2010. Children ≤ 13 years old with urethral strictures ≤ 1.5 cm were included successively. Recurrent cases, congenital obstructions and cases with complete arrest of dye in voiding cystourethrography were excluded. Scar tissue was incised at twelve o'clock. Outcome was compared using Student's t, Mann-Whitney, Chi-square or Fisher exact tests as appropriate. Each group included 21 patients. Mean age was 6.27 ± 3.23 (2-13) years old. Mean stricture length was 1.02 versus 1 cm in group A versus B, respectively (p = 0.862). Ten cases of penile/bulbous strictures and another 11 cases of membranous strictures were found in each group. There was no significant difference between both groups in preoperative data. Success rate for initial VIU was 66.7% in group A versus 38% in group B (p = 0.064). This was associated with significantly higher Q max in group A (mean 16.52 vs 12.09 ml/s; p = 0.03). Success rate after two trials of VIU was 76.2% for group A and 47.61% for group B (p = 0.057). No complications were reported in both groups. Laser VIU has a higher success rate than cold knife VIU for urethral strictures ≤ 1.5 cm in children with significantly higher Q max . Both are easy to perform, low invasive and safe.

Analysing power for neutron-proton scattering at 14.1 MeV

International Nuclear Information System (INIS)

Brock, J.E.; Chisholm, A.; Duder, J.C.; Garrett, R.; Poletti, J.L.

1981-01-01

The analysing power Asub(y)(theta) for neutron-proton scattering has been measured at 14.1 MeV for c.m. angles between 50 0 and 157 0 . A polarized neutron beam was produced by the reaction 3 H(d,n) 4 He at 110 keV, using polarized deuterons from an atomic beam polarized ion source. Liquid and plastic scintillators were used for proton targets and the scattered particles were detected in an array of platic scintillators. Use of the associated alpha technique, multi-parameter recording of events and off-line computer treatment led to very low backgrounds. The results differ significantly from the predictions of the phase-shift analyses of Yale IV, Livermore X and Arndt et al. We find, however, excellent agreement with the predictions of the Paris potential of Lacombe et al. Existing n-p analysing power results up to 30 MeV are surveyed and found to be consistent. An attempt was made to look for an isospin splitting of the triplet P-wave phase shifts. (orig.)

Sputtering of vanadium and niobium under 14.1 MeV neutron impact

International Nuclear Information System (INIS)

Kaminsky, M.; Das, S.K.

1976-01-01

The recent studies of particle emission from cold-rolled and annealed niobium under 14.1-MeV neutron impact were extended to a heavily etched, polycrystalline niobium surface and to cold worked vanadium surfaces with different degrees of microstructure. The type and amount of material released and deposited on collector surfaces facing the irradiated targets were determined by three analytical techniques. Two types of deposits were found for certain types of surfaces--one in the form of chunks; the other as a fractional atom layer covering the surface. The chunks vary significantly in size. The small number of chunks observed suggests that the ejection of chunks is a relatively rare event in comparison to the total number of primary knock-on events produced by 14-MeV neutrons in near surface regions. Estimates of the total sputtering yield based on the chunk deposits and on the fractional atom layer deposit will be given

Expression and Purification of the Recombinant Cytochrome P450 CYP141 Protein of Mycobacterium Tuberculosis as a Diagnostic Tool and Vaccine Production.

Science.gov (United States)

Heidari, Reza; Rabiee-Faradonbeh, Mohammad; Darban-Sarokhalil, Davood; Alvandi, Amirhooshang; Abdian, Narges; Aryan, Ehsan; Soleimani, Neda; Gholipour, Abolfazl

2015-06-01

Tuberculosis (TB) is regarded as a health problem worldwide, particularly in developing countries. Mycobacterium tuberculosis (M. tuberculosis) is the cause of this disease. Approximately two billion people worldwide are infected by M. tuberculosis and annually about two million individuals die in consequence. Forty million people are estimated to die because of M. tuberculosis over the next 25 years if the measures for controlling this infection are not extensively developed. In the vaccination field, Bacillus Calmette-Guérin (BCG) is still the most effective vaccine but it shows no efficacy in adult pulmonary patients. One of the other problems regarding TB is its appropriate diagnosis. In this experimental study, the recombinant cytochrome P450 CYP141 protein of M. tuberculosis was expressed and purified to be used as a vaccine candidate and diagnostic purpose in subsequent investigations. The optimization of the cytochrome P450 CYP141 protein expression was evaluated in different conditions. Then, this protein was purified with a resin column of nickel-nitrilotriacetic acid and investigated via Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) and Western Blotting. The highest expression of the cytochrome P450 CYP141 protein was obtained by the addition of 1 mM of isopropyl β-D-1-thiogalactopyranoside (IPTG) to the bacterial culture grown to an optical density at 600 nm (OD600) of 0.6, 16 hours after induction. This protein was subsequently purified with a purification of higher than 80%. The results of Western Blotting indicated that the purified protein was specifically detected. In this experimental study, for the first time in Iran the expression and purification of this recombinant protein was done successfully. This recombinant protein could be used as a vaccine candidate and diagnostic purpose in subsequent investigations.

K2-141 b A 5-M-circle plus super-Earth transiting a K7V star every 6.7 h

DEFF Research Database (Denmark)

Barragan, O.; Gandolfi, D.; Dai, F.

2018-01-01

We report on the discovery of K2-141 b (EPIC 246393474 b), an ultra-short-period super-Earth on a 6.7 h orbit transiting an active K7V star based on data from K2 campaign 12. We confirmed the planet's existence and measured its mass with a series of follow-up observations: seeing-limited MuSCAT i...

Experimental measurements and nuclear model calculations on the excitation functions of $^{nat}Ce(^{3}He, xn)$ and $^{141}$therapeutic radionuclide $^{140}$Nd

CERN Document Server

Hilgers, K; Coenen, H H; Qaim, S M

2005-01-01

For production of the therapy related Auger electron emitting neutron deficient nuclide /sup 140/Nd (T/sub fraction 1/2/=3.37d) two routes were investigated: the nuclear reaction range from 15 to 36 MeV and the reaction /sup 141/Pr(p,2n)/sup 140isotopes, namely /sup 139/Nd and /sup 141/Nd, as well as to cerium(IV)-oxide and praseodymium (III)-oxide were obtained by sedimentation and the conventional stacked-foil technique was used for cross section measurements. All the experimental data obtained in this work were compared with the results of theoretical calculations using the exciton model code ALICE-IPPE as well as with literature experimental data, if available. In general, good agreement between experimental and theoretical results was found. The theoretical thick target yields of all the product nuclides were calculated from the measured excitation functions. The theoretical thick target yield of amounts to 12 MBq/mu Acenterdoth and over the energy range E/sub p/=30rightward arrow15 Me V to 210 MBq/mu; A...

Measurements of analyzing power for 2H(n,n)2H scattering at 14.1 MeV and comparisons to 2H(p,p)2H

International Nuclear Information System (INIS)

Tornow, W.; Byrd, R.C.; Howell, C.R.; Pedroni, R.S.; Walter, R.L.

1983-01-01

Data for the analyzing power A/sub y/(theta) for elastic scattering of neutrons from deuterons have been measured at 14.1 MeV for the range from 30 0 to 153 0 (c.m.) to accuracies between +- 0.003 and +- 0.006. The results are compared to previous n-d data at 14 MeV and are in significant disagreement with the most recent measurement. The present data are in excellent agreement with a Faddeev calculation by Doleschall. The data are also very similar to p-d scattering data at 14.1 MeV, although systematic deviations are observed at forward angles and near the maximum of A/sub y/(theta) at 130 0 . Recent calculations indicate that Coulomb effects can explain most of these differences, although some features will require further investigation

Holmium laser enucleation versus transurethral resection in patients with benign prostate hyperplasia: an updated systematic review with meta-analysis and trial sequential analysis.

Directory of Open Access Journals (Sweden)

Sheng Li

Full Text Available BACKGROUND: Holmium laser enucleation (HoLEP in surgical treatment of benign prostate hyperplasia (BPH potentially offers advantages over transurethral resection of the prostate (TURP. METHODS: Published randomized controlled trials (RCTs were identified from PubMed, EMBASE, Science Citation Index, and the Cochrane Library up to October 10, 2013 (updated on February 5, 2014. After methodological quality assessment and data extraction, meta-analysis was performed using STATA 12.0 and Trial Sequential Analysis (TSA 0.9 software. RESULTS: Fifteen studies including 8 RCTs involving 855 patients met the criteria. The results of meta-analysis showed that: a efficacy indicators: there was no significant difference in quality of life between the two groups (P>0.05, but compared with the TURP group, Qmax was better at 3 months and 12 months, PVR was less at 6, 12 months, and IPSS was lower at 12 months in the HoLEP, b safety indicators: compared with the TURP, HoLEP had less blood transfusion (RR 0.17, 95% CI 0.06 to 0.47, but there was no significant difference in early and late postoperative complications (P>0.05, and c perioperative indicators: HoLEP was associated with longer operation time (WMD 14.19 min, 95% CI 6.30 to 22.08 min, shorter catheterization time (WMD -19.97 h, 95% CI -24.24 to -15.70 h and hospital stay (WMD -25.25 h, 95% CI -29.81 to -20.68 h. CONCLUSIONS: In conventional meta-analyses, there is no clinically relevant difference in early and late postoperative complications between the two techniques, but HoLEP is preferable due to advantage in the curative effect, less blood transfusion rate, shorter catheterization duration time and hospital stay. However, trial sequential analysis does not allow us to draw any solid conclusion in overall clinical benefit comparison between the two approaches. Further large, well-designed, multicentre/international RCTs with long-term data and the comparison between the two approaches remain open.

The 3D-HST Survey: Hubble Space Telescope WFC3/G141 Grism Spectra, Redshifts, and Emission Line Measurements for ~ 100,000 Galaxies

Science.gov (United States)

Momcheva, Ivelina G.; Brammer, Gabriel B.; van Dokkum, Pieter G.; Skelton, Rosalind E.; Whitaker, Katherine E.; Nelson, Erica J.; Fumagalli, Mattia; Maseda, Michael V.; Leja, Joel; Franx, Marijn; Rix, Hans-Walter; Bezanson, Rachel; Da Cunha, Elisabete; Dickey, Claire; Förster Schreiber, Natascha M.; Illingworth, Garth; Kriek, Mariska; Labbé, Ivo; Ulf Lange, Johannes; Lundgren, Britt F.; Magee, Daniel; Marchesini, Danilo; Oesch, Pascal; Pacifici, Camilla; Patel, Shannon G.; Price, Sedona; Tal, Tomer; Wake, David A.; van der Wel, Arjen; Wuyts, Stijn

2016-08-01

We present reduced data and data products from the 3D-HST survey, a 248-orbit HST Treasury program. The survey obtained WFC3 G141 grism spectroscopy in four of the five CANDELS fields: AEGIS, COSMOS, GOODS-S, and UDS, along with WFC3 H 140 imaging, parallel ACS G800L spectroscopy, and parallel I 814 imaging. In a previous paper, we presented photometric catalogs in these four fields and in GOODS-N, the fifth CANDELS field. Here we describe and present the WFC3 G141 spectroscopic data, again augmented with data from GO-1600 in GOODS-N (PI: B. Weiner). We developed software to automatically and optimally extract interlaced two-dimensional (2D) and one-dimensional (1D) spectra for all objects in the Skelton et al. (2014) photometric catalogs. The 2D spectra and the multi-band photometry were fit simultaneously to determine redshifts and emission line strengths, taking the morphology of the galaxies explicitly into account. The resulting catalog has redshifts and line strengths (where available) for 22,548 unique objects down to {{JH}}{IR}≤slant 24 (79,609 unique objects down to {{JH}}{IR}≤slant 26). Of these, 5459 galaxies are at z\\gt 1.5 and 9621 are at 0.7\\lt z\\lt 1.5, where Hα falls in the G141 wavelength coverage. The typical redshift error for {{JH}}{IR}≤slant 24 galaxies is {σ }z≈ 0.003× (1+z), I.e., one native WFC3 pixel. The 3σ limit for emission line fluxes of point sources is 2.1× {10}-17 erg s-1 cm-2. All 2D and 1D spectra, as well as redshifts, line fluxes, and other derived parameters, are publicly available.18

The influence of age on the effectiveness of DTPA in reducing 141Ce retention in rats

International Nuclear Information System (INIS)

Kargacin, B.; Kostial, K.; Landeka, M.

1983-01-01

The influence of age on the effectiveness of chelation treatment in reducing retention of radioactive cerium was studied in two- and six-week-old albino rats. 141 Ce was administered intraperitoneally, followed immediately and after 24 and 48 hours by intraperitoneal administration of the tri-sodium calcium salt of diethylenetriaminepentaacetic acid-Na 3 (CaDTPA) at 380 μmol/kg body weight. The whole-body retention was determined 2, 4 and 6 days after radiocerium administration, when the animals were killed and the organ retention was determined. The chelation therapy significantly reduced the whole-body retention of radiocerium. This treatment was however twice as effective in older as in younger animals. (author)

The complexes of Ho with methylenediphosphonate and 1 hydroxyethylidenephosphonate

International Nuclear Information System (INIS)

Vanura, P.; Jedinakova-Krizova, V.; Hakenova, L.; Munesawa, Y.

1999-01-01

The composition and stability of holmium methylenediphosphonate (MDP) and 1-hydroxyethylidenephosphonate (HEDP) complexes in the aqueous solution of 0.1 M NaCl at the temperature of 25 grad C were studied by potentiometric titration methods. The complexes of the composition HoH n L have been found in the aqueous solution if the concentration of the ligand is higher than the concentration of holmium. The protonation constants of both acids and stability constants of all complexes were determined and the comparison with literature data of analogical complexes of other lanthanides was performed. (authors)

Oil-spill risk analysis: Central and western Gulf of Mexico Outer Continental Shelf, Lease Sales 139 and 141. Final report

International Nuclear Information System (INIS)

Johnson, W.R.; Lear, E.M.

1992-02-01

The Federal Government has proposed to offer Outer Continental Shelf lands in the Gulf of Mexico for oil and gas leasing. Because oil spills may occur from activities associated with offshore oil production, the Minerals Management Service conducts a formal risk assessment. The effects of oil spills that could occur during oil and gas production must be considered. The report summarizes results of an oil spill risk analysis conducted for the proposed Gulf of Mexico Outer Continental Shelf Lease Sales 139 and 141

Do We Really Need to Wear Proper Eye Protection When Using Holmium:YAG Laser During Endourologic Procedures? Results from an Ex Vivo Animal Model on Pig Eyes.

Science.gov (United States)

Villa, Luca; Cloutier, Jonathan; Compérat, Eva; Kronemberg, Peter; Charlotte, Frederic; Berthe, Laurent; Rouchausse, Yann; Salonia, Andrea; Montorsi, Francesco; Traxer, Olivier

2016-03-01

We sought to evaluate the effect of holmium:yttrium-aluminum-garnet (Ho:YAG) laser exposure on ex vivo pig eyes and to test the protective action of different glasses in preventing eye lesions in case of accident. We pointed the tip of a Ho:YAG laser fiber from different distances (0, 3, 5, 8, 10, and 20 cm, respectively) toward the center of the pupil of the pig eye. The Ho:YAG laser was activated for 1 or 5 seconds at three different settings (0.5 J-20 Hz, 1 J-10 Hz, and 2 J-10 Hz, respectively). The experiment was repeated using laser safety glasses and eyeglasses. A total of 78 pig eyes were used. The effects of the Ho:YAG laser on pig eyes were assessed by histopathology. Comparable laser emission experiments were performed on thermal paper at different distances using different pulse energies. Ho:YAG laser-induced corneal lesions were observed in unprotected eyes, ranging from superficial burning lesions to full-thickness necrotic areas, and were directly related to pulse energy and time of exposure and inversely related to the distance from the eye. When the laser was placed 5 cm or more, no corneal damage was observed regardless of the laser setting and the time of exposure. Similar distance/energy level relationships were observed on thermal paper. No damage was observed to the lens or the retina in any of the Ho-YAG laser-treated eyes or in any of the eyes protected by laser safety and eyeglasses. Ho:YAG lasers can cause damage when set to high energy, but only to the cornea, from close distances (0-5 cm) and in the absence of eye protection. Eyeglasses are equally effective in preventing laser damage as laser safety glasses.

Evaluation of erbium:YAG and holmium:YAG laser radiation and dental hard tissue

Science.gov (United States)

Attrill, David Cameron

Lasers have become increasingly established in medicine as effective alternatives or adjuncts to conventional techniques. In dentistry, several clinical laser systems have been developed and marketed, but their applications have been limited to soft tissue surgery. To date, no laser has been capable of effectively cutting or modifying the highly mineralised dental tissues of enamel and dentine. The aim of this study was to evaluate two new laser systems for use in dentistry through a series of in vitro experiments. Both generic erbium and holmium lasers have theoretically superior operating characteristics over currently established lasers for applications with dental hard tissues. The two lasers investigated in this study were pulsed Er:YAG (lambda=2.94) a.m. and Cr-Tm-Ho:YAG (lambda=2.1mu.m). Both operated with a macropulse duration of approximately 200lambdas, at pulse repetition rates of 2-8Hz and mean pulse energies up to 230mJ. Radiation was focused using CaF[2] lenses (f=50-120mm). The lasers could be operated with or without the addition of a surface water film at the interaction site. Tissue removal efficiency was expressed as a latent heat of ablation (LHA, kJ/cm[3]) using a modification of the technique described by Charlton et al. (1990). The mean LHA's for the Er:YAG laser were 6.24kJ/cm[3] and 22.99kJ/cm[3] with dentine and enamel respectively without water, and 10.07kJ/cm[3] and 18.73kJ/cm[3] for dentine and enamel with water. The Cr-Tm-Ho:YAG laser was unable to effectively remove enamel at the fluences and pulse energies available; the mean LHA's for the Cr-Tm- Ho:YAG laser with dentine were 82.79kJ/cm3 and 57.57kJ/cm3 with and without water respectively. The Cr-Tm-Ho;YAG was approximately 8-9 times less efficient for tissue removal than the Er:YAG system. Er:YAG tissue removal with water was characterised by clean "surgical" cuts, comparable in histological appearance to those obtained using conventional instrumentation. Some thermal disruption

141Ce as a tracer to find the efficient washing method for hair in the analysis of rare earth elements

International Nuclear Information System (INIS)

Tong Shilu

1989-01-01

Various procedures were compared in relation to the removal of 141 Ce exogenously contaminated as well as endogenously incorporated in hair. Extraction efficiency of cerium with hot EDTA was the greatest among the four washing procedures. However, no procedure can effectively remove all exogenous cerium without reducing the endogenous cerium. Among the four procedures evaluated, washing with 0.1 mol/l EDTA (50 deg C, 10 minutes) is recommended before the analysis of rare earth elements in hair because of its efficiency in removing exogenous cerium and causing less loss on endogenous cerium

Peripheral phosphodiesterase 4 inhibition produced by 4-[2-(3,4-Bis-difluoromethoxyphenyl)-2-[4-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)-phenyl]-ethyl]-3-methylpyridine-1-oxide (L-826,141) prevents experimental autoimmune encephalomyelitis

DEFF Research Database (Denmark)

Moore, Craig S.; Earl, Nathalie; Frenette, Richard

2006-01-01

Administration of phosphodiesterase 4 (PDE4) inhibitors suppresses the pathogenesis associated with experimental autoimmune encephalomyelitis (EAE), an animal model of multiple sclerosis (MS). In the present study, we compared the effects of rolipram and 4-[2-(3,4-bis-difluoromethoxyphenyl)-2...... observed. Only L-826,141 at a dose of 30 mg/kg p.o. significantly decreased the clinical severity of EAE compared with vehicle controls. Immunohistochemical detection of the neuronal activity marker Fos confirmed that L-826,141 did not reach concentrations in the central nervous system sufficient...

Diode-pumped two micron solid-state lasers

International Nuclear Information System (INIS)

Elder, I.F.

1997-01-01

This thesis presents an investigation of diode-pumped two micron solid-state lasers, concentrating on a comparison of the cw room temperature operation of Tm:YAP, Tm,Ho:YAP and Tm,Ho:YLF. Dopant concentrations in YAP were 4.2% thulium and 0.28% holmium; in YLF they were 6% thulium and 0.4% holmium. Thermal modelling was carried out in order to provide an insight into the thermal lensing and population distributions in these materials. Laser operation was achieved utilising an end-pumping geometry with a simple two mirror standing wave resonator. The pump source for these experiments was a 3 W laser diode. Maximum output power was achieved with Tm:YAP, generating 730 mW of laser output, representing 42% conversion efficiency in terms of absorbed pump power. Upper bounds on the conversion efficiency of Tm,Ho:YAP and Tm,Ho:YLF laser crystal of 14% and 30% were obtained, with corresponding output powers of 270 and 660 mW. In all three cases, the output beam was TEM 00 in nature. Visible upconversion fluorescence bands in the green and red were identified in Tm,Ho:YAP and Tm,Ho:YLF, with additional blue emission from the latter, all assigned to transitions on holmium. The principal upconversion mechanisms in these materials all involved the holmium first excited state. Upconversion in Tm:YAP was negligible. The spectral output of Tm:YAP consisted of a comb of lines in the range 1.965 to 2.020 μm. For both the double-doped crystals, the laser output was multilongitudinal mode on a single transition, wavelength 2.120 μm in YAP, 2.065 μm in YLF. In the time domain the output of Tm:YAP was dominated by large amplitude spiking, unlike both of the double-doped laser crystals. The long lifetime of the thulium upper laser level (4.4 ms) provided very weak damping of the spiking. Excitation sharing between thulium and holmium, with a measured characteristic lifetime in YAP of 11.9 μs and YLF of 14.8 μs, provided strong damping of any spiking behaviour. (author)

Thermal and pseudoelastic cycling in Cu-14.1Al-4.2Ni (wt%) single crystals

International Nuclear Information System (INIS)

Gastien, R.; Corbellani, C.E.; Sade, M.; Lovey, F.C.

2005-01-01

Thermally and stress induced martensitic transformations between β and a mixture of martensitic structures, β' and γ', were studied in Cu-14.1Al-4.2Ni (wt%) single crystals. In this way information on the relative stability between β' and γ' martensites, compared to the β phase, was obtained. The measurement of electrical resistance as a function of temperature was used to follow the evolution of thermally induced transitions. The stress induced transformations were analyzed in the small temperature range at which the pseudoelastic behavior between β and a mixture of both martensites plays the main role. A clear inhibition of the γ' martensite is detected as the number of cycles increases, no matter which thermodynamic coordinate is varied to induce the phase transition, i.e., temperature or stress. An evaluation of the magnitude of the relative stabilization of the β' martensite compared with γ' was obtained by a suitably designed experiment

Spectral properties and laser performance of Tm, Ho: LuLF4 crystal

Science.gov (United States)

Peng, Haiyan; Zhang, Kun; Zhang, Lianhan; Hang, Yin; Xu, Jianqiu; Tang, Yulong; Cheng, Yan; Xiong, Jing

2008-12-01

LuLiF4 single crystals co-doped with thulium (5%) and holmium (0.5%), which had large size, intact shape and high optical quality, were successfully grown by the medium frequency induction heating Czochralski Technique. The absorption spectrum of the crystals showed that the main absorption peak located at 686 nm and 792nm. At room temperature, LuLiF4 single crystals co-doped with thulium (5%) and holmium (0.5%) were end-pumped by a fiber-coupled laser diode system with pumping wavelength of 795 nm. We achieved power of 50 mw continuous laser output at 2.05 μm wavelength.

Rorschach Comprehensive System data for a sample of 141 adult nonpatients from Denmark.

Science.gov (United States)

Ivanouw, Jan

2007-01-01

A sample (n = 141) of Danish nonpatients 25-50 years of age, never hospitalized with a psychiatric diagnosis and currently employed, was demographically representative of two geographical areas of Copenhagen with different social strain. The sample, as well as 45 persons not currently employed, was tested with the Rorschach (Exner, 1995), MMPI-2 (Butcher, Dahlstrom, Graham, Tellegen, & Kaemmer, 1989), Word Association Test (Ivanouw, 1999b), WAIS Comprehension subtest (Hess, 1974), and SCL-90-R (Olsen, Mortenson, & Bech, 2006). Half of the persons contacted volunteered for the study. There was no difference in rate of volunteering between a standard no-feedback condition and a feedback condition; the latter, however, tended to attract more psychologically resourceful persons. The employed persons tended to appear healthier than the not employed. Response style of the subjects, quality of the Rorschach protocols, reliability of scoring, and the effect of the data being grouped on geographical area and examiner were examined. Form level, color, texture, cooperative movement, and EA were lower than in the Comprehensive System (CS; n = 450) sample, but higher than in nine international nonpatient Rorschach studies. Unique for the Danish sample was a low number of animal movement answers. The Rorschach data showed women to be healthier than men. Differences in Rorschach variables based on educational level were small.

High-pressure phase transition in Ho2O3

International Nuclear Information System (INIS)

Lonappan, Dayana; Shekar, N.V. Chandra; Ravindran, T.R.; Sahu, P. Ch.

2010-01-01

High-pressure X-ray diffraction and Raman studies on holmium sesquioxide (Ho 2 O 3 ) have been carried out up to a pressure of ∼17 GPa in a diamond-anvil cell at room temperature. Holmium oxide, which has a cubic or bixbyite structure under ambient conditions, undergoes an irreversible structural phase transition at around 9.5 GPa. The high-pressure phase has been identified to be low symmetry monoclinic type. The two phases coexist to up to about 16 GPa, above which the parent phase disappears. The high-pressure laser-Raman studies have revealed that the prominent Raman band ∼370 cm -1 disappears around the similar transition pressure. The bulk modulus of the parent phase is reported.

Advances in laser technology and fibre-optic delivery systems in lithotripsy.

Science.gov (United States)

Fried, Nathaniel M; Irby, Pierce B

2018-06-08

The flashlamp-pumped, solid-state holmium:yttrium-aluminium-garnet (YAG) laser has been the laser of choice for use in ureteroscopic lithotripsy for the past 20 years. However, although the holmium laser works well on all stone compositions and is cost-effective, this technology still has several fundamental limitations. Newer laser technologies, including the frequency-doubled, double-pulse YAG (FREDDY), erbium:YAG, femtosecond, and thulium fibre lasers, have all been explored as potential alternatives to the holmium:YAG laser for lithotripsy. Each of these laser technologies is associated with technical advantages and disadvantages, and the search continues for the next generation of laser lithotripsy systems that can provide rapid, safe, and efficient stone ablation. New fibre-optic approaches for safer and more efficient delivery of the laser energy inside the urinary tract include the use of smaller-core fibres and fibres that are tapered, spherical, detachable or hollow steel, or have muzzle brake distal fibre-optic tips. These specialty fibres might provide advantages, including improved flexibility for maximal ureteroscope deflection, reduced cross section for increased saline irrigation rates through the working channel of the ureteroscope, reduced stone retropulsion for improved stone ablation efficiency, and reduced fibre degradation and burnback for longer fibre life.

Different lasers in the treatment of benign prostatic hyperplasia: a network meta-analysis

Science.gov (United States)

Zhang, Xingming; Shen, Pengfei; He, Qiying; Yin, Xiaoxue; Chen, Zhibin; Gui, Haojun; Shu, Kunpeng; Tang, Qidun; Yang, Yaojing; Pan, Xiuyi; Wang, Jia; Chen, Ni; Zeng, Hao

2016-01-01

All available surgical treatments for benign prostatic hyperplasia (BPH) have their individual advantages or disadvantages. However, the lack of head-to-head studies comparing different surgeries makes it unavailable to conduct direct analysis. To compare the efficacy and safety among different lasers and transurethral resection of prostate (TURP) for BPH, randomized controlled trials were searched in MEDLINE, EMBASE, Cochrane library, WHO International Clinical Trial Registration Platform, and Clinical Trial.gov by 2015.5; and the effectiveness-, perioperation- and complication-related outcomes were assessed by network meta-analysis. 36 studies involving 3831 patients were included. Holmium laser through resection and enucleation had the best efficacy in maximum flow rate. Thulium laser through vapo-resection was superior in improving international prostate symptom score and holmium laser through enucleation was the best for post-voiding residual volume improvement. Diode laser through vaporization was the rapidest in removing postoperative indwelling catheter, while TURP was the longest. TURP required the longest hospitalization and thulium laser through vapo-resection was relatively shorter. Holmium and thulium lasers seem to be relatively better in surgical efficacy and safety, so that these two lasers might be preferred in selection of optimal laser surgery. Actually, more large-scale and high quality head-to-head RCTs are suggested to validate the conclusions. PMID:27009501

A quasi-optical and corrugated waveguide microwave transmission system for simultaneous dynamic nuclear polarization NMR on two separate 14.1 T spectrometers

Science.gov (United States)

Dubroca, Thierry; Smith, Adam N.; Pike, Kevin J.; Froud, Stuart; Wylde, Richard; Trociewitz, Bianca; McKay, Johannes; Mentink-Vigier, Frederic; van Tol, Johan; Wi, Sungsool; Brey, William; Long, Joanna R.; Frydman, Lucio; Hill, Stephen

2018-04-01

Nuclear magnetic resonance (NMR) is an intrinsically insensitive technique, with Boltzmann distributions of nuclear spin states on the order of parts per million in conventional magnetic fields. To overcome this limitation, dynamic nuclear polarization (DNP) can be used to gain up to three orders of magnitude in signal enhancement, which can decrease experimental time by up to six orders of magnitude. In DNP experiments, nuclear spin polarization is enhanced by transferring the relatively larger electron polarization to NMR active nuclei via microwave irradiation. Here, we describe the design and performance of a quasi-optical system enabling the use of a single 395 GHz gyrotron microwave source to simultaneously perform DNP experiments on two different 14.1 T (1H 600 MHz) NMR spectrometers: one configured for magic angle spinning (MAS) solid state NMR; the other configured for solution state NMR experiments. In particular, we describe how the high power microwave beam is split, transmitted, and manipulated between the two spectrometers. A 13C enhancement of 128 is achieved via the cross effect for alanine, using the nitroxide biradical AMUPol, under MAS-DNP conditions at 110 K, while a 31P enhancement of 160 is achieved via the Overhauser effect for triphenylphosphine using the monoradical BDPA under solution NMR conditions at room temperature. The latter result is the first demonstration of Overhauser DNP in the solution state at a field of 14.1 T (1H 600 MHz). Moreover these results have been produced with large sample volumes (∼100 μL, i.e. 3 mm diameter NMR tubes).

Discussion of “Geology and diamond distribution of the 140/141 kimberlite, Fort à la Corne, central Saskatchewan, Canada”, by A. Berryman, B.H. Scott-Smith and B.C. Jellicoe (Lithos v. 76, p. 99 114)

Science.gov (United States)

Kjarsgaard, Bruce A.; Leckie, Dale A.; Zonneveld, John-Paul

2007-09-01

A wide variety of geological data and geological observations by numerous geoscientists do not support a two-stage crater excavation and in-fill model, or a champagne glass-shaped geometry for the 169 or 140/141 kimberlite bodies in the Fort à la Corne kimberlite field, Saskatchewan as described by Berryman, A., Scott Smith, B.H., Jellicoe, B., (2004). Rather, these kimberlite bodies are best described as polygenetic kimberlite tephra cones and tuff rings with associated feeder vents of variable geometry as shown by previous workers for the 169 kimberlite, the 140/141 kimberlite and the Star kimberlite. The domal tephra cone geometry is preserved due to burial by conformable Cretaceous marine mudstones and siltstones and is not an artifact of Quaternary glacial processes.

Endovascular management of dural carotid-cavernous sinus fistulas in 141 patients

Energy Technology Data Exchange (ETDEWEB)

Kirsch, M. [Alfried Krupp Krankenhaus, Klinik fuer Radiologie und Neuroradiologie, Essen (Germany); Universitaetsklinikum Greifswald, Institut fuer Diagnostische Radiologie und Neuroradiologie, Greifswald (Germany); Henkes, H.; Liebig, T.; Weber, W.; Golik, S.; Kuehne, D. [Alfried Krupp Krankenhaus, Klinik fuer Radiologie und Neuroradiologie, Essen (Germany); Esser, J. [Universitaetsklinikum Essen, Zentrum fuer Augenheilkunde, Essen (Germany)

2006-07-15

Introduction: The purpose of this study was to evaluate the single-centre experience with transvenous coil treatment of dural carotid-cavernous sinus fistulas. Methods: Between November 1991 and December 2005, a total of 141 patients (112 female) with dural carotid-cavernous sinus fistula underwent 161 transvenous treatment sessions. The patient files and angiograms were analysed retrospectively. Clinical signs and symptoms included chemosis (94%), exophthalmos (87%), cranial nerve palsy (54%), increased intraocular pressure (60%), diplopia (51%), and impaired vision (28%). Angiography revealed in addition cortical drainage in 34% of the patients. Partial arterial embolization was carried out in 23% of the patients. Transvenous treatment comprised in by far the majority of patients complete filling of the cavernous sinus and the adjacent segment of the superior and inferior ophthalmic vein with detachable coils. Complete interruption of the arteriovenous shunt was achieved in 81% of the patients. A minor residual shunt (without cortical or ocular drainage) remained in 13%, a significant residual shunt (with cortical or ocular drainage) remained in 4%, and the attempted treatment failed in 2%. There was a tendency for ocular pressure-related symptoms to resolve rapidly, while cranial nerve palsy and diplopia improved slowly (65%) or did not change (11%). The 39 patients with visual impairment recovered within the first 2 weeks after endovascular treatment. After complete interruption of the arteriovenous shunt, no recurrence was observed. The transvenous coil occlusion of the superior and inferior ophthalmic veins and the cavernous sinus of the symptomatic eye is a highly efficient and safe treatment in dural carotid-cavernous sinus fistulas. In the majority of patients a significant and permanent improvement in clinical signs and symptoms can be achieved. (orig.)

Solvent hold tank sample results for MCU-17-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017): Quarterly Report

Energy Technology Data Exchange (ETDEWEB)

Fondeur, F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

2017-09-13

A trend summary of four Solvent Hold Tank (SHT) monthly samples; MCU-16-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017) are reported. Analyses of the June SHT sample (MCU-17-141-149) indicated that the modifier (CS-7SB) and the extractant (MaxCalix) concentrations were slightly below (4% each) their nominal recommended levels (169,000 mg/L and 46,400 mg/L respectively). The suppressor (TiDG) level has decreased since the January 2017 measurement but has remained steady in the range of 666 to 705 mg/L, well above the minimum recommended level (479 mg/L), but below the nominal level. The “flat” trends observed in the TiDG, MaxCalix, modifier, and Gamma measurement are consistent with the solvent being idle since January 10, 2017.

Plasma membrane profiling defines an expanded class of cell surface proteins selectively targeted for degradation by HCMV US2 in cooperation with UL141.

Directory of Open Access Journals (Sweden)

Jye-Lin Hsu

2015-04-01

Full Text Available Human cytomegalovirus (HCMV US2, US3, US6 and US11 act in concert to prevent immune recognition of virally infected cells by CD8+ T-lymphocytes through downregulation of MHC class I molecules (MHC-I. Here we show that US2 function goes far beyond MHC-I degradation. A systematic proteomic study using Plasma Membrane Profiling revealed US2 was unique in downregulating additional cellular targets, including: five distinct integrin α-chains, CD112, the interleukin-12 receptor, PTPRJ and thrombomodulin. US2 recruited the cellular E3 ligase TRC8 to direct the proteasomal degradation of all its targets, reminiscent of its degradation of MHC-I. Whereas integrin α-chains were selectively degraded, their integrin β1 binding partner accumulated in the ER. Consequently integrin signaling, cell adhesion and migration were strongly suppressed. US2 was necessary and sufficient for degradation of the majority of its substrates, but remarkably, the HCMV NK cell evasion function UL141 requisitioned US2 to enhance downregulation of the NK cell ligand CD112. UL141 retained CD112 in the ER from where US2 promoted its TRC8-dependent retrotranslocation and degradation. These findings redefine US2 as a multifunctional degradation hub which, through recruitment of the cellular E3 ligase TRC8, modulates diverse immune pathways involved in antigen presentation, NK cell activation, migration and coagulation; and highlight US2's impact on HCMV pathogenesis.

Ca-site substitution induced a metal-insulator transition in manganite CaMnO3

International Nuclear Information System (INIS)

Sousa, D.; Nunes, M.R.; Silveira, C.; Matos, I.; Lopes, A.B.; Melo Jorge, M.E.

2008-01-01

A systematic study of the A-site doping in Mn(IV)-rich perovskite manganites Ca 1-x Ho x MnO 3 , over a large homogeneity range (0.1 ≤ x ≤ 0.4), has been performed. A significant increase in the lattice parameters indicated the presence of mixed valence state of Mn: Mn 3+ and Mn 4+ . The substitution of calcium by holmium also induces strong changes in the electrical properties. We found that small Ho concentration produces an important decrease in the electrical resistivity and induces an electrical transition, the temperature corresponding to the metal-insulator transition (T MI ) shifts with the holmium content. This electrical behavior is attributed to the Mn 3+ ions content and a charge order effect

Association between Virulence Factors and TRAF1/4-1BB/Bcl-xL Expression in Gastric Mucosa Infected with Helicobacter pylori

Directory of Open Access Journals (Sweden)

Fen Wang

2015-01-01

Full Text Available Objective. CagA+/vacAs1+/vacAm1+ Helicobacter pylori upregulates the expression of tumor necrosis factor receptor–associated factor 1 (TRAF1, tumor necrosis factor receptor superfamily member 9 (4-1BB, and B-cell lymphoma-extra large (Bcl-xL in human gastric epithelial cells. We investigated the correlation between cagA/vacAs1/vacAm1 and TRAF1/4-1BB/Bcl-xL expression in gastric mucosal tissue of patients with gastric disorders. Methods. We collected gastric mucosa samples from 35 chronic, nonatrophic gastritis (CG patients, 41 atrophic gastritis patients, 44 intestinal metaplasia with atypical hyperplasia (IM patients, and 28 gastric carcinoma (Ca patients. The expression of  TRAF1, 4-1BB, and Bcl-xL was determined using western blotting. The expression of cagA, vacAs1, and vacAm1 in H. pylori was examined with polymerase chain reaction. Results. The expression of TRAF1, 4-1BB, and Bcl-xL was significantly upregulated in IM and Ca patients (P<0.05 compared with CG. There were more cases of cagA+/vacAs1+/vacAm1+ H. pylori infection in samples with elevated TRAF1, 4-1BB, or Bcl-xL expression (P<0.05. Additionally, there were a remarkably large number of samples with upregulated TRAF1/4-1BB/Bcl-xL expression in cases of cagA+/vacAs1+/vacAm1+ H. pylori infection (44 cases, 67.7%; P<0.05. Conclusions. The pathogenesis of IM and Ca may be promoted by cagA+/vacAs1+/vacAm1+ H. pylori, possibly via upregulated TRAF1, 4-1BB, and Bcl-xL in gastric mucosal tissue.

MERLIN observations of the OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5

International Nuclear Information System (INIS)

Chapman, J.; Cohen, R.J.; Norris, R.P.; Diamond, P.J.; Booth, R.S.

1984-01-01

OH maser emission from the three OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5 has been mapped with an angular resolution of 0.28 arcsec and a velocity resolution of 0.7 km s -1 using the Jodrell Bank MERLIN array. Maps are presented of the 1612-MHz OH emission over individual velocity ranges. The maps are consistent with a uniform expanding shell model, and by fitting such models to the data the angular diameters of the shells have been estimated to an accuracy of approx. 25 per cent. (author)

Nuclear and activation characteristics of materials in 14.1-MeV and 2.5-MeV neutron field

International Nuclear Information System (INIS)

Seki, Yasushi; Takeyasu, Yuuichi.

1988-11-01

The nuclear and activation characteristics of various materials and elements of interest in terms of fusion reactor design are calculated and the results are graphically shown. The elements and materials are placed in a simple geometry modelling a blanket and shield of a fusion reactor. The neutrons with 14.1-MeV and 2.5-MeV energy are generated from the region represented as D-T and D-D plasma, respectively. The following activation characteristics after neutron irradiation are shown for each material and element; 1. Time evolution of induced activity, 2. Time evolution of decay heat, 3. Delayed gamma-ray dose distribution, 4. Decay heat distribution. In addition to the above activation characteristics, nuclear characteristics during the neutron irradiation, e.g. neutron energy spectra, neutron and gamma-ray flux distribution, nuclear heating distributions, and neutron and gamma-ray dose rate are also shown. (author)

The relevance of rare earth elements to nuclear medicine

International Nuclear Information System (INIS)

Cox, P.H.

1998-01-01

Full text: The lanthanides are an interesting series of metallic elements which have almost identical chemical characteristics and which offer a variety of radioisotopes with differing energy spectra suitable for open source therapy. Their inorganic salts tend to form chemically and biological stable colloids which have proved to be useful for intercavity therapies, in particular for synovectomy. Yttrium-90 silicate is a standard product for large joints with a thick synovium whilst for smaller joints Erbium-169, with its shorter tissue penetration, is more widely used for smaller joints to reduce the risk of radiation induced bone necrosis. Recently the development of an inert biodegradable colloid, chitosan, labelled with Holmium 166. for intercavity therapy of cystic brain tumours has been reported. Yttrium-90 has been chelated to peptide and antibody fragments for tumour targeting as a potentially more effective radionuclide than Iodine-131. The search for alternatives to Strontium-89 for the palliative treatment of pain arising from bone metastases has led to the introduction of diphosphonate complexes of Samarium-153, Lutetium-177 and Holmium-166. These complexes are of special interest because the radionuclides can be produced economically in developing countries. Terbium-149, an alpha emitter, has been mentioned as a possible therapeutic radionuclide. Yttrium-90 and Holmium-166 can an both be made available as generator products which is an added potential advantage for developing nuclear medical applications

The phase-in and phase-out of European emissions of HCFC-141b and HCFC-142b under the Montreal Protocol: Evidence from observations at Mace Head, Ireland and Jungfraujoch, Switzerland from 1994 to 2004

Science.gov (United States)

Derwent, R. G.; Simmonds, P. G.; Greally, B. R.; O'doherty, S.; McCulloch, A.; Manning, A.; Reimann, S.; Folini, D.; Vollmer, M. K.

The mixing ratios of HCFC-141b (1,1-dichlorofluoroethane) and HCFC-142b (1-chloro-1,1-difluoroethane) have been rising steadily in baseline air at Mace Head, Ireland over the 10-year period from 1994 to 2004. These HCFCs are widely used replacements for the chlorofluorocarbons phased out under the Montreal Protocol and its subsequent amendments. Analysis of the HCFC content of regionally-polluted air arriving at Mace Head from the European continent shows that European emissions reached a peak during 2000-2001 and have declined subsequently, following the phase-out in their usage. European emissions of HCFC-141b have been further constrained by observations at the High-Alpine Jungfraujoch site. The reductions are consistent with the phase-out of HCFC production and use from the year 2001 onwards mandated by European regulations designed to exceed the requirements of the Montreal Protocol.

Comparison of Ho and Y complexation data obtained by electromigration methods, potentiometry and spectrophotometry

International Nuclear Information System (INIS)

Vinsova, H.; Koudelkova, M.; Ernestova, M.; Jedinakova-Krizova, V.

2003-01-01

Many of holmium and yttrium complex compounds of both organic and inorganic origin have been studied recently from the point of view of their radiopharmaceutical behavior. Complexes with Ho-166 and Y-90 can be either directly used as pharmaceutical preparations or they can be applied in a conjugate form with selected monoclonal antibody. Appropriate bifunctional chelation agents are necessary in the latter case for indirect binding of monoclonal antibody and selected radionuclide. Our present study has been focused on the characterization of radionuclide (metal) - ligand interaction using various analytical methods. Electromigration methods (capillary electrophoresis, capillary isotachophoresis), potentiometric titration and spectrophotometry have been tested from the point of view of their potential to determine conditional stability constants of holmium and yttrium complexes. A principle of an isotachophoretic determination of stability constants is based on the linear relation between logarithms of stability constant and a reduction of a zone of complex. For the calculation of thermodynamic constants using potentiometry it was necessary at first to determine the protonation constants of acid. Those were calculated using the computer program LETAGROP Etitr from data obtained by potentiometric acid-base titration. Consequently, the titration curves of holmium and yttrium with studied ligands and protonation constants of corresponding acid were applied for the calculation of metal-ligand stability constants. Spectrophotometric determination of stability constants of selected systems was based on the titration of holmium and yttrium nitrate solutions by Arsenazo III following by the titration of metal-Arsenazo III complex by selected ligand. Data obtained have been evaluated using the computation program OPIUM. Results obtained by all analytical methods tested in this study have been compared. It was found that direct potentiometric titration technique could not be

A quasi-optical and corrugated waveguide microwave transmission system for simultaneous dynamic nuclear polarization NMR on two separate 14.1 T spectrometers.

Science.gov (United States)

Dubroca, Thierry; Smith, Adam N; Pike, Kevin J; Froud, Stuart; Wylde, Richard; Trociewitz, Bianca; McKay, Johannes; Mentink-Vigier, Frederic; van Tol, Johan; Wi, Sungsool; Brey, William; Long, Joanna R; Frydman, Lucio; Hill, Stephen

2018-04-01

Nuclear magnetic resonance (NMR) is an intrinsically insensitive technique, with Boltzmann distributions of nuclear spin states on the order of parts per million in conventional magnetic fields. To overcome this limitation, dynamic nuclear polarization (DNP) can be used to gain up to three orders of magnitude in signal enhancement, which can decrease experimental time by up to six orders of magnitude. In DNP experiments, nuclear spin polarization is enhanced by transferring the relatively larger electron polarization to NMR active nuclei via microwave irradiation. Here, we describe the design and performance of a quasi-optical system enabling the use of a single 395 GHz gyrotron microwave source to simultaneously perform DNP experiments on two different 14.1 T ( 1 H 600 MHz) NMR spectrometers: one configured for magic angle spinning (MAS) solid state NMR; the other configured for solution state NMR experiments. In particular, we describe how the high power microwave beam is split, transmitted, and manipulated between the two spectrometers. A 13 C enhancement of 128 is achieved via the cross effect for alanine, using the nitroxide biradical AMUPol, under MAS-DNP conditions at 110 K, while a 31 P enhancement of 160 is achieved via the Overhauser effect for triphenylphosphine using the monoradical BDPA under solution NMR conditions at room temperature. The latter result is the first demonstration of Overhauser DNP in the solution state at a field of 14.1 T ( 1 H 600 MHz). Moreover these results have been produced with large sample volumes (∼100 µL, i.e. 3 mm diameter NMR tubes). Copyright © 2018 Elsevier Inc. All rights reserved.

Impact of human-associated Escherichia coli clonal groups in Antarctic pinnipeds: presence of ST73, ST95, ST141 and ST131.

Science.gov (United States)

Mora, Azucena; García-Peña, Francisco Javier; Alonso, María Pilar; Pedraza-Diaz, Susana; Ortega-Mora, Luis Miguel; Garcia-Parraga, Daniel; López, Cecilia; Viso, Susana; Dahbi, Ghizlane; Marzoa, Juan; Sergeant, Martin J; García, Vanesa; Blanco, Jorge

2018-03-16

There is growing concern about the spreading of human microorganisms in relatively untouched ecosystems such as the Antarctic region. For this reason, three pinniped species (Leptonychotes weddellii, Mirounga leonina and Arctocephalus gazella) from the west coast of the Antartic Peninsula were analysed for the presence of Escherichia spp. with the recovery of 158 E. coli and three E. albertii isolates. From those, 23 harboured different eae variants (α1, β1, β2, ε1, θ1, κ, ο), including a bfpA-positive isolate (O49:H10-A-ST206, eae-k) classified as typical enteropathogenic E. coli. Noteworthy, 62 of the 158 E. coli isolates (39.2%) exhibited the ExPEC status and 27 (17.1%) belonged to sequence types (ST) frequently occurring among urinary/bacteremia ExPEC clones: ST12, ST73, ST95, ST131 and ST141. We found similarities >85% within the PFGE-macrorrestriction profiles of pinniped and human clinic O2:H6-B2-ST141 and O16:H5/O25b:H4-B2-ST131 isolates. The in silico analysis of ST131 Cplx genomes from the three pinnipeds (five O25:H4-ST131/PST43-fimH22-virotype D; one O16:H5-ST131/PST506-fimH41; one O25:H4-ST6252/PST9-fimH22-virotype D1) identified IncF and IncI1 plasmids and revealed high core-genome similarities between pinniped and human isolates (H22 and H41 subclones). This is the first study to demonstrate the worrisome presence of human-associated E. coli clonal groups, including ST131, in Antarctic pinnipeds.

SLC52A2 [p.P141T] and SLC52A3 [p.N21S] causing Brown-Vialetto-Van Laere Syndrome in an Indian patient: First genetically proven case with mutations in two riboflavin transporters.

Science.gov (United States)

Udhayabanu, Tamilarasan; Subramanian, Veedamali S; Teafatiller, Trevor; Gowda, Vykuntaraju K; Raghavan, Varun S; Varalakshmi, Perumal; Said, Hamid M; Ashokkumar, Balasubramaniem

2016-11-01

Brown-Vialetto-Van Laere Syndrome (BVVLS), a rare neurological disorder characterized by bulbar palsies and sensorineural deafness, is mainly associated with defective riboflavin transporters encoded by the SLC52A2 and SLC52A3 genes. Here we present a 16-year-old BVVLS patient belonging to a five generation consanguineous family from Indian ethnicity with two homozygous missense mutations viz., c.421C>A [p.P141T] in SLC52A2 and c.62A>G [p.N21S] in SLC52A3. Functional characterization based on 3 H-riboflavin uptake assay and live-cell confocal imaging revealed that the effect of mutation c.421C>A [p.P141T] identified in SLC52A2 had a slight reduction in riboflavin uptake; on the other hand, the c.62A>G [p.N21S] identified in SLC52A3 showed a drastic reduction in riboflavin uptake, which appeared to be due to impaired trafficking and membrane targeting of the hRFVT-3 protein. This is the first report presenting mutations in both riboflavin transporters hRFVT-2 and hRFVT-3 in the same BVVLS patient. Also, c.62A>G [p.N21S] in SLC52A3 appears to contribute more to the disease phenotype in this patient than c.421C>A [p.P141T] in SLC52A2. Copyright © 2016 Elsevier B.V. All rights reserved.

Detecting neutrons by forward recoil protons at the Energy & Transmutation facility: Detector development and calibration with 14.1-MeV neutrons

Science.gov (United States)

Afanasev, S.; Vishnevskiy, A.; Vishnevskiy, D.; Rogachev, A.; Tyutyunnikov, S.

2017-05-01

As part of the Energy & Transmutation project, we are developing a detector for neutrons with energies in the 10-100 MeV range emitted from the target irradiated by a charged-particle beam. The neutron is detected by measuring the time-of-flight and total kinetic energy of the forward-going recoil proton [1] knocked out at a small angle from a thin layer of plastic scintillator, which has to be selected against an intense background created by γ quanta, scattered neutrons, and charged particles. On the other hand, neutron energy has to be measured over the full range with no extra tuning of the detector operation regime. Initial measurements with a source of 14.1-MeV neutrons are reported.

Rietveld refinement of the mixed boracite Fe1.59Zn1.41B7O13Br

Directory of Open Access Journals (Sweden)

Sandra Ulloa-Godínez

2009-11-01

Full Text Available The structural characterization of the new iron–zinc heptaborate bromide with composition Fe1.59Zn1.41B7O13Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable interatomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetrahedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetrahedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF was used to determinate the Fe/Zn ratio.

Rietveld refinement of the mixed boracite Fe(1.59)Zn(1.41)B(7)O(13)Br.

Science.gov (United States)

Ulloa-Godínez, Sandra; Rosales, Ivonne; Bucio, Lauro; Farías, Mario H; Campa-Molina, Jorge

2009-10-31

The structural characterization of the new iron-zinc hepta-borate bromide with composition Fe(1.59)Zn(1.41)B(7)O(13)Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable inter-atomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetra-hedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetra-hedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF) was used to determinate the Fe/Zn ratio.

Optical and Physical Investigations of Lanthanum Bismuth Borate glasses doped with Ho2O3

Science.gov (United States)

Ramesh, P.; Jagannath, G.; Eraiah, B.; Kokila, M. K.

2018-02-01

Holmium doped 10La2O3-15Bi2O3-(75-x) B2O3 (Ho3+: LBB) glasses have been prepared by melt quench technique and the impact of holmium ions concentration on optical and physical properties of present glasses have been examined. Ho3+ dependent density, molar volume, refractive index, rare earth ion concentration, polaron radius, inter ionic distance, field strength and energy band gap are calculated and tabulated. Amorphous nature of the all glasses has been confirmed by XRD patterns. The room temperature (RT) Uv-Vis absorption spectrum doped with 1 mol% of Ho2O3 exhibit eight prominent bands centred at 895, 641, 537, 486, 472, 467, 451 and 416 due to transition between ground state to various excited states. The results show that, the density is increases and molar volume of the glasses is decreases with an increase in Ho2O3 concentration and consequently generate more non-bridging oxygen (NBOs) in the glass matrix. The Urbach energy is increases with holmium concentration which exemplifies the degree of disorder present in the LBB glasses. The considerable increase in field strength observed in present glasses is attributed to occurrence of strong bridge between Ho3+ and B- ions and this strong bridge is possibly due to the displacement between Ho3+ and oxygen atoms which are generated from the conversion BO3-BO4 units.

CheckMate 141: 1-Year Update and Subgroup Analysis of Nivolumab as First-Line Therapy in Patients with Recurrent/Metastatic Head and Neck Cancer.

Science.gov (United States)

Gillison, Maura L; Blumenschein, George; Fayette, Jerome; Guigay, Joel; Colevas, A Dimitrios; Licitra, Lisa; Harrington, Kevin J; Kasper, Stefan; Vokes, Everett E; Even, Caroline; Worden, Francis; Saba, Nabil F; Iglesias Docampo, Lara Carmen; Haddad, Robert; Rordorf, Tamara; Kiyota, Naomi; Tahara, Makoto; Monga, Manish; Lynch, Mark; Li, Li; Ferris, Robert L

2018-06-04

Nivolumab significantly improved overall survival (OS) vs investigator's choice (IC) of chemotherapy at the primary analysis of randomized, open-label, phase 3 CheckMate 141 in patients with recurrent or metastatic (R/M) squamous cell carcinoma of the head and neck (SCCHN). Here, we report that OS benefit with nivolumab was maintained at a minimum follow-up of 11.4 months. Further, OS benefit with nivolumab vs IC was also noted among patients who received first-line treatment for R/M SCCHN after progressing on platinum therapy for locally advanced disease in the adjuvant or primary (i.e., with radiation) setting. The Oncologist 2018. © AlphaMed Press 2018.

De fines y elecciones pirrónicos. Un análisis comparativo de DL 9.107-8 y M 11.141-67

Directory of Open Access Journals (Sweden)

Alfonso Correa Motta

2015-01-01

Full Text Available El artículo presenta un análisis comparativo de los últimos parágrafos de la Vida de Pirrón de Diógenes Laercio (9.107-8 y de un capítulo del Adversus ethicos de Sexto Empírico (M 11.[5].141-67. Los resultados de este análisis harán plausible la hipótesis de una fuente común, reproducida parcialmente en DL, pero elaborada y refinada en Sexto. En ambos textos son centrales las nociones de fin y de elección. Se presentan las diferencias entre ambos textos entorno a la primera, y las tensiones internas comunes que implica el tratamiento de la segunda.

N,N′,N′′-Tris(2-nitrobenzyl-2,2′,2′′-nitrilotriethanaminium trichloride 1.41-hydrate

Directory of Open Access Journals (Sweden)

Perla Elizondo

2009-07-01

Full Text Available The title compound, C27H36N7O63+·3Cl−1.41H2O, is the hydrochloride of a tripodal amine, and was structurally characterized because the free base, used as a ligand in podate complexes, is an oily material. In the cation, the secondary amine groups are protonated, and, despite the induced Coulombic repulsions, a claw-like conformation is stabilized, with a cavity approximating C3 point symmetry. Such a topology, with the lone pair of the tertiary N atom placed inside the cavity, allows the encapsulation of guest species. Indeed, three chloride counter-ions balance the charges, one of which is located inside the cation cavity and is strongly bonded to the NH2+ groups. The asymmetric unit is completed by two water molecules with occupancies 0.793 (11 and 0.621 (9. The crystal structure is formed by a complex network of efficient N—H...Cl and O—H...Cl hydrogen bonds. One nitro group also forms weak contacts with a water molecule.

Radiolanthanide labeled compounds as radiopharmaceuticals for radio-synoviorthesis

Czech Academy of Sciences Publication Activity Database

Melichar, František; Kropáček, Martin; Šrank, Jiří; Mirzajevová, Marcela; Beran, Miloš; Zimová, Jana; Eigner-Henke, Kateřina; Forsterová, Michaela; Kraft, O.

2007-01-01

Roč. 6, č. 1 (2007), s. 45-45 ISSN 1450-1147 R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiosynoviorthesis * holmium-166 Subject RIV: FR - Pharmacology ; Medidal Chemistry

Our first clinical experience with radiosynoviorthesis by means of 166

Czech Academy of Sciences Publication Activity Database

Kraft, O.; Kašpárek, R.; Ullmann, V.; Melichar, František; Kropáček, Martin; Mirzajevová, Marcela

2005-01-01

Roč. 8, č. 2 (2005), s. 131-134 ISSN 1506-9680 R&D Projects: GA AV ČR(CZ) 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : holmium * radiotherapy Subject RIV: CH - Nuclear ; Quantum Chemistry

Lifetime measurements of the rare earths

International Nuclear Information System (INIS)

Stahnke, H.J.

1981-01-01

The lifetime of excited energy levels of Praseodymium, Neodymium, Gadolinium, Holmium and Erbium are measured. The measurements were done on atomic beams excited by laser radiation. The experimental results allow an interpretation of the electronic structure of the rare earths. (BEF)

A Mid-IR 14.1 W ZnGeP{sub 2} Optical Parametric Oscillator Pumped by a Tm,Ho:GdVO{sub 4} Laser

Energy Technology Data Exchange (ETDEWEB)

Guo-Li, Zhu; You-Lun, Ju; Tian-Heng, Wang; Yue-Zhu, Wang [National Key Laboratory of Tunable Laser Technology, Harbin Institute of Technology, Harbin 150001 (China)

2009-03-15

We report a high power and high efficiency double resonant ZnGeP{sub 2} (ZGP) optical parametric oscillator (OPO) pumped by a Tm,Ho:GdVO{sub 4} laser. We employ a Tm,Ho:GdVO{sub 4} laser as the pump source operated at 2.049 {mu}m with M{sup 2} = 1.1. The ZGP OPO can generate a total combined output power of 14.1 W at 3.80 {mu}m signal and 4.45 {mu}m idler under pumping power of 28.7 W. The slope efficiency reaches 61.8%, and M{sup 2} = 3.6 for OPO output is obtained. (fundamental areas of phenomenology (including applications))

Preparation of .sup.166./sup.Ho-Macroaggregates and .sup.166./sup.Ho-Chitosan for the Radiotherapy

Czech Academy of Sciences Publication Activity Database

Kropáček, Martin; Melichar, František; Mirzajevová, Marcela

2002-01-01

Roč. 29, č. 2 (2002), s. 382 ISSN 1619-7070 R&D Projects: GA MZd NM6828; GA AV ČR KSK4055109 Keywords : Holmium-166 * 166 Ho-macroaggregates * 166 Ho-chitosan Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

A bromine-based dichroic X-ray polarization analyser

CERN Document Server

Collins, S P; Brown, S D; Thompson, P

2001-01-01

We have demonstrated the advantages offered by dichroic X-ray polarization filters for linear polarization analysis, and describe such a device, based on a dibromoalkane/urea inclusion compound. The polarizer has been successfully tested by analysing the polarization of magnetic diffraction from holmium.

Retrograde intrarenal stone surgery for extracorporeal shock-wave lithotripsy-resistant kidney stones

DEFF Research Database (Denmark)

Jung, Helene; Nørby, Bettina; Osther, Palle Jörn

2006-01-01

OBJECTIVE: The newer flexible ureteroscopes, 150-200-microm holmium YAG laser fibres and superflexible Dormia baskets have made it possible to reach and treat stones in all parts of the kidney. The object of this evaluation was to study the outcome of retrograde intrarenal stone surgery (RIRS......) for extracorporeal shock-wave lithotripsy (ESWL)-resistant kidney stones. MATERIAL AND METHODS: A total of 38 consecutive patients (18 males, 20 females) participated in the study. All patients had undergone ESWL prior to RIRS without success. In all cases the stones could be reached with the endoscope. Calculi...... ranged in size from 3 to 20 mm (mean 9 mm). In 32 cases the stones were fragmented using a holmium YAG laser and in six the stones could be extracted using zero-tip Dormia baskets without fragmentation. Sixteen patients had lower calyceal calculi and eight had an abnormal anatomy of the upper urinary...

Development of radiolabelled compound using reactor produced RI - Development of Ho-166 skin patch for treatment of skin cancer

Energy Technology Data Exchange (ETDEWEB)

Park, Kyung Bae [Korea Atomic Energy Research Institute, Taejon (Korea); Ryu, Jei Man [Dong Wha Pharm. Ind. Co., Ltd., Seoul (Korea)

1999-04-01

A radioactive patch which can be treat the skin cancer by direct irradiation was prepared by blending Ho(NO{sub 3}){sub 3}, 5H{sub 2}O and polyurethane(PU) and then irradiating with neutron in the nuclear reactor. The blend formation of the film was fonfirmed by FT-IR. Degree of the distribution of holmium and solvent in remaining in the film was determined. Physical properties of the film by thermal analysis, mechanical measurement and surface analysis were characterized, respectively. To evaluate efficacy of the patch, it was applied to the tumor surface of the hairlessmous. Until 6 weeks of the patch treatment 7 mice with skin tumor were cured totally (7/13). And the other nuclear except for holmium was in patch was not detected. Furthermore, the patch was stable at room temperature, 40 deg C and 60 deg C. (author). 17 refs., 13 figs., 9 tabs.

Arthroscopic management of temporomandibular joint disc perforations and associated advanced chondromalacia by discoplasty and abrasion arthroplasty: a supplemental report.

Science.gov (United States)

Quinn, J H; Stover, J D

1998-11-01

This article describes the results of treating temporomandibular joint (TMJ) articular disc perforation and advanced chondromalacia arthroscopically by the use of discoplasty and abrasion arthroplasty. Forty-four joints were treated in 25 patients (23 females and 2 males). Twenty-nine disc perforations were present, 24 joints had grade III chondromalacia (fibrillated cartilage), and 14 joints had grade IV chondromalacia (exposed bone). Surgical procedures included 14 abrasion arthroplasties and 24 motorized shavings or holmium laser vaporizations. Holmium laser discoplasty with mobilization was used in 29 joints. Patients were followed-up for an average of 40.8 months (11 to 74 months). Preoperative pain on the visual analog scale (VAS) (1 to 10 cm) ranged from 5 to 10 cm, with an average of 7.4 cm. Postoperatively, nine patients had no pain and 16 patients had an average VAS of 2.7 cm (range, 1 to 5 cm). Preoperatively, 30 joints had clicking, and 14 joints had crepitation. Postoperatively, 25 joints had no noise, 12 joints had slight intermittent clicking, and seven joints had crepitation. The preoperative range of motion averaged 29.7 mm. Postoperatively, the range of motion averaged 37.7 mm (range, 33 to 42 mm). All patients could masticate a regular diet except hard food after an average of 40.8 months (11 to 74 months). These findings seem to justify the arthroscopic surgical procedures of discoplasty for disc perforations, motorized shaving, or holmium laser vaporization of grade III chondromalacia, and abrasion arthroplasty for bone exposure. The results also question the need for discectomy in the treatment of disc perforation.

The ABCG2 gene Q141K polymorphism contributes to an increased risk of gout: a meta-analysis of 2185 cases.

Science.gov (United States)

Qiu, Ya; Liu, Hua; Qing, Yufeng; Yang, Min; Tan, Xiaoyao; Zhao, Mingcai; Lin, Monica; Zhou, Jingguo

2014-09-01

Individual genetic association studies examining the relationship between the ABCG2 gene polymorphisms and gout have yielded inconsistent results. This study aims to evaluate the association between the ABCG2 gene variants and gout using meta-analysis. Relevant studies were identified by searching databases extensively. The odds ratio (OR) was calculated using a random-effect or fixed-effect model. A Q statistic was used to evaluate homogeneity, and Egger's test and funnel plot were used to assess publication bias. Subgroup analyses on ethnicities and sex were also performed. A total of 7 studies, including 2185 gout patients and 8028 controls from 5 countries or regions, were included and identified for the current meta-analysis. It was found that the A allele or AA genotype of the ABCG2 Q141K polymorphism (rs2231142) had an increased risk of gout in the general population (A allele, p gout (p gout.

Genome-wide scan of 29,141 African Americans finds no evidence of directional selection since admixture.

Science.gov (United States)

Bhatia, Gaurav; Tandon, Arti; Patterson, Nick; Aldrich, Melinda C; Ambrosone, Christine B; Amos, Christopher; Bandera, Elisa V; Berndt, Sonja I; Bernstein, Leslie; Blot, William J; Bock, Cathryn H; Caporaso, Neil; Casey, Graham; Deming, Sandra L; Diver, W Ryan; Gapstur, Susan M; Gillanders, Elizabeth M; Harris, Curtis C; Henderson, Brian E; Ingles, Sue A; Isaacs, William; De Jager, Phillip L; John, Esther M; Kittles, Rick A; Larkin, Emma; McNeill, Lorna H; Millikan, Robert C; Murphy, Adam; Neslund-Dudas, Christine; Nyante, Sarah; Press, Michael F; Rodriguez-Gil, Jorge L; Rybicki, Benjamin A; Schwartz, Ann G; Signorello, Lisa B; Spitz, Margaret; Strom, Sara S; Tucker, Margaret A; Wiencke, John K; Witte, John S; Wu, Xifeng; Yamamura, Yuko; Zanetti, Krista A; Zheng, Wei; Ziegler, Regina G; Chanock, Stephen J; Haiman, Christopher A; Reich, David; Price, Alkes L

2014-10-02

The extent of recent selection in admixed populations is currently an unresolved question. We scanned the genomes of 29,141 African Americans and failed to find any genome-wide-significant deviations in local ancestry, indicating no evidence of selection influencing ancestry after admixture. A recent analysis of data from 1,890 African Americans reported that there was evidence of selection in African Americans after their ancestors left Africa, both before and after admixture. Selection after admixture was reported on the basis of deviations in local ancestry, and selection before admixture was reported on the basis of allele-frequency differences between African Americans and African populations. The local-ancestry deviations reported by the previous study did not replicate in our very large sample, and we show that such deviations were expected purely by chance, given the number of hypotheses tested. We further show that the previous study's conclusion of selection in African Americans before admixture is also subject to doubt. This is because the FST statistics they used were inflated and because true signals of unusual allele-frequency differences between African Americans and African populations would be best explained by selection that occurred in Africa prior to migration to the Americas. Copyright © 2014 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

African Journal of Urology - Vol 8, No 4 (2002)

African Journals Online (AJOL)

Assiut Experience in the Application of Holmium Laser in Treatment of Ureteral Calculi in Adults · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A.M. Abdel Lateef, A.E. Abdel Moniem, M.I. Taha, M.A. Shalaby, 185-189 ...

Preparation and Quality Control of 166-Ho--Macroaggregates for Radiosynoviorthesis

Czech Academy of Sciences Publication Activity Database

Kropáček, Martin; Melichar, František; Šrank, Jiří; Mirzajevová, Marcela; Klejzarová, Michaela; Kraft, O.; Kašpárek, R.; Záhlava, J.; Chodacki, A.

2007-01-01

Roč. 22, Č. 3 (2007), s. 450-452 ISSN 1084-9785 R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiosynoviorthesis * Holmium-166 * radionuclide synovectomy Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 1.725, year: 2007

Study of multicomponent fluoro-phosphate based glasses: Ho3+ as a luminescence center

International Nuclear Information System (INIS)

Babu, S.; Seshadri, M.; Balakrishna, A.; Reddy Prasad, V.; Ratnakaram, Y.C.

2015-01-01

The multicomponent 49.5P 2 O 5 –10AlF 3 –10BaF 2 –10SrF 2 –10PbO–10M (M=Li 2 O, Na 2 O, K 2 O, ZnO and Bi 2 O 3 ) glasses doped with 0.5 mol% holmium were prepared by melt quenching technique. Their thermal behavior was examined from differential scanning calorimetry (DSC). It is found that bismuth fluoro-phosphate glass matrix has good thermal stability. Their structures were characterized by the X-ray diffraction with SEM analysis, fourier transform infrared (FTIR), Raman spectroscopy and magic angle spinning (MAS) nuclear magnetic resonance (NMR) techniques. It was found that the phosphate network of these glasses was composed mainly of Q 2 and Q 3 phosphate tetrahedral units. The Judd–Ofelt parameters (J–O) (Ω 2 , Ω 4 and Ω 6 ) were evaluated from the intensities of the energy levels through optical absorption spectra. The most intense transitions are observed in the visible region of the spectrum. It is observed that the transition 5 I 8 → 5 G 6 is the hypersensitive transition for Ho 3+ ion. With these J–O parameters, various radiative properties like the probabilities of radiative transitions, radiative lifetimes and branching ratios have been calculated for different fluoro-phosphate glasses. The luminescence kinetics from excited holmium levels have been studied upon selective excitation through photoluminescence measurements. Holmium produces two visible laser emissions i.e. one is green ( 5 F 4 ( 5 S 2 )→ 5 I 8 ) and another one is red ( 5 F 5 → 5 I 8 ). The lifetimes of these levels have been experimentally determined through decay profile studies. The above results suggest that the prepared bismuth fluoro-phosphate glass system could be a suitable candidate for using it as a green laser source ( 5 F 4 ( 5 S 2 )→ 5 I 8 ) in the visible region of the spectrum. - Highlights: • Holmium doped different fluoro-phosphate glasses were prepared and characterized. • Structural, thermal and spectroscopic properties have been studied

Temperature dependence of the absorption coefficient of water for midinfrared laser radiation

NARCIS (Netherlands)

Jansen, E. D.; van Leeuwen, T. G.; Motamedi, M.; Borst, C.; Welch, A. J.

1994-01-01

The dynamics of the water absorption peak around 1.94 microns was examined. This peak is important for the absorption of holmium and thulium laser radiation. To examine the effect of temperature on the absorption coefficient, the transmission of pulsed Ho:YAG, Ho:YAG, Ho:YSGG, and Tm:YAG laser

Extracorporeal Shock Wave Lithotripsy versus Lasertripsy For The ...

African Journals Online (AJOL)

Objectives: To compare the efficacy, cost effectiveness and safety of both ESWL and Holmium:YAG laser lithotripsy for the management of upper ureteric stones. Patients and Methods: One hundred and eight patients of various age groups and of both sexes who had primary or recurrent unilateral or bilateral upper ureteric ...

Circulating forms of immunoreactive parathyroid hormone-related protein for identifying patients with humoral hypercalcemia of malignancy. A comparative study with C-terminal (109-141)- and N-terminal (1-86)-region-specific PTHrP radioassay

International Nuclear Information System (INIS)

Suehiro, Mitsuko; Murakami, Minoru; Fukuchi, Minoru

1994-01-01

We evaluated the circulating forms of immunoreactive parathyroid hormone-related protein(PTHrP) in 115 healthy subjects and 122 patients with malignant diseases by using radioassay systems (RAS) specific for the C-terminal (109-141) fragment of PTHrP (C-RAS) and for the N-terminal(1-86) (N-RAS). PTHrP levels in healthy controls ranged from 1.5 to 38.2 (mean: 24.5) pmol/L with the C-RAS and from 0.9 to 2.5 (mean: 1.7) pmol/L with the N-RAS. The ratio of circulating N-terminal fragment (N) to C-terminal fragment (C) of PTHrP was calculated to be about 1 : 14.4 in the healthy subjects. Of the 122 patients with malignant diseases, 40 (32.8%) had circulating PTHrP levels undetectable with the N-RAS, but only 11 (9.0%) patients had levels undetectable with the C-RAS. Of the former 122 patients, 41 (33.6%) had high PTHrP as determined with the C-RAS, and 10 (8.2%) had high PTHrP as determined with the N-RAS. The former of these included only 8 (19.5%) humoral hypercalcemia malignancy(HHM) patients, while the latter included 8 (80.0%) HHM patients. The circulating N to C ratio was about 1 : 70.7 in the HHM patients. The N and C obtained with the different RASs showed a close correlation (r=0.86). The values also showed a close correlation with serum Ca; r=0.75 for C-RAS and r=0.81 for N-RAS. In addition, the correlation between the PTHrP reading obtained with the different RASs and serum Cr were: r=0.42 with C-RAS and r=0.26 with N-RAS. The circulating form of immunoreactive PTHrP fragments is therefore comprised mainly of PTHrP (109-141). In contrast, circulating concentrations of the PTHrP (1-86) fragment are very low, but detection of the PTHrP (1-86) fragment with the N-RAS is a more useful indicator of HHM with fewer false positive results and is less likely to be influenced by renal function than the detection of the PHPrP (109-141) fragment with C-RAS. (author)

Study of the quasi-free scattering at the reaction 2H(p,2p)n at Esub(p)0 = 14.1 MeV

International Nuclear Information System (INIS)

Helten, H.J.

1980-01-01

The breakup reaction 2 H(p,2p)n was studied at Ep = 14.1 MeV in complete coincidence experiments on quasifree pp scattering in a systematic range of cinematic situations of the pp-subsystem for c.m. production angles between 90 0 and 140 0 and different violation of the quasifree condition as well on interferences with final-state interaction processes. The absolute differential breakup cross section was compared with approximate solutions of the Faddeev equations with separable s-wave potentials without explicite Coulomb interaction according to Ebenhoeh. The agreement is generally good referring to the form of the spectra, but the theoretical amplitude is in the mean 20% to high. The permanent independence of the quasifree breakup from the scattering parameter asub(pp) doesn't suggest to use this process for the determination of nn-scattering lengths from the mirror reaction 2 H(n,2n)p. (orig.)

Removal of Reactive Red 141 Dye from Synthetic Wastewater by Electrocoagulation Process: Investigation of Operational Parameters

Directory of Open Access Journals (Sweden)

Elham Rahmanpour Salmani

2016-01-01

Full Text Available Release of textile industries waste especially their dying effluent impose a serious pollution on the environment. Reactive dyes are one of the most used dyes which are recalcitrant to conventional treatment processes. In the performed project, the effectiveness of electrocoagulation process was studied on decolorization. RR141 was selected as model dye and treatment process was performed in a simple batch of electrocoagulation (EC cell using iron electrodes. Central Composite Design (CCD was used to plan study runs. Experiments were done under 5 levels of various operational parameters at bench scale. Initial concentration of dye was varied among 50 and 500ppm, pH ranging from 4-12; retention time was ranged between 3-30 minutes, 1-3cm was selected as the distance between electrodes, and current intensity studied under the range of 5-30 mA/cm2. EC treatment process of dyestuff wastewater was satisfactory at high levels of current density, pH, and retention time. While increasing the initial dye concentration and electrodes gap had a negative effect on decolorization performance. Determined optimal conditions to treat 200ml of sample were including pH: 9.68, electrode gap: 1.58cm, dye concentration: 180ppm, retention time: 10.82 minutes, and current intensity: 22.76mA/cm2. Successful removal of the model dye about 99.88% was recorded in the mentioned values of variables. Simple design and operation of the experiments can be an interesting option for implementation and applying of inexpensive electrocoagulation treatment process which was successful to reach nearly a complete decolorization.

High prevalence of Arginine to Glutamine Substitution at 98, 141 and 162 positions in Troponin I (TNNI3 associated with hypertrophic cardiomyopathy among Indians

Directory of Open Access Journals (Sweden)

Rani Deepa

2012-08-01

Full Text Available Abstract Background Troponin I (TNNI3 is the inhibitory subunit of the thin filament regulatory complex Troponin, which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Mutations (2-7% in this gene had been reported in hypertrophic cardiomyopathy patients (HCM. However, the frequencies of mutations and associated clinical presentation have not been established in cardiomyopathy patients of Indian origin, hence we have undertaken this study. Methods We have sequenced all the exons, including the exon-intron boundaries of TNNI3 gene in 101 hypertrophic cardiomyopathy patients (HCM, along with 160 healthy controls, inhabited in the same geographical region of southern India. Results Our study revealed a total of 16 mutations. Interestingly, we have observed Arginine to Glutamine (R to Q mutation at 3 positions 98, 141 and 162, exclusively in HCM patients with family history of sudden cardiac death. The novel R98Q was observed in a severe hypertrophic obstructive cardiomyopathy patient (HOCM. The R141Q mutation was observed in two familial cases of severe asymmetric septal hypertrophy (ASH++. The R162Q mutation was observed in a ASH++ patient with mean septal thickness of 29 mm, and have also consists of allelic heterogeneity by means of having one more synonymous (E179E mutation at g.4797: G → A: in the same exon 7, which replaces a very frequent codon (GAG: 85% with a rare codon (GAA: 14%. Screening for R162Q mutation in all the available family members revealed its presence in 9 individuals, including 7 with allelic heterogeneity (R162Q and E179E of which 4 were severely affected. We also found 2 novel SNPs, (g.2653; G → A and g.4003 C → T exclusively in HCM, and in silico analysis of these SNPs have predicted to cause defect in recognition/binding sites for proteins responsible for proper splicing. Conclusion Our study has provided valuable information regarding the prevalence of TNNI3 mutations in

Lattice effects in HoVo(3) single crystal

NARCIS (Netherlands)

Sikora, M.; Marquina, C.; Ibarra, M. R.; Nugroho, A. A.; Palstra, T. T. M.

We report the study of lattice effects in the Mott insulator HoVO3 performed by means of linear thermal expansion on a single crystal in the temperature range 10-290 K. The holmium orthovanadate HoVO3 reveals gradual orbital ordering (OO) below T-OO = 200K and orders antiferromagnetically at T-N =

Preparation and Quality Control of 166-Ho-Boro-Macroaggregates for Radiosynoviorthesis

Czech Academy of Sciences Publication Activity Database

Kropáček, Martin; Šrank, Jiří; Mirzajevová, Marcela; Klejzarová, Michaela; Kraft, O.; Kašpárek, R.; Záhlava, J.; Chodacki, A.

2006-01-01

Roč. 33, č. 14 (2006), S327-S327 ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine. 30.9.2006-4.10.2006, Athens] R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : holmium * radiotherapy Subject RIV: FD - Oncology ; Hematology

Preparation and quality control of Ho-166 labelled compounds for radiotherapy

Czech Academy of Sciences Publication Activity Database

Kropáček, Martin; Melichar, František; Šrank, Jiří; Ventruba, Jiří; Mirzajevová, Marcela; Kraft, O.; Křížová, V.

2006-01-01

Roč. 5, č. 1 (2006), S95-S95 ISSN 1450-1147. [Congress of World Federation of Nuclear Medicine and Biology /9./. 22.10.2006-27.10.2006, Seoul] R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : holmium * radiotherapy Subject RIV: FD - Oncology ; Hematology

Preparation and Quality Control of 166 Ho-boro -Macroaggregates for radiosynoviorthesis

Czech Academy of Sciences Publication Activity Database

Kropáček, Martin; Melichar, František; Šrank, Jiří; Mirzajevová, Marcela; Klejzarová, M.; Kraft, O.; Kasparek, R.; Zahlava, J.; Chodacki, A.

2006-01-01

Roč. 33, Supplement 2 (2006), S327-S327 ISSN 1619-7070. [Annual Congress of European Association of Nuclear Medicine. 30.09.2006-04.10.2006, Athens] R&D Projects: GA AV ČR(CZ) 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : holmium * radiotherapy * synoviorthesa Subject RIV: CH - Nuclear ; Quantum Chemistry

Preparation of .sup.166./sup.Ho-Macroaggregates and .sup.166./sup.Ho-chitosan for the endoradiotherapy

Czech Academy of Sciences Publication Activity Database

Melichar, František; Kropáček, Martin; Eigner-Henke, Kateřina; Křížová, V.; Konopková, M.; Lang, O.; Mirzajevová, Marcela

2002-01-01

Roč. 1, č. 2 (2002), s. 314 ISSN 1450-1147. [Abstracts of the Congress of the World Federation of Nuclear Medicine and Biology. 29.09.2002-02.10.2002, Santiago] R&D Projects: GA MZd NM6828; GA AV ČR KSK4055109 Keywords : Holmium-166 * radionuclide synovectomy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

Study of Optical and Structural Characteristics of Ceria Nanoparticles Doped with Negative and Positive Association Lanthanide Elements

Directory of Open Access Journals (Sweden)

N. Shehata

2014-01-01

Full Text Available This paper studies the effect of adding lanthanides with negative association energy, such as holmium and erbium, to ceria nanoparticles doped with positive association energy lanthanides, such as neodymium and samarium. That is what we called mixed doped ceria nanoparticles (MDC NPs. In MDC NPs of grain size range around 6 nm, it is proved qualitatively that the conversion rate from Ce4+ to Ce3+ is reduced, compared to ceria doped only with positive association energy lanthanides. There are many pieces of evidence which confirm the obtained conclusion. These indications are an increase in the allowed direct band gap which is calculated from the absorbance dispersion measurements, a decrease in the emitted fluorescence intensity, and an increase in the size of nanoparticles, which is measured using both techniques: transmission electron microscope (TEM and X-ray diffractometer (XRD. That gives a novel conclusion that there are some trivalent dopants, such as holmium and erbium, which can suppress Ce3+ ionization states in ceria and consequently act as scavengers for active O-vacancies in MDC. This promising concept can develop applications which depend on the defects in ceria such as biomedicine, electronic devices, and gas sensors.

Correction of senile entropion using holmium laser

Science.gov (United States)

Kecik, Mariusz; Kecik, Dariusz; Kasprzak, Jan; Brodecka, Malgorzata

2003-10-01

Ninety-eight patients were included in clinical trials. They were divided into 3 groups, depending on the severity of lower lid inversion. Eighteen patients were included in the group with mild lid inversion; 59 patients had moderate lid inversion and in 21 patients the inversion was severe. Additionally, the patients were subdivided into two groups, according to their age - up to and above the age of 69 years. In both age groups, patients with moderate entropion predominated. All patients underwent photocoagulation of the lower lid. Post-operative wound healing took about 14 days. The effect was described as good when the position of the lid returned to normal with the lashes at an angle of about 45° to the free edge of the eyelid. When the position of the eyelid was normal with the lashes at an angle of about 60° or more to the edge of the lid and not rubbing against the globe, the effect was considered satisfactory. When the inversion of the lid was not corrected, the effect was unsatisfactory. Good effects were seen in 61% of patients, 21% of the patients demonstrated satisfactory effects and in 18% the outcome was unsatisfactory. The best results were observed in patients with mild entropion, aged 69 years and younger.

Coherent magnetic structures in terbium/holmium superlattices

DEFF Research Database (Denmark)

Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.

1997-01-01

to 230 K, two samples retain this magnetic structure while the third undergoes a transition first to a mixed phase of helically and ferromagnetically ordered Tb moments, then to a phase with only helically ordered To moments. Ln all cases, the magnetic ordering is found to be long ranged, with coherence...

Holmium hafnate: An emerging electronic device material

International Nuclear Information System (INIS)

Pavunny, Shojan P.; Sharma, Yogesh; Kooriyattil, Sudheendran; Dugu, Sita; Katiyar, Rajesh K.; Katiyar, Ram S.; Scott, James F.

2015-01-01

We report structural, optical, charge transport, and temperature properties as well as the frequency dependence of the dielectric constant of Ho 2 Hf 2 O 7 (HHO) which make this material desirable as an alternative high-k dielectric for future silicon technology devices. A high dielectric constant of ∼20 and very low dielectric loss of ∼0.1% are temperature and voltage independent at 100 kHz near ambient conditions. The Pt/HHO/Pt capacitor exhibits exceptionally low Schottky emission-based leakage currents. In combination with the large observed bandgap E g of 5.6 eV, determined by diffuse reflectance spectroscopy, our results reveal fundamental physics and materials science of the HHO metal oxide and its potential application as a high-k dielectric for the next generation of complementary metal-oxide-semiconductor devices

Holmium hafnate: An emerging electronic device material

Science.gov (United States)

Pavunny, Shojan P.; Sharma, Yogesh; Kooriyattil, Sudheendran; Dugu, Sita; Katiyar, Rajesh K.; Scott, James F.; Katiyar, Ram S.

2015-03-01

We report structural, optical, charge transport, and temperature properties as well as the frequency dependence of the dielectric constant of Ho2Hf2O7 (HHO) which make this material desirable as an alternative high-k dielectric for future silicon technology devices. A high dielectric constant of ˜20 and very low dielectric loss of ˜0.1% are temperature and voltage independent at 100 kHz near ambient conditions. The Pt/HHO/Pt capacitor exhibits exceptionally low Schottky emission-based leakage currents. In combination with the large observed bandgap Eg of 5.6 eV, determined by diffuse reflectance spectroscopy, our results reveal fundamental physics and materials science of the HHO metal oxide and its potential application as a high-k dielectric for the next generation of complementary metal-oxide-semiconductor devices.

Holmium hafnate: An emerging electronic device material

Energy Technology Data Exchange (ETDEWEB)

Pavunny, Shojan P., E-mail: shojanpp@gmail.com, E-mail: rkatiyar@hpcf.upr.edu; Sharma, Yogesh; Kooriyattil, Sudheendran; Dugu, Sita; Katiyar, Rajesh K.; Katiyar, Ram S., E-mail: shojanpp@gmail.com, E-mail: rkatiyar@hpcf.upr.edu [Department of Physics and Institute for Functional Nanomaterials, University of Puerto Rico, P.O. Box 70377, San Juan, Puerto Rico 00936-8377 (United States); Scott, James F. [Department of Physics and Institute for Functional Nanomaterials, University of Puerto Rico, P.O. Box 70377, San Juan, Puerto Rico 00936-8377 (United States); Department of Physics, Cavendish Laboratory, University of Cambridge, Cambridge CB3 OHE (United Kingdom)

2015-03-16

We report structural, optical, charge transport, and temperature properties as well as the frequency dependence of the dielectric constant of Ho{sub 2}Hf{sub 2}O{sub 7} (HHO) which make this material desirable as an alternative high-k dielectric for future silicon technology devices. A high dielectric constant of ∼20 and very low dielectric loss of ∼0.1% are temperature and voltage independent at 100 kHz near ambient conditions. The Pt/HHO/Pt capacitor exhibits exceptionally low Schottky emission-based leakage currents. In combination with the large observed bandgap E{sub g} of 5.6 eV, determined by diffuse reflectance spectroscopy, our results reveal fundamental physics and materials science of the HHO metal oxide and its potential application as a high-k dielectric for the next generation of complementary metal-oxide-semiconductor devices.

Ureteroscopic Holmium Lasertripsy for Treatment of Impacted ...

African Journals Online (AJOL)

line therapy for chronically impacted ureteral stones, which are frequently associated with chronic infl ammation, polyps and strictures. It is quite safe and it avoids the futile repetition of ESWL and problems caused by a prolonged passage of ...

A seasonal comparison of deposition velocities and retention half-times for Cs-134 and Ce-141 on cool desert vegetation

International Nuclear Information System (INIS)

Millard, Gloria C.; Fraley, Leslie Jr.; Markham, O.D.

1978-01-01

Due to a scarcity of reliable deposition velocity estimates for radionuclides (particularly those in the submicron range) pooled estimates have been used to predict population doses resulting from atmospheric releases of radioactive particulates. The use of these estimates has led to large uncertainties in whole body dose estimates. Deposition velocities and retention half-times were therefore determined for submicron aerosols of 141 Ce (biologically inactive) and 134 Cs (biologically active) on sagebrush dominated desert vegetation in SE Idaho. Approximately 250 mCi (9.3 GBq) of each radionuclide were released over stands of Artemisia tridentata (big sagebrush) and bottlebrush grass (Sitanion hystrix) during three stages of plant development - spring vegetative growth, seed development, and plant dormancy. Air filters and vegetation samples were collected immediately following each release for use in deposition velocity calculations. Vegetation sampling was continued for a period of three months to obtain retention data. Deposition velocity values were 0.20 cm/s for sagebrush and 0.025 cm/s for grass. The loss of activity on the vegetation seemed to best fit a two component exponential loss function. Short component half-times were 1 to 2 days for both species. Long component half-times were two to three weeks for the shrub species and one to two weeks for the grass species. No significant difference was observed between nuclides. (author)

Decreasing incidence of malignant tumors of the paranasal sinuses in Sweden. An analysis of 141 consecutive cases at Karolinska Hospital from 1960 to 1980.

Science.gov (United States)

Norlander, Tomas; Frödin, Jan-Erik; Silfverswärd, Claes; Anggård, Anders

2003-03-01

We reviewed 141 cases of paranasal sinus tumors treated at Karolinska Hospital from 1960 to 1980. Of these tumors, 100 were located in the maxillary sinus, 32 in the ethmoidal sinuses, 8 in both the ethmoidal and maxillary regions, and 1 in the sphenoidal sinus. The male-to-female ratio was 2.1 to 1. Squamous cell carcinoma and adenocarcinoma were the most frequent types of tumors (55% and 13%, respectively). Treatment included surgery, irradiation, or both. The 5-year survival rate was 34% for squamous cell carcinomas and 64% for adenocarcinomas. When compared to a previous material of patients treated at the same hospital from 1940 to 1950, the proportion of poorly differentiated squamous cell carcinomas had increased significantly. The age-adjusted incidence rate decreased from 1.2 to 0.4 for male patients and from 0.7 to 0.3 for female patients between 1960 and 1980. We conclude that the incidence of malignant paranasal sinus tumors has decreased, and that squamous cell tumors now seem to be generally less differentiated than they were 50 years ago.

40 CFR Appendix A to Subpart Q of... - NPDWR Violations and Other Situations Requiring Public Notice 1

Science.gov (United States)

2010-07-01

... 141.62(b) 3 141.23(a), (c) 11. Nitrate 1 141.62(b) 12 1, 3 141.23(a), (d), 141.23(f)(2) 12. Nitrite 1 141.62(b) 12 1, 3 141.23(a), (e), 141.23(f)(2) 13. Total Nitrate and Nitrite 1 141.62(b) 3 141.23(a) 14. Selenium 2 141.62(b) 3 141.23(a), (c) 15. Thallium 2 141.62(b) 3 141.23(a), (c) C. Lead and...

Specific features of the motion of neutrons in a medium with a helical magnetic structure

International Nuclear Information System (INIS)

Fraerman, A. A.; Udalov, O. G.

2007-01-01

The specific features of the motion of neutrons in a noncoplanar magnetic field are considered by an example of the magnetization distribution in the form of a conical helix. The reflection coefficients of neutrons from holmium crystals are calculated. It is shown that, for a noncoplanar distribution of a magnetic field in a crystal, the reflection coefficient of neutrons with spin flip exhibits an additional feature

Decomposition of supersaturated solid solutions Mg-Ho and Mg-Gd

International Nuclear Information System (INIS)

Sukhanov, V.D.; Dobromyslov, A.V.; Rokhlin, L.L.; Dobatkina, T.V.

2002-01-01

Methods of electron microscopy and X-ray diffraction analysis are applied to study ageing magnesium base alloys with holmium and gadolinium. It is shown that the precipitation of supersaturated Mg base solid solutions goes through several subsequent stages and is accompanied by a considerable precipitation hardening effect at the stage of metastable phase precipitation. The influence of aging time and temperature on precipitation kinetics is established [ru

Synthesis and characterization of Ho{sup 3+}-doped strontium titanate downconversion nanocrystals and its application in dye-sensitized solar cells

Energy Technology Data Exchange (ETDEWEB)

Li, Y.Y. [Department of Inorganic Nonmetallic Materials Engineering, Dalian Polytechnic University, Dalian 116034 (China); Liaoning Provincial College Key Laboratory of New Materials and Material Modification, Dalian Polytechnic University, Dalian 116034 (China); Hao, H.S., E-mail: beike1952@163.com [Department of Inorganic Nonmetallic Materials Engineering, Dalian Polytechnic University, Dalian 116034 (China); Liaoning Provincial College Key Laboratory of New Materials and Material Modification, Dalian Polytechnic University, Dalian 116034 (China); Qin, L. [National Engineering Research Center of Seafood, Dalian Polytechnic University, Dalian 116034 (China); Wang, H.L.; Nie, M.Q.; Hu, Z.Q.; Gao, W.Y.; Liu, G.S. [Department of Inorganic Nonmetallic Materials Engineering, Dalian Polytechnic University, Dalian 116034 (China); Liaoning Provincial College Key Laboratory of New Materials and Material Modification, Dalian Polytechnic University, Dalian 116034 (China)

2015-02-15

Highlights: • A new downconversion (DC) nanocrystal (SrTiO{sub 3}:Ho{sup 3+}) was synthesized. • The effect of SrTiO{sub 3}:Ho{sup 3+} as a photoanode in DSSCs was investigated. • SrTiO{sub 3}:Ho{sup 3+} absorb ultraviolet light and downconvert it to visible light. • DC SrTiO{sub 3}:Ho{sup 3+} as a photoanode achieve the higher photoelectric conversion efficiency. - Abstract: Ho{sup 3+}-doped strontium titanate (SrTiO{sub 3}:Ho{sup 3+}) downconversion (DC) nanocrystals are synthesized by the solid state interaction of titanium dioxide, strontium nitrate, holmium oxide and sodium chloride and then used as a photoanode in dye-sensitized solar cells (DSSCs) to investigate the effect of DC nanocrystals in DSSCs. Differential thermal analysis, X-ray diffraction, scanning electronic microscope, energy dispersive spectroscopy and Brunauer-Emmet-Teller analysis confirmed the formation of cubic structured SrTiO{sub 3}:Ho{sup 3+} nanocrystals with diameters of 40-400 nm, pore size of ∼45 nm, sintering temperature of 950 °C. The photofluorescence and UV-Vis absorption spectra of the SrTiO{sub 3}:Ho{sup 3+} nanocrystals revealed strong emission intensity and visible light absorption when doped content of holmium oxide was between 1 wt% and 3 wt%. Compared with the pure SrTiO{sub 3} photoanode, SrTiO{sub 3}:Ho{sup 3+} DC photoanode showed a greater photovoltaic efficiency. The photoelectric conversion efficiency (η) of the DSSCs with a SrTiO{sub 3}:Ho{sup 3+} photoanode doped with 1 wt% holmium oxide was 59% higher than that with a pure SrTiO{sub 3} photoanode. This phenomenon could be explained by SrTiO{sub 3}:Ho{sup 3+} nanocrystals’ ability to absorb ultraviolet light and downconvert it to visible light, which extends spectral response range of DSSC to the ultraviolet region and increased the short-circuit current density (Jsc) of DSSCs.

Thermal neutron capture cross-section and resonance integral measurements of {sup 139}La(n, γ){sup 140}La and {sup 140}Ce(n, γ){sup 141}Ce using a Am-Be neutron source

Energy Technology Data Exchange (ETDEWEB)

Panikkath, Priyada; Mohanakrishnan, P. [Manipal University, Manipal Centre for Natural Sciences, Karnataka (India)

2017-03-15

Thermal neutron capture cross-sections and resonance integrals of {sup 139}La(n, γ){sup 140}La and {sup 140}Ce (n, γ){sup 141}Ce are measured with respect to reference reactions {sup 197}Au(n, γ){sup 198}Au and {sup 55}Mn(n, γ){sup 56}Mn using the neutron activation technique. Measurements are carried out using neutrons from an Am-Be source located inside a concrete bunker. Two different methods are used for determining self-shielding factors of activation foils as well as for finding the epithermal neutron spectrum shape factor. For {sup 139}La with reference to {sup 197}Au and {sup 55}Mn the measured thermal cross sections are 9.24 ± 0.25 b and 9.28 ± 0.37 b, respectively, while the measured resonance integrals are 12.18 ± 0.67 b and 11.81 ± 0.94 b, respectively. For {sup 140}Ce with reference to {sup 197}Au and {sup 55}Mn the measured thermal cross sections are 0.44 ± 0.01 b and 0.44 ± 0.02 b, respectively, while the measured resonance integrals are 0.55 ± 0.03 b and 0.54 ± 0.04 b, respectively. The present measurements are compared with earlier measurements and evaluations. Presently estimated values confirm the established {sup 139}La(n, γ){sup 140}La cross-sections. The presently measured thermal capture cross-section {sup 140}Ce(n, γ){sup 141}Ce, though lower than the evaluated data, is having higher accuracy compared to previous measurements with large uncertainties. The resonance integral measured is higher (like most previous measurements) than most evaluations requiring a revision of the evaluated data. (orig.)

Measurements of differential cross sections for the reactions 6,7Li(n,d)5,6He and 6,7Li(n,t)4,5He at 14.1 MeV

International Nuclear Information System (INIS)

Shirato, Shoji; Hata, Kazuhiro; Ando, Yoshiaki; Shibuya, Shinji; Shibata, Keiichi.

1989-08-01

A summary of our measured cross sections for the 14.1 MeV neutron-induced reactions on lithium isotopes has been presented. Our data were measured with two counter telescopes, each of which consisted of two gas proportional counters and silicon ΔE and E detectors. Measured energy spectra of deuterons and tritons from 6 Li(n,d)n 4 He and 7 Li(n,t)n 4 He, respectively, were analyzed by a simple final-state interaction theory. Measured angular distributions for these reactions as well as 6 Li(n,t) 4 He and 7 Li(n,d) 6 He were analyzed by exact finite-range distorted wave Born approximation (EFR-DWBA) calculations. Spectroscopic factors extracted from the EFR-DWBA analyses have been compared with theoretical predictions. (author)

Endoscopic lysis of bladder scar associated with Hunner's lesions: A new technique

Directory of Open Access Journals (Sweden)

Sonia Bahlani

2015-01-01

Conclusion: Patients with IC/BPS may be severely debilitated by a clinically significant decrease in their bladder capacity, especially in the face of HL. The use of the holmium laser to incise regions of scar and bladder wall tethering may produce a clinically significant and durable increase in bladder capacity. The use of this technique as a means of treating bladder scarring poses an excellent adjunct to existing treatment strategies.

Addition compounds between lanthanide trifluoromethane sulphonates and N,N,N',N' - tetrametilmalonamida (TMMA)

International Nuclear Information System (INIS)

Bellis, V.M. de.

1984-01-01

The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt

Spin reorientation in HoIG investigated by means of Faraday effect

International Nuclear Information System (INIS)

Balanda, M.; Niziol, S.

1979-01-01

Faraday rotation measurements in pulsed magnetic fields up to 160 kOe and in low dc fields are carried out for Ho 3 Fe 5 O 12 near the compensation point. Transition to the canted phase is observed and the temperature dependence of the critical field determined. From the holmium sublattice magnetization and Hsub(cr) versus. T gradient, values of the two molecular field coefficients are determined. (author)

Determination of trace amounts of rare earth elements in samarium, terbium and disprosium oxides by graphite furnace atomic-absorption spectrometry

International Nuclear Information System (INIS)

Dantas, E.S.K.

1990-01-01

A graphite furnace atomic-absorption spectrometry method for the determination of neodymium, europium, terbium, dysprosium and yttrium at trace level in samarium oxide; of samarium, europium, dysprosium, holmium, erbium and yttrium in terbium oxide and of europium, terbium, holmium, erbium and yttrium in dysprosium oxide was established. The best pyrolysis and atomization temperatures were determined for each lanthanide considered. Calibration curves were obtained for the pure elements, for binary mixtures formed by the matrix and each of the lanthanides studied and, finally, for the complex mixtures constituted by the matrix and all the other lanthanide of the group under scrutiny. This study has been carried out to examine the interference of the presence of one lanthanide on the behaviour of the other, since a lack of linearity on the calibration curves has been observed in some cases. Detection and determination limits have been determined as well. The detection limits encountered were within the range 0.002 to 0.3% for different elements. The precision of the method expressed as the relative standard deviation was calculated for each element present in each of the matrices studied. The conclusion arrived at is that the method can be applied for determining the above mentioned lanthanides present in the matrices studied with purity up to 99.50%. (author)

Thermophysical Properties of Matter - The TPRC Data Series. Volume 4. Specific Heat - Metallic Elements and Alloys

Science.gov (United States)

1971-01-01

Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11

Best laser for prostatectomy in the year 2013

OpenAIRE

Pankaj N Maheshwari; Nitin Joshi; Reeta P Maheshwari

2013-01-01

Lasers have come a long way in the management of benign prostatic hyperplasia. Over last nearly two decades, various different lasers have been utilized for prostatectomy. Neodymium: yttrium-aluminum-garnet laser that started this journey, is no longer used for prostatectomy. Holmium laser can achieve transurethral enucleation of the prostatic adenoma producing a fossa that can be compared with the fossa after Freyer's prostatectomy. Green light laser has a short learning curve, is nearly blo...

On interaction of lanthanide ions with cyclic β-diketones and diantipyryllkanes

International Nuclear Information System (INIS)

Gerasimenko, G.I.; Ul'yanova, T.M.; Vitkun, R.A.; Tishchenko, M.A.; Poluehktov, N.S.

1985-01-01

Spectrophotometric and luminescence methods have been used to study neodymium, holmium, erbium and europium complexing with diantipyrylalkanes and cyclic β-diketones (2-acetyl-, 2-benzoyl-1,3-indandiones and 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5). Different-ligand complexes of 1:1:3 composition are stated to be formed. Molar coefficients of extinction and constants of stability as well as oscillator strengths of supersensitive transitions are determined. Correlations of the determined values are discussed

Case report 141

International Nuclear Information System (INIS)

Bonfiglio, M.; Platz, C.E.

1981-01-01

The case reported represents another example of dedifferentiation occurring in a benign cartilaginous tumor of bone. Osteosarcoma and fibrosarcoma are generally considered to represent the more malignant counterparts of such dedifferentiation, but studies recently have indicated that malignant fibrous histiocytoma may indeed be a common feature in such dedifferentiated lesions. It is stressed that lesions previously designated histologically as malignant giant cell tumor, when dedifferentiation occurs, may represent a special variant of malignant fibrous histiocytoma. (orig./MG)

ORIGINAL ARTILE 141

African Journals Online (AJOL)

Boaz

extracts employed were from Azadirachta indica (Neem), Anacardium occidentale (Cashew), Euphorbia hirta (Asthma weed),Jatropha curcas (Physic nut), ... d'inhibition complète à l'égard d'aucun des isolats cliniques à 100 mg/ml mais montrent un souci nettement inférieur à la plus faible concentration de. 25 mg/ml mieux.

Automated production of no carrier added holmium-166

International Nuclear Information System (INIS)

Izard, M.E.; Dadchova, E.

1996-01-01

Full text: An automated system has been developed to produce no carrier added 166 Ho from the decay of 166 Dy produced by neutron activation of 164 Dy 2 O 3 . Targets consisting of 5-10 mg of 164 Dy 2 O 3 are irradiated in HIFAR at 5 x 10 13 n.s -1 .cm -2 for 12h then allowed to cool for 2 days. The irradiation can is then transferred to the automated system located in a 'hot' cell in the radiopharmaceutical research building. A two dimension robotic arm encompassing a grab and motorized screwdriver is used to open the irradiation can. A second arm carrying a teflon tube introduces 9M HCI into the can to dissolve the target. A second tube carries the dissolved target via a peristaltic pump to a heated vial where it is evaporated to dryness under a flow of N 2 . A Peltier cooled trap is used to prevent release of HCl fumes into the cell. A motorized syringe pump dispenses 1 mL of 0.1 M HNO 3 to redissolve the digest which is then transferred by peristaltic pump via a hollow fibre filter and auto injector into an Aminex- A5 HPLC column. 166 Dy is eluted from the column in 0.132 M α-HIBA into a heated cyclone flask and evaporated to dryness under a stream of N 2 heated to about 50 deg C. After two days the evaporated Dy/ 166 Ho digest is dissolved in another 1 mL of 0.1 M HNO 3 and injected onto the HPLC column. 166 Ho is collected in 20-25 mL of α-HIBA and evaporated to dryness as before at about 400 C to ensure complete decomposition of the α-HIBA. The product is finally dissolved in about I mL of 0.1 M HCI and pumped through a 0.22 μM filter to a product vial

Magnetic structures of holmium-lutetium alloys and superlattices

DEFF Research Database (Denmark)

Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

1996-01-01

Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

Self-swept holmium fiber laser near 2100 nm

Czech Academy of Sciences Publication Activity Database

Aubrecht, Jan; Peterka, Pavel; Koška, Pavel; Podrazký, Ondřej; Todorov, Filip; Honzátko, Pavel; Kašík, Ivan

2017-01-01

Roč. 25, č. 4 (2017), s. 4120-4125 ISSN 1094-4087 R&D Projects: GA ČR(CZ) GA16-13306S Institutional support: RVO:67985882 Keywords : Fiber lasers * Fourier transform infrared spectrometer * Laser wavelength Subject RIV: BH - Optics , Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics ) Impact factor: 3.307, year: 2016

The systems terbium (holmium) nitrate-piperidine nitrate-water

International Nuclear Information System (INIS)

Khisaeva, D.A.; Zhuravlev, E.F.; Semenova, Eh.B.

1982-01-01

Using the method of cross sections at 25 and 50 deg C solubility in the systems Tb(NO 3 ) 2 -C 5 H 10 NHxHNO 3 -H 2 O and Ho(NO 3 ) 3 -C 5 H 10 NHxHNO 3 -H 2 O has been studied. The systems are characterized by chemical interaction of components. Solubility isotherms have crystallization fields of solid phases of the composition Tb(NO 3 ) 3 x3[C 5 H 10 NHxHNO 3 ]x3H 2 O and Ho(NO 3 ) 3 x2[C 5 H 10 NHxHNO 3 ]. The compounds detected are singled out preparatively, their IR spectra are studied, their thermogravimetric analysis is carried out. Investigation results are compared with similar systems formed by nitrates of other representatives of rare earth group

Efficient energy extraction from a diode-pumped Q-switched Tm,Ho:YLiF4 laser

Science.gov (United States)

Mcguckin, B. T.; Menzies, R. T.; Hemmati, H.

1991-01-01

The operation of a diode-laser pumped thulium, holmium yttrium-lithium-fluoride laser (Tm,Ho:YLF) in Q-switched mode is reported. Output energies of 200 microjoules in pulses of 22 ns duration are recorded at Q-switch frequencies commensurate with an effective upper laser level lifetime of 6 ms. This lifetime is appreciably longer than that observed in other hosts permitting stored energy extraction of 64 percent, close to the projected maximum performance from these materials.

A high gradient superconducting quadrupole for a low charge state ion linac

International Nuclear Information System (INIS)

Kim, J.W.; Shepard, K.W.; Nolen, J.A.

1995-01-01

A superconducting quadrupole magnet has been designed for use as the focusing element in a low charge state linac proposed at Argonne. The expected field gradient is 350 T/m at an operating current of 53 A, and the bore diameter is 3 cm. The use of rare earth material holmium for pole tips provides about 10% more gradient then iron pole tips. The design and the status of construction of a prototype singlet magnet is described

Efeito do Hólmio YAG laser (Ho: YAG sobre o tendão patelar de ratos após 12 e 24 semanas de seguimento The effects of Holmium YAG laser (Ho:YAG on the patellar tendon of rats after 12 and 24 weeks of follow up

Directory of Open Access Journals (Sweden)

Waldo Lino Júnior

2005-01-01

, com neoformação vascular evidente. No grupo de 24 semanas as fibras de colágeno se apresentavam com disposição regular e paralela ao longo eixo do tendão.The authors have studied the effects of the Holmium: Yttrium Aluminum Grenade (Ho:YAG laser on tendon sizes (proximal and distal length and width and on the cellularity and arrangement of collagen fibers in 20 Wistar variety, male, white, adult rats (Rattus Novergicus. The animals have been divided in two groups, according to the follow-up time (12 and 24 weeks and pursuant to the for form of laser application (continuous or two-point. A Holmium laser (pulsed, solid state, 2.1 micron waves, 40 watts, OmniTip 30º tip apparatus was used. After the animals were sacrificed, the proximal and distal length and width of the operated size of such rats were compared to those of the non-operated size be means of non-parametric testing (considering p=0,05. The length in the operated size was significantly bigger for both follow-up groups, when compared to the length of the non-operated size, however there was no significant difference in such measures in function of the type of laser application. In the same manner, the width, both in the proximal and distal regions, was significantly bigger in the operated size in both follow-up groups, without showing any significant difference whatsoever in function of the type of application. When the measures in both follow-up groups were compared, distal length and width showed a trend to become bigger after 24 weeks, while width in the proximal region was significantly bigger in this group. As for the subjective microscopic evaluation, both in longitudinal and cross sections, it was possible to observe and increase in the number of fibroblasts, mainly in the 12-week group. The average fibroblast concentration in the tendon with 24-week follow-up was group deemed to be intermediate between the 12-week group and non-operated tendon. The conjunctive tissue was exuberant in the region

Ablation of intervertebral discs in dogs using a MicroJet-assisted dye-enhanced injection device coupled with the diode laser

Science.gov (United States)

Bartels, Kenneth E.; Henry, George A.; Dickey, D. Thomas; Stair, Ernest L.; Powell, Ronald; Schafer, Steven A.; Nordquist, Robert E.; Frederickson, Christopher J.; Hayes, Donald J.; Wallace, David B.

1998-07-01

Use of holmium laser energy for vaporization/coagulation of the nucleus pulposus in canine intervertebral discs has been previously reported and is currently being applied clinically in veterinary medicine. The procedure was originally developed in the canine model and intended for potential human use. Since the pulsed (15 Hz) holmium laser energy exerts photomechanical and photothermal effects, the potential for extrusion of additional disc material to the detriment of the patient is possible using the procedure developed for the dog. To reduce this potential complication, use of diode laser (805 nm - CW mode) energy, coupled with indocyanine green (ICG) as a selective laser energy absorber, was formulated as a possible alternative. Delivery of the ICG and diode laser energy was through a MicroJet device that could dispense dye interactively between individual laser 'shots.' Results have shown that it is possible to selectively ablate nucleus pulposus in the canine model using the device described. Acute observations (gross and histopathologic) illustrate that accurate placement of the spinal needle before introduction of the MicroJet device is critically dependent on the expertise of the interventional radiologist. In addition, the success of the overall technique depends on consistent delivery of both ICG and diode laser energy. Minimizing tissue carbonization on the tip of the MicroJet device is also of crucial importance for effective application of the technique in clinical veterinary medicine.

Application of ureterorenoscope and flexible ureterorenoscope lithotripsy in removing calculus from extracorporeal living donor renal graft: a single-center experience.

Science.gov (United States)

Lin, Chun-Hua; Zhang, Zuo-Fu; Wang, Jiahui; Yu, Lu-Xin; Wang, Wen-Ting; Shi, Lei; Lin, Xiang-Nan

2017-11-01

Here, we reported our clinical application of ureterorenoscope (URS) and flexible URS lithotripsy in stone removal on 10 cases of excised living donor kidney graft. After the extraction of donor kidney by retroperitoneal laparoscopy, the donor graft was perfused with 4 °C HCA solution. Calculus between 2-4 mm were removed intact with lithotomy forceps under direct vision of URS. Larger calculi of >4 mm were fractured with flexible URS combining holmium laser lithotripsy. Fragments of the calculus were extracted with basket extractor and lithotomy forceps. All operations were successful. The operation time was 14-31 min (average 21.2 ± 6.3 min). The kidneys were then transplanted to the recipients using routine procedure. The transplanted kidneys functioned well after transplantation. Gross hematuria resolved 1-4 d after operation (average 2.6 ± 0.9 d). The transplanted kidneys functioned well without early complications such as functional recovery delay and acute graft rejection. The donors and recipients were followed for 12 months. The size of the transplanted kidneys was normal and new stones or urinary obstruction was not seen upon urinary color Doppler ultrasound examination. In conclusion, we believe it is feasible, safe and effective to use URS or flexible URS combining holmium laser lithotripsy on extracorporeal living donor kidney.

Optical stimulation of peripheral nerves in vivo

Science.gov (United States)

Wells, Jonathon D.

This dissertation documents the emergence and validation of a new clinical tool that bridges the fields of biomedical optics and neuroscience. The research herein describes an innovative method for direct neurostimulation with pulsed infrared laser light. Safety and effectiveness of this technique are first demonstrated through functional stimulation of the rat sciatic nerve in vivo. The Holmium:YAG laser (lambda = 2.12 mum) is shown to operate at an optimal wavelength for peripheral nerve stimulation with advantages over standard electrical neural stimulation; including contact-free stimulation, high spatial selectivity, and lack of a stimulation artifact. The underlying biophysical mechanism responsible for transient optical nerve stimulation appears to be a small, absorption driven thermal gradient sustained at the axonal layer of nerve. Results explicitly prove that low frequency optical stimulation can reliably stimulate without resulting in tissue thermal damage. Based on the positive results from animal studies, these optimal laser parameters were utilized to move this research into the clinic with a combined safety and efficacy study in human subjects undergoing selective dorsal rhizotomy. The clinical Holmium:YAG laser was used to effectively stimulate human dorsal spinal roots and elicit functional muscle responses recorded during surgery without evidence of nerve damage. Overall these results predict that this technology can be a valuable clinical tool in various neurosurgical applications.

On the specific electrophysical properties of n-InSe single crystals

Energy Technology Data Exchange (ETDEWEB)

Abdinov, A. Sh., E-mail: abdinov-axmed@yahoo.com [Baku State University (Azerbaijan); Babaeva, R. F., E-mail: babaeva-rena@yandex.ru; Rzaev, R. M., E-mail: abdinov-axmed@yandex.ru [Azerbaijan State Economic University (Azerbaijan); Ragimova, N. A.; Amirova, S. I. [Baku State University (Azerbaijan)

2016-01-15

The temperature dependences of physical parameters (the conductivity and the Hall constant) are experimentally investigated for pure indium-selenide (n-InSe) crystals and those lightly doped with rareearth elements (gadolinium, holmium, and dysprosium). It is established that the obtained results depend on the origin of the samples under investigation and prove to be contradictory for different samples. The obtained experimental results are treated taking into account the presence of chaotic large-scale defects and drift barriers caused by them in these samples.

Interaction of laser radiation with urinary calculi

OpenAIRE

Mayo, M E

2009-01-01

Urolithias, calculus formation in the urinary system, affects 5 – 10% of the population and is a painful and recurrent medical condition. A common approach in the treatment of calculi is the use of laser radiation, a procedure known as laser lithotripsy, however, the technique has not yet been fully optimised. This research examines the experimental parameters relevant to the interactions of the variable microsecond pulsed holmium laser (λ = 2.12 μm, τp = 120 – 800 μs, I ~ 3 MW...