ASM Triggered too Observations of 100,000 C/s Black-Hole Candidates

Science.gov (United States)

van der Klis, Michiel

Resubmission accepted Cycle 2-11 proposal. The PCA is unique by the high count rates (~100.000 c/s) it can record, and its resulting extreme sensitivity to weak variability. Only few sources get this bright. Our RXTE work on Sco X-1 and 1744-28 shows that high count rate observations are very rewarding, but also difficult and not without risk. In the life of the satellite probably only one black hole transient (if any) will reach 10^5 cps/5 PCU levels. When this occurs a window of discovery will be opened on black holes, which will nearly certainly close again within a few days. This proposal aims at ensuring that optimal use is made of this opportunity by performing state of the art high count rate observations covering all of the most crusial aspects of the source variability.

Astronomical calibration of upper Campanian–Maastrichtian carbon isotope events and calcareous plankton biostratigraphy in the Indian Ocean (ODP Hole 762C)

DEFF Research Database (Denmark)

Thibault, Nicolas Rudolph; Husson, Dorothée; Harlou, Rikke

2012-01-01

An integrated framework of magnetostratigraphy, calcareous microfossil bio-events, cyclostratigraphy and d13C stratigraphy is established for the upper Campanian–Maastrichtian of ODP Hole 762C (Exmouth Plateau, Northwestern Australian margin). Bulk-carbonate d13C events and nannofossil bio-events...

Bis[3,5-difluoro-2-(4-methylpyridin-2-ylphenyl-κ2C1,N](picolinato-κ2N,Oiridium(III chloroform monosolvate

Directory of Open Access Journals (Sweden)

Young-Inn Kim

2011-09-01

Full Text Available In the title complex, [Ir(C12H8F2N2(C6H4NO2]·CHCl3, two similar molecules of each component comprise the asymmetric unit. The independent complex molecules are linked by intermolecular π–π interactions [centroid–centroid distance = 3.830 (4 Å]. The IrIII ion adopts a distorted octahedral geometry, being coordinated by three N atoms, two C atoms, and one O atom of three bidentate ligands, with the N atoms arranged meridionally.

A VERY CLOSE BINARY BLACK HOLE IN A GIANT ELLIPTICAL GALAXY 3C 66B AND ITS BLACK HOLE MERGER

International Nuclear Information System (INIS)

Iguchi, Satoru; Okuda, Takeshi; Sudou, Hiroshi

2010-01-01

Recent observational results provide possible evidence that binary black holes (BBHs) exist in the center of giant galaxies and may merge to form a supermassive black hole in the process of their evolution. We first detected a periodic flux variation on a cycle of 93 ± 1 days from the 3 mm monitor observations of a giant elliptical galaxy 3C 66B for which an orbital motion with a period of 1.05 ± 0.03 yr had been already observed. The detected signal period being shorter than the orbital period can be explained by taking into consideration the Doppler-shifted modulation due to the orbital motion of a BBH. Assuming that the BBH has a circular orbit and that the jet axis is parallel to the binary angular momentum, our observational results demonstrate the presence of a very close BBH that has a binary orbit with an orbital period of 1.05 ± 0.03 yr, an orbital radius of (3.9 ± 1.0) x 10 -3 pc, an orbital separation of (6.1 +1.0 -0.9 ) x 10 -3 pc, a larger black hole mass of (1.2 +0.5 -0.2 ) x 10 9 M sun , and a smaller black hole mass of (7.0 +4.7 -6.4 ) x 10 8 M sun . The BBH decay time of (5.1 +60.5 -2.5 ) x 10 2 yr provides evidence for the occurrence of black hole mergers. This Letter will demonstrate the interesting possibility of black hole collisions to form a supermassive black hole in the process of evolution, one of the most spectacular natural phenomena in the universe.

Results of Hydraulic Tests in Miocene Tuffaceous Rocks at the C-Hole Complex, 1995 to 1997, Yucca Mountain, Nye County, Nevada

Science.gov (United States)

Geldon, Arthur L.; Umari, Amjad M.A.; Fahy, Michael F.; Earle, John D.; Gemmell, James M.; Darnell, Jon

2002-01-01

Four hydraulic tests were conducted by the U.S. Geological Survey at the C-hole complex at Yucca Mountain, Nevada, between May 1995 and November 1997. These tests were conducted as part of ongoing investigations to determine the hydrologic and geologic suitability of Yucca Mountain as a potential site for permanent underground storage of high-level nuclear waste. The C-hole complex consists of three 900-meter-deep boreholes that are 30.4 to 76.6 meters apart. The C-holes are completed in fractured, variably welded tuffaceous rocks of Miocene age. Six hydrogeologic intervals occur within the saturated zone in these boreholes - the Calico Hills, Prow Pass, Upper Bullfrog, Lower Bullfrog, Upper Tram, and Lower Tram intervals. The Lower Bullfrog and Upper Tram intervals contributed about 90 percent of the flow during hydraulic tests. The four hydraulic tests conducted from 1995 to 1997 lasted 4 to 553 days. Discharge from the pumping well, UE-25 c #3, ranged from 8.49 to 22.5 liters per second in different tests. Two to seven observation wells, 30 to 3,526 meters from the pumping well, were used in different tests. Observation wells included UE-25 c #1, UE-25 c #2, UE-25 ONC-1, USW H-4, UE-25 WT #14, and UE-25 WT #3 in the tuffaceous rocks and UE-25 p #1 in Paleozoic carbonate rocks. In all hydraulic tests, drawdown in the pumping well was rapid and large (2.9-11 meters). Attributable mostly to frictional head loss and borehole-skin effects, this drawdown could not be used to analyze hydraulic properties. Drawdown and recovery in intervals of UE-25 c #1 and UE-25 c #2 and in other observation wells typically was less than 51 centimeters. These data were analyzed. Hydrogeologic intervals in the C-holes have layered heterogeneity related to faults and fracture zones. Transmissivity, hydraulic conductivity, and storativity generally increase downhole. Transmissivity ranges from 4 to 1,600 meters squared per day; hydraulic conductivity ranges from 0.1 to 50 meters per day

Gammay rays from Penrose powered black holes in centaurus A, 3C 273, and NGC 4151

International Nuclear Information System (INIS)

Kafatos, M.; and Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center)

1980-01-01

Gamma-ray observations of active galaxies have important consequences for theories of the activity in their nuclei. The observations of Cen A, 3C 273, and NGC 4151 are examined under the assumption that Penrose collision processes in the ergospheres of massive black holes power their nuclei. The observed sharp break in the MeV region of the NGC 4151 spectrum cannot be due to the γ-γ pair production process. We attribute this break to the Penrose Compton scattering (PCS), in which γ-rays escape from the ergosphere as a result of Penrose processes involving electrons and lower energy X-ray photons in the ergosphere of the black hole. The absence of an MeV break in the spectra of Cen A and 3C 273 argues in favor of the Penrose pair production (PPP), in which high-energy pairs (a few GeV in energy) escape as result of Penrose processes involving protons and γ-rays that are present in any hot, optically thin, vertically extended accretion disk. An intrinsic break in the GeV region is predicted for both Cen A and 3C 273 as well as any other PPP powered nucleus.If PPP is important for QSOs and radio galaxies and some Seyferts, powerful radio objects should also be powerful γ-ray objects. Nuclei in which the black hole is spinning slowly would still emit visible light, UV, and X-rays as result of accretion without Penrose processes but would be weak in radio or high-energy γ-rays. Future γ-ray observations should provide clues as to whether this scenario is correct. Besides spectral information at γ-ray frequencies, possible variability at γ-ray frequencies should be searched for

Uppermost Cretaceous to middle Oligocene carbon and oxygen isotope stratigraphy of Southwest Pacific : holes 1121B and 1124C, ODP Leg 181

International Nuclear Information System (INIS)

Wei, K.-Y.; Mii, H.-S.; Shu, I-T.; Lin, Y.-J.

2005-01-01

Oxygen and carbon isotopic ratios of bulk sediments from ODP Leg 181, holes 1121B and 1124C, in the Southwest Pacific were measured. The isotopic signals are mainly contributed by calcareous nannofossils with minimal diagenetic alteration. A complete section of the late Paleogene age between 60.7 and 57.5 Ma was recovered from Hole 1121B. However, the Paleogene sedimentary sequence of Hole 1124C was truncated by three major hiatuses: late Paleocene to middle Eocene (59-42 Ma), middle Eocene to early Oligocene (40-33.5 Ma), and early Oligocene to middle Oligocene (31.3-27.5 Ma). The middle Eocene shows the most negative δ 18 O values (c. -0.8 permille) compared to the early Paleocene (c. -0.2 to -0.3 permille) and Oligocene (c. 0.6-0.9 permille). The δ 18 O pattern is consistent with previous understanding of the Paleogene paleoclimate: a warmth optimum in the early-middle Eocene followed by a major glaciation in the early Oligocene at c. 34 Ma. The hiatus of 33.5-40 Ma indicates that the Tasmanian Gateway had deepened enough by 33.5 Ma, allowing the breakthrough of cold, bottom water and consequently the formation of the Deep Western Boundary Current (DWBC). With the aid of independent biochronological and magnetochronological markers, the Paleocene carbon isotopic profiles were correlated with that of DSDP 577 in the North Pacific. Both sites record the early part of the Paleocene carbon isotopic maximum event, while only Hole 1124C extends back to the early Paleocene and latest Cretaceous. A short hiatus of 60.5-62.5 Ma age may exist. Although the Cretaceous/Tertiary boundary is not directly recorded, a significant cooling trend across the boundary is evident. The surface water became warmer after 64.5 Ma, and reached a stable warmth level during 64-59 Ma. A major cooling took place during c. 59-57 Ma in the late Paleocene. The temperature gradients between the two sites (ODP 1121 and 1124, paleolatitudes 64 degrees S versus 53 degrees S) are estimated to be c

ASM Triggered too Observations of 100,000 C/s Black-Hole Candidates (core Program)

Science.gov (United States)

Resubmission accepted Cycle 2-11 proposal. The PCA is unique by the high count rates (~100.000 c/s) it can record, and its resulting extreme sensitivity to weak variability. Only few sources get this bright. Our RXTE work on Sco X-1 and 1744-28 shows that high count rate observations are very rewarding, but also difficult and not without risk. In the life of the satellite probably only one black hole transient (if any) will reach 10^5 cps/5 PCU levels. When this occurs a window of discovery will be opened on black holes, which will nearly certainly close again within a few days. This proposal aims at ensuring that optimal use is made of this opportunity by performing state of the art high count rate observations covering all of the most crusial aspects of the source variability.

New Insights from Domain-averaged Fermi holes and Bond Order Analysis into the Bonding Conundrum in C2.

Czech Academy of Sciences Publication Activity Database

Cooper, D.L.; Ponec, Robert; Kohout, M.

2016-01-01

Roč. 114, 7-8 (2016), s. 1270-1284 ISSN 0026-8976 Institutional support: RVO:67985858 Keywords : peculiarity of C2 bonding * domain-averaged Fermi holes (DAFH) * cioslowski bond orders Subject RIV: CC - Organic Chemistry Impact factor: 1.870, year: 2016

Analysis of materials modifications caused by UV laser micro drilling of via holes in AlGaN/GaN transistors on SiC

Energy Technology Data Exchange (ETDEWEB)

Wernicke, Tim [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Gustav-Kirchhoff-Str. 4, 12489 Berlin (Germany)]. E-mail: tim.wernicke@fbh-berlin.de; Krueger, Olaf [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Gustav-Kirchhoff-Str. 4, 12489 Berlin (Germany); Herms, Martin [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Gustav-Kirchhoff-Str. 4, 12489 Berlin (Germany); Wuerfl, Joachim [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Gustav-Kirchhoff-Str. 4, 12489 Berlin (Germany); Kirmse, Holm [Humboldt-Universitaet zu Berlin, Institut fuer Physik, AG Kristallographie, Newtonstr. 15, 12489 Berlin (Germany); Neumann, Wolfgang [Humboldt-Universitaet zu Berlin, Institut fuer Physik, AG Kristallographie, Newtonstr. 15, 12489 Berlin (Germany); Behm, Thomas [Technische Universitaet Bergakademie Freiberg, Institut fuer Theoretische Physik, Bernhard-von-Cotta-Str. 4, 09596 Freiberg (Germany); Irmer, Gert [Technische Universitaet Bergakademie Freiberg, Institut fuer Theoretische Physik, Bernhard-von-Cotta-Str. 4, 09596 Freiberg (Germany); Traenkle, Guenther [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Gustav-Kirchhoff-Str. 4, 12489 Berlin (Germany)

2007-07-31

Pulsed UV laser drilling can be applied to fabricate vertical electrical interconnects (vias) for AlGaN/GaN high electron mobility transistor devices on single-crystalline silicon carbide (SiC) substrate. Through-wafer micro holes with a diameter of 50-100 {mu}m were formed in 400 {mu}m thick bulk 4H-SiC by a frequency-tripled solid-state laser (355 nm) with a pulse width of {<=}30 ns and a focal spot size of {approx}15 {mu}m. The impact of laser machining on the material system in the vicinity of micro holes was investigated by means of micro-Raman spectroscopy and transmission electron microscopy. After removing the loosely deposited debris by etching in buffered hydrofluoric acid, a layer of <4 {mu}m resolidified material remains at the side walls of the holes. The thickness of the resolidified layer depends on the vertical distance to the hole entry as observed by scanning electron microscopy. Micro-Raman spectra indicate a change of internal strain due to laser drilling and evidence the formation of nanocrystalline silicon (Si). Microstructure analysis of the vias' side walls using cross sectional TEM reveals altered degree of crystallinity in SiC. Layers of heavily disturbed SiC, and nanocrystalline Si are formed by laser irradiation. The layers are separated by 50-100 nm thick interface regions. No evidence of extended defects, micro cracking or crystal damage was found beneath the resolidified layer. The precision of UV laser micro ablation of SiC using nanosecond pulses is not limited by laser-induced extended crystal defects.

Effect of Web Holes and Bearing Stiffeners on Flexural-Shear Interaction Strength of Steel Cold-Formed C-Channel Sections

Directory of Open Access Journals (Sweden)

Iman Faridmehr

Full Text Available Abstract This paper presents an investigation on interaction equation between the required flexural strength, M, and the required shear strength, V, of cold-formed C-channels with web holes and bearing stiffeners. The primarily shear condition test was employed to study total 8 back to back lipped C channel sections of 95 and 100 mm depth when bearing stiffeners and circular holes were placed at center and both ends of specimens. The interaction equation were evaluated via Direct Strength Method, DSM, in accordance with the American Iron and Steel Institute for the design of cold-formed steel structural members, AISI 2007. A nonlinear finite element model was developed and verified against the test results in terms of failure buckling modes. It was concluded that the M-V interaction equation for specimens with web stiffeners was conservative where these specimens experienced plastic failure mode rather than local (Msl or distortional (Msd buckling mode. Moreover, the results indicated that proposed M-V interaction equation calculated by local buckling strength (Msl adequately predicted the behavior of specimens with circular web holes.

Dominant mutations in KAT6A cause intellectual disability with recognizable syndromic features.

Science.gov (United States)

Tham, Emma; Lindstrand, Anna; Santani, Avni; Malmgren, Helena; Nesbitt, Addie; Dubbs, Holly A; Zackai, Elaine H; Parker, Michael J; Millan, Francisca; Rosenbaum, Kenneth; Wilson, Golder N; Nordgren, Ann

2015-03-05

Through a multi-center collaboration study, we here report six individuals from five unrelated families, with mutations in KAT6A/MOZ detected by whole-exome sequencing. All five different de novo heterozygous truncating mutations were located in the C-terminal transactivation domain of KAT6A: NM_001099412.1: c.3116_3117 delCT, p.(Ser1039∗); c.3830_3831insTT, p.(Arg1278Serfs∗17); c.3879 dupA, p.(Glu1294Argfs∗19); c.4108G>T p.(Glu1370∗) and c.4292 dupT, p.(Leu1431Phefs∗8). An additional subject with a 0.23 MB microdeletion including the entire KAT6A reading frame was identified with genome-wide array comparative genomic hybridization. Finally, by detailed clinical characterization we provide evidence that heterozygous mutations in KAT6A cause a distinct intellectual disability syndrome. The common phenotype includes hypotonia, intellectual disability, early feeding and oromotor difficulties, microcephaly and/or craniosynostosis, and cardiac defects in combination with subtle facial features such as bitemporal narrowing, broad nasal tip, thin upper lip, posteriorly rotated or low-set ears, and microretrognathia. The identification of human subjects complements previous work from mice and zebrafish where knockouts of Kat6a/kat6a lead to developmental defects. Copyright © 2015 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

Polyethers containing 4-(carbazol-2-yl)-7-arylbenzo[c]-1,2,5-thiadiazole chromophores as solution processed materials for hole transporting layers of OLEDs

Science.gov (United States)

Krucaite, G.; Tavgeniene, D.; Xie, Z.; Lin, X.; Zhang, B.; Grigalevicius, S.

2018-02-01

Two polyethers containing electroactive pendent 4-(carbazol-2-yl)-7-arylbenzo[c]-1,2,5-thiadiazole moieties have been synthesized by the multi-step synthetic route. Full characterization of their structures is presented. The polymers represent derivatives of very high thermal stability with initial thermal degradation temperatures of 425 °C and 431 °C. Glass transition temperatures of the amorphous materials were also very high and reached values of 154 °C and 163 °C. The electron photoemission spectra of thin layers of the polymers showed ionization potentials of 5.84 eV and 5.93 eV. Hole-transporting properties of the polymeric materials were tested in the structures of organic light emitting diodes with Alq3 as the green emitter and electron transporting material. An electroluminescent device containing hole-transporting layer (HTL) of the polymer with electroactive 4-carbazolyl-7-phenylbenzo[c]-1,2,5-thiadiazole moieties exhibited turn on voltage of 6.2 V, maximum photometric efficiency of 2.5 cd/A and maximum brightness exceeding 300 cd/m2. The device containing HTL of the polymer with 4-carbazolyl-7-(1-naphtyl)benzo[c]-1,2,5-thiadiazole moieties demonstrated turn on voltage of 5.2 V, maximum photometric efficiency of 1.6 cd/A and maximum brightness exceeding 1500 cd/m2. The efficiencies were about 30-90% higher than that of the device containing widely used hole transporting layers of poly(9-vinylcarbazole).

Electronic structure of C r2AlC as observed by angle-resolved photoemission spectroscopy

Science.gov (United States)

Ito, Takahiro; Pinek, Damir; Fujita, Taishi; Nakatake, Masashi; Ideta, Shin-ichiro; Tanaka, Kiyohisa; Ouisse, Thierry

2017-11-01

We investigate the electronic band structure and Fermi surfaces (FSs) of C r2AlC single crystals with angle-resolved photoemission spectroscopy. We evidence hole bands centered around the M points and electron bands centered around the Γ point in reciprocal space. Electron and hole bands exhibit an open, tubular structure along the c axis, confirming the quasi-two-dimensional character of this highly anisotropic, nanolamellar compound. Dependence of the photoionization cross sections on beam light polarization and orientation allows us to assess the orbital character of each observed band locally. Despite some differences, density functional theory calculations show a good agreement with experiment.

Take the "C" Train

Science.gov (United States)

Lawton, Rebecca

2008-01-01

In this essay, the author recalls several of her experiences in which she successfully pulled her boats out of river holes by throwing herself to the water as a sea-anchor. She learned this trick from her senior guides at a spring training. Her guides told her, "When you're stuck in a hole, take the "C" train."" "Meaning?" The author asked her…

A new cubic theory of gravity in five dimensions: black hole, Birkhoff's theorem and C-function

Energy Technology Data Exchange (ETDEWEB)

Oliva, Julio [Instituto de Fisica, Facultad de Ciencias, Universidad Austral de Chile, Valdivia (Chile); Ray, Sourya, E-mail: julio.oliva@docentes.uach.c, E-mail: ray@cecs.c [Centro de Estudios CientIficos (CECS), Casilla 1469, Valdivia (Chile)

2010-11-21

We present a new cubic theory of gravity in five dimensions which has second-order traced field equations, analogous to BHT new massive gravity in three dimensions. Moreover, for static spherically symmetric spacetimes all the field equations are of second order, and the theory admits a new asymptotically locally flat black hole. Furthermore, we prove the uniqueness of this solution, study its thermodynamical properties and show the existence of a C-function for the theory following the arguments of Anber and Kastor (2008 J. High Energy Phys. JHEP05(2008)061 (arXiv:0802.1290 [hep-th])) in pure Lovelock theories. Finally, we include the Einstein-Gauss-Bonnet and cosmological terms and find new asymptotically AdS black holes at the point where the three maximally symmetric solutions of the theory coincide. These black holes may also possess a Cauchy horizon.

Extremal limits of the C metric: Nariai, Bertotti-Robinson, and anti-Nariai C metrics

International Nuclear Information System (INIS)

Dias, Oscar J.C.; Lemos, Jose P.S.

2003-01-01

In two previous papers we have analyzed the C metric in a background with a cosmological constant Λ, namely, the de-Sitter (dS) C metric (Λ>0), and the anti-de Sitter (AdS) C metric (Λ 0, Λ=0, and Λ 2 xS-tilde 2 ) to each point in the deformed two-sphere S-tilde 2 corresponds a dS 2 spacetime, except for one point which corresponds to a dS 2 spacetime with an infinite straight strut or string. There are other important new features that appear. One expects that the solutions found in this paper are unstable and decay into a slightly nonextreme black hole pair accelerated by a strut or by strings. Moreover, the Euclidean version of these solutions mediate the quantum process of black hole pair creation that accompanies the decay of the dS and AdS spaces

78 FR 55123 - Submission for Review: We Need Information About Your Missing Payment, RI 38-31

Science.gov (United States)

2013-09-09

...The Retirement Services, Office of Personnel Management (OPM) offers the general public and other Federal agencies the opportunity to comment on an extension, without change, of a currently approved information collection request (ICR) 3206-0187, We Need Information About Your Missing Payment, RI 38-31. As required by the Paperwork Reduction Act of 1995 (Pub. L. 104-13, 44 U.S.C. chapter 35) as amended by the Clinger-Cohen Act (Pub. L. 104-106), OPM is soliciting comments for this collection. The Office of Management and Budget is particularly interested in comments that: 1. Evaluate whether the proposed collection of information is necessary for the proper performance of functions of OPM, including whether the information will have practical utility; 2. Evaluate the accuracy of OPM's estimate of the burden of the proposed collection of information, including the validity of the methodology and assumptions used; 3. Enhance the quality, utility, and clarity of the information to be collected; and 4. Minimize the burden of the collection of information on those who are to respond, including through the use of appropriate automated, electronic, mechanical, or other technological collection techniques or other forms of information technology, e.g., permitting electronic submissions of responses.

A c-function for non-supersymmetric attractors

International Nuclear Information System (INIS)

Goldstein, Kevin; Jena, Rudra P.; Mandal, Gautam; Trivedi, Sandip P.

2006-01-01

We present a c-function for spherically symmetric, static and asymptotically flat solutions in theories of four-dimensional gravity coupled to gauge fields and moduli. The c-function is valid for both extremal and non-extremal black holes. It monotonically decreases from infinity and in the static region acquires its minimum value at the horizon, where it equals the entropy of the black hole. Higher dimensional cases, involving p-form gauge fields, and other generalisations are also discussed

Betavoltaic device in por-SiC/Si C-Nuclear Energy Converter

Directory of Open Access Journals (Sweden)

Akimchenko Alina

2017-01-01

Full Text Available The miniature and low-power devices with long service life in hard operating conditions like the Carbon-14 beta-decay energy converters indeed as eternal resource for integrated MEMS and NEMS are considered. Authors discuss how to create the power supply for MEMS/NEMS devices, based on porous SiC/Si structure, which are tested to be used as the beta-decay energy converters of radioactive C-14 into electrical energy. This is based on the silicon carbide obtaining by self-organizing mono 3C-SiC endotaxy on the Si substrate. The new idea is the C-14 atoms including in molecules in the silicon carbide porous structure by this technology, which will increase the efficiency of the converter due to the greater intensity of electron-hole pairs generation rate in the space charge region. The synthesis of C-14 can be also performed by using the electronically controlled magneto-optic chamber.

A SPITZER c2d LEGACY SURVEY TO IDENTIFY AND CHARACTERIZE DISKS WITH INNER DUST HOLES

International Nuclear Information System (INIS)

Merin, Bruno; Brown, Joanna M.; Herczeg, Gregory J.; Van Dishoeck, Ewine F.; Oliveira, Isa; Lahuis, Fred; Bottinelli, Sandrine; Augereau, Jean-Charles; Olofsson, Johan; Evans, Neal J.; Harvey, Paul M.; Cieza, Lucas; Spezzi, Loredana; Prusti, Timo; Alcala, Juan M.; Blake, Geoffrey A.; Bayo, Amelia; Geers, Vincent G.; Walter, Frederick M.; Chiu, Kuenley

2010-01-01

Understanding how disks dissipate is essential to studies of planet formation. However, identifying exactly how dust and gas dissipate is complicated due to the difficulty of finding objects that are clearly in the transition phase of losing their surrounding material. We use Spitzer Infrared Spectrograph (IRS) spectra to examine 35 photometrically selected candidate cold disks (disks with large inner dust holes). The infrared spectra are supplemented with optical spectra to determine stellar and accretion properties and 1.3 mm photometry to measure disk masses. Based on detailed spectral energy distribution modeling, we identify 15 new cold disks. The remaining 20 objects have IRS spectra that are consistent with disks without holes, disks that are observed close to edge-on, or stars with background emission. Based on these results, we determine reliable criteria to identify disks with inner holes from Spitzer photometry, and examine criteria already in the literature. Applying these criteria to the c2d surveyed star-forming regions gives a frequency of such objects of at least 4% and most likely of order 12% of the young stellar object population identified by Spitzer. We also examine the properties of these new cold disks in combination with cold disks from the literature. Hole sizes in this sample are generally smaller than in previously discovered disks and reflect a distribution in better agreement with exoplanet orbit radii. We find correlations between hole size and both disk and stellar masses. Silicate features, including crystalline features, are present in the overwhelming majority of the sample, although the 10 μm feature strength above the continuum declines for holes with radii larger than ∼7 AU. In contrast, polycyclic aromatic hydrocarbons are only detected in 2 out of 15 sources. Only a quarter of the cold disk sample shows no signs of accretion, making it unlikely that photoevaporation is the dominant hole-forming process in most cases.

High density plasma via hole etching in SiC

International Nuclear Information System (INIS)

Cho, H.; Lee, K.P.; Leerungnawarat, P.; Chu, S.N.G.; Ren, F.; Pearton, S.J.; Zetterling, C.-M.

2001-01-01

Throughwafer vias up to 100 μm deep were formed in 4H-SiC substrates by inductively coupled plasma etching with SF 6 /O 2 at a controlled rate of ∼0.6 μm min-1 and use of Al masks. Selectivities of >50 for SiC over Al were achieved. Electrical (capacitance-voltage: current-voltage) and chemical (Auger electron spectroscopy) analysis techniques showed that the etching produced only minor changes in reverse breakdown voltage, Schottky barrier height, and near surface stoichiometry of the SiC and had high selectivity over common frontside metallization. The SiC etch rate was a strong function of the incident ion energy during plasma exposure. This process is attractive for power SiC transistors intended for high current, high temperature applications and also for SiC micromachining

Covariance mapping of two-photon double core hole states in C 2 H 2 and C 2 H 6 produced by an x-ray free electron laser

International Nuclear Information System (INIS)

Mucke, M; Motomura, K; Bozek, J D; Schorb, S; Messerschmidt, M; Glownia, J M; Cryan, J P; Coffee, R N; Takahashi, O; Prince, K C; Feifel, R; Univ. of Gothenburg

2015-01-01

Few-photon ionization and relaxation processes in acetylene (C 2 H 2 ) and ethane (C 2 H 6 ) were investigated at the linac coherent light source x-ray free electron laser (FEL) at SLAC, Stanford using a highly efficient multi-particle correlation spectroscopy technique based on a magnetic bottle. The analysis method of covariance mapping has been applied and enhanced, allowing us to identify electron pairs associated with double core hole (DCH) production and competing multiple ionization processes including Auger decay sequences. The experimental technique and the analysis procedure are discussed in the light of earlier investigations of DCH studies carried out at the same FEL and at third generation synchrotron radiation sources. In particular, we demonstrate the capability of the covariance mapping technique to disentangle the formation of molecular DCH states which is barely feasible with conventional electron spectroscopy methods

Drift mobility of thermalized and highly energetic holes in thin layers of amorphous dielectric SiC

International Nuclear Information System (INIS)

Sielski, Jan; Jeszka, Jeremiasz K.

2012-01-01

The development of new technology in the electronics industry requires new dielectric materials. It is also important to understand the charge-carrier transport mechanism in these materials. We examined the hole drift mobility in amorphous SiC dielectric thin films using the time-of-flight (TOF) method. Charge carriers were generated using an electron gun. The generated holes gave a dispersive TOF signal and the mobility was low. For electric field strengths above 4 x 10 5 V cm -1 the drift mobility shows a very strong dependence on the electric field and a weak temperature dependence (transport of ''high-energy'' charge carriers). At lower electric fields and for thermalized charge carriers the mobility is practically field independent and thermally activated. The observed phenomenon was attributed to the changes in the effective energy of the generated carriers moving in the high electric fields and consequently in the density of localized states taking part in the transport. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

The effect of C60 doping on the electroluminescent performance of organic light-emitting devices

International Nuclear Information System (INIS)

Xu Denghui; Deng Zhenbo; Xiao Jing; Guo Dong; Hao Jingang; Zhang Yuanyuan; Gao Yinhao; Liang Chunjun

2007-01-01

Organic light-emitting devices (OLEDs) with the PVK hole transport layer were fabricated. The effect of C 60 doping in the hole transport PVK layer on the performance of the devices was investigated by changing the C 60 content from 0 to 3.0 wt%. The OLEDs had a structure of ITO/PEDOT:PSS/PVK:C 60 (0, 0.5, 1.0, 2.0, 3.0 wt%)/AlQ/LiF/Al. The doping led to a higher conductivity in C 60 -doped PVK layer and the hole mobility of PVK was improved from 4.5x10 -7 to 2.6x10 -6 cm 2 /Vs with the doping concentration of C 60 changing from 0 to 3.0 wt%. Moreover, the doping led to a high density of equilibrium charges carriers, which facilitated hole injection and transport. Doping of C 60 in PVK resulted in efficient hole injection and low drive voltage at high luminance

Analysis of a multiple-well interference test in Miocene tuffaceous rocks at the C-Hole complex, May--June 1995, Yucca Mountain, Nye County, Nevada

International Nuclear Information System (INIS)

Geldon, A.L.; Umari, A.M.A.; Earle, J.D.; Fahy, M.F.; Gemmell, J.M.; Darnell, J.

1998-01-01

A multiple-well interference (pumping) test was conducted in Miocene tuffaceous rocks at the C-hole complex at Yucca Mountain, Nev., from May 22 to June 12, 1995, by the US Geological Survey, in cooperation with the US Department of Energy. This pumping test was conducted as part of investigations to determine the suitability of Yucca Mountain as a potential site for the storage of high-level nuclear waste in a mined geologic repository. During the test, borehole UE-25 c number-sign 3 was pumped for 10 days at an average rate of 17.9 liters per second. Drawdown in 6 observation wells completed in Miocene tuffaceous rocks 29.0--3,525.6 meters from the pumping well ranged from 0 to 0.42 meters 14,000 minutes after pumping started. The spatial distribution of this drawdown indicates that a northwest-trending zone of discontinuous faults might be affecting ground-water movement in the Miocene tuffaceous rocks near the C-holes. No drawdown was observed in a borehole completed in a regional Paleozoic carbonate aquifer 630.0 meters from the pumping well. Consequently, it could not be determined during the pumping test if the Miocene tuffaceous rocks are connected hydraulically to the regional aquifer. Analyses of drawdown and recovery indicate that the Miocene tuffaceous rocks in the vicinity of the C-holes have transmissivity values of 1,600--3,200 meters squared per day, horizontal hydraulic conductivity values of 6.5--13 meters per day, vertical hydraulic conductivity values of 0.2--1.7 meters per day, storativity values of 0.001--0.003, and specific yield values of 0.01--0.2

Predictions of tracer transport in interwell tracer tests at the C-Hole complex. Yucca Mountain site characterization project report milestone 4077

International Nuclear Information System (INIS)

Reimus, P.W.

1996-09-01

This report presents predictions of tracer transport in interwell tracer tests that are to be conducted at the C-Hole complex at the Nevada Test Site on behalf of the Yucca Mountain Site Characterization Project. The predictions are used to make specific recommendations about the manner in which the tracer test should be conducted to best satisfy the needs of the Project. The objective of he tracer tests is to study flow and species transport under saturated conditions in the fractured tuffs near Yucca Mountain, Nevada, the site of a potential high-level nuclear waste repository. The potential repository will be located in the unsaturated zone within Yucca Mountain. The saturated zone beneath and around the mountain represents the final barrier to transport to the accessible environment that radionuclides will encounter if they breach the engineered barriers within the repository and the barriers to flow and transport provided by the unsaturated zone. Background information on the C-Holes is provided in Section 1.1, and the planned tracer testing program is discussed in Section 1.2

Temperature dependence of hole mobility in Mott insulators: Normal-state resistivity of high-T/sub c/ superconductors

International Nuclear Information System (INIS)

Kumar, N.

1989-01-01

We consider the diffusion of a hole injected in a Mott insulator described by a one-band Hubbard Hamiltonian at half-filling and in the atomic limit. The diffusion coefficient turns out to be temperature independent exactly giving 1/T dependence for the drift mobility via the Einstein relation. This is in marked disagreement with the (1/T)/sup 1/2/ dependence obtaining in the self-retracing path approximation at low temperatures. We note the possible relevance of our result to the linear T dependence of the normal-state resistivity observed in the high-T/sub c/ oxide superconductors

Notch Sensitivity of Fatigue Behavior of a Hi-Nicalon™/SiC-B4C Composite at 1,200 °C in Air and in Steam

Science.gov (United States)

Ruggles-Wrenn, M. B.; Kurtz, G.

2013-10-01

The effect of holes on the fatigue life of a non-oxide ceramic composite processed via chemical vapor infiltration (CVI) was examined at 1,200 °C in laboratory air and in steam. The effect of holes on tensile strength at 1,200 °C was also evaluated. The composite comprised laminated woven Hi-Nicalon™ fibers in an oxidation inhibited matrix, which consisted of alternating layers of silicon carbide and boron carbide. Fiber preforms had pyrolytic carbon fiber coating with boron carbon overlay applied. Unnotched specimens and specimens with a center hole having a radius to width ratio of 0.24 were tested in tension-tension fatigue at 0.1 Hz and at 1.0 Hz. The fatigue stresses ranged from 100 to 140 MPa in air and in steam. Fatigue run-out was defined as 105 cycles at 0.1 Hz and as 2 × 105 cycles at 1.0 Hz. The net-section strength was less than the unnotched ultimate tensile strength. Comparison of notched and unnotched data also revealed that the fatigue performance was notch insensitive in both air and steam environments. Composite microstructure, as well as damage and failure mechanisms were investigated.

Effect of different parameters on machining of SiC/SiC composites via pico-second laser

Energy Technology Data Exchange (ETDEWEB)

Li, Weinan; Zhang, Ruoheng [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an, Shaanxi 10068 (China); Liu, Yongsheng, E-mail: yongshengliu@nwpu.edu.cn [Science and technology on Thermostructure Composite Materials Laboratory, Northwestern Polytechnical University, Xi’an, Shaanxi 710072 (China); Wang, Chunhui; Wang, Jing [Science and technology on Thermostructure Composite Materials Laboratory, Northwestern Polytechnical University, Xi’an, Shaanxi 710072 (China); Yang, Xiaojun [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an, Shaanxi 10068 (China); Cheng, Laifei [Science and technology on Thermostructure Composite Materials Laboratory, Northwestern Polytechnical University, Xi’an, Shaanxi 710072 (China)

2016-02-28

Graphical abstract: - Highlights: • The highlights of the manuscript include the following two aspects. • First, we found that the different machining modes (helical line scanning and single ring line scanning) and processing power of machining have remarkable effect on the surface morphology of the machined area, such as the shape, depth and the formation of different surface structures. • Secondly, we investigated that the debris consisted of C, Si and O was observed on the machined surface. • Some of the Si–C bonds of the SiC matrix and fibers would be transformed into Si–O bonds after machined, depending on the processing power. - Abstract: Pico-second laser plays an important role in modern machining technology, especially in machining high hardness materials. In this article, pico-second laser was utilized for irradiation on SiC/SiC composites, and effects of different processing parameters including the machining modes and laser power were discussed in detail. The results indicated that the machining modes and laser power had great effect on machining of SiC/SiC composites. Different types of surface morphology and structure were observed under helical line scanning and single ring line scanning, and the analysis of their formulation was discussed in detail. It was believed that the machining modes would be responsible to the different shapes of machining results at the same parameters. The processing power shall also influence the surface morphology and quality of machining results. In micro-hole drilling process, large amount of debris and fragments were observed within the micro-holes, and XPS analysis showed that there existed Si–O bonds and Si–C bonds, indicating that the oxidation during processing was incomplete. Other surface morphology, such as pores and pits were discussed as well.

Black hole singularity, generalized (holographic) c-theorem and entanglement negativity

Energy Technology Data Exchange (ETDEWEB)

Banerjee, Shamik [Kavli Institute for the Physics and Mathematics of the Universe, The University of Tokyo,5-1-5 Kashiwa-no-Ha, Kashiwa City, Chiba 277-8568 (Japan); Paul, Partha [Institute of Physics, Sachivalaya Marg, Bhubaneshwar-751005, Odisha (India)

2017-02-08

In this paper we revisit the question that in what sense empty AdS{sub 5} black brane geometry can be thought of as RG-flow. We do this by first constructing a holographic c-function using causal horizon in the black brane geometry. The UV value of the c-function is a{sub UV} and then it decreases monotonically to zero at the curvature singularity. Intuitively, the behavior of the c-function can be understood if we recognize that the dual CFT is in a thermal state and thermal states are effectively massive with a gap set by the temperature. In field theory, logarithmic entanglement negativity is an entanglement measure for mixed states. For example, in two dimensional CFTs at finite temperature the renormalized entanglement negativity of an interval has UV (Low-T) value c{sub UV} and IR (High-T) value zero. So this is a potential candidate for our c-function. In four dimensions we expect the same thing to hold on physical grounds. Now since the causal horizon goes behind the black brane horizon the holographic c-function is sensitive to the physics of the interior. Correspondingly the field theory c-function should also contain information about the interior. So our results suggest that high temperature (IR) expansion of the negativity (or any candidate c-function) may be a way to probe part of the physics near the singularity. Negativity at finite temperature depends on the full operator content of the theory and so perhaps this can be done in specific cases only. The existence of this c-function in the bulk is an extreme example of the paradigm that space-time is built out of entanglement. In particular the fact that the c-function reaches zero at the curvature singularity correlates the two facts: loss of quantum entanglement in the IR field theory and the end of geometry in the bulk which in this case is the formation of curvature singularity.

A new form of the rotating C-metric

International Nuclear Information System (INIS)

Hong, Kenneth; Teo, Edward

2005-01-01

In a previous paper, we showed that the traditional form of the charged C-metric can be transformed, by a change of coordinates, into one with an explicitly factorizable structure function. This new form of the C-metric has the advantage that its properties become much simpler to analyse. In this paper, we propose an analogous new form for the rotating charged C-metric, with structure function G(ξ) = (1 - ξ 2 )(1 + r + Aξ)(1 + r - Aξ), where r ± are the usual locations of the horizons in the Kerr-Newman black hole. Unlike the non-rotating case, this new form is not related to the traditional one by a coordinate transformation. We show that the physical distinction between these two forms of the rotating C-metric lies in the nature of the conical singularities causing the black holes to accelerate apart: the new form is free of torsion singularities and therefore does not contain any closed timelike curves. We claim that this new form should be considered the natural generalization of the C-metric with rotation

Sinkhole investigated at B.C. Hydro's Bennett Dam

International Nuclear Information System (INIS)

Anon.

1996-01-01

The cause of a sinkhole which appeared in a roadway crossing an earth filled dam in B. C., was discussed. The hole measured 6 ft. across and 20 ft. deep, and occurred in B.C. Hydro's W.A.C. Bennett Dam which measures 600 ft. high, 2,600 ft. wide at the base and 35 ft. wide at the crest. The cause of the sinkhole is not known, but it is believed that a weakness in the dam may have found its way to the surface via a pipe connected to a bedrock settlement gauge buried within the dam. Sonar and ground penetrating radar were used to examine the area. The hole has been filled with gravel and monitoring continues. Experts do not anticipate immediate risk of dam failure. 1 fig

Mud Gas Logging In A Deep Borehole: IODP Site C0002, Nankai Trough Accretionary Prism

Science.gov (United States)

Toczko, S.; Hammerschmidt, S.; Maeda, L.

2014-12-01

Mud logging, a tool in riser drilling, makes use of the essentially "closed-circuit" drilling mud flow between the drilling platform downhole to the bit and then back to the platform for analyses of gas from the formation in the drilling mud, cuttings from downhole, and a range of safety and operational parameters to monitor downhole drilling conditions. Scientific riser drilling, with coincident control over drilling mud, downhole pressure, and returning drilling mud analyses, has now been in use aboard the scientific riser drilling vessel Chikyu since 2009. International Ocean Discovery Program (IODP) Expedition 348, as part of the goal of reaching the plate boundary fault system near ~5000 mbsf, has now extended the deep riser hole (Hole C0002 N & P) to 3058.5 mbsf. The mud gas data discussed here are from two approximately parallel boreholes, one a kick-off from the other; 860-2329 mbsf (Hole C0002N) and 2163-3058 mbsf (Hole C0002P). An approximate overlap of 166 m between the holes allows for some slight depth comparison between the two holes. An additional 55 m overlap at the top of Hole C0002P exists where a 10-5/8-inch hole was cored, and then opened to 12-1/4-inch with logging while drilling (LWD) tools (Fig. 1). There are several fault zones revealed by LWD data, confirmed in one instance by coring. One of the defining formation characteristics of Holes C0002 N/P are the strongly dipping bedding planes, typically exceeding 60º. These fault zones and bedding planes can influence the methane/ethane concentrations found in the returning drilling mud. A focused comparison of free gas in drilling mud between one interval in Hole C0002 P, drilled first with a 10 5/8-inch coring bit and again with an 12 ¼-inch logging while drilling (LWD) bit is shown. Hole C0002N above this was cased all the way from the sea floor to the kick-off section. A fault interval (in pink) was identified from the recovered core section and from LWD resistivity and gamma. The plot of

Durability-enhanced two-dimensional hole gas of C-H diamond surface for complementary power inverter applications.

Science.gov (United States)

Kawarada, Hiroshi; Yamada, Tetsuya; Xu, Dechen; Tsuboi, Hidetoshi; Kitabayashi, Yuya; Matsumura, Daisuke; Shibata, Masanobu; Kudo, Takuya; Inaba, Masafumi; Hiraiwa, Atsushi

2017-02-20

Complementary power field effect transistors (FETs) based on wide bandgap materials not only provide high-voltage switching capability with the reduction of on-resistance and switching losses, but also enable a smart inverter system by the dramatic simplification of external circuits. However, p-channel power FETs with equivalent performance to those of n-channel FETs are not obtained in any wide bandgap material other than diamond. Here we show that a breakdown voltage of more than 1600 V has been obtained in a diamond metal-oxide-semiconductor (MOS) FET with a p-channel based on a two-dimensional hole gas (2DHG). Atomic layer deposited (ALD) Al 2 O 3 induces the 2DHG ubiquitously on a hydrogen-terminated (C-H) diamond surface and also acts as both gate insulator and passivation layer. The high voltage performance is equivalent to that of state-of-the-art SiC planar n-channel FETs and AlGaN/GaN FETs. The drain current density in the on-state is also comparable to that of these two FETs with similar device size and V B .

UV laser drilling of SiC for semiconductor device fabrication

Energy Technology Data Exchange (ETDEWEB)

Krueger, Olaf; Schoene, Gerd; Wernicke, Tim; John, Wilfred; Wuerfl, Joachim; Traenkle, Guenther [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Gustav-Kirchhoff-Str. 4, 12489 Berlin (Germany)

2007-04-15

Pulsed UV laser processing is used to drill micro holes in silicon carbide (SiC) wafers supporting AlGaN/GaN transistor structures. Direct laser ablation using nanosecond pulses has been proven to provide an efficient way to create through and blind holes in 400 {mu}m thick SiC. When drilling through, openings in the front pads are formed, while blind holes stop {approx}40 {mu}m before the backside and were advanced to the electrical contact pad by subsequent plasma etching without an additional mask. Low induction connections (vias) between the transistor's source pads and the ground on the backside were formed by metallization of the holes. Micro vias having aspect ratios of 5-6 have been processed in 400 {mu}m SiC. The process flow from wafer layout to laser drilling is available including an automated beam alignment that allows a positioning accuracy of {+-}1 {mu}m with respect to existing patterns on the wafer. As proven by electrical dc and rf measurements the laser-assisted via technologies have successfully been implemented into fabrication of AlGaN/GaN high-power transistors.

Occupied and unoccupied orbitals of C{sub 60} and C{sub 70} probed with C 1s emission and absorption

Energy Technology Data Exchange (ETDEWEB)

Carlisle, J.A.; Terminello, L.J.; Hudson, E.A. [Lawrence Berkeley National Lab., CA (United States)] [and others

1997-04-01

The aim of this work is to characterize the orbital structure of the fullerenes, and to pursue its evolution from a cluster to the infinite solid. For obtaining a complete picture of the electronic structure the authors compare a variety of experimental techniques, i.e. photoemission and core level emission for occupied orbitals and inverse photoemission and core level absorption for unoccupied orbitals. Their experimental results focus on optical probes involving the C 1s core level, i.e. absorption via transitions from the C 1s level into unoccupied {pi}* and {sigma}* orbitals and emission involving transitions from occupied orbitals into a C 1s hole. Due to the simplicity of the C 1s level there exist clear selection rules. For example, only transitions to and from orbitals with p-character are dipole-allowed. These results on the p-projected density of states are compared with inverse photoemission and photoemission results, where the selection rules are less definitive. In addition, a first-principles quasiparticle calculation of the density of states is used to assign the orbital features. The spectra from C{sub 60} and C{sub 70} are still far from their infinite analog, i.e., graphite, which is also measured with the same techniques. In order to determine the effect of electron transfer onto C{sub 60}, as in superconducting alkali fullerides, the authors are studying resonant emission of C{sub 60}. An electron is placed in the lowest unoccupied molecular orbital (LUMO) by optical absorption from the C 1s level and the C 1s emission detected in the presence of this spectator electron.

Compressibility of rotating black holes

International Nuclear Information System (INIS)

Dolan, Brian P.

2011-01-01

Interpreting the cosmological constant as a pressure, whose thermodynamically conjugate variable is a volume, modifies the first law of black hole thermodynamics. Properties of the resulting thermodynamic volume are investigated: the compressibility and the speed of sound of the black hole are derived in the case of nonpositive cosmological constant. The adiabatic compressibility vanishes for a nonrotating black hole and is maximal in the extremal case--comparable with, but still less than, that of a cold neutron star. A speed of sound v s is associated with the adiabatic compressibility, which is equal to c for a nonrotating black hole and decreases as the angular momentum is increased. An extremal black hole has v s 2 =0.9 c 2 when the cosmological constant vanishes, and more generally v s is bounded below by c/√(2).

Sinkhole investigated at B.C. Hydro`s Bennett Dam

Energy Technology Data Exchange (ETDEWEB)

Anon.

1996-07-01

The cause of a sinkhole which appeared in a roadway crossing an earth filled dam in B. C., was discussed. The hole measured 6 ft. across and 20 ft. deep, and occurred in B.C. Hydro`s W.A.C. Bennett Dam which measures 600 ft. high, 2,600 ft. wide at the base and 35 ft. wide at the crest. The cause of the sinkhole is not known, but it is believed that a weakness in the dam may have found its way to the surface via a pipe connected to a bedrock settlement gauge buried within the dam. Sonar and ground penetrating radar were used to examine the area. The hole has been filled with gravel and monitoring continues. Experts do not anticipate immediate risk of dam failure. 1 fig.

Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC

International Nuclear Information System (INIS)

Gusev, A.I.

1985-01-01

Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established

Results and interpretation of preliminary aquifer tests in boreholes UE-25c number-sign 1, UE-25c number-sign 2, and UE-25c number-sign 3, Yucca Mountain, Nye County, Nevada

International Nuclear Information System (INIS)

Geldon, A.L.

1996-01-01

Pumping and injection tests conducted in 1983 and 1984 in boreholes UE-25c number-sign 1, UE-25c number-sign 2, and UE-25c number-sign 3 (the c-holes) at Yucca Mountain, Nevada, were analyzed with respect to information obtained from lithologic and borehole geophysical logs, core permeameter tests, and borehole flow surveys. The three closely spaced c-holes, each of which is about 3,000 feet deep, are completed mainly in nonwelded to densely welded, ash-flow tuff of the tuffs and lavas of Calico Hills and the Crater Flat Tuff of Miocene age. Below the water table, tectonic and cooling fractures pervade the tuffaceous rocks but are distributed mainly in 11 transmissive intervals, many of which also have matrix permeability. Information contained in this report is presented as part of ongoing investigations by the US Geological Survey (USGS) regarding the hydrologic and geologic suitability of Yucca Mountain, Nevada, as a potential site for the storage of high-level nuclear waste in an underground mined geologic repository. This investigation was conducted in cooperation with the US Department of Energy under Interagency Agreement DE-AI08-78ET44802, as part of the Yucca Mountain Site Characterization Project

Anyon black holes

Science.gov (United States)

Aghaei Abchouyeh, Maryam; Mirza, Behrouz; Karimi Takrami, Moein; Younesizadeh, Younes

2018-05-01

We propose a correspondence between an Anyon Van der Waals fluid and a (2 + 1) dimensional AdS black hole. Anyons are particles with intermediate statistics that interpolates between a Fermi-Dirac statistics and a Bose-Einstein one. A parameter α (0 quasi Fermi-Dirac statistics for α >αc, but a quasi Bose-Einstein statistics for α quasi Bose-Einstein statistics. For α >αc and a range of values of the cosmological constant, there is, however, no event horizon so there is no black hole solution. Thus, for these values of cosmological constants, the AdS Anyon Van der Waals black holes have only quasi Bose-Einstein statistics.

BLACK HOLE MASS ESTIMATES BASED ON C IV ARE CONSISTENT WITH THOSE BASED ON THE BALMER LINES

Energy Technology Data Exchange (ETDEWEB)

Assef, R. J.; Denney, K. D.; Kochanek, C. S.; Peterson, B. M.; Kozlowski, S.; Dietrich, M.; Grier, C. J.; Khan, R. [Department of Astronomy, The Ohio State University, 140 W. 18th Ave., Columbus, OH 43210 (United States); Ageorges, N.; Buschkamp, P.; Gemperlein, H.; Hofmann, R. [Max-Planck-Institut fuer Extraterrestrische Physik, Giessenbachstr., D-85748 Garching (Germany); Barrows, R. S. [Arkansas Center for Space and Planetary Sciences, University of Arkansas, Fayetteville, AR 72701 (United States); Falco, E.; Kilic, M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Feiz, C.; Germeroth, A. [Landessternwarte, ZAH, Koenigstuhl 12, D-69117 Heidelberg (Germany); Juette, M.; Knierim, V. [Astron. Institut der Ruhr Univ. Bochum, Universitaetsstr. 150, D-44780 Bochum (Germany); Laun, W., E-mail: rjassef@astronomy.ohio-state.edu [Max-Planck-Institut fuer Astronomie, Koenigstuhl 17, D-69117 Heidelberg (Germany); and others

2011-12-01

Using a sample of high-redshift lensed quasars from the CASTLES project with observed-frame ultraviolet or optical and near-infrared spectra, we have searched for possible biases between supermassive black hole (BH) mass estimates based on the C IV, H{alpha}, and H{beta} broad emission lines. Our sample is based upon that of Greene, Peng, and Ludwig, expanded with new near-IR spectroscopic observations, consistently analyzed high signal-to-noise ratio (S/N) optical spectra, and consistent continuum luminosity estimates at 5100 A. We find that BH mass estimates based on the full width at half-maximum (FWHM) of C IV show a systematic offset with respect to those obtained from the line dispersion, {sigma}{sub l}, of the same emission line, but not with those obtained from the FWHM of H{alpha} and H{beta}. The magnitude of the offset depends on the treatment of the He II and Fe II emission blended with C IV, but there is little scatter for any fixed measurement prescription. While we otherwise find no systematic offsets between C IV and Balmer line mass estimates, we do find that the residuals between them are strongly correlated with the ratio of the UV and optical continuum luminosities. This means that much of the dispersion in previous comparisons of C IV and H{beta} BH mass estimates are due to the continuum luminosities rather than to any properties of the lines. Removing this dependency reduces the scatter between the UV- and optical-based BH mass estimates by a factor of approximately two, from roughly 0.35 to 0.18 dex. The dispersion is smallest when comparing the C IV {sigma}{sub l} mass estimate, after removing the offset from the FWHM estimates, and either Balmer line mass estimate. The correlation with the continuum slope is likely due to a combination of reddening, host contamination, and object-dependent SED shapes. When we add additional heterogeneous measurements from the literature, the results are unchanged. Moreover, in a trial observation of a

Hole superconductivity

International Nuclear Information System (INIS)

Hirsch, J.E.; Marsiglio, F.

1989-01-01

The authors review recent work on a mechanism proposed to explain high T c superconductivity in oxides as well as superconductivity of conventional materials. It is based on pairing of hole carriers through their direct Coulomb interaction, and gives rise to superconductivity because of the momentum dependence of the repulsive interaction in the solid state environment. In the regime of parameters appropriate for high T c oxides this mechanism leads to characteristic signatures that should be experimentally verifiable. In the regime of conventional superconductors most of these signatures become unobservable, but the characteristic dependence of T c on band filling survives. New features discussed her include the demonstration that superconductivity can result from repulsive interactions even if the gap function does not change sign and the inclusion of a self-energy correction to the hole propagator that reduces the range of band filling where T c is not zero

BINARY BLACK HOLES, GAS SLOSHING, AND COLD FRONTS IN THE X-RAY HALO HOSTING 4C+37.11

Energy Technology Data Exchange (ETDEWEB)

Andrade-Santos, Felipe; Bogdán, Ákos; Forman, William R.; Jones, Christine; Murray, Stephen S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Romani, Roger W. [Department of Physics, Stanford University, Stanford, CA 94305-4060 (United States); Taylor, Greg B. [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Zavala, Robert T. [US Naval Observatory, Flagstaff Station, 10391 W. Naval Observatory Road, Flagstaff, AZ 86001 (United States)

2016-07-20

We analyzed deep Chandra ACIS-I exposures of the cluster-scale X-ray halo surrounding the radio source 4C+37.11. This remarkable system hosts the closest resolved pair of super-massive black holes and an exceptionally luminous elliptical galaxy, the likely product of a series of past mergers. We characterize the halo with r {sub 500} ∼ 0.95 Mpc, M {sub 500} = 2.5 ± 0.2 × 10{sup 14} M {sub ⊙}, kT = 4.6 ± 0.2 keV, and a gas mass of M {sub g,500} = 2.2 ± 0.1 × 10{sup 13} M {sub ⊙}. The gas mass fraction within r {sub 500} is f {sub g} = 0.09 ± 0.01. The entropy profile shows large non-gravitational heating in the central regions. We see several surface brightness jumps, associated with substantial temperature and density changes but approximate pressure equilibrium, implying that these are sloshing structures driven by a recent merger. A residual intensity image shows a core spiral structure closely matching that seen in the Perseus cluster, although at z = 0.055 the spiral pattern is less distinct. We infer that the most recent merger occurred 1–2 Gyr ago and that the event that brought the two observed super-massive black holes to the system core is even older. Under this interpretation, the black hole binary pair has, unusually, remained at a parsec-scale separation for more than 2 Gyr.

Black hole collapse in the 1/c expansion

Energy Technology Data Exchange (ETDEWEB)

Anous, Tarek [Center for Theoretical Physics, Massachusetts Institute of Technology,Cambridge, MA 02139 (United States); Hartman, Thomas [Department of Physics, Cornell University,Ithaca, New York (United States); Rovai, Antonin; Sonner, Julian [Center for Theoretical Physics, Massachusetts Institute of Technology,Cambridge, MA 02139 (United States); Department of Theoretical Physics, University of Geneva,25 quai Ernest-Ansermet, 1214 Genève 4 (Switzerland)

2016-07-25

We present a first-principles CFT calculation corresponding to the spherical collapse of a shell of matter in three dimensional quantum gravity. In field theory terms, we describe the equilibration process, from early times to thermalization, of a CFT following a sudden injection of energy at time t=0. By formulating a continuum version of Zamolodchikov’s monodromy method to calculate conformal blocks at large central charge c, we give a framework to compute a general class of probe observables in the collapse state, incorporating the full backreaction of matter fields on the dual geometry. This is illustrated by calculating a scalar field two-point function at time-like separation and the time-dependent entanglement entropy of an interval, both showing thermalization at late times. The results are in perfect agreement with previous gravity calculations in the AdS{sub 3}-Vaidya geometry. Information loss appears in the CFT as an explicit violation of unitarity in the 1/c expansion, restored by nonperturbative corrections.

Enhanced photocatalytic activity of BiOCl by C70 modification and mechanism insight

Science.gov (United States)

Ma, Dongmei; Zhong, Junbo; Li, Jianzhang; Wang, Li; Peng, Rufang

2018-06-01

As an excellent photocatalyst which can compete with TiO2, BiOCl has triggered increasing attention. However, the practical application of BiOCl has been significantly limited by the fast recombination of the photoinduced electron-hole charge pairs. In this study, to further enhance the separation efficiency of photoinduced electron-hole charge pairs of BiOCl, a series of efficient BiOCl photocatalysts were prepared by C70 surface modification. The trapping experiments reveal that the main active species were determined to be superoxide radicals (O2rad -) and holes (h+) under simulated sunlight irradiation. The surface photovoltage spectroscopy (SPS) demonstrates that separation of the photoinduced electron-hole pairs has been significantly promoted, forming more radOH, proven by terephthalic acid photoluminescence probing technique. The photocatalytic evaluation results display that the C70/BiOCl photocatalysts exhibit much higher photocatalytic activity in decolorization of rhodamine B (RhB) than that of the bare BiOCl under the simulated sunlight irradiation. The excellent electron acceptability of C70 is conducive to the separation of the photogenerated carriers and results in efficient formation of O2rad -, proven by the results of SPS and electron spin-resonance (ESR), therefore the photocatalytic performance of C70/BiOCl has been greatly improved. Based on all these observations, an enhancement mechanism in photocatalytic performance of C70/BiOCl was proposed.

Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections

Science.gov (United States)

Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.

2012-01-01

The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.

Interfacial Electronic Structures of Photodetectors Based on C8BTBT/Perovskite.

Science.gov (United States)

Li, Lin; Tong, Sichao; Zhao, Yuan; Wang, Can; Wang, Shitan; Lyu, Lu; Huang, Yingbao; Huang, Han; Yang, Junliang; Niu, Dongmei; Liu, Xiaoliang; Gao, Yongli

2018-06-07

Comprehensive measurements of ultraviolet photoemission spectroscopy, X-ray photoemission spectroscopy, X-ray diffraction, and atomic force microscopy are adopted to investigate the corelevance of energy level alignment, molecular orientation, and film growth of Au/C8BTBT/perovskite interfaces. A small energy offset of valence band maximum of 0.06 eV between perovskite and C8BTBT makes hole transportation feasible. About 0.65 eV upward shift of energy levels is observed with the deposition of the Au film on C8BTBT, which enhances hole transportation to the Au electrode. The observations from the interface analysis are supported by a prototype photodetector of Au (80 nm)/C8BTBT (20 nm)/perovskite (100 nm) that exhibits excellent performances whose responsivity can reach up to 2.65 A W -1 , 4 times higher than the best CH 3 NH 3 PbI 3 photodetectors.

Remarkable Enhancement of the Hole Mobility in Several Organic Small-Molecules, Polymers, and Small-Molecule:Polymer Blend Transistors by Simple Admixing of the Lewis Acid p-Dopant B(C6F5)3

KAUST Repository

Panidi, Julianna; Paterson, Alexandra F.; Khim, Dongyoon; Fei, Zhuping; Han, Yang; Tsetseris, Leonidas; Vourlias, George; Patsalas, Panos A.; Heeney, Martin; Anthopoulos, Thomas D.

2017-01-01

Improving the charge carrier mobility of solution-processable organic semiconductors is critical for the development of advanced organic thin-film transistors and their application in the emerging sector of printed electronics. Here, a simple method is reported for enhancing the hole mobility in a wide range of organic semiconductors, including small-molecules, polymers, and small-molecule:polymer blends, with the latter systems exhibiting the highest mobility. The method is simple and relies on admixing of the molecular Lewis acid B(C6F5)(3) in the semiconductor formulation prior to solution deposition. Two prototypical semiconductors where B(C6F5)(3) is shown to have a remarkable impact are the blends of 2,8-difluoro-5,11-bis(triethylsilylethynyl)anthradithiophene:poly(triarylamine) (diF-TESADT:PTAA) and 2,7-dioctyl[1]-benzothieno[3,2-b][1]benzothiophene:poly(indacenodithiophene-co-benzothiadiazole) (C8-BTBT:C16-IDTBT), for which hole mobilities of 8 and 11 cm(2) V-1 s(-1), respectively, are obtained. Doping of the 6,13-bis(triisopropylsilylethynyl)pentacene:PTAA blend with B(C6F5)(3) is also shown to increase the maximum hole mobility to 3.7 cm(2) V-1 s(-1). Analysis of the single and multicomponent materials reveals that B(C6F5)(3) plays a dual role, first acting as an efficient p-dopant, and secondly as a microstructure modifier. Semiconductors that undergo simultaneous p-doping and dopant-induced long-range crystallization are found to consistently outperform transistors based on the pristine materials. Our work underscores Lewis acid doping as a generic strategy towards high performance printed organic microelectronics.

Remarkable Enhancement of the Hole Mobility in Several Organic Small-Molecules, Polymers, and Small-Molecule:Polymer Blend Transistors by Simple Admixing of the Lewis Acid p-Dopant B(C6F5)3.

Science.gov (United States)

Panidi, Julianna; Paterson, Alexandra F; Khim, Dongyoon; Fei, Zhuping; Han, Yang; Tsetseris, Leonidas; Vourlias, George; Patsalas, Panos A; Heeney, Martin; Anthopoulos, Thomas D

2018-01-01

Improving the charge carrier mobility of solution-processable organic semiconductors is critical for the development of advanced organic thin-film transistors and their application in the emerging sector of printed electronics. Here, a simple method is reported for enhancing the hole mobility in a wide range of organic semiconductors, including small-molecules, polymers, and small-molecule:polymer blends, with the latter systems exhibiting the highest mobility. The method is simple and relies on admixing of the molecular Lewis acid B(C 6 F 5 ) 3 in the semiconductor formulation prior to solution deposition. Two prototypical semiconductors where B(C 6 F 5 ) 3 is shown to have a remarkable impact are the blends of 2,8-difluoro-5,11-bis(triethylsilylethynyl)anthradithiophene:poly(triarylamine) (diF-TESADT:PTAA) and 2,7-dioctyl[1]-benzothieno[3,2-b][1]benzothiophene:poly(indacenodithiophene-co-benzothiadiazole) (C8-BTBT:C16-IDTBT), for which hole mobilities of 8 and 11 cm 2 V -1 s -1 , respectively, are obtained. Doping of the 6,13-bis(triisopropylsilylethynyl)pentacene:PTAA blend with B(C 6 F 5 ) 3 is also shown to increase the maximum hole mobility to 3.7 cm 2 V -1 s -1 . Analysis of the single and multicomponent materials reveals that B(C 6 F 5 ) 3 plays a dual role, first acting as an efficient p-dopant, and secondly as a microstructure modifier. Semiconductors that undergo simultaneous p-doping and dopant-induced long-range crystallization are found to consistently outperform transistors based on the pristine materials. Our work underscores Lewis acid doping as a generic strategy towards high performance printed organic microelectronics.

Remarkable Enhancement of the Hole Mobility in Several Organic Small-Molecules, Polymers, and Small-Molecule:Polymer Blend Transistors by Simple Admixing of the Lewis Acid p-Dopant B(C6F5)3

KAUST Repository

Panidi, Julianna

2017-10-05

Improving the charge carrier mobility of solution-processable organic semiconductors is critical for the development of advanced organic thin-film transistors and their application in the emerging sector of printed electronics. Here, a simple method is reported for enhancing the hole mobility in a wide range of organic semiconductors, including small-molecules, polymers, and small-molecule:polymer blends, with the latter systems exhibiting the highest mobility. The method is simple and relies on admixing of the molecular Lewis acid B(C6F5)(3) in the semiconductor formulation prior to solution deposition. Two prototypical semiconductors where B(C6F5)(3) is shown to have a remarkable impact are the blends of 2,8-difluoro-5,11-bis(triethylsilylethynyl)anthradithiophene:poly(triarylamine) (diF-TESADT:PTAA) and 2,7-dioctyl[1]-benzothieno[3,2-b][1]benzothiophene:poly(indacenodithiophene-co-benzothiadiazole) (C8-BTBT:C16-IDTBT), for which hole mobilities of 8 and 11 cm(2) V-1 s(-1), respectively, are obtained. Doping of the 6,13-bis(triisopropylsilylethynyl)pentacene:PTAA blend with B(C6F5)(3) is also shown to increase the maximum hole mobility to 3.7 cm(2) V-1 s(-1). Analysis of the single and multicomponent materials reveals that B(C6F5)(3) plays a dual role, first acting as an efficient p-dopant, and secondly as a microstructure modifier. Semiconductors that undergo simultaneous p-doping and dopant-induced long-range crystallization are found to consistently outperform transistors based on the pristine materials. Our work underscores Lewis acid doping as a generic strategy towards high performance printed organic microelectronics.

Single-neutron knockout from 20C and the structure of 19C

Directory of Open Access Journals (Sweden)

J.W. Hwang

2017-06-01

Full Text Available The low-lying unbound level structure of the halo nucleus 19C has been investigated using single-neutron knockout from 20C on a carbon target at 280 MeV/nucleon. The invariant mass spectrum, derived from the momenta of the forward going beam velocity 18C fragment and neutrons, was found to be dominated by a very narrow near threshold (Erel=0.036(1 MeV peak. Two less strongly populated resonance-like features were also observed at Erel=0.84(4 and 2.31(3 MeV, both of which exhibit characteristics consistent with neutron p-shell hole states. Comparisons of the energies, measured cross sections and parallel momentum distributions to the results of shell-model and eikonal reaction calculations lead to spin-parity assignments of 5/21+ and 1/21− for the levels at Ex=0.62(9 and 2.89(10 MeV with Sn=0.58(9 MeV. Spectroscopic factors were also deduced and found to be in reasonable accord with shell-model calculations. The valence neutron configuration of the 20C ground state is thus seen to include, in addition to the known 1s1/22 component, a significant 0d5/22 contribution. The level scheme of 19C, including significantly the 1/21− cross-shell state, is well accounted for by the YSOX shell-model interaction developed from the monopole-based universal interaction.

Investigation into solubility and diffusion in SiC-NbC, SiC-TiC, SiC-ZrC systems

International Nuclear Information System (INIS)

Safaraliev, G.K.; Tairov, Yu.M.; Tsvetkov, V.F.; Shabanov, Sh.Sh.

1991-01-01

An investigation is carried out which demonstrates solid-phase interaction between SiC and NbC, TiC and ZrC monocrystals. The monocrystals are subjected to hot pressing in SiC powder with dispersity of 5x10 -6 m. The pressing temperature is 2270-2570 K and pressure is varied in the range of 20-40 MPa. Element composition and the distribution profile in a thin layer near the boundary of SiC-NbC, SiC-TiC and SiC-ZrC are investigated by the Anger spectroscopy method. The obtained results permit to make the conclusion in the possibility of solid solution formation in investigated systems

Anisotropic carrier mobility in single- and bi-layer C3N sheets

Science.gov (United States)

Wang, Xueyan; Li, Qingfang; Wang, Haifeng; Gao, Yan; Hou, Juan; Shao, Jianxin

2018-05-01

Based on the density functional theory combined with the Boltzmann transport equation with relaxation time approximation, we investigate the electronic structure and predict the carrier mobility of single- and bi-layer newly fabricated 2D carbon nitrides C3N. Although C3N sheets possess graphene-like planar hexagonal structure, the calculated carrier mobility is remarkably anisotropic, which is found mainly induced by the anisotropic effective masses and deformation potential constants. Importantly, we find that both the electron and hole mobilities are considerable high, for example, the hole mobility along the armchair direction of single-layer C3N sheets can arrive as high as 1.08 ×104 cm2 V-1 s-1, greatly larger than that of C2N-h2D and many other typical 2D materials. Owing to the high and anisotropic carrier mobility and appropriate band gap, single- and bi-layer semiconducting C3N sheets may have great potential applications in high performance electronic and optoelectronic devices.

Further Rehabilitating CIV-based Black Hole Mass Estimates in Quasars

Science.gov (United States)

Brotherton, Michael S.; Runnoe, Jessie C.; Shang, Zhaohui; Varju, Melinda

2016-06-01

Virial black hole masses are routinely estimated for high-redshift quasars using the C IV lambda 1549 emission line using single-epoch spectra that provide a gas velocity and a continuum luminosity. Such masses are very uncertain, however, especially because C IV likely possesses a non-virial component that varies with the Eddington ratio. We have previously used the 1400 feature, a blend of S i IV and O IV] emission that does not suffer the problems of C IV, to rehabilitate C IV-based mases by providing a correction term. The C IV profile itself, however, provides enough information to correct the black hole masses and remove the effects of the non-virial component. We use Mg II-based black hole masses to calibrate and test a new C IV-based black hole mass formula using only C IV and continuum measurements superior to existing formulations, as well as to test for additional dependencies on luminosity.

Remarkable Enhancement of the Hole Mobility in Several Organic Small‐Molecules, Polymers, and Small‐Molecule:Polymer Blend Transistors by Simple Admixing of the Lewis Acid p‐Dopant B(C6F5)3

Science.gov (United States)

Panidi, Julianna; Paterson, Alexandra F.; Khim, Dongyoon; Fei, Zhuping; Han, Yang; Tsetseris, Leonidas; Vourlias, George; Patsalas, Panos A.; Heeney, Martin

2017-01-01

Abstract Improving the charge carrier mobility of solution‐processable organic semiconductors is critical for the development of advanced organic thin‐film transistors and their application in the emerging sector of printed electronics. Here, a simple method is reported for enhancing the hole mobility in a wide range of organic semiconductors, including small‐molecules, polymers, and small‐molecule:polymer blends, with the latter systems exhibiting the highest mobility. The method is simple and relies on admixing of the molecular Lewis acid B(C6F5)3 in the semiconductor formulation prior to solution deposition. Two prototypical semiconductors where B(C6F5)3 is shown to have a remarkable impact are the blends of 2,8‐difluoro‐5,11‐bis(triethylsilylethynyl)anthradithiophene:poly(triarylamine) (diF‐TESADT:PTAA) and 2,7‐dioctyl[1]‐benzothieno[3,2‐b][1]benzothiophene:poly(indacenodithiophene‐co‐benzothiadiazole) (C8‐BTBT:C16‐IDTBT), for which hole mobilities of 8 and 11 cm2 V−1 s−1, respectively, are obtained. Doping of the 6,13‐bis(triisopropylsilylethynyl)pentacene:PTAA blend with B(C6F5)3 is also shown to increase the maximum hole mobility to 3.7 cm2 V−1 s−1. Analysis of the single and multicomponent materials reveals that B(C6F5)3 plays a dual role, first acting as an efficient p‐dopant, and secondly as a microstructure modifier. Semiconductors that undergo simultaneous p‐doping and dopant‐induced long‐range crystallization are found to consistently outperform transistors based on the pristine materials. Our work underscores Lewis acid doping as a generic strategy towards high performance printed organic microelectronics. PMID:29375962

An exploration of the black hole entropy via the Weyl tensor

Energy Technology Data Exchange (ETDEWEB)

Li, Nan [Northeastern University, Department of Physics, College of Sciences, Shenyang (China); Li, Xiao-Long [Beijing Normal University, Department of Astronomy, Beijing (China); Song, Shu-Peng [Beijing Normal University, Department of Physics, Beijing (China)

2016-03-15

The role of the Weyl tensor C{sub μνλρ} in black hole thermodynamics is explored by looking at the relation between the scalar invariant C{sub μνλρ}C{sup μνλρ} and the entropy of n-dimensional static black holes. It is found that this invariant can be identified as the entropy density of the gravitational fields for classical 5-dimensional black holes. We calculate the proper volume integrals of C{sub μνλρ}C{sup μνλρ} for the Schwarzschild and Schwarzschild-anti-de Sitter black holes and show that these integrals correctly lead to the Bekenstein-Hawking entropy formulas, only up to some coefficients. (orig.)

Effect of Annealing Temperature on Morphological and Optical Transition of Silver Nanoparticles on c-Plane Sapphire.

Science.gov (United States)

Pandey, Puran; Kunwar, Sundar; Sui, Mao; Li, Ming-Yu; Zhang, Quanzhen; Lee, Jihoon

2018-05-01

As a promising candidate for the improved performance, silver nanoparticles (Ag NPs) have been successfully adapted in various applications such as photovoltaics, light emitting diodes (LEDs), sensors and catalysis by taking the advantage of their controllable plasmonic properties. In this paper, the control on the morphologies and optical properties of Ag NPs on c-plane sapphire (0001) is demonstrated by the systematic control of annealing temperature (between 200 and 950 °C) with 20 and 6 nm thick Ag films through the solid state dewetting. With the relatively thicker film of 20 nm, various configuration and size of Ag NPs are fabricated such as irregular, round dome-shaped and tiny Ag NPs depending on the annealing temperature. In a shrill contrast, the 6 nm Ag set exhibits a sharp distinction with the formation of densely packed small NPs and ultra-highly dense tiny Ag NPs due to the higher dewetting rate. While, the surface diffusion assumes the main driving force in the evolution process of Ag NP morphologies up to 550 °C, the sublimation of Ag atoms has played a significant role on top on the surface diffusion between 600 and 950 °C. The reflectance spectra of Ag NPs exhibit the quadrupolar resonance and dipolar resonance peaks, and the evolution of peaks, shift and average reflectance were discussed based on the Ag NPs size and surface coverage. In particular, the dipolar resonance peak in the reflectance spectra red shifts from ~475 to ~570 nm due to the size increment of Ag NPs (38.31 to 74.68 nm). The wide surface coverage of Ag NPs exhibits the highest average reflectance (~27%) and the lowest Raman intensity.

Impact of organic overlayers on a-Si:H/c-Si surface potential

KAUST Repository

Seif, Johannes P.

2017-04-11

Bilayers of intrinsic and doped hydrogenated amorphous silicon, deposited on crystalline silicon (c-Si) surfaces, simultaneously provide contact passivation and carrier collection in silicon heterojunction solar cells. Recently, we have shown that the presence of overlaying transparent conductive oxides can significantly affect the c-Si surface potential induced by these amorphous silicon stacks. Specifically, deposition on the hole-collecting bilayers can result in an undesired weakening of contact passivation, thereby lowering the achievable fill factor in a finished device. We test here a variety of organic semiconductors of different doping levels, overlaying hydrogenated amorphous silicon layers and silicon-based hole collectors, to mitigate this effect. We find that these materials enhance the c-Si surface potential, leading to increased implied fill factors. This opens opportunities for improved device performance.

Impact of organic overlayers on a-Si:H/c-Si surface potential

KAUST Repository

Seif, Johannes P.; Niesen, Bjoern; Tomasi, Andrea; Ballif, Christophe; De Wolf, Stefaan

2017-01-01

Bilayers of intrinsic and doped hydrogenated amorphous silicon, deposited on crystalline silicon (c-Si) surfaces, simultaneously provide contact passivation and carrier collection in silicon heterojunction solar cells. Recently, we have shown that the presence of overlaying transparent conductive oxides can significantly affect the c-Si surface potential induced by these amorphous silicon stacks. Specifically, deposition on the hole-collecting bilayers can result in an undesired weakening of contact passivation, thereby lowering the achievable fill factor in a finished device. We test here a variety of organic semiconductors of different doping levels, overlaying hydrogenated amorphous silicon layers and silicon-based hole collectors, to mitigate this effect. We find that these materials enhance the c-Si surface potential, leading to increased implied fill factors. This opens opportunities for improved device performance.

Top-gate microcrystalline silicon TFTs processed at low temperature (<200 deg. C)

International Nuclear Information System (INIS)

Saboundji, A.; Coulon, N.; Gorin, A.; Lhermite, H.; Mohammed-Brahim, T.; Fonrodona, M.; Bertomeu, J.; Andreu, J.

2005-01-01

N-type as well P-type top-gate microcrystalline silicon thin film transistors (TFTs) are fabricated on glass substrates at a maximum temperature of 200 deg. C. The active layer is an undoped μc-Si film, 200 nm thick, deposited by Hot-Wire Chemical Vapor. The drain and source regions are highly phosphorus (N-type TFTs) or boron (P-type TFTs)-doped μc-films deposited by HW-CVD. The gate insulator is a silicon dioxide film deposited by RF sputtering. Al-SiO 2 -N type c-Si structures using this insulator present low flat-band voltage,-0.2 V, and low density of states at the interface D it =6.4x10 10 eV -1 cm -2 . High field effect mobility, 25 cm 2 /V s for electrons and 1.1 cm 2 /V s for holes, is obtained. These values are very high, particularly the hole mobility that was never reached previously

Synthesis of C@Bi{sub 2}MoO{sub 6} nanocomposites with enhanced visible light photocatalytic activity

Energy Technology Data Exchange (ETDEWEB)

Sun, Yuying; Wu, Juan; Ma, Tianjin; Wang, Pengchao; Cui, Chunyue; Ma, Dong, E-mail: madong8088@126.com

2017-05-01

Highlights: • C@BM composites were obtained by two–step hydrothermal method. • The properties of Bi{sub 2}MoO{sub 6} were deeply influenced by carbon layer. • Carbon could reduce recombination of electrons and holes in C@BM composites. • The holes and ·O{sub 2}{sup −} are the two main reactive species for Rh B degradation. - Abstract: Carbon–coated Bi{sub 2}MoO{sub 6} (C@BM) composites have been successfully synthesized via two–step hydrothermal method. The morphology, structure and photocatalytic performance of the composites in the degradation of Rhodamine B (Rh B) are characterized. The results show that the C@BM composites exhibit enhanced photocatalytic performance in the degradation of Rh B with maximum degradation rates of 90% (210 min) under visible light irradiation. 1.0%C@BM sample shows the highest photocatalytic activity, and the improved photocatalytic performance is mainly ascribed to the formation of Mo−O−C and Bi−O−C bonds. The bonds could promote electron transfer from Bi{sub 2}MoO{sub 6} to carbon layer and inhibit the recombination of electron–hole pairs with the presence of carbon layer in the composites. Moreover, the carbon layer on Bi{sub 2}MoO{sub 6} could enhance the absorption in the visible light region. In the photocatalytic degradation process, ·O{sub 2}{sup −}and holes are the predominant active species for the decomposition of Rh B.

Variation of sigma-hole magnitude with M valence electron population in MX(n)Y(4-n) molecules (n = 1-4; M = C, Si, Ge; X, Y = F, Cl, Br).

Science.gov (United States)

McDowell, Sean A C; Joseph, Jerelle A

2014-01-14

Sigma holes are described as electron-deficient regions on atoms, particularly along the extension of covalent bonds, due to non-uniform electron density distribution on the surface of these atoms. A computational study of MX(n)Y(4-n) molecules (n = 1-4; M = C, Si, Ge; X, Y = F, Cl, Br) was undertaken and it is shown that the relative sigma hole potentials on M due to X-M and Y-M can be adequately explained in terms of the variation in the valence electron population of the central M atom. A model is proposed for the depletion of the M valence electron population which explains the trends in sigma hole strengths, especially those that cannot be accounted for solely on the basis of relative electronegativities.

HfC plasma coating of C/C composites

International Nuclear Information System (INIS)

Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.

1992-01-01

The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs

Misdiagnosis and management of iatrogenic pseudoaneurysm of vertebral artery after Harms technique of C1-C2 fixation

Directory of Open Access Journals (Sweden)

MIN Li

2012-12-01

Full Text Available 【Abstract】 Harms technique of C1-C2 fixation for atlantoaxial complex becomes more popular due to good fusion rate and low vertebral artery injury (VAI rate. But considering the unique and variable anatomy of atlanto-axial complex, iatrogenic VAI will result in catastrophic con-sequences and provides particular surgical challenges for surgeons. To our knowledge, comparing with iatrogenic VAI in the screw hole, iatrogenic VAI in the “open space” is much rarer during the Harms technique of C1-C2 fixation. In this article, we present a case of iatrogenic vertebral artery pseudoaneurysm after Harms technique of posterior C1-C2 fixation. This case of iatrogenic VAI effectively treated by endovascular coil occlusion and external local compression was initially misdiagnosed as VAI by pedicle screw perforation. It can be concluded that intraoperative or post-operative computed angiography is very helpful to diag-nose the exact site of VAI and the combination of endovascular coil occlusion as well as external local com-pression can further prevent bleeding and abnormal verte-bral artery flow in the pseudoaneurysm. However, patients treated require further follow-up to confirm that there is no recurrence of the pseudoaneurysm. Key words: Vertebral artery; Aneurysm, false; Endovascular procedures

Excitation functions of the systems 12C+14C and 13C+12C

International Nuclear Information System (INIS)

Haindl, E.

1975-01-01

The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de

Probing Exciton Diffusion and Dissociation in Single-Walled Carbon Nanotube-C60 Heterojunctions

Energy Technology Data Exchange (ETDEWEB)

Dowgiallo, Anne-Marie; Mistry, Kevin S.; Johnson, Justin C.; Reid, Obadiah G.; Blackburn, Jeffrey L.

2016-05-19

The efficiency of thin-film organic photovoltaic (OPV) devices relies heavily upon the transport of excitons to type-II heterojunction interfaces, where there is sufficient driving force for exciton dissociation and ultimately the formation of charge carriers. Semiconducting single-walled carbon nanotubes (SWCNTs) are strong near-infrared absorbers that form type-II heterojunctions with fullerenes such as C60. Although the efficiencies of SWCNT-fullerene OPV devices have climbed over the past few years, questions remain regarding the fundamental factors that currently limit their performance. In this study, we determine the exciton diffusion length in the C60 layer of SWCNT-C60 bilayer active layers using femtosecond transient absorption measurements. We demonstrate that hole transfer from photoexcited C60 molecules to SWCNTs can be tracked by the growth of narrow spectroscopic signatures of holes in the SWCNT 'reporter layer'. In bilayers with thick C60 layers, the SWCNT charge-related signatures display a slow rise over hundreds of picoseconds, reflecting exciton diffusion through the C60 layer to the interface. A model based on exciton diffusion with a Beer-Lambert excitation profile, as well as Monte Carlo simulations, gives the best fit to the data as a function of C60 layer thickness using an exciton diffusion length of approximately 5 nm.

Electron irradiation-induced defects in {beta}-SiC

Energy Technology Data Exchange (ETDEWEB)

Oshima, Ryuichiro [Osaka Prefectural Univ., Sakai (Japan). Reseach Inst. for Advanced Science and Technology

1996-04-01

To add information of point defects in cubic crystal SiC, polycrystal {beta}-SiC on the market was used as sample and irradiated by neutron and electron. In situ observation of neutron and electron irradiation-induced defects in {beta}-SiC were carried out by ultra high-voltage electronic microscope (UHVEM) and ordinary electronic microscope. The obtained results show that the electron irradiation-induced secondary defects are micro defects less than 20 nm at about 1273K, the density of defects is from 2x10{sup 17} to 1x10{sup 18}/cc, the secondary defects may be hole type at high temperature and the preexistant defects control nuclear formation of irradiation-induced defects, effective sink. (S.Y.)

Effect of Environment on Fatigue Behavior of a Nicalon(TM)/Si-N-C Ceramic Matrix Composite

Science.gov (United States)

Kalluri, Sreeramesh; Ojard, Greg C.; Verrilli, Michael J.; Kiraly, Louis J. (Technical Monitor)

2002-01-01

The effect of environmental exposure on the fatigue life of Nicalon(TM) /Si-N-C composite was investigated in this study. Test specimens with arrays of 1.8 mm diameter holes and two different open areas, 25 and 35%, were machined. Three environmental conditions were studied: 1) continuous fatigue cycling in air, 2) fatigue cycling in air alternating with humidity exposure, and 3) fatigue cycling in air alternating with exposure to a salt-fog environment. All fatigue testing on specimens with holes was performed with a load ratio, R = 0.05, and at a temperature of 910 C. In general, fatigue lives were shortest for specimens subjected to salt-fog exposure and longest for specimens subjected to continuous fatigue cycling in air. The fatigue data generated on the specimens with holes were compared with fatigue data generated in air on specimens with no holes. Fatigue strength reduction factors for different environmental conditions and open areas investigated in the study were calculated for the Nicalon(TM) /Si-N-C composite.

LC-MS/MS suggests that hole hopping in cytochrome c peroxidase protects its heme from oxidative modification by excess H2O2.

Science.gov (United States)

Kathiresan, Meena; English, Ann M

2017-02-01

We recently reported that cytochrome c peroxidase (Ccp1) functions as a H 2 O 2 sensor protein when H 2 O 2 levels rise in respiring yeast. The availability of its reducing substrate, ferrocytochrome c (Cyc II ), determines whether Ccp1 acts as a H 2 O 2 sensor or peroxidase. For H 2 O 2 to serve as a signal it must modify its receptor so we employed high-performance LC-MS/MS to investigate in detail the oxidation of Ccp1 by 1, 5 and 10 M eq. of H 2 O 2 in the absence of Cyc II to prevent peroxidase activity. We observe strictly heme-mediated oxidation, implicating sequential cycles of binding and reduction of H 2 O 2 at Ccp1's heme. This results in the incorporation of ∼20 oxygen atoms predominantly at methionine and tryptophan residues. Extensive intramolecular dityrosine crosslinking involving neighboring residues was uncovered by LC-MS/MS sequencing of the crosslinked peptides. The proximal heme ligand, H175, is converted to oxo-histidine, which labilizes the heme but irreversible heme oxidation is avoided by hole hopping to the polypeptide until oxidation of the catalytic distal H52 in Ccp1 treated with 10 M eq. of H 2 O 2 shuts down heterolytic cleavage of H 2 O 2 at the heme. Mapping of the 24 oxidized residues in Ccp1 reveals that hole hopping from the heme is directed to three polypeptide zones rich in redox-active residues. This unprecedented analysis unveils the remarkable capacity of a polypeptide to direct hole hopping away from its active site, consistent with heme labilization being a key outcome of Ccp1-mediated H 2 O 2 signaling. LC-MS/MS identification of the oxidized residues also exposes the bias of electron paramagnetic resonance (EPR) detection toward transient radicals with low O 2 reactivity.

Hydrogen incorporation in high hole density GaN:Mg

Science.gov (United States)

Zvanut, M. E.; Uprety, Y.; Dashdorj, J.; Moseley, M.; Doolittle, W. Alan

2011-03-01

We investigate hydrogen passivation in heavily doped p-type GaN using electron paramagnetic resonance (EPR) spectroscopy. Samples include both conventionally grown GaN (1019 cm-3 Mg, 1017 cm-3 holes) and films grown by metal modulation epitaxy (MME), which yielded higher Mg (1- 4 x 1020 cm-3) and hole (1- 40 x 1018 cm-3) densities than found in conventionally grown GaN. The Mg acceptor signal is monitored throughout 30 minute annealing steps in N2 :H2 (92%:7%)) and subsequently pure N2 . N2 :H2 heat treatments of the lower hole density films begin to reduce the Mg EPR intensity at 750 o C, but quench the signal in high hole density films at 600 o C. Revival of the signal by subsequent N2 annealing occurs at 800 o C for the low hole density material and 600 o C in MME GaN. The present work highlights chemical differences between heavily Mg doped and lower doped films; however, it is unclear whether the difference is due to changes in hydrogen-Mg complex formation or hydrogen diffusion. The work at UAB is supported by the NSF.

Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

DEFF Research Database (Denmark)

Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

1997-01-01

This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems

International Nuclear Information System (INIS)

Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.

1981-01-01

The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru

Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.

Science.gov (United States)

Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt

2002-02-22

C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.

Identifying isomers of C-78 by means of x-ray spectroscopy

DEFF Research Database (Denmark)

Bassan, Arianna; Nyberg, Mats; Luo, Yi

2002-01-01

X-ray photoelectron and absorption spectra of C-78 isomers have been generated using density functional theory with inclusion of the full core-hole potentials. Strong isomer dependence has been found in absorption, but not in the photoelectron spectra. C-78 isomers can be thought to be formed by ...... by inserting 18 carbon atoms into an opened C-60. We have shown how the different local arrangements of these 18 carbon atoms are responsible for the significant isomer dependence observed. Our calculated spectra are in excellent agreement with the experimental counterparts....

Electron stimulated desorption of cations from C sub 6 H sub 6 and C sub 6 H sub 1 sub 2 molecules adsorbed on Pt(1 1 1) and Ar spacer layer

CERN Document Server

Kawanowa, H; Hanatani, K; Gotoh, Y; Souda, R

2003-01-01

Mechanisms of electron stimulated cation desorption have been investigated for adsorbed C sub 6 H sub 6 and C sub 6 H sub 1 sub 2 molecules on the Pt(1 1 1) surface and the Ar spacer layer formed on it. The ion yields from the molecules adsorbed on the Ar spacer layer are highly enhanced at the smallest coverage and decay steeply with increasing coverage. No such enhancement was observed when they are adsorbed directly on the Pt(1 1 1) substrate. This behavior is explained in terms of the Coulombic repulsion of cations confined in nanoclusters, together with the delocalization of valence holes on the Pt(1 1 1) substrate as well as in the multilayer hydrocarbons. The holes in the C sub 6 H sub 6 molecule are more delocalized than those in the C sub 6 H sub 1 sub 2 molecule due to the overlap of pi orbitals.

BUDI DAYA TERPADU Cherax quadricarinatus DAN C. albertisi DENGAN PADI DALAM KOLAM TANAH

Directory of Open Access Journals (Sweden)

Taufik Ahmad

2016-11-01

Cherax spp. in Indonesia is not so well known compare to other crustaceans such as penaeids shrimp, the main aquaculture products. Since the 1990’s, the production of cherax post larvae has been intended to supply the hobbyists of ornamental crustaceans.  No data available of how large is the production of cherax in Indonesia, either for food or ornament. To provide evidence that cherax is not a padi eater, an experiment was carried out in an integrated culture with padi in 1 m x 1 m x 0.5 m earthen ponds. The cherax stocked into the ponds are C. quadricarinatus and C. albertisi, at 15 PL-45/m2 of each different pond. The water depth in each pond is maintained at 30—40 cm on the perimeter ditch. The feed, grower penaeids shrimp feed, is given at 3% biomass weight when necessary. The cherax is sampled every 30 days for total and carapace length as well as individual weight. Number and weight of grain produced and numbers of paddy seedling are the variable observed to monitor padi growth. The number of grains and seedling in cherax ponds which is not significantly different (P>0.05 from those in ponds without cherax indicating that cherax is not padi eater. Either C. quadricarinatus or C. albertisi achieved maximum individual weight of 20 g in 90 days rearing period. Both of the cherax are dyke hole maker, but tend to causing seepage. The depth of the hole ranges from 20—80 cm, just enough for the cherax to hide just after moulting. Obviously, cherax culture could be developed as a new source of income for the farmers and would not cherax is not padi eater. Either C. quadricarinatus or C. albertisi achieved maximum individual weight of 20 g in 90 days rearing period. Both of the cherax are dyke hole maker, but tend to causing seepage. The depth of the hole ranges from 20—80 cm, just enough for the cherax to hide just after moulting. Obviously, cherax culture could be developed as a new source of income for the farmers and would not threaten the production

Total Synthesis of Zoanthamine Alkaloids, Part 2. Construction of the C1-C5, C6-C10 and C11-C24 Fragments of Zoanthamine

DEFF Research Database (Denmark)

Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter

1997-01-01

This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...

Multilocus sequence typing (MLST methods for the emerging Campylobacter species C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus

Directory of Open Access Journals (Sweden)

William G Miller

2012-04-01

Full Text Available Multilocus sequence typing (MLST systems have been reported previously for multiple food- and food animal-associated Campylobacter species (e.g. C. jejuni, C. coli, C. lari and C. fetus to both differentiate strains and identify clonal lineages. These MLST methods focused primarily on campylobacters of human clinical (e.g. C. jejuni or veterinary (e.g. C. fetus relevance. However, other, emerging, Campylobacter species have been isolated increasingly from environmental, food animal or human clinical samples. We describe herein MLST methods for five emerging Campylobacter species: C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus. The concisus/curvus method uses the loci aspA, atpA, glnA, gltA, glyA, ilvD and pgm, whereas the other methods use the seven loci defined for C. jejuni (i.e., aspA, atpA, glnA, gltA, glyA, pgm, and tkt. Multiple food animal and human clinical C. hyointestinalis (n=48, C. lanienae (n=34 and C. sputorum (n=24 isolates were typed, along with 86 human clinical C. concisus and C. curvus isolates. A large number of sequence types (STs were identified using all four MLST methods. Similar to Campylobacter MLST methods described previously, these novel MLST methods identified mixed isolates containing two or more strains of the same species. Additionally, these methods speciated unequivocally isolates that had been typed ambiguously using other molecular-based speciation methods, such as 16S rDNA sequencing. Finally, the design of degenerate primer pairs for some methods permitted the typing of related species; for example, the C. hyointestinalis primer pairs could be used to type C. fetus strains. Therefore, these novel Campylobacter MLST methods will prove useful in speciating and differentiating strains of multiple, emerging Campylobacter species.

Holographic geometry of cMERA for quantum quenches and finite temperature

International Nuclear Information System (INIS)

Mollabashi, Ali; Naozaki, Masahiro; Ryu, Shinsei; Takayanagi, Tadashi

2014-01-01

We study the time evolution of cMERA (continuous MERA) under quantum quenches in free field theories. We calculate the corresponding holographic metric using the proposal in http://arxiv.org/abs/1208.3469 and confirm that it qualitatively agrees with its gravity dual given by a half of the AdS black hole spacetime, argued by Hartman and Maldacena in http://arxiv.org/abs/1303.1080. By doubling the cMERA for the quantum quench, we give an explicit construction of finite temperature cMERA. We also study cMERA in the presence of chemical potential and show that there is an enhancement of metric in the infrared region corresponding to the Fermi energy

Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets

International Nuclear Information System (INIS)

Swamy, K.S.K.

1987-01-01

The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)

Substrate-Mediated C-C and C-H Coupling after Dehalogenation.

Science.gov (United States)

Kong, Huihui; Yang, Sha; Gao, Hongying; Timmer, Alexander; Hill, Jonathan P; Díaz Arado, Oscar; Mönig, Harry; Huang, Xinyan; Tang, Qin; Ji, Qingmin; Liu, Wei; Fuchs, Harald

2017-03-15

Intermolecular C-C coupling after cleavage of C-X (mostly, X = Br or I) bonds has been extensively studied for facilitating the synthesis of polymeric nanostructures. However, the accidental appearance of C-H coupling at the terminal carbon atoms would limit the successive extension of covalent polymers. To our knowledge, the selective C-H coupling after dehalogenation has not so far been reported, which may illuminate another interesting field of chemical synthesis on surfaces besides in situ fabrication of polymers, i.e., synthesis of novel organic molecules. By combining STM imaging, XPS analysis, and DFT calculations, we have achieved predominant C-C coupling on Au(111) and more interestingly selective C-H coupling on Ag(111), which in turn leads to selective synthesis of polymeric chains or new organic molecules.

Black-hole production from ultrarelativistic collisions

International Nuclear Information System (INIS)

Rezzolla, Luciano; Takami, Kentaro

2013-01-01

Determining the conditions under which a black hole can be produced is a long-standing and fundamental problem in general relativity. We use numerical simulations of colliding self-gravitating fluid objects to study the conditions of black-hole formation when the objects are boosted to ultrarelativistic speeds. Expanding on the previous work, we show that the collision is characterized by a type-I critical behaviour, with a black hole being produced for masses above a critical value, M c , and a partially bound object for masses below the critical one. More importantly, we show for the first time that the critical mass varies with the initial effective Lorentz factor 〈γ〉 following a simple scaling of the type M c ∼ K〈γ〉 −1.0 , thus indicating that a black hole of infinitesimal mass is produced in the limit of a diverging Lorentz factor. Furthermore, because a scaling is present also in terms of the initial stellar compactness, we provide a condition for black-hole formation in the spirit of the hoop conjecture. (fast track communication)

Distinct Signaling Roles of cIMP, cCMP, and cUMP.

Science.gov (United States)

Seifert, Roland

2016-10-04

The cyclic purine nucleotide cIMP and the cyclic pyrimidine nucleotides cCMP and cUMP are emerging second messengers. These cNMPs show different biological effects, but the molecular mechanisms remain elusive. In this issue of Structure, Ng et al. (2016) provide structural evidence for distinct interactions of cIMP, cCMP, and cUMP with ion channels. Copyright © 2016 Elsevier Ltd. All rights reserved.

Resonance spectrum of near-extremal Kerr black holes in the eikonal limit

International Nuclear Information System (INIS)

Hod, Shahar

2012-01-01

The fundamental resonances of rapidly rotating Kerr black holes in the eikonal limit are derived analytically. We show that there exists a critical value, μ c =√((15-√(193))/2 ), for the dimensionless ratio μ≡m/l between the azimuthal harmonic index m and the spheroidal harmonic index l of the perturbation mode, above which the perturbations become long lived. In particular, it is proved that above μ c the imaginary parts of the quasinormal frequencies scale like the black-hole temperature: ω I (n;μ>μ c )=2πT BH (n+1/2 ). This implies that for perturbations modes in the interval μ c I of the black hole becomes extremely long as the extremal limit T BH →0 is approached. A generalization of the results to the case of scalar quasinormal resonances of near-extremal Kerr-Newman black holes is also provided. In particular, we prove that only black holes that rotate fast enough (with MΩ≥2/5 , where M and Ω are the black-hole mass and angular velocity, respectively) possess this family of remarkably long-lived perturbation modes.

SiC Optically Modulated Field-Effect Transistor

Science.gov (United States)

Tabib-Azar, Massood

2009-01-01

An optically modulated field-effect transistor (OFET) based on a silicon carbide junction field-effect transistor (JFET) is under study as, potentially, a prototype of devices that could be useful for detecting ultraviolet light. The SiC OFET is an experimental device that is one of several devices, including commercial and experimental photodiodes, that were initially evaluated as detectors of ultraviolet light from combustion and that could be incorporated into SiC integrated circuits to be designed to function as combustion sensors. The ultraviolet-detection sensitivity of the photodiodes was found to be less than desired, such that it would be necessary to process their outputs using high-gain amplification circuitry. On the other hand, in principle, the function of the OFET could be characterized as a combination of detection and amplification. In effect, its sensitivity could be considerably greater than that of a photodiode, such that the need for amplification external to the photodetector could be reduced or eliminated. The experimental SiC OFET was made by processes similar to JFET-fabrication processes developed at Glenn Research Center. The gate of the OFET is very long, wide, and thin, relative to the gates of typical prior SiC JFETs. Unlike in prior SiC FETs, the gate is almost completely transparent to near-ultraviolet and visible light. More specifically: The OFET includes a p+ gate layer less than 1/4 m thick, through which photons can be transported efficiently to the p+/p body interface. The gate is relatively long and wide (about 0.5 by 0.5 mm), such that holes generated at the body interface form a depletion layer that modulates the conductivity of the channel between the drain and the source. The exact physical mechanism of modulation of conductivity is a subject of continuing research. It is known that injection of minority charge carriers (in this case, holes) at the interface exerts a strong effect on the channel, resulting in amplification

Production of Λc+ hypernuclei in antiproton–nucleus collisions

Directory of Open Access Journals (Sweden)

R. Shyam

2017-07-01

Full Text Available We investigate the production of charm-baryon hypernucleus OΛc+16 in the antiproton–O16 collisions within a fully covariant model that is based on an effective Lagrangian approach. The explicit Λ¯c−Λc+ production vertex is described by the t-channel D0 and D⁎0 meson-exchanges in the initial collision of the incident antiproton with one of the protons of the target nucleus. The Λc+ bound state spinors as well as the self-energies of the exchanged mesons employed in our calculations are derived from the quark–meson coupling model. The parameters of various vertices are taken to be the same as those used in our previous study of the elementary p¯+p→Λ¯c−+Λc+ reaction. We find that for antiproton beam momenta of interest to the P¯ANDA experiment, the 0∘ differential cross sections for the formation of OΛc+16 hypernuclear states with simple particle–hole configurations, have magnitudes in the range of a few μb/sr.

Synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F.

Science.gov (United States)

Roy, Sudeshna; Spilling, Christopher D

2010-11-19

A convergent synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization, and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with l-selectride to give the fragments of amphidinolide C and F.

Mapping the Superconducting Anti-ferromagnetic C4 Phase in Iron-Pnictides

Science.gov (United States)

Stadel, Ryan; Taddei, Keith; Bugaris, Dan; Lapidus, Saul; Claus, Helmut; Phelan, Daniel; Chung, Duck Young; Kanatzidis, Mercouri; Osborn, Raymond; Rosenkranz, Stephan; Chmaissem, Omar

Following the discovery of the microscopic coexistence of antifermagnetic spin density waves and superconductivity in Ba1-xKxFe2As2 and the low temperature re-entrance to the novel magnetic C4 tetragonal phase in Ba1-xNaxFe2As2, there has been significant interest in developing an understanding of the properties and formation of these phases and analyzing their dependence on temperature and composition in hole-doped 122 alkaline earth metal/iron-pnictides. We describe the mapping of various Ba, Sr, and Ca 122 phase diagrams with systematically controlled levels of hole-doping of alkaline metal onto the alkaline earth metal site, which was investigated via x-ray and neutron diffraction. Our elaborate synthesis, diffraction work, and analysis maps and firmly establishes the C4 phase space in these ternary diagrams as well as the boundary lines that separate the individual phases, and provides natural clues as well as a framework to investigate the stability and formation of the C4 domes that shift location with doping contents in the phase diagrams. Work at Argonne was supported by US DOE, Office of Science, Materials Sciences and Engineering Division.

Why Y-c.c

Czech Academy of Sciences Publication Activity Database

Chodounský, David; Zapletal, Jindřich

2015-01-01

Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664

Electronic transitions and band offsets in C60:SubPc and C60:MgPc on MoO3 studied by modulated surface photovoltage spectroscopy

International Nuclear Information System (INIS)

Fengler, S.; Dittrich, Th.; Rusu, M.

2015-01-01

Electronic transitions at interfaces between MoO 3 layers and organic layers of C 60 , SubPc, MgPc, and nano-composite layers of SubPc:C 60 and MgPc:C 60 have been studied by modulated surface photovoltage (SPV) spectroscopy. For all systems, time dependent and modulated SPV signals pointed to dissociation of excitons at the MoO 3 /organic layer interfaces with a separation of holes towards MoO 3 . The highest occupied molecular orbital (HOMO)-lowest unoccupied molecular orbital (LUMO) gaps (E HL ) of C 60 , SubPc, and MgPc and the effective E HL of SubPc:C 60 and MgPc:C 60 were measured. The offsets between the LUMO (ΔE L ) or HOMO (ΔE H ) bands were obtained with high precision and amounted to 0.33 or 0.73 eV for SubPc:C 60 , respectively, and to −0.33 or 0.67 eV for MgPc:C 60 , respectively. Exponential tails below E HL and most pronounced sub-bandgap transitions were characterized and ascribed to disorder and transitions from HOMO bands to unoccupied defect states

Alkane Activation at Ambient Temperatures: Unusual Selectivities, C-C, C-H Bond Scission versus C-C Bond Coupling

NARCIS (Netherlands)

Trionfetti, C.; Agiral, A.; Gardeniers, Johannes G.E.; Lefferts, Leonardus; Seshan, Kulathuiyer

2008-01-01

Activating bonds: A cold plasma generated by dielectric barrier discharge in a microreactor converts alkanes (C1–C3) at atmospheric pressure. Large amounts of products with higher molecular weight than the starting hydrocarbons are observed showing that C-H activation at lower T favourably leads to

Spectral features of radiation from Nordstroem and Kerr-Newman white holes. [Kinetics

Energy Technology Data Exchange (ETDEWEB)

Dadhich, N [Poona Univ. (India). Dept. of Mathematics and Statistics

1977-01-01

Unlike the Schwarzschild white hole, Nordstroem and Kerr-Newman white holes cannot explode right down from the space time singularity R = 0. For example a charged white hole has to commence explosion (i.e., comes into existence) with a radius Rsub(o)=Rsub(c)(2-Rsub(c)/Rsub(b))sup(-1) where Rsub(c) is the 'classical radius' and Rsub(b) is the final radius attained when the stationary state is reached. That means charged and rotating black holes also cannot hit the singularity R = 0 and perish. Here the explosion is decelerated by the presence of charge and rotation and hence the radiation emitted would be not as energetic as in the Schwarzschild case where its energy is infinitely large for emission from R = 0.

In-silico assessment of protein-protein electron transfer. a case study: cytochrome c peroxidase--cytochrome c.

Directory of Open Access Journals (Sweden)

Frank H Wallrapp

Full Text Available The fast development of software and hardware is notably helping in closing the gap between macroscopic and microscopic data. Using a novel theoretical strategy combining molecular dynamics simulations, conformational clustering, ab-initio quantum mechanics and electronic coupling calculations, we show how computational methodologies are mature enough to provide accurate atomistic details into the mechanism of electron transfer (ET processes in complex protein systems, known to be a significant challenge. We performed a quantitative study of the ET between Cytochrome c Peroxidase and its redox partner Cytochrome c. Our results confirm the ET mechanism as hole transfer (HT through residues Ala194, Ala193, Gly192 and Trp191 of CcP. Furthermore, our findings indicate the fine evolution of the enzyme to approach an elevated turnover rate of 5.47 × 10(6 s(-1 for the ET between Cytc and CcP through establishment of a localized bridge state in Trp191.

C59N+ and C69N+: isoelectronic heteroanalogues of C60 and C70

International Nuclear Information System (INIS)

Lamparth, I.; Nuber, B.; Schick, G.; Skiebe, A.; Groesser, T.; Hirsch, A.

1995-01-01

Fragmentation reactions in the mass spectrometer were used to generate the first characterized nitrogen heterofullerene ions C 59 N + and C 69 N + from regioselectively synthesized oligoiminofullerenes. During this process one carbon atom in the fullerene core is removed and replaced with a nitrogen atom. C 59 N + has almost the same structure as the isoelectronic C 60 . (orig.)

Drain current enhancement induced by hole injection from gate of 600-V-class normally off gate injection transistor under high temperature conditions up to 200 °C

Science.gov (United States)

Ishii, Hajime; Ueno, Hiroaki; Ueda, Tetsuzo; Endoh, Tetsuo

2018-06-01

In this paper, the current–voltage (I–V) characteristics of a 600-V-class normally off GaN gate injection transistor (GIT) from 25 to 200 °C are analyzed, and it is revealed that the drain current of the GIT increases during high-temperature operation. It is found that the maximum drain current (I dmax) of the GIT is 86% higher than that of a conventional 600-V-class normally off GaN metal insulator semiconductor hetero-FET (MIS-HFET) at 150 °C, whereas the GIT obtains 56% I dmax even at 200 °C. Moreover, the mechanism of the drain current increase of the GIT is clarified by examining the relationship between the temperature dependence of the I–V characteristics of the GIT and the gate hole injection effect determined from the shift of the second transconductance (g m) peak of the g m–V g characteristic. From the above, the GIT is a promising device with enough drivability for future power switching applications even under high-temperature conditions.

Joining of SiC ceramics and SiC/SiC composites

Energy Technology Data Exchange (ETDEWEB)

Rabin, B.H. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

1996-08-01

This project has successfully developed a practical and reliable method for fabricating SiC ceramic-ceramic joints. This joining method will permit the use of SiC-based ceramics in a variety of elevated temperature fossil energy applications. The technique is based on a reaction bonding approach that provides joint interlayers compatible with SiC, and excellent joint mechanical properties at temperatures exceeding 1000{degrees}C. Recent emphasis has been given to technology transfer activities, and several collaborative research efforts are in progress. Investigations are focusing on applying the joining method to sintered {alpha}-SiC and fiber-reinforced SiC/SiC composites for use in applications such as heat exchangers, radiant burners and gas turbine components.

Structures, stabilities, aromaticity, and electronic properties of C66 fullerene isomers, anions (C662-, C664-, C666-), and metallofullerenes (Sc2-C66)

International Nuclear Information System (INIS)

Cui Yanhong; Tian, Wei Quan; Feng Jikang; Chen Deli

2010-01-01

Among all the 4478 classical isomers of C 66 , C 66 (C s :0060) with the lowest number of pentagon-pentagon fusions was predicted to be the most stable isomer, followed by isomers C 66 (C 2v :0011) and C 66 (C 2 :0083). The infrared spectra and aromaticity of the most stable isomers were predicted. The relative stabilities of C 66 isomers change with charges or doping of metals. The structures and relative stabilities of the most stable metallofullerenes were delineated and compared with experiment. Sc 2 -C 66 (C 2 :0083) was predicted to be the most stable metallofullerene, although Sc 2 -C 66 (C 2v :0011) was observed. Charge-transfer from Sc 2 to the fused pentagons and the bonding between these two moieties significantly decrease the strain energies caused by the pair of fused pentagons thereby stabilizing the fullerene cage.

Oxidation protection of multilayer CVD SiC/B/SiC coatings for 3D C/SiC composite

International Nuclear Information System (INIS)

Liu Yongsheng; Cheng Laifei; Zhang Litong; Wu Shoujun; Li Duo; Xu Yongdong

2007-01-01

A CVD boron coating was introduced between two CVD SiC coating layers. EDS and XRD results showed that the CVD B coating was a boron crystal without other impurity elements. SEM results indicated that the CVD B coating was a flake-like or column-like crystal with a compact cross-section. The crack width in the CVD SiC coating deposited on CVD B is smaller than that in a CVD SiC coating deposited on CVD SiC coating. After oxidation at 700 deg. C and 1000 deg. C, XRD results indicated that the coating was covered by product B 2 O 3 or B 2 O 3 .xSiO 2 film. The cracks were sealed as observed by SEM. There was a large amount of flake-like material on hybrid coating surface after oxidation at 1300 deg. C. Oxidation weight loss and residual flexural strength results showed that hybrid SiC/B/SiC multilayer coating provided better oxidation protection for C/SiC composite than a three layer CVD SiC coating at temperatures from 700 deg. C to 1000 deg. C for 600 min, but worse oxidation protection above 1000 deg. C due to the large amount of volatilization of B 2 O 3 or B 2 O 3 .xSiO 2

Black and white holes

International Nuclear Information System (INIS)

Zeldovich, Ya.; Novikov, I.; Starobinskij, A.

1978-01-01

The theory is explained of the origination of white holes as a dual phenomenon with regard to the formation of black holes. Theoretically it is possible to derive the white hole by changing the sign of time in solving the general theory of relativity equation implying the black hole. The white hole represents the amount of particles formed in the vicinity of a singularity. For a distant observer, matter composed of these particles expands and the outer boundaries of this matter approach from the inside the gravitational radius Rsub(r). At t>>Rsub(r)/c all radiation or expulsion of matter terminates. For the outside observer the white hole exists for an unlimited length of time. In fact, however, it acquires the properties of a black hole and all processes in it cease. The qualitative difference between a white hole and a black hole is in that a white hole is formed as the result of an inner quantum explosion from the singularity to the gravitational radius and not as the result of a gravitational collapse, i.e., the shrinkage of diluted matter towards the gravitational radius. (J.B.)

Black and white holes

Energy Technology Data Exchange (ETDEWEB)

Zeldovich, Ya; Novikov, I; Starobinskii, A

1978-07-01

The theory is explained of the origination of white holes as a dual phenomenon with regard to the formation of black holes. Theoretically it is possible to derive the white hole by changing the sign of time in solving the general theory of relativity equation implying the black hole. The white hole represents the amount of particles formed in the vicinity of a singularity. For a distant observer, matter composed of these particles expands and the outer boundaries of this matter approach from the inside the gravitational radius R/sub r/. At t>>R/sub r//c all radiation or expulsion of matter terminates. For the outside observer the white hole exists for an unlimited length of time. In fact, however, it acquires the properties of a black hole and all processes in it cease. The qualitative difference between a white hole and a black hole is in that a white hole is formed as the result of an inner quantum explosion from the singularity to the gravitational radius and not as the result of a gravitational collapse, i.e., the shrinkage of diluted matter towards the gravitational radius.

Intermolecular interactions between σ- and π-holes of bromopentafluorobenzene and pyridine: computational and experimental investigations.

Science.gov (United States)

Yang, Fang-Ling; Yang, Xing; Wu, Rui-Zhi; Yan, Chao-Xian; Yang, Fan; Ye, Weichun; Zhang, Liang-Wei; Zhou, Pan-Pan

2018-04-25

The characters of σ- and π-holes of bromopentafluorobenzene (C6F5Br) enable it to interact with an electron-rich atom or group like pyridine which possesses an electron lone-pair N atom and a π ring. Theoretical studies of intermolecular interactions between C6F5Br and C5H5N have been carried out at the M06-2X/aug-cc-pVDZ level without and with the counterpoise method, together with single point calculations at M06-2X/TZVP, wB97-XD/aug-cc-pVDZ and CCSD(T)/aug-cc-pVDZ levels. The σ- and π-holes of C6F5Br exhibiting positive electrostatic potentials make these sites favorably interact with the N atom and the π ring of C5H5N with negative electrostatic potentials, leading to five different dimers connected by a σ-holen bond, a σ-holeπ bond or a π-holeπ bond. Their geometrical structures, characteristics, nature and spectroscopy behaviors were systematically investigated. EDA analyses reveal that the driving forces in these dimers are different. NCI, QTAIM and NBO analyses confirm the existence of intermolecular interactions formed via σ- and π-holes of C6F5Br and the N atom and the π ring of C5H5N. The experimental IR and Raman spectra gave us important information about the formation of molecular complexes between C6F5Br and C5H5N. We expect that the results could provide valuable insights into the investigation of intermolecular interactions involving σ- and π-holes.

Generation of a C3c specific monoclonal antibody and assessment of C3c as a putative inflammatory marker derived from complement factor C3

DEFF Research Database (Denmark)

Palarasah, Yaseelan; Skjodt, Karsten; Brandt, Jette

2010-01-01

complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m....... The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust ELISA...... that allows for a quick and reliable evaluation of complement activation and consumption as a marker for inflammatory processes. We established the C3c plasma range in 100 healthy Danish blood donors with a mean of 3.47 μg/ml and a range of 2.12-4.92 μg/ml. We believe that such an antibody might...

Volatility study of [C1C1im][NTf2] and [C2C3im][NTf2] ionic liquids

International Nuclear Information System (INIS)

Rocha, Marisa A.A.; Ribeiro, Filipe M.S.; Schröder, Bernd; Coutinho, João A.P.; Santos, Luís M.N.B.F.

2014-01-01

Highlights: • Vapor pressures of [C 1 C 1 im][NTf 2 ] and [C 2 C 3 im][NTf 2 ] ionic liquids are reported. • [C 1 C 1 im][NTf 2 ] presents higher enthalpy and entropy of vaporization than expected. • The high volatility of [C 2 C 3 im][NTf 2 ] is a result from its asymmetric character. -- Abstract: Vapor pressures of 1,3-dimethylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 1 C 1 im][NTf 2 ]) and 1-ethyl-3-propylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 2 C 3 im][NTf 2 ]) ionic liquids were measured as a function of temperature using a Knudsen effusion apparatus combined with a quartz crystal microbalance. Enthalpies and entropies of vaporization were derived from the fitting of vapor pressure and temperature results to the Clarke and Glew equation. [C 1 C 1 im][NTf 2 ] presents a higher enthalpy and entropy of vaporization than the neighboring members of the series. The enthalpy of vaporization of [C 2 C 3 im][NTf 2 ] lies in between the asymmetric and symmetric ionic liquid series, reflecting a decrease in the electrostatic interactions due to a decrease of the charge accessibility between the ionic pairs when the methyl group is replaced by an ethyl group. The obtained higher volatility of [C 2 C 3 im][NTf 2 ] arises from its asymmetric character, leading to an higher entropic contribution that compensates the enthalpic penalty. The border conditions ([C 1 C 1 im][NTf 2 ], [C 2 C 1 im][NTf 2 ] and [C 2 C 2 im][NTf 2 ]), topology ([C 2 C 3 im][NTf 2 ]) and symmetry/asymmetry of the ILs effect were evaluated and rationalized based on a comparative analysis of the thermodynamic properties, enthalpies and entropies of vaporization

Quasinormal modes of a massless charged scalar field on a small Reissner-Nordstroem-anti-de Sitter black hole

International Nuclear Information System (INIS)

Uchikata, Nami; Yoshida, Shijun

2011-01-01

We investigate quasinormal modes of a massless charged scalar field on a small Reissner-Nordstroem-anti-de Sitter (RN-AdS) black hole both with analytical and numerical approaches. In the analytical approach, by using the small black hole approximation (r + + /L→0, where r + and L stand for the black hole event horizon radius and the AdS scale, respectively. We then show that the small RN-AdS black hole is unstable if its quasinormal modes satisfy the superradiance condition and that the instability condition of the RN-AdS black hole in the limit of r + /L→0 is given by Q>(3/eL)Q c , where Q, Q c , and e are the charge of the black hole, the critical (maximum) charge of the black hole, and the charge of the scalar field, respectively. In the numerical approach, we calculate the quasinormal modes for the small RN-AdS black holes with r + + =0.2L, 0.1L, and 0.01L become unstable against scalar perturbations with eL=4 when the charge of the black hole satisfies Q > or approx. 0.8Q c , 0.78Q c , and 0.76Q c , respectively.

Epitaxial growth of 3C-SiC by using C{sub 60} as a carbon source; Untersuchungen zum epitaktischen Wachstum von 3C-SiC bei Verwendung einer C{sub 60}-Kohlenstoffquelle

Energy Technology Data Exchange (ETDEWEB)

Schreiber, Sascha

2006-01-15

Within this work epitaxial 3C-SiC-films were grown on Si(001) substrates and on ion beam synthesized 3C-SiC(001) pseudo substrates. A rather new process was used which is based on the simultaneous deposition of C60 and Si. In order to set up the necessary experimental conditions an ultra-high vacuum chamber has been designed and built. A RHEED system was used to examine SiC film growth in-situ. Using the described technique 3C-SiC films were grown void-free on Si(001) substrates. Deposition rates of C60 and Si were chosen adequately to maintain a Si:C ratio of approximately one during the deposition process. It was shown that stoichiometric and epitaxial 3C-SiC growth with the characteristic relationship (001)[110]Si(001)[110]3C-SiC could be achieved. TEM investigations revealed that the grown 3C-SiC films consist of individual grains that extend from the Si substrate to the film surface. Two characteristic grain types could be identified. The correlation between structure and texture of void-free grown 3C-SiC films and film thickness was studied by X-ray diffraction (XRD). Pole figure measurements showed that thin films only contain first-order 3C-SiC twins. With higher film thickness also second-order twins are found which are located as twin lamellae in grain type 2. Improvement of polar texture with increasing film thickness couldn't be observed in the investigated range of up to 550 nm. On ion beam synthesized 3C-SiC pseudo substrates homoepitaxial 3C-SiC growth could be demonstrated for the first time by using a C{sub 60} carbon source. In respect to the crystalline quality of the grown films the surface quality of the used substrates was identified as a crucial factor. Furthermore a correlation between the ratio of deposition rates of C{sub 60} and Si and 3C-SiC film quality could be found. Under silicon-rich conditions, i.e. with a Si:C ratio of slightly greater one, homoepitaxial 3C-SiC layer-by-layer growth can be achieved. Films grown under these

The methylenetetrahydrofolate reductase c.c.677 C>T and c.c.1298 A>C polymorphisms in reproductive failures: Experience from an RSA and RIF study on a Polish population.

Science.gov (United States)

Nowak, Izabela; Bylińska, Aleksandra; Wilczyńska, Karolina; Wiśniewski, Andrzej; Malinowski, Andrzej; Wilczyński, Jacek R; Radwan, Paweł; Radwan, Michał; Barcz, Ewa; Płoski, Rafał; Motak-Pochrzęst, Hanna; Banasik, Małgorzata; Sobczyński, Maciej; Kuśnierczyk, Piotr

2017-01-01

Almost 1600 individuals from the Polish population were recruited to this study. Among them 319 were fertile couples, 289 were recurrent spontaneous abortion (RSA) couples, and 131 were in the group of recurrent implantation failure (RIF) following in vitro fertilization. The aim of this study was to evaluate the MTHFR c.c.677 C>T and c.c.1298 A>C polymorphisms' association with RSA and RIF. We used PCR-RFLP with HinfI (677 C>T) and MboII (1298 A>C) digestion. We observed a protective effect of the female AC genotype (OR = 0.64, p = 0.01) and the C allele (AC+CC genotypes; OR = 0.65, p = 0.009) against RSA. Moreover, 1298 AA/677 CT women were more frequent in RSA (31.14%) and RIF (25.20%) groups in comparison to fertile women (22.88%), although this difference was significant only in the case of RSA (p = 0.022, OR = 1.52). Male combined genotype analysis revealed no association with reproductive failure of their partners. Nevertheless, the female/male combination AA/AC of the 1298 polymorphism was more frequent in RSA couples (p = 0.049, OR = 1.49). However, the significant results became insignificant after Bonferroni correction. In addition, analysis of haplotypes showed significantly higher frequency of the C/C haplotype (1298 C/677 C) in the female control group than in the female RSA group (p = 0.03, OR = 0.77). Moreover, the association between elevated homocysteine (Hcy) level in plasma of RSA and RIF women and MTHFR polymorphisms was investigated but did not reveal significant differences. In conclusion, for clinical practice, it is better to check the homocysteine level in plasma and, if the Hcy level is increased, to recommend patients to take folic acid supplements rather than undergo screening of MTHFR for 1298 A>C and 677 C>T polymorphisms.

Electroluminescence of erbium in Al/α-Si:H(Er)/p-c-Si/Al structure

International Nuclear Information System (INIS)

Kon'kov, I.O.; Kuznetsov, A.N.; Pak, P.E.; Terukov, E.I.; Granitsyna, L.S.

2001-01-01

It is informed for the first time on the observation of the erbium intensive electroluminescence from the amorphous hydrated silicon layer by application of the Al/α-Si:H(Er)/p-c-Si/Al structure in the direct shift mode. The above structure is the n-p-heterostructure with the barrier values of 0.3-0.4 eV for the electrons and 0.9-1.1 eV for the holes. The electroluminescence efficiency is evaluated at the level ∼ 2 x 10 -5 . The electroluminescence effect in the Al/α-Si:H(Er)/p-c-Si/Al structure is connected with the hole tunneling from the crystal silicon by the amorphous silicon localized states with the subsequent release into the valent zone [ru

Synthesis of the C(18)–C(34) Fragment of Amphidinolide C and the C(18)–C(29) Fragment of Amphidinolide F

Science.gov (United States)

Roy, Sudeshna; Spilling, Christopher D.

2010-01-01

A convergent synthesis of the C(18)–C(34) fragment of amphidinolide C and the C(18)–C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with L-selectride to give the fragments of amphidinolide C and F. PMID:21028791

C-14 release and transport from a nuclear waste repository in an unsaturated medium

International Nuclear Information System (INIS)

Light, W.B.; Zwahlen, E.D.; Pigford, T.H.; Chambre, P.L.; Lee, W.W.L.

1990-06-01

The release of 14 C as 14 CO 2 from partly failed spent fuel containers has been analyzed by the flow of gases into and out of the containers. This flow of gases is driven by pressure differences, which are in turn caused by heating by the spent fuel. In this analysis, the timing and size of holes in the containers are assumed to be given. A better means of predicting the time distribution and sizes of penetrations in nuclear waste containers is needed. For the purposes of far-field transport calculations, we have adopted release rates that are shown to be bonding for the large range of hole sizes studied. The transport of released 14 CO 2 has been analyzed by transport in equivalent porous medium. The peak 14 CO 2 concentration in pore gas at 350 m above the repository does not depend on the time of hole occurrence, although the time of penetration obviously affects the arrival and duration of exposure to 14 C. Nor does water saturation have much effect on peak concentration. In this analysis we have used a constant gas Darcy velocity. We performed limited sensitivity analysis on gas Darcy velocity by using values one order of magnitude above and below the published value. This probably gives us bounds on the likely gas Darcy velocity. Our calculations show that essentially all the released 14 C will reach the ground surface in less than one half-life of 14 C. However, the quantities of 14 C reaching the ground surface are so small that even if all containers fail at emplacement and conservative dose factors are used, the resultant inhalation dose to the maximally exposed individual is about 0.1% of natural background radiation. 14 refs., 18 figs., 3 tabs

Hemoglobin C, S-C, and E Diseases

Science.gov (United States)

... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...

Characterization of Vadose Zone Sediments from C Waste Management Area: Investigation of the C-152 Transfer Line Leak

Energy Technology Data Exchange (ETDEWEB)

Brown, Christopher F; Serne, R JEFFREY; Bjornstad, Bruce N; Valenta, Michelle M; Lanigan, David C; Vickerman, Tanya S; Clayton, Ray E; Geiszler, Keith N; Iovin, Cristian; Clayton, Eric T; Kutynakov, I V; Baum, Steven R; Lindberg, Michael J; Orr, Robert D

2007-02-05

A geologic/geochemical investigation in the vicinity of UPR-200-E-82 was performed using pairs of cone-penetrometer probe holes. A total of 41 direct-push cone-penetrometer borings (19 pairs to investigate different high moisture zones in the same sampling location and 3 individual) were advanced to characterize vadose zone moisture and the distribution of contaminants. A total of twenty sample sets, containing up to two split-spoon liners and one grab sample, were delivered to the laboratory for characterization and analysis. The samples were collected around the documented location of the C-152 pipeline leak, and created an approximately 120-ft diameter circle around the waste site. UPR-200-E-82 was a loss of approximately 2,600 gallons of Cs-137 Recovery Process feed solution containing an estimated 11,300 Ci of cesium-137 and 5 Ci of technetium-99. Several key parameters that are used to identify subsurface contamination were measured, including: water extract pH, electrical conductivity, nitrate, technetium-99, sodium, and uranium concentrations and technetium-99 and uranium concentrations in acid extracts. All of the parameters, with the exception of electrical conductivity, were elevated in at least some of the samples analyzed as part of this study. Specifically, soil pH was elevated (from 8.69 to 9.99) in five samples collected northeast and southwest of the C-152 pipeline leak. Similarly, samples collected from these same cone-pentrometer holes contained significantly more water-extractable sodium (more than 50 g/g of dry sediment), uranium (as much as 7.66E-01 g/g of dry sediment), nitrate (up to 30 g/g of dry sediment), and technetium-99 (up to 3.34 pCi/g of dry sediment). Most of the samples containing elevated concentrations of water-extractable sodium also had decreased levels of water extractable calcium and or magnesium, indicating that tank-related fluids that were high in sodium did seep into the vadose zone near these probe holes. Several of the

Some Simple Black Hole Thermodynamics

Science.gov (United States)

Lopresto, Michael C.

2003-05-01

In his recent popular book The Universe in a Nutshell, Steven Hawking gives expressions for the entropy1 and temperature (often referred to as the ``Hawking temperature''2 ) of a black hole:3 S = kc34ℏG A T = ℏc38πkGM, where A is the area of the event horizon, M is the mass, k is Boltzmann's constant, ℏ = h2π (h being Planck's constant), c is the speed of light, and G is the universal gravitational constant. These expressions can be used as starting points for some interesting approximations on the thermodynamics of a Schwarzschild black hole, of mass M, which by definition is nonrotating and spherical with an event horizon of radius R = 2GMc2.4,5

C r C =

Indian Academy of Sciences (India)

Administrator

C r. C. = CTPPY: concentration of TPPY; CAuNPs: concentration of Au NPs. The concentration of the Au NPs is calculated as follows: (1) The weight of Au (WAu) produced from the complete reduction of HAuCl4 is calculated by multiplying the mole of added HAuCl4 (weight of added. HAuCl4·4H2O divided by molecular ...

Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands

International Nuclear Information System (INIS)

Amiot, C.

1983-01-01

The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41

Advanced C and C++ compiling

CERN Document Server

Stevanovic, Milan

2014-01-01

Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res

The spectrum of 12C in a multi-configuration Hartree-Fock Basis

International Nuclear Information System (INIS)

Amos, K.; Morrison, I.; Smith, R.; Schmid, K.W.

1981-01-01

The energy level spectrum of 12 C is calculated in a truncated but large shell model space of projected one particle-one hole Hartree Fock determinants using a realistic G-matrix. Predictions of electromagnetic decays and electron scattering form factors are compared with experimental values

Oxidation behavior of TiC, ZrC, and HfC dispersed in oxide matrices

International Nuclear Information System (INIS)

Arun, R.; Subramanian, M.; Mehrotra, G.M.

1990-01-01

The oxidation behavior of hot pressed TiC-Al 2 O 3 , TiC-ZrO 2 , ZrC-ZrO 2 , and HfC-HfO 2 composites has been investigated at 1273 K. The oxidation of TiC, ZrC, and HfC in hot-pressed composites containing ZrO 2 and HfO 2 has been found to be extremely rapid. The kinetics of oxidation of TiC and a 90 wt% TiC-Al 2 O 3 composite appear to be faster compared to that of pure TiC. X-ray diffraction results for hot-pressed ZrC-HfO 2 and HfC-HfO 2 composites indicate partial stabilization of tetragonal ZrO 2 and HfO 2 phases in these composites

De novo Transcriptome Assembly and Comparison of C3, C3-C4, and C4 Species of Tribe Salsoleae (Chenopodiaceae

Directory of Open Access Journals (Sweden)

Maximilian Lauterbach

2017-11-01

Full Text Available C4 photosynthesis is a carbon-concentrating mechanism that evolved independently more than 60 times in a wide range of angiosperm lineages. Among other alterations, the evolution of C4 from ancestral C3 photosynthesis requires changes in the expression of a vast number of genes. Differential gene expression analyses between closely related C3 and C4 species have significantly increased our understanding of C4 functioning and evolution. In Chenopodiaceae, a family that is rich in C4 origins and photosynthetic types, the anatomy, physiology and phylogeny of C4, C2, and C3 species of Salsoleae has been studied in great detail, which facilitated the choice of six samples of five representative species with different photosynthetic types for transcriptome comparisons. mRNA from assimilating organs of each species was sequenced in triplicates, and sequence reads were de novo assembled. These novel genetic resources were then analyzed to provide a better understanding of differential gene expression between C3, C2 and C4 species. All three analyzed C4 species belong to the NADP-ME type as most genes encoding core enzymes of this C4 cycle are highly expressed. The abundance of photorespiratory transcripts is decreased compared to the C3 and C2 species. Like in other C4 lineages of Caryophyllales, our results suggest that PEPC1 is the C4-specific isoform in Salsoleae. Two recently identified transporters from the PHT4 protein family may not only be related to the C4 syndrome, but also active in C2 photosynthesis in Salsoleae. In the two populations of the C2 species S. divaricata transcript abundance of several C4 genes are slightly increased, however, a C4 cycle is not detectable in the carbon isotope values. Most of the core enzymes of photorespiration are highly increased in the C2 species compared to both C3 and C4 species, confirming a successful establishment of the C2 photosynthetic pathway. Furthermore, a function of PEP-CK in C2 photosynthesis

Microstructure and mechanical properties of Cu/SiC metal matrix composite fabricated via friction stir processing

International Nuclear Information System (INIS)

Akramifard, H.R.; Shamanian, M.; Sabbaghian, M.; Esmailzadeh, M.

2014-01-01

Highlights: • Designing a net hole was effective to achieve uniform distribution SiC particles and prevent agglomeration of them. • SZ has fine and equiaxed grains and distribution of SiC particles in the matrix is almost uniform. • No intermetallic compound was formed after FSP. • In comparison to pure Cu, Cu/SiC composite shows higher hardness and better wear behavior. - Abstract: In the present investigation, pure Cu sheets were reinforced with 25 μm SiC particles to fabricate a composite surface layer by friction stir processing (FSP). In order to improve distribution of reinforcing SiC particles, a net of holes were designed by drill on the surface of pure Cu sheet. For evaluation of microstructure, Optical Microscope (OM) and Scanning Electron Microscope (SEM) were used. Microstructural observation confirmed fine and equiaxed grains in the stir zone (SZ) and showed that SiC particles act as heterogeneous nucleation sites in the dynamic recrystallization of Cu grains. Moreover, agglomeration of particles was not observed and fine particles had a good distribution in SZ. In the SEM micrographs, porosities were detected as microstructure defects. Microhardness measurements showed that surface hardness was two times as high as that of substrate. The rotational wear tests demonstrated that use of SiC particles enhanced wear resistance and increased average friction coefficient of pure Cu. No intermetallic compound was found in Cu/SiC composite as revealed by XRD analysis

Degradation of antibiotic norfloxacin in aqueous solution by visible-light-mediated C-TiO2 photocatalysis

International Nuclear Information System (INIS)

Chen, Meijuan; Chu, W.

2012-01-01

Highlights: ► Vis/C-TiO 2 process was employed to degrade norfloxacin for the first time. ► An original schematic diagram for deciphering the catalyst surface property was proposed. ► OH· radicals are verified to play a major role in the norfloxacin decomposition. ► Hole scavenger of ammonium did not show negative influence. ► Fluoride presented a unique restriction in the norfloxacin decay. - Abstract: A visible-light-mediated C-TiO 2 photocatalytic process (Vis/C-TiO 2 ) was employed to degrade antibiotic norfloxacin. The influences of catalyst dosage, initial probe compound concentration and solution pH levels on the decay performance and reaction kinetics were investigated and optimized. Based on the experimental results, an equation was established to predict the observed rate constant under neutral pH. In addition, the decay rate was accelerated under weak alkali in the presence of moderate OH − anions. Hydroxyl radical was confirmed to play a major role in the Vis/TiO 2 process, where in the presence of ·OH quencher and electron acceptor, retardation and improvement were found respectively. Furthermore, an original schematic diagram describing the surface property of C-TiO 2 was built and further verified, in which, NH 4 + cations normally served as hole scavengers showed a negligible effect because the adsorbed OH − formed a barrier for NH 4 + ions to approach the holes, and the F − anions presented a significant suppression on norfloxacin decay due to the formation of hydrogen bond (O-H⋯F) around the C-TiO 2 surface. Besides, the recycling and sedimentation tests justified that the Vis/C-TiO 2 process is a cost-effective and feasible way for wastewater treatment.

Alcohol binding in the C1 (C1A + C1B) domain of protein kinase C epsilon

Science.gov (United States)

Pany, Satyabrata; Das, Joydip

2015-01-01

Background Alcohol regulates the expression and function of protein kinase C epsilon (PKCε). In a previous study we identified an alcohol binding site in the C1B, one of the twin C1 subdomains of PKCε. Methods In this study, we investigated alcohol binding in the entire C1 domain (combined C1A and C1B) of PKCε. Fluorescent phorbol ester, SAPD and fluorescent diacylglycerol (DAG) analog, dansyl-DAG were used to study the effect of ethanol, butanol, and octanol on the ligand binding using fluorescence resonance energy transfer (FRET). To identify alcohol binding site(s), PKCεC1 was photolabeled with 3-azibutanol and 3-azioctanol, and analyzed by mass spectrometry. The effects of alcohols and the azialcohols on PKCε were studied in NG108-15 cells. Results In the presence of alcohol, SAPD and dansyl-DAG showed different extent of FRET, indicating differential effects of alcohol on the C1A and C1B subdomains. Effects of alcohols and azialcohols on PKCε in NG108-15 cells were comparable. Azialcohols labeled Tyr-176 of C1A and Tyr-250 of C1B. Inspection of the model structure of PKCεC1 reveals that these residues are 40 Å apart from each other indicating that these residues form two different alcohol binding sites. Conclusions The present results provide evidence for the presence of multiple alcohol-binding sites on PKCε and underscore the importance of targeting this PKC isoform in developing alcohol antagonists. PMID:26210390

Sodium doping in copper-phthalocyanine/C60 heterojunction for organic photovoltaic applications

International Nuclear Information System (INIS)

Chen, Hui-Ju; Wu, Hsuan-Ta; Hung, Kuang-Teng; Fu, Sheng-Wen; Shih, Chuan-Feng

2013-01-01

Sodium was incorporating at the copper-phthalocyanine (CuPc)/C 60 interface in CuPc/C 60 -based small-molecular solar cells to enhance their power conversion efficiency. C 60 was deposited on slightly sodium-doped CuPc. Post-annealing improved the cell properties. Post-annealing doubled the conversion efficiency of the least sodium-doped devices (75 °C, 40 min). The electron/hole mobility ratio gradually approached unity as the annealing time increased, indicating that a reduction in the space charge accumulation was the main cause of the increase of the short-circuit current. The mechanism of enhancement of carrier transport by annealing was investigated by making capacitance–voltage measurements and performing corresponding depth-profile analyses. - Highlights: • Incorporate Na at copper-phthalocyanine/C 60 interface • Annealing importantly improved the cell efficiency of Na-doped devices. • Change in the carrier mobility and concentration was investigated

Molecular resonances in sub-Coulomb energy region (12C-12C, 12C-24Mg, 12C-9Be systems)

International Nuclear Information System (INIS)

Takimoto, Kiyohiko; Shimomura, Susumu; Tanaka, Makoto; Murakami, Tetsuya; Fukada, Mamoru; Sakaguchi, Atsushi

1982-01-01

Molecular resonance in sub-Coulomb energy region was studied on 12 C- 12 C, 12 C- 24 Mg and 12 C- 9 Be systems. The excitation functions and the angular distributions were measured on the reactions 12 C( 12 C, 8 Besub(g,s,)) 16 Osub(g,s,), 24 Mg( 12 C, α) 32 S and 9 Be ( 12 C, 8 Besub(g,s,)) 13 Csub(g,s,). Sub-Coulomb resonances were observed in all systems and the contribution of the 12 Csub(2nd)*(0 + , 7.65 MeV) state is proposed. (author)

Borane-catalyzed cracking of C-C bonds in coal; Boran-katalysierte C-C-Bindungungsspaltung in Steinkohle

Energy Technology Data Exchange (ETDEWEB)

Narangerel, J; Haenel, M W [Max-Planck-Institut fuer Kohlenforschung, Muelheim an der Ruhr (Germany)

1998-09-01

Coal, especially coking coal, was reacted with hydrogen at comparatively mild reaction conditions (150-280 degrees centigrade, 20 MPa hydrogen pressure) in the presence of catalysts consisting of borange reagents and certain transition metal halides to obtaine more than 80 percent of pyridine-soluble products. The influence of the degree of coalification, catalyst and temperature on the borane-catalyzed hydrogenolysis of C-C bonds in coal was investigated. (orig.) [Deutsch] Steinkohlen, insbesondere im Inkohlungsbereich der Fettkohlen (Kokskohlen), werden in Gegenwart von Katalysatoren aus Boran-Reagentien und bestimmten Uebergangsmetallhalogeniden mit Wasserstoff bei vergleichsweise milden Reaktionsbedingungen (250-280 C, 20 MPa Wasserstoffdruck) in zu ueber 80% pyridinloesliche Produkte umgewandelt. Der Einfluss von Inkohlungsgrad, Katalysator und Temperatur auf die Boran-katalysierte C-C-Bindungshydrogenolyse in Kohle wurde untersucht. (orig.)

Determination of material properties for short fibre reinforced C/C-SiC

Directory of Open Access Journals (Sweden)

Hausherr J.-M.

2015-01-01

Full Text Available Determining the mechanical properties of short fibre reinforced CMC using standard sized coupons has always been a challenge due to a high statistical scattering of the measured values. Although the random orientation of short fibres results in a quasi-isotropic material behavior of 2D-structures with a sufficiently large volume, the small volume typical for test coupons usually results in a non-isotropic fibre orientation in the tested volume. This paper describes a method for manufacturing unidirectional oriented short fibre reinforced CMC materials and presents material properties of UD-C/C-SiC. After verifying the fibre orientation of the CMC using micro-computed tomography, coupons were extracted to determine the orthotropic material properties. These orthotropic material properties were then used to predict the properties of C/C-SiC with randomly distributed short fibres. To validate the method, micro-computed tomography is used to quantitatively determine the fibre orientation within coupons extracted from randomly distributed short fibre C/C-SiC. After mechanical three-point-bending tests, the measured stiffness and bending strength is compared with the predicted properties. Finally, the data are used to devise a method suited for reducing the inherent large spread of material properties associated with the measurement of CMC materials with randomly distributed short fibres.

Slowly balding black holes

International Nuclear Information System (INIS)

Lyutikov, Maxim; McKinney, Jonathan C.

2011-01-01

The 'no-hair' theorem, a key result in general relativity, states that an isolated black hole is defined by only three parameters: mass, angular momentum, and electric charge; this asymptotic state is reached on a light-crossing time scale. We find that the no-hair theorem is not formally applicable for black holes formed from the collapse of a rotating neutron star. Rotating neutron stars can self-produce particles via vacuum breakdown forming a highly conducting plasma magnetosphere such that magnetic field lines are effectively ''frozen in'' the star both before and during collapse. In the limit of no resistivity, this introduces a topological constraint which prohibits the magnetic field from sliding off the newly-formed event horizon. As a result, during collapse of a neutron star into a black hole, the latter conserves the number of magnetic flux tubes N B =eΦ ∞ /(πc(ℎ/2π)), where Φ ∞ ≅2π 2 B NS R NS 3 /(P NS c) is the initial magnetic flux through the hemispheres of the progenitor and out to infinity. We test this theoretical result via 3-dimensional general relativistic plasma simulations of rotating black holes that start with a neutron star dipole magnetic field with no currents initially present outside the event horizon. The black hole's magnetosphere subsequently relaxes to the split-monopole magnetic field geometry with self-generated currents outside the event horizon. The dissipation of the resulting equatorial current sheet leads to a slow loss of the anchored flux tubes, a process that balds the black hole on long resistive time scales rather than the short light-crossing time scales expected from the vacuum no-hair theorem.

HOTSPOT: The Snake River Scientifi c Drilling Project— Tracking the Yellowstone Hotspot Through Space and Time

Directory of Open Access Journals (Sweden)

Douglas F. Williams

2006-09-01

Full Text Available The project “HOTSPOT: Scientifi c Drilling of the Snake　River Plain” held its inaugural workshop in Twin Falls, Idaho,　U.S.A. on 18–21 May 2006. This inter-disciplinary workshop,　sponsored by the International Continental Scientifi c Drilling　Program (ICDP, explored the major scientifi c and logistical　issues central to a transect of boreholes along the hotspot　track and addressing the geochemical evolution of continental　lithosphere in response to interaction with deepseated　mantle hotspots or plumes. A series of four to six bore　holes is envisioned, each about 1.5–2.0 km deep and located　along the axis of the Snake River Plain. The holes will　specific ally target the origin and evolution of hotspot-related　volcanism in space and time. To accomplish scientific and　logistical planning, sixty scientists from six countries　attended the workshop.

Synthesis of [5,6-13C2, 1-14C]olivetolic acid, methyl [1'-13C]olivetolate and [5,6-13C2, 1-14C]cannabigerolic acid

International Nuclear Information System (INIS)

Porwoll, J.P.; Leete, E.

1985-01-01

Potential advanced intermediates in the biosynthesis of delta 9 -tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous 13 C atoms and 14 C. Methyl [5,6- 13 C 2 , 1- 14 C]olivetolate was prepared from lithium [ 13 C 2 ]acetylide and dimethyl [2- 14 C]malonate. Reaction with geranyl bromide afforded methyl [5,6- 13 C 2 , 1- 14 C]cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The 13 C- 13 C couplings observable in the 13 C NMR spectra of these 13 C-enriched compounds and their synthetic precursors are recorded. Methyl [1'- 14 C]olivetolate was prepared from 13 CO 2 to confirm assignments of the 13 C chemical shifts in the pentyl side chain of these compounds. (author)

Synthesis of [2-13C, 2-14C] 2-aminoethanol, [1-13C, 1-14C] 2-chloroethylamine, N,N'-bis([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(BCNU) and N-([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(CNU)

International Nuclear Information System (INIS)

Narayan, R.; Chang, C-j.

1982-01-01

[2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)

Effects of C+ ion implantation on electrical properties of NiSiGe/SiGe contacts

International Nuclear Information System (INIS)

Zhang, B.; Yu, W.; Zhao, Q.T.; Buca, D.; Breuer, U.; Hartmann, J.-M.; Holländer, B.; Mantl, S.; Zhang, M.; Wang, X.

2013-01-01

We have investigated the morphology and electrical properties of NiSiGe/SiGe contact by C + ions pre-implanted into relaxed Si 0.8 Ge 0.2 layers. Cross-section transmission electron microscopy revealed that both the surface and interface of NiSiGe were improved by C + ions implantation. In addition, the effective hole Schottky barrier heights (Φ Bp ) of NiSiGe/SiGe were extracted. Φ Bp was observed to decrease substantially with an increase in C + ion implantation dose

The spectrum of the two-dimensional black hole or does the two-dimensional black hole have tachyonic or W-hair?

International Nuclear Information System (INIS)

Marcus, N.; Oz, Y.

1993-01-01

We solve the equations of motion of the tachyon and the discrete states in the background of Witten's semiclassical black hole and in the exact two-dimensional dilaton-graviton background of Dijkgraaf et al. We find the exact solutions for weak fields, leading to conclusions in disagreement with previous studies of tachyons in the black hole. Demanding that a state in the black hole be well behaved at the horizon implies that it must tend asymptotically to a combination of a Seiberg and an anti-Seiberg c=1 state. For such a state to be well behaved asymptotically, it must satisfy the condition that neither its Seiberg nor its anti-Seiberg Liouville momentum is positive. Thus, although the free-field BRST cohomologies of the underlying SL(2, R) theory is the same as that of a c=1 theory, the black-hole spectrum is drastically truncated: There are no W ∞ states, and only tachyons with x-momenta vertical stroke p tach ≤m tach vertical stroke are allowed. In the Minkowski case only the static tachyon is allowed. The black hole is stable to the back reaction of these remaining tachyons, so they are good perturbations of the black hole, or 'hair'. However, this leaves only three tachyonic hairs in the black hole and seven in the exact solution. Such sparse hair is clearly irrelevant to the maintenance of coherence during black-hole evaporation. (orig.)

Gas-phase reactivity of lanthanide cations with fluorocarbons: C-F versus C-H and C-C bond activation

International Nuclear Information System (INIS)

Cornehl, H.H.; Hornung, G.; Schwarz, H.

1996-01-01

The gas-phase reactivity of the fluorinated hydrocarbons CF 4 , CHF 3 , CH 3 F, C 2 F 6 , 1,1-C 2 H 4 F 2 , and C 6 F 6 with the lanthanide cations Ce + , Pr + , Sm + , Ho + , Tm + , and Yb + and the reactivity of C 6 H 5 F with all lanthanide cations Ln + (Ln = La-Lu, with the exception of Pm + ) have been examined by Fourier-transform ion cyclotron resonance mass spectrometry. The perfluorinated compounds tetrafluoromethane and hexafluoroethane as well as trifluoromethane do not react with any lanthanide cation. Selective activation of the strong C-F bonds in fluoromethane, 1,1-difluoroethane, hexafluorobenzene, and fluorobenzene appears as a general reaction scheme along the 4f row. Experimental evidence is given for a 'harpoon'-like mechanism for the F atom abstraction process which operates via an initial electron transfer from the lanthanide cation to the fluorinated substrate in the encounter complex Ln + RF. The most reactive lanthanides La + , Ce + , Gd + , and Tb + and also the formal closed-shell species Lu + exhibit additional C-H and C-C bond activation pathways in the reaction with fluorobenzene, namely dehydrohalogenation as well as loss of a neutral acetylene molecule. In the case of Tm + and Yb + the formation of neutral LnF 3 is observed in a multistep process via C-C coupling and charge transfer. 17 refs., 2 figs., 2 tabs

Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18

Directory of Open Access Journals (Sweden)

R. F. Weiss

2012-05-01

Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.

Solar photocatalytic water oxidation over Ag3PO4/g-C3N4 composite materials mediated by metallic Ag and graphene

Science.gov (United States)

Cui, Xingkai; Tian, Lin; Xian, Xiaozhai; Tang, Hua; Yang, Xiaofei

2018-02-01

Solar-driven water splitting over semiconductor-based photocatalysts provides direct conversion of solar energy to chemical energy, in which electron-hole separation and charge transport are critical for enhancing the photocatalytic activity of semiconducting materials. Moreover, the search for active photocatalysts that efficiently oxidize water remains a challenging task. Here, we demonstrate that a series of Ag3PO4/Ag/graphene/graphitic carbon nitride (g-C3N4) heterostructured materials can drive photocatalytic water oxidation efficiently under LED illumination. The water oxidation behavior of as-prepared composite photocatalysts in relation to the added amount of g-C3N4 and the roles of electron mediators was investigated in detail. Based on the illuminated Z-scheme photocatalytic mechanism, the photogenerated electrons and holes can be separated effectively and the electron-hole recombination of bulk material is suppressed. The reduced metallic Ag nanoparticles were found to function as the center for the accumulation of electrons from Ag3PO4 and holes from g-C3N4. By exploiting the proper addition of g-C3N4 into the composite, photocatalytic oxygen evolution performance over the heterostructured materials could be suitably tuned, which resulted in highly efficient water oxidation.

Construction of g-C3N4/CeO2/ZnO ternary photocatalysts with enhanced photocatalytic performance

Science.gov (United States)

Yuan, Yuan; Huang, Gui-Fang; Hu, Wang-Yu; Xiong, Dan-Ni; Zhou, Bing-Xin; Chang, Shengli; Huang, Wei-Qing

2017-07-01

Promoting the spatial separation of photoexcited charge carriers is of paramount significance for photocatalysis. In this work, binary g-C3N4/CeO2 nanosheets are first prepared by pyrolysis and subsequent exfoliation method, then decorated with ZnO nanoparticles to construct g-C3N4/CeO2/ZnO ternary nanocomposites with multi-heterointerfaces. Notably, the type-II staggered band alignments existing between any two of the constituents, as well as the efficient three-level transfer of electron-holes in unique g-C3N4/CeO2/ZnO ternary composites, leads to the robust separation of photoexcited charge carriers, as verified by its photocurrent increased by 8 times under visible light irradiation. The resulting g-C3N4/CeO2/ZnO ternary nanocomposites unveil appreciably increased photocatalytic activity, faster than that of pure g-C3N4, ZnO and g-C3N4/CeO2 by a factor of 11, 4.6 and 3.7, respectively, and good stability toward methylene blue (MB) degradation. The remarkably enhanced photocatalytic activity of g-C3N4/CeO2/ZnO ternary heterostructures can be interpreted in terms of lots of active sites of nanosheet shapes and the efficient charge separation owing to the resulting type-II band alignment with more than one heterointerface and the efficient three-level electron-hole transfer. A plausible mechanism is also elucidated via active species trapping experiments with various scavengers, which indicating that the photogenerated holes and •OH radicals play a crucial role in photodegradation reaction under visible light irradiation. This work suggest that the rational design and construction of type II multi-heterostructures is powerful for developing highly efficient and reusable visible-light photocatalysts for environmental purification and energy conversion.

Correlation between choroidal thickness and macular hole

Directory of Open Access Journals (Sweden)

Li-Li Wang

2018-01-01

Full Text Available AIM:To explore the correlation between choroidal thickness and macular hole, and to provide a theoretical basis for diagnosis and treatment of macular hole. METHODS: This study included 40 cases of monocular idiopathic macular hole patients who were treated in ophthalmology of our hospital from June 2015 to June 2016 and 40 cases of healthy people. Sicked eyes of idiopathic macular hole patients(40 eyeswere set as the Group A, uninjured side eyes(40 eyeswere set as the Group B, eyes of 40 cases of healthy people(40 normal eyeswere set as the Group C. Choroidal thickness of macular fovea, macular fovea 1mm, 3mm at 9 points, 4 directions in the upper, lower, nasal and temporal regions were measured through coherent optical tomography of enhanced deep imaging(enhanced depth image optical coherence tomography, EDI-OCT. They were recorded as SFCT, SCT1mm, SCT3mm, ICT1mm, ICT3mm, NCT1mm, NCT3mm, TCT1mm, TCT3mm, and correlation analysis between SFCT and age was analyzed. RESULTS: Average SFCT of Group A, B had no significant difference, data of the Group C was significantly higher than those of the Group A, B, there was statistical significance(P1mm, SCT3mm, ICT1mm, ICT3mm, NCT1mm, NCT3mm, TCT1mm, TCT3mm of the Group A, B had no significant difference(P>0.05, and choroidal thickness at each point of the Group C was significantly higher than that of Group A and B, there was statistical significance(Pr=-0.065, P=0.148; r=-0.057, P=0.658, SFCT of the Group C was negatively correlated with age(r=-0.343, P=0.041. CONCLUSION: The pathogenesis of idiopathic macular hole may be related to the sharp decrease of choroidal thickness, choroidal thickness of uninjured side eyes reduces more sharply than normal population and choroidal vascular metabolism reduces may be pathogenic.

A specific assay for quantification of human C4c by use of an anti-C4c monoclonal antibody

DEFF Research Database (Denmark)

Pilely, Katrine; Skjoedt, Mikkel-Ole; Nielsen, Christian

2014-01-01

a mouse monoclonal antibody (mAb) that is able to detect fluid phase C4c without interference from other products generated from the complement component C4. The C4c specific mAb was tested in different enzyme-linked immunosorbent assay (ELISA) combinations with various types of in vitro activated sera...

Single night postoperative prone posturing in idiopathic macular hole surgery.

LENUS (Irish Health Repository)

2012-02-01

Purpose. To evaluate the role of postoperative prone posturing for a single night in the outcome of trans pars plana vitrectomy (TPPV) with internal limiting membrane (ILM) peel and 20% perfluoroethane (C2F6) internal tamponade for idiopathic macular hole. Methods. This prospective trial enrolled 14 eyes in 14 consecutive patients with idiopathic macular hole. All eyes underwent TPPV with vision blue assisted ILM peeling with and without phacoemulsification and intraocular lens (IOL) for macular hole. Intraocular gas tamponade (20% C2F6) was used in all cases with postoperative face-down posturing overnight and without specific posturing afterwards. LogMAR visual acuity, appearance by slit-lamp biomicroscopy, and ocular coherence tomography (OCT) scans were compared preoperatively and postoperatively to assess outcome. Results. Among 14 eyes recruited, all eyes were phakic; 50% of patients underwent concurrent phacoemulsification with IOL. The macular holes were categorized preoperatively by OCT appearance, 4 (28.57%) were stage 2, 7 (50%) were stage 3, and 3 (21.43%) were stage 4. Mean macular hole size was 0.35 disk diameters. Symptoms of macular hole had been present for an average of 6.5 months. All holes (100%) were closed 3 and 6 months postoperatively. Mean visual acuity (logMAR) was improved to 0.61 at 3 months and was stable at 6 months after the surgery. None of the eyes had worse vision postoperatively. Conclusions. Vitrectomy with ILM peeling and 20% C2F6 gas with a brief postoperative 1 night prone posturing regimen is a reasonable approach to achieve anatomic closure in idiopathic macular hole. Concurrent cataract extraction did not alter outcomes and was not associated with any additional complications.

Analytical results for a hole in an antiferromagnet

International Nuclear Information System (INIS)

Li, Y.M.; d'Ambrumenil, N.; Su, Z.B.

1996-04-01

The Green's function for a hole moving in an antiferromagnet is derived analytically in the long-wavelength limit. We find that the infrared divergence is eliminated in two and higher dimensions so that the quasiparticle weight is finite. Our results also suggest that the hole motion is polaronic in nature with a bandwidth proportional to t 2 /J exp[-c(t/J) 2 ] (c is a constant) for J/t >or approx 0.5. The connection of the long-wavelength approximation to the first-order approximation in the cumulant expansion is also clarified. (author). 23 refs, 2 figs

Synthesis of g-C3N4/Ag3PO4 heterojunction with enhanced photocatalytic performance

International Nuclear Information System (INIS)

He, Peizhi; Song, Limin; Zhang, Shujuan; Wu, Xiaoqing; Wei, Qingwu

2014-01-01

Graphical abstract: g-C 3 N 4 /Ag 3 PO 4 heterojunction photocatalyst with visible-light response was prepared by a facile coprecipitation method. The results show that g-C 3 N 4 /Ag 3 PO 4 possesses a much higher activity for the decomposition of RhB than that of the pure Ag 3 PO 4 particles. The most mechanism is that g-C 3 N 4 /Ag 3 PO 4 heterojunction photocatalyst can efficiently separate the photogenerated electron–hole pairs, enhancing the photocatalytic activity of g-C 3 N 4 /Ag 3 PO 4 composites. - Highlights: • g-C 3 N 4 /Ag 3 PO 4 heterojunction showed much higher activity than that of Ag 3 PO 4 . • The high activity could be attributed to g-C 3 N 4 for modifying Ag 3 PO 4 . • More ·OH radicals may be significant reason to improve Ag 3 PO 4 activity. - Abstract: g-C 3 N 4 /Ag 3 PO 4 heterojunction photocatalyst with visible-light response was prepared by a facile coprecipitation method. The photocatalysts were characterized by X-ray powder diffraction, transmission electron microscopy, UV–vis absorption spectroscopy and Fourier transform infrared spectroscopy. The photocatalytic activities of the obtained samples were tested by using Rhodamine B (RhB) as the degradation target under visible light irradiation. g-C 3 N 4 /Ag 3 PO 4 decomposed RhB more effectively than the pure Ag 3 PO 4 particles did, and 2 wt.% g-C 3 N 4 had the highest activity. Furthermore, 2 wt.% g-C 3 N 4 /Ag 3 PO 4 degraded high-concentration RhB more potently than unmodified Ag 3 PO 4 did, probably because g-C 3 N 4 /Ag 3 PO 4 heterojunction photocatalyst enhanced the photocatalytic activity by efficiently separating the photogenerated electron–hole pairs

Organic field-effect transistor nonvolatile memories utilizing sputtered C nanoparticles as nano-floating-gate

Energy Technology Data Exchange (ETDEWEB)

Liu, Jie; Liu, Chang-Hai; She, Xiao-Jian; Sun, Qi-Jun; Gao, Xu; Wang, Sui-Dong, E-mail: wangsd@suda.edu.cn [Institute of Functional Nano and Soft Materials (FUNSOM), Soochow University, Suzhou, Jiangsu 215123 (China)

2014-10-20

High-performance organic field-effect transistor nonvolatile memories have been achieved using sputtered C nanoparticles as the nano-floating-gate. The sputtered C nano-floating-gate is prepared with low-cost material and simple process, forming uniform and discrete charge trapping sites covered by a smooth and complete polystyrene layer. The devices show large memory window, excellent retention capability, and programming/reading/erasing/reading endurance. The sputtered C nano-floating-gate can effectively trap both holes and electrons, and it is demonstrated to be suitable for not only p-type but also n-type organic field-effect transistor nonvolatile memories.

Organic field-effect transistor nonvolatile memories utilizing sputtered C nanoparticles as nano-floating-gate

International Nuclear Information System (INIS)

Liu, Jie; Liu, Chang-Hai; She, Xiao-Jian; Sun, Qi-Jun; Gao, Xu; Wang, Sui-Dong

2014-01-01

High-performance organic field-effect transistor nonvolatile memories have been achieved using sputtered C nanoparticles as the nano-floating-gate. The sputtered C nano-floating-gate is prepared with low-cost material and simple process, forming uniform and discrete charge trapping sites covered by a smooth and complete polystyrene layer. The devices show large memory window, excellent retention capability, and programming/reading/erasing/reading endurance. The sputtered C nano-floating-gate can effectively trap both holes and electrons, and it is demonstrated to be suitable for not only p-type but also n-type organic field-effect transistor nonvolatile memories.

Early antihepatitis C virus response with second-generation C200/C22 ELISA

NARCIS (Netherlands)

van der Poel, C. L.; Bresters, D.; Reesink, H. W.; Plaisier, A. A.; Schaasberg, W.; Leentvaar-Kuypers, A.; Choo, Q. L.; Quan, S.; Polito, A.; Houghton, M.

1992-01-01

Detection of early antibody to hepatitis C virus (HCV) by a new second-generation C200/C22 anti-HCV enzyme-linked immunosorbent assay (ELISA) and a four-antigen recombinant immunoblot assay (4-RIBA) was compared with the first-generation anti-HCV C100 ELISA using sequential serum samples of 9

Black hole as a wormhole factory

Directory of Open Access Journals (Sweden)

Sung-Won Kim

2015-12-01

Full Text Available There have been lots of debates about the final fate of an evaporating black hole and the singularity hidden by an event horizon in quantum gravity. However, on general grounds, one may argue that a black hole stops radiation at the Planck mass (ħc/G1/2∼10−5 g, where the radiated energy is comparable to the black hole's mass. And also, it has been argued that there would be a wormhole-like structure, known as “spacetime foam”, due to large fluctuations below the Planck length (ħG/c31/2∼10−33 cm. In this paper, as an explicit example, we consider an exact classical solution which represents nicely those two properties in a recently proposed quantum gravity model based on different scaling dimensions between space and time coordinates. The solution, called “Black Wormhole”, consists of two different states, depending on its mass parameter M and an IR parameter ω: For the black hole state (with ωM2>1/2, a non-traversable wormhole occupies the interior region of the black hole around the singularity at the origin, whereas for the wormhole state (with ωM2<1/2, the interior wormhole is exposed to an outside observer as the black hole horizon is disappearing from evaporation. The black hole state becomes thermodynamically stable as it approaches the merging point where the interior wormhole throat and the black hole horizon merges, and the Hawking temperature vanishes at the exact merge point (with ωM2=1/2. This solution suggests the “Generalized Cosmic Censorship” by the existence of a wormhole-like structure which protects the naked singularity even after the black hole evaporation. One could understand the would-be wormhole inside the black hole horizon as the result of microscopic wormholes created by “negative” energy quanta which have entered the black hole horizon in Hawking radiation process; the quantum black hole could be a wormhole factory! It is found that this speculative picture may be consistent with the

Despite phylogenetic effects, C3-C4 lineages bridge the ecological gap to C4 photosynthesis.

Science.gov (United States)

Lundgren, Marjorie R; Christin, Pascal-Antoine

2017-01-01

C 4 photosynthesis is a physiological innovation involving several anatomical and biochemical components that emerged recurrently in flowering plants. This complex trait evolved via a series of physiological intermediates, broadly termed 'C 3 -C 4 ', which have been widely studied to understand C 4 origins. While this research program has focused on biochemistry, physiology, and anatomy, the ecology of these intermediates remains largely unexplored. Here, we use global occurrence data and local habitat descriptions to characterize the niches of multiple C 3 -C 4 lineages, as well as their close C 3 and C 4 relatives. While C 3 -C 4 taxa tend to occur in warm climates, their abiotic niches are spread along other dimensions, making it impossible to define a universal C 3 -C 4 niche. Phylogeny-based comparisons suggest that, despite shifts associated with photosynthetic types, the precipitation component of the C 3 -C 4 niche is particularly lineage specific, being highly correlated with that of closely related C 3 and C 4 taxa. Our large-scale analyses suggest that C 3 -C 4 lineages converged toward warm habitats, which may have facilitated the transition to C 4 photosynthesis, effectively bridging the ecological gap between C 3 and C 4 plants. The intermediates retained some precipitation aspects of their C 3 ancestors' habitat, and likely transmitted them to their C 4 descendants, contributing to the diversity among C 4 lineages seen today. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Geometric factors in f.c.c. and b.c.c. metal-on-metal epitaxy

International Nuclear Information System (INIS)

Bruce, L.A.; Jaeger, H.

1978-01-01

Deposits of Ni, Au and Ag formed by condensing metal vapour in U.H.V. onto (001)W, held at a temperature Tsub(s) in the range 300K< Tsub(s)<1200 K, always form epitaxial layers. However, while Au and Ag form (001) epitaxial layers of f.c.c. single crystals, (001)d parallel to (001)s with, say, [110]d parallel to [010]s, Ni and Cu occur in two orthogonal domains, each characterized by an exclusive set of fault (or twin) planes. Within a fault plane, atoms are hexagonally close-packed and, within a domain, fault planes are normal to either [1-1-0]s or [1-10]s and a close-packed direction in the planes is normal to the substrate. The lateral stacking of the fault planes may range from random at low values of Tsub(s) to that of, say, (11-1-) planes in heavily faulted and/or twinned (110) epitaxed f.c.c. material, or of basal planes in (110) epitaxed h.c.p. material at high values of Tsub(s). The results are readily explained on the basis of a growth model developed for deposits of Ni and Cu on (001) Ag. (author)

Low dose irradiation performance of SiC interphase SiC/SiC composites

International Nuclear Information System (INIS)

Snead, L.L.; Lowden, R.A.; Strizak, J.; More, K.L.; Eatherly, W.S.; Bailey, J.; Williams, A.M.; Osborne, M.C.; Shinavski, R.J.

1998-01-01

Reduced oxygen Hi-Nicalon fiber reinforced composite SiC materials were densified with a chemically vapor infiltrated (CVI) silicon carbide (SiC) matrix and interphases of either 'porous' SiC or multilayer SiC and irradiated to a neutron fluence of 1.1 x 10 25 n m -2 (E>0.1 MeV) in the temperature range of 260 to 1060 C. The unirradiated properties of these composites are superior to previously studied ceramic grade Nicalon fiber reinforced/carbon interphase materials. Negligible reduction in the macroscopic matrix microcracking stress was observed after irradiation for the multilayer SiC interphase material and a slight reduction in matrix microcracking stress was observed for the composite with porous SiC interphase. The reduction in strength for the porous SiC interfacial material is greatest for the highest irradiation temperature. The ultimate fracture stress (in four point bending) following irradiation for the multilayer SiC and porous SiC interphase materials was reduced by 15% and 30%, respectively, which is an improvement over the 40% reduction suffered by irradiated ceramic grade Nicalon fiber materials fabricated in a similar fashion, though with a carbon interphase. The degradation of the mechanical properties of these composites is analyzed by comparison with the irradiation behavior of bare Hi-Nicalon fiber and Morton chemically vapor deposited (CVD) SiC. It is concluded that the degradation of these composites, as with the previous generation ceramic grade Nicalon fiber materials, is dominated by interfacial effects, though the overall degradation of fiber and hence composite is reduced for the newer low-oxygen fiber. (orig.)

Highly Stable [C60AuC60]+/- Dumbbells.

Science.gov (United States)

Goulart, Marcelo; Kuhn, Martin; Martini, Paul; Chen, Lei; Hagelberg, Frank; Kaiser, Alexander; Scheier, Paul; Ellis, Andrew M

2018-05-17

Ionic complexes between gold and C 60 have been observed for the first time. Cations and anions of the type [Au(C 60 ) 2 ] +/- are shown to have particular stability. Calculations suggest that these ions adopt a C 60 -Au-C 60 sandwich-like (dumbbell) structure, which is reminiscent of [XAuX] +/- ions previously observed for much smaller ligands. The [Au(C 60 ) 2 ] +/- ions can be regarded as Au(I) complexes, regardless of whether the net charge is positive or negative, but in both cases, the charge transfer between the Au and C 60 is incomplete, most likely because of a covalent contribution to the Au-C 60 binding. The C 60 -Au-C 60 dumbbell structure represents a new architecture in fullerene chemistry that might be replicable in synthetic nanostructures.

SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...

Quantification of C=C and C=O Surface Carbons in Detonation Nanodiamond by NMR

Energy Technology Data Exchange (ETDEWEB)

Cui, J -F; Fang, X -W; Schmidt-Rohr, K

2014-05-08

The ability of solid-state 13C NMR to detect and quantify small amounts of sp2-hybridized carbon on the surface of ~5 nm diameter nanodiamond particles is demonstrated. The C=C carbon fraction is only 1.1 ± 0.4% in pristine purified detonation nanodiamond, while a full single-layer graphitic or “bucky diamond” shell would contain ca. 25% of all C in a 5 nm diameter particle. Instead of large aromatic patches repeatedly proposed in the recent literature, sp3-hybridized CH and COH carbons cover most of the nanodiamond particle surface, accounting for ~5% each. C=O and COO groups also seen in X-ray absorption near-edge structure spectroscopy (XANES) but not detected in previous NMR studies make up ca. 1.5% of all C. They are removed by heat treatment at 800 °C, which increases the aromatic fraction. 13C{1H} NMR demonstrates that the various sp2-hybridized carbons are mostly not protonated, but cross-polarization shows that they are separated from 1H by only a few bond lengths, which proves that they are near the protonated surface. Together, the observed C–H, C–OH, C=O, and C=C groups account for 12–14% of all C, which matches the surface fraction expected for bulk-terminated 5 nm diameter diamond particles.

A comparative study of low energy radiation responses of SiC, TiC and ZrC

International Nuclear Information System (INIS)

Jiang, M.; Xiao, H.Y.; Zhang, H.B.; Peng, S.M.; Xu, C.H.; Liu, Z.J.; Zu, X.T.

2016-01-01

In this study, an ab initio molecular dynamics method is employed to compare the responses of SiC, TiC and ZrC to low energy irradiation. It reveals that C displacements are dominant in the cascade events of the three carbides. The associated defects in SiC are mainly Frenkel pairs and antisite defects, whereas damage end states in TiC and ZrC generally consist of Frenkel pairs and very few antisite defects are created. It is proposed that the susceptibility to antisite formation in SiC contributes to its crystalline-to-amorphous transformation under irradiation that is observed experimentally. The stronger radiation tolerance of TiC and ZrC than SiC can be originated from their different electronic structures, i.e., the C> and C> bonds are a mixture of covalent, metallic, and ionic character, whereas the C> bond is mainly covalent. The presented results provide underlying mechanisms for defect generation in SiC, TiC and ZrC, and advance the fundamental understanding of the radiation resistances of carbide materials.

Quintessence background for 5D Einstein-Gauss-Bonnet black holes

Science.gov (United States)

Ghosh, Sushant G.; Amir, Muhammed; Maharaj, Sunil D.

2017-08-01

As we know that the Lovelock theory is an extension of the general relativity to the higher-dimensions, in this theory the first- and the second-order terms correspond to general relativity and the Einstein-Gauss-Bonnet gravity, respectively. We obtain a 5D black hole solution in Einstein-Gauss-Bonnet gravity surrounded by the quintessence matter, and we also analyze their thermodynamical properties. Owing to the quintessence corrected black hole, the thermodynamic quantities have also been corrected except for the black hole entropy, and a phase transition is achievable. The phase transition for the thermodynamic stability is characterized by a discontinuity in the specific heat at r=r_C, with the stable (unstable) branch for r ) r_C.

Towards room-temperature superconductivity in low-dimensional C60 nanoarrays: An ab initio study

Science.gov (United States)

Erbahar, Dogan; Liu, Dan; Berber, Savas; Tománek, David

2018-04-01

We propose to raise the critical temperature Tc for superconductivity in doped C60 molecular crystals by increasing the electronic density of states at the Fermi level N (EF) and thus the electron-phonon coupling constant in low-dimensional C60 nanoarrays. We consider both electron and hole dopings and present numerical results for N (EF) , which increases with the decreasing bandwidth of the partly filled hu- and t1 u-derived frontier bands with the decreasing coordination number of C60. Whereas a significant increase in N (EF) occurs in two-dimensional (2D) arrays of doped C60 intercalated in-between graphene layers, we propose that the highest-Tc values approaching room temperature may occur in bundles of nanotubes filled by one-dimensional (1D) arrays of externally doped C60 or La @C60 or in diluted three-dimensional (3D) crystals where quasi-1D arrangements of C60 form percolation paths.

Essential oils from Calyptranthes concinna, C. lucida and C. rubella (Myrtaceae Óleos essenciais de Calyptranthes concinna, C. lucida and C. rubella (Myrtaceae

Directory of Open Access Journals (Sweden)

Renata Pereira Limberger

2002-09-01

Full Text Available Essential oils from Calyptranthes concinna, C. lucida and C. rubella, collected in Southern Brazil, were analyzed by GC and GC/MS. Sixty-two compounds were identified representing about 98% of the oil contents. All samples were rich in cyclic sesquiterpenes (more than 90 %, mainly those from cadinane, bisabolane and germacrane cyclization pathway. The mainly components characterized were bicyclogermacrene (22.1% in C. concinna;11.7% in C. rubella, cis-calamenene (10.3% in C. concinna, beta-caryophyllene (16.5% in C. rubella; 9.4% in C. lucida, beta-bisabolene (25.5% in C. lucida, spathulenol (15.4% in C. rubella and caryophyllene oxide (7.6% in C. concinna.Os óleos essenciais de Calyptranthes concinna, C. lucida e C. rubella, coletadas no sul do Brasil, foram analisados por GC/FID e GC/MS. Sessenta e dois constituintes foram identificados representando cerca de 98% do óleo. Todas as amostras mostraram-se ricas em sesquiterpenos cíclicos (mais de 90%, principalmente aquelas da via de ciclização dos cadinanos, bisabolanos e germacranos. Os principais constituintes caracterizados foram biciclogermacreno (22,1% em C. concinna; 11,7% em C. rubella, cis-calameneno (10,3% em C. concinna, betacariofileno (16,5% em C. rubella; 9,4% em C. lucida, beta-bisaboleno (25,5% em C. lucida, espatulenol (15,4% em C. rubella e óxido de cariofileno (7,6% em C. concinna.

Thermal effect of TiC in the Mo/TiC/SiC system at elevated temperature

International Nuclear Information System (INIS)

Roger, Jerome; Audubert, Fabienne; Le Petitcorps, Yann

2010-01-01

In this study, we examined the effect induced by the addition of a TiC interlayer on the stability of the Mo/SiC system at high temperature. Indeed, Mo/SiC couple is unstable at high temperature with formation of Mo 2 C and Mo 5 Si 3 C x phases. In order to limit the degradation of Mo mechanical properties, a TiC film was inserted between Mo and SiC. Samples used in this work were prepared on metallic wires substrates, SiC and TiC being deposited by CVD. The protection given by TiC layer was considered in the 1473-1673 K temperature range and for TiC thicknesses up to about 60 μm. From our results, TiC is not effective enough to mitigate C and Si atoms diffusion. Nevertheless, a notable reduction of the reaction extent is obtained at any temperatures. The so-observed effect depends on the TiC thickness and the temperature. In actual fact, TiC efficiency increases when temperature and/or TiC layer thickness increases without reaching a complete protection.

The Λc(2860), Λc(2880), Ξc(3055) and Ξc(3080) as D-wave baryon states in QCD

Science.gov (United States)

Wang, Zhi-Gang

2018-01-01

In this article, we tentatively assign the Λc (2860), Λc (2880), Ξc (3055) and Ξc (3080) to be the D-wave baryon states with the spin-parity JP = 3/2+, 5/2 +, 3/2+ and 5/2+, respectively, and study their masses and pole residues with the QCD sum rules in a systematic way by constructing three-types interpolating currents with the quantum numbers (Lρ ,Lλ) = (0 , 2), (2 , 0) and (1 , 1), respectively. The present predictions favor assigning the Λc (2860), Λc (2880), Ξc (3055) and Ξc (3080) to be the D-wave baryon states with the quantum numbers (Lρ ,Lλ) = (0 , 2) and JP = 3/2+, 5/2+, 3/2+ and 5/2+, respectively. While the predictions for the masses of the (Lρ ,Lλ) = (2 , 0) and (1 , 1) D-wave Λc and Ξc states can be confronted to the experimental data in the future.

Beginning C

CERN Document Server

Horton, Ivor

2013-01-01

Beginning C, 5th Edition teaches you how to program using the widely-available C language. You'll begin from first-principles and progress through step-by-step examples to become a competent, C-language programmer. All you need are this book and any of the widely available free or commercial C or C++ compilers, and you'll soon be writing real C programs. C is a foundational language that every programmer ought to know. C is the basis for C# used in Microsoft .NET programming. It is the basis for Objective-C used in programming for the iPhone, the iPad, and other Apple devices. It is the basis

SystemC and systemC-AMS in practice systemC 2.3, 2.2 and systemC-AMS 1.0

CERN Document Server

Banerjee, Amal

2013-01-01

This book describes how engineers can make optimum use of the two industry standard analysis/design tools, SystemC and SystemC-AMS.  The authors use a system-level design approach, emphasizing how SystemC and SystemC-AMS features can be exploited most effectively to analyze/understand a given electronic system and explore the design space. The approach taken by this book enables system engineers to concentrate on only those SystemC/SystemC-AMS features that apply to their particular problem, leading to more efficient design. The presentation includes numerous, realistic and complete examples,

A consistent and unified picture for critical phenomena of f(R) AdS black holes

International Nuclear Information System (INIS)

Mo, Jie-Xiong; Li, Gu-Qiang; Wu, Yu-Cheng

2016-01-01

A consistent and unified picture for critical phenomena of charged AdS black holes in f ( R ) gravity is drawn in this paper. Firstly, we investigate the phase transition in canonical ensemble. We derive the explicit solutions corresponding to the divergence of C Q . The two solutions merge into one when the condition Q c =√(−1/3 R 0 ) is satisfied. The curve of specific heat for Q < Q c has two divergent points and can be divided into three regions. Both the large radius region and the small radius region are thermodynamically stable with positive specific heat while the medium radius region is unstable with negative specific heat. However, when Q > Q c , the specific heat is always positive, implying the black holes are locally stable and no phase transition will take place. Secondly, both the T − r + curve and T − S curve f ( R ) AdS black holes are investigated and they exhibit Van der Vaals like behavior as the P − v curve in the former research. Critical physical quantities are obtained and they are consistent with those derived from the specific heat analysis. We carry out numerical check of Maxwell equal area law for the cases Q =0.2 Q c , 0.4 Q c , 0.6 Q c , 0.8 Q c . The relative errors are amazingly small and can be negligible. So the Maxwell equal area law holds for T − S curve of f ( R ) black holes. Thirdly, we establish geometrothermodynamics for f ( R ) AdS black hole to examine the phase structure. It is shown that the Legendre invariant scalar curvature R would diverge exactly where the specific heat diverges. To summarize, the above three perspectives are consistent with each other, thus providing a unified picture which deepens the understanding of critical phenomena of f ( R ) AdS black holes.

Hot pressing of B4C/SiC composites

International Nuclear Information System (INIS)

Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O.

2005-01-01

B 4 C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B 4 C/SiC composite samples were lower than monolithic B 4 C in all experimental conditions. (authors)

From hilltop to kettle hole: what trends across the terrestrial-aquatic transition zone are revealed by organic matter stable isotope (δ13C and δ15N) composition?

Science.gov (United States)

Kayler, Z. E.; Nitzsche, K. N.; Gessler, A.; Kaiser, M. L.; Hoffmann, C.; Premke, K.; Ellerbrock, R.

2016-12-01

Steep environmental gradients develop across the interface between terrestrial and aquatic domains that influence organic matter (OM) retention. In NE Germany, kettle holes are small water bodies found in high density across managed landscapes. Kettle hole water budgets are generally fed through precipitation and overland flow and are temporarily connected to groundwater resulting in distinct hydroperiods. We took advantage of the range of environmental conditions created by the fluctuating shoreline to investigate patterns of OM stability along transects spanning from hilltops to sediments within a single kettle hole. We physically and chemically separated OM fractions that are expected to be loosely bound, such as particulate organic matter, to those that are tightly bound, such as OM associated with mineral or metal surfaces. The study design allowed us to investigate stabilization processes at the aggregate, transect, and kettle hole catchment scale. At the aggregate scale, we analyzed soil characteristics (texture, pH, extractable Al, Fe, Ca) to contribute to our understanding of OM stabilization. At the transect scale, we compared isotopic trends in the different fractions against a simple Rayleigh distillation model to infer disruption of the transfer of material, for example erosion, by land management such as tillage or the addition of OM through fertilization. At the kettle hole catchment scale, we correlated our findings with plant productivity, landform properties, and soil wetness proxies. Aggregate scale patterns of OM 13C and 15N were fraction dependent; however, we observed a convergence in isotopic patterns with soil properties from OM of more stabilized fractions. At the transect scale, loosely bound fractions did not conform to the simple model, suggesting these fractions are more dynamic and influenced by land management. The stabilized fractions did follow the Rayleigh model, which implies that transfer processes play a larger role in these

Preparation and oxidation protection of CVD SiC/a-BC/SiC coatings for 3D C/SiC composites

International Nuclear Information System (INIS)

Liu Yongsheng; Zhang Litong; Cheng Laifei; Yang Wenbin; Zhang Weihua; Xu Yongdong

2009-01-01

An amorphous boron carbide (a-BC) coating was prepared by LPCVD process from BCl 3 -CH 4 -H 2 -Ar system. XPS result showed that the boron concentration was 15.0 at.%, and carbon was 82.0 at.%. One third of boron was distributed to a bonding with carbon and 37.0 at.% was dissolved in graphite lattice. A multiple-layered structure of CVD SiC/a-BC/SiC was coated on 3D C/SiC composites. Oxidation tests were conducted at 700, 1000, and 1200 deg. C in 14 vol.% H 2 O/8 vol.% O 2 /78 vol.% Ar atmosphere up to 100 h. The 3D C/SiC composites with the modified coating system had a good oxidation resistance. This resulted in the high strength retained ratio of the composites even after the oxidation.

Interfacial characterization of CVI-SiC/SiC composites

International Nuclear Information System (INIS)

Yang, W.; Kohyama, A.; Noda, T.; Katoh, Y.; Hinoki, T.; Araki, H.; Yu, J.

2002-01-01

The mechanical properties of the interfaces of two families of chemical vapor infiltration SiC/SiC composites, advanced Tyranno-SA and Hi-Nicalon fibers reinforced SiC/SiC composites with various carbon and SiC/C interlayers, were investigated by single fiber push-out/push-back tests. Interfacial debonding and fibers sliding mainly occurred adjacent to the first carbon layer on the fibers. The interfacial debonding strengths and frictional stresses for both Tyranno-SA/SiC and Hi-Nicalon/SiC composites were correlated with the first carbon layer thickness. Tyranno-SA/SiC composites exhibited much larger interfacial frictional stresses compared to Hi-Nicalon/SiC composites. This was assumed to be mainly contributed by the rather rough surface of the Tyranno-SA fiber

Magnetic Origin of Black Hole Winds Across the Mass Scale

Science.gov (United States)

Fukumura, Keigo; Kazanas, Demosthenes; Shrader, Chris; Behar, Ehud; Tombesi, Francesco; Contopoulos, Ioannis

2017-01-01

Black hole accretion disks appear to produce invariably plasma outflows that result in blue-shifted absorption features in their spectra. The X-ray absorption-line properties of these outflows are quite diverse, ranging in velocity from non-relativistic (approx. 300 km/sec) to sub-relativistic (approx. 0.1c where c is the speed of light) and a similarly broad range in the ionization states of the wind plasma. We report here that semi-analytic, self-similar magnetohydrodynamic (MHD) wind models that have successfully accounted for the X-ray absorber properties of supermassive black holes, also fit well the high-resolution X-ray spectrum of the accreting stellar-mass black hole, GRO J1655-40. This provides an explicit theoretical argument of their MHD origin (aligned with earlier observational claims) and supports the notion of a universal magnetic structure of the observed winds across all known black hole sizes.

Management of C2-C3 fracture subluxation by anterior cervical approach and C2-C3 trans-cortical screw placement

Directory of Open Access Journals (Sweden)

Agrawal Amit

2018-03-01

Full Text Available Cervical spine injuries are the major cause of morbidity and mortality in trauma victims. Upper cervical spine injuries account for about 24% of acute fractures and dislocations and one third of fractures occur at the level of C2, while one half of injuries occur at the C6 or C7 levels. In contrast to this approach we used the transverse cervical, platysma splitting incision at a lower (C3-C4 disc to expose the upper cervical spine particularly lower border of C3 (entry point for the screw.

Effective modern C++ 42 specific ways to improve your use of C++11 and C++14

CERN Document Server

Meyers, Scott

2015-01-01

At first glance, C++11 and C++14 are defined by the new features they introduce, e.g., auto type declarations, move semantics, lambda expressions, and concurrency support. Information on these features is easy to come by, but learning to apply them effectively (such that the resulting software is correct, efficient, maintainable, and portable) is more challenging. That’s the role of this book. It describes how to write effective software using C++11 and C++14, i.e., using modern C++. Topics include: * The pros and cons of uniform initialization, noexcept specifications, perfect forwarding, and smart pointer make functions. * The relationships among std::move, std::forward, rvalues references, and universal references. * The most effective forms of lambda capture. * How best practices in “old” C++ programming (i.e., C++98) require revision for modern C++. Effective Modern C++ follows the proven format of Scott Meyers’ earlier Effective books (Effective C++, More Effective C++, and Effective STL), but c...

On the sintering behaviour of steel bonded TiC-Cr3C2 and TiC-Cr3C2-WC mixed carbides

International Nuclear Information System (INIS)

Stojanov, L.G.; Exner, H.E.

1978-01-01

Powder mixtures of TiC+Cr 3 C 2 and TiC+Cr 3 C 2 + WC were hot pressed to nearly full density. The lattice parameter of the resulting cubic mixed crystal decreases linearly with increasing additions of Cr 3 C 2 and (Cr 3 C 2 +WC 1:1). Microhardness increases with Cr 3 C 2 content up to 20 wt.%. By addition of WC, microhardness is increased further and reaches a maximum value of approx. 38 000 MN/m 2 for 20 wt.% Cr 3 C 2 and 20 wt.% WC. From these solid solutions powder compositions of Ferro-TiC type were produced by milling with 55 wt.% Fe and 0.4 wt.% C. The sintering behaviour of these powders was studied in a vacuum dilatometer. The pronounced increase of shrinkage by Cr 3 C 2 and higher amounts of Cr 3 C 2 +WC dissolved in TiC previous to binder phase melting is attributed to the increased solubility of the carbide in solid iron. Presintering at 700 0 C in hydrogen has a negative influence on sintering activity and requires much higher temperatures for complete densification during subsequent vacuum sintering. (orig.) [de

Irradiation effect on Nite-SiC/SiC composites

International Nuclear Information System (INIS)

Hinoki, T.; Choi, Y.B.; Kohyama, A.; Ozawa, K.

2007-01-01

Full text of publication follows: Silicon carbide (SiC) and SiC composites are significantly attractive materials for nuclear application in particular due to exceptional low radioactivity, excellent high temperature mechanical properties and chemical stability. Despite of the excellent potential of SiC/SiC composites, the prospect of industrialization has not been clear mainly due to the low productivity and the high material cost. Chemical vapor infiltration (CVI) method can produce the excellent SiC/SiC composites with highly crystalline and excellent mechanical properties. It has been reported that the high purity SiC/SiC composites reinforced with highly crystalline fibers and fabricated by CVI method is very stable to neutron irradiation. However the production cost is high and it is difficult to fabricate thick and dense composites by CVI method. The novel processing called Nano-powder Infiltration and Transient Eutectic Phase (NITE) Processing has been developed based on the liquid phase sintering (LPS) process modification. The NITE processing can achieve both the excellent material quality and the low processing cost. The productivity of the processing is also excellent, and various kinds of shape and size of SiC/SiC composites can be produced by the NITE processing. The NITE processing can form highly crystalline matrix, which is requirement for nuclear application. The objective of this work is to understand irradiation effect of the NITESiC/SiC composites. The SiC/SiC composites used were reinforced with high purity SiC fibers, Tyranno TM SA and fabricated by the NITE method. The NITE-SiC/SiC composite bars and reference monolithic SiC bars fabricated by CVI and NITE were irradiated at up to 1.0 dpa and 600-1000 deg. C at JMTR, Japan. Mechanical properties of non-irradiated and irradiated NITESiC/ SiC composites bars were evaluated by tensile tests. Monolithic SiC bars were evaluated by flexural tests. The fracture surface was examined by SEM. Ultimate

Sodium doping in copper-phthalocyanine/C{sub 60} heterojunction for organic photovoltaic applications

Energy Technology Data Exchange (ETDEWEB)

Chen, Hui-Ju; Wu, Hsuan-Ta; Hung, Kuang-Teng; Fu, Sheng-Wen [Department of Electrical Engineering, National Cheng Kung University, Tainan, 70101, Taiwan (China); Shih, Chuan-Feng, E-mail: cfshih@mail.ncku.edu.tw [Department of Electrical Engineering, National Cheng Kung University, Tainan, 70101, Taiwan (China); Center for Micro/Nano Science and Technology, National Cheng Kung University, Tainan, 70101, Taiwan (China)

2013-10-01

Sodium was incorporating at the copper-phthalocyanine (CuPc)/C{sub 60} interface in CuPc/C{sub 60}-based small-molecular solar cells to enhance their power conversion efficiency. C{sub 60} was deposited on slightly sodium-doped CuPc. Post-annealing improved the cell properties. Post-annealing doubled the conversion efficiency of the least sodium-doped devices (75 °C, 40 min). The electron/hole mobility ratio gradually approached unity as the annealing time increased, indicating that a reduction in the space charge accumulation was the main cause of the increase of the short-circuit current. The mechanism of enhancement of carrier transport by annealing was investigated by making capacitance–voltage measurements and performing corresponding depth-profile analyses. - Highlights: • Incorporate Na at copper-phthalocyanine/C{sub 60} interface • Annealing importantly improved the cell efficiency of Na-doped devices. • Change in the carrier mobility and concentration was investigated.

Black holes: a slanted overview

International Nuclear Information System (INIS)

Vishveshwara, C.V.

1988-01-01

The black hole saga spanning some seventy years may be broadly divided into four phases, namely, (a) the dark ages when little was known about black holes even though they had come into existence quite early through the Schwarzschild solution, (b) the age of enlightenment bringing in deep and prolific discoveries, (c) the age of fantasy that cast black holes in all sorts of extraordinary roles, and (d) the golden age of relativistic astrophysics - to some extent similar to Dirac's characterisation of the development of quantum theory - in which black holes have been extensively used to elucidate a number of astrophysical phenomena. It is impossible to give here even the briefest outline of the major developments in this vast area. We shall only attempt to present a few aspects of black hole physics which have been actively pursued in the recent past. Some details are given in the case of those topics that have not found their way into text books or review articles. (author)

Studying of the function of expected ABC transporter Rv1458c-Rv1457c-Rv1456c in mycobacteria; Studium funkcie predpokladaneho ABC transportera Rv1458c-Rv1457c-Rv1456c v mykobakteriach

Energy Technology Data Exchange (ETDEWEB)

Sarkan, M; Mikusova, K; Kordulakova, J [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra biochemie, 84215 Bratislava (Slovakia)

2012-04-25

The bacterium Mycobacterium tuberculosis - the originator of tuberculosis in humans - is characterized by a complex cell wall, which is responsible for a high bacteria resistant to adverse external environmental conditions, as well as to the common antibiotics. The structure of the cell wall components and enzymes involved into its biosynthesis are relatively well described, but there is no information on the transfer of intermediate products of its biosynthetic across the plasmatic membrane. Orthologues of genes rv1459c-rv1458c-rv1457c-rv1456c of M. tuberculosis are in the same configuration in genomes of all previously sequenced mycobacterial strains. Rv1459c gene encodes a probable glycosyltransferases and genes rv1458c, rv1457c rv1456c code nucleotide binding and transmembrane subunits of expected ABC transporter. In our work we focused on the study of the function of expected ABC transporter Rv1458c-Rv1457c-Rv1456c, through analysis of phenotypes of strains M. Smegmatis. They have orthologues of genes encoding the transmembrane subunits of this transporter suspended by fragment encoding resistance to kanamycin. (authors)

Do stringy corrections stabilize colored black holes?

International Nuclear Information System (INIS)

Kanti, P.; Winstanley, E.

2000-01-01

We consider hairy black hole solutions of Einstein-Yang-Mills-dilaton theory, coupled to a Gauss-Bonnet curvature term, and we study their stability under small, spacetime-dependent perturbations. We demonstrate that stringy corrections do not remove the sphaleronic instabilities of colored black holes with the number of unstable modes being equal to the number of nodes of the background gauge function. In the gravitational sector and in the limit of an infinitely large horizon, colored black holes are also found to be unstable. Similar behavior is exhibited by magnetically charged black holes while the bulk of neutral black holes are proved to be stable under small, gauge-dependent perturbations. Finally, electrically charged black holes are found to be characterized only by the existence of a gravitational sector of perturbations. As in the case of neutral black holes, we demonstrate that for the bulk of electrically charged black holes no unstable modes arise in this sector. (c) 2000 The American Physical Society

Quintessence background for 5D Einstein-Gauss-Bonnet black holes

Energy Technology Data Exchange (ETDEWEB)

Ghosh, Sushant G. [University of KwaZulu-Natal, Astrophysics and Cosmology Research Unit, School of Mathematics, Statistics and Computer Science, Durban (South Africa); Centre for Theoretical Physics, New Delhi (India); Amir, Muhammed [Centre for Theoretical Physics, New Delhi (India); Maharaj, Sunil D. [University of KwaZulu-Natal, Astrophysics and Cosmology Research Unit, School of Mathematics, Statistics and Computer Science, Durban (South Africa)

2017-08-15

As we know that the Lovelock theory is an extension of the general relativity to the higher-dimensions, in this theory the first- and the second-order terms correspond to general relativity and the Einstein-Gauss-Bonnet gravity, respectively. We obtain a 5D black hole solution in Einstein-Gauss-Bonnet gravity surrounded by the quintessence matter, and we also analyze their thermodynamical properties. Owing to the quintessence corrected black hole, the thermodynamic quantities have also been corrected except for the black hole entropy, and a phase transition is achievable. The phase transition for the thermodynamic stability is characterized by a discontinuity in the specific heat at r = r{sub C}, with the stable (unstable) branch for r < (>) r{sub C}. (orig.)

Dicty_cDB: CHH542 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 35.1 UCRCS08_0003L02_f Parent Washington Navel Orange Callus cDNA Library UCRCS08...cDNA library - UCR Poncirus trifoliata cDNA clone UCRPT01_02_C04, mRNA sequence. 40 0.002 2 CV714035 |CV7140

Borehole Summary Report for Core Hole C4998 – Waste Treatment Plant Seismic Boreholes Project

Energy Technology Data Exchange (ETDEWEB)

Barnett, D. BRENT; Garcia, Benjamin J.

2006-12-15

Seismic borehole C4998 was cored through the upper portion of the Columbia River Basalt Group and Ellensburg Formation to provide detailed lithologic information and intact rock samples that represent the geology at the Waste Treatment Plant. This report describes the drilling of borehole C4998 and documents the geologic data collected during the drilling of the cored portion of the borehole.

Measurements of psi -> K-Lambda(Xi)over-bar(+) + c.c. and psi -> gamma K-Lambda(Xi)over-bar(+) + c.c.

NARCIS (Netherlands)

Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Duan, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

2015-01-01

Using a sample of 1.06 x 10(8) psi(3686) events produced in e(+)e(-) collisions at root s = 3.686 GeV and collected with the BESIII detector at the BEPCII collider, we present studies of the decays psi(3686) -> K-Lambda(Xi) over bar (+) + c.c. and psi(3686) -> gamma K-Lambda(Xi) over bar (+) + c.c.

$\\chi^{\\vphantom\\dagger}_{c0}(3915)$ As the Lightest $c\\bar c s \\bar s$ State

CERN Document Server

Lebed, Richard F.

2016-05-23

The state $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ has recently been demoted by the Particle Data Group from its previous status as the conventional $c\\bar c$ $2 {}^3P_0$ state, largely due to the absence of expected $D\\bar D$ decays. We propose that $\\chi^{\\vphantom\\dagger}_{c0}(3915)$ is actually the lightest $c\\bar c s \\bar s$ state, and calculate the spectrum of such states using the diquark model, identifying many of the observed charmoniumlike states that lack open-charm decay modes as $c\\bar c s \\bar s$. Among other results, we argue that $Y(4140)$ is a $J^{PC} = 1^{++}$ $c\\bar c s \\bar s$ state that has been not been seen in two-photon fusion largely as a consequence of the Landau-Yang theorem.

Isomerisation of c4-c6 aldoses with zeolites

DEFF Research Database (Denmark)

2014-01-01

The present invention relates to isomerization of C4-C6 aldoses to their corresponding C4-C6 ketoses. In particular, the invention concerns isomerization of C4-C6 aldoses over solid zeolite catalysts free of any metals other than aluminum, in the presence of suitable solvent(s) at suitable elevated...... temperatures. C6 and C5 aldose sugars such as glucose and xylose, which are available in large amounts from biomass precursors, are isomerized to fructose and xylulose respectively, in a one or two-step process over inexpensive commercially available zeolite catalysts, containing aluminum as the only metal...

Review of the thermodynamics of the U--C, Pu--C, and U--Pu--C systems

International Nuclear Information System (INIS)

Tetenbaum, M.; Sheth, A.; Olson, W.

1975-06-01

Thermodynamic properties such as enthalpy, heat capacity, entropy, heat and free energy of formation, and vaporization behavior are presented for the U--C, Pu--C, and U--Pu--C systems. These properties are of interest to scientists and engineers involved in the expanding field of advanced fuel LMFBR systems. The information on these systems has been derived largely from the discussions of the IAEA Panel on the assessment of thermodynamic properties of the U--C, Pu--C, and U--Pu--C systems. (U.S.)

Structural differences between glycosylated, disulfide-linked heterodimeric Knob-into-Hole Fc fragment and its homodimeric Knob-Knob and Hole-Hole side products.

Science.gov (United States)

Kuglstatter, A; Stihle, M; Neumann, C; Müller, C; Schaefer, W; Klein, C; Benz, J

2017-09-01

An increasing number of bispecific therapeutic antibodies are progressing through clinical development. The Knob-into-Hole (KiH) technology uses complementary mutations in the CH3 region of the antibody Fc fragment to achieve heavy chain heterodimerization. Here we describe the X-ray crystal structures of glycosylated and disulfide-engineered heterodimeric KiH Fc fragment and its homodimeric Knob-Knob and Hole-Hole side products. The heterodimer structure confirms the KiH design principle and supports the hypothesis that glycosylation stabilizes a closed Fc conformation. Both homodimer structures show parallel Fc fragment architectures, in contrast to recently reported crystal structures of the corresponding aglycosylated Fc fragments which in the absence of disulfide mutations show an unexpected antiparallel arrangement. The glycosylated Knob-Knob Fc fragment is destabilized as indicated by variability in the relative orientation of its CH3 domains. The glycosylated Hole-Hole Fc fragment shows an unexpected intermolecular disulfide bond via the introduced Y349C Hole mutation which results in a large CH3 domain shift and a new CH3-CH3 interface. The crystal structures of glycosylated, disulfide-linked KiH Fc fragment and its Knob-Knob and Hole-Hole side products reported here will facilitate further design of highly efficient antibody heterodimerization strategies. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

BURNER RIG TESTING OF A500 C/SiC

Science.gov (United States)

2018-03-17

AFRL-RX-WP-TR-2018-0071 BURNER RIG TESTING OF A500® C /SiC Larry P. Zawada Universal Technology Corporation Jennifer Pierce UDRI...TITLE AND SUBTITLE BURNER RIG TESTING OF A500® C /SiC 5a. CONTRACT NUMBER In-House 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62102F 6...test program characterized the durability behavior of A500® C /SiC ceramic matrix composite material at room and elevated temperature. Specimens were

Acute intracranial bleeding and recurrence after bur hole craniostomy for chronic subdural hematoma.

Science.gov (United States)

Pang, Chang Hwan; Lee, Soo Eon; Kim, Chang Hyeun; Kim, Jeong Eun; Kang, Hyun-Seung; Park, Chul-Kee; Paek, Sun Ha; Kim, Chi Heon; Jahng, Tae-Ahn; Kim, Jin Wook; Kim, Yong Hwy; Kim, Dong Gyu; Chung, Chun Kee; Jung, Hee-Won; Yoo, Heon

2015-07-01

There is inconsistency among the perioperative management strategies currently used for chronic subdural hematoma (cSDH). Moreover, postoperative complications such as acute intracranial bleeding and cSDH recurrence affect clinical outcome of cSDH surgery. This study evaluated the risk factors associated with acute intracranial bleeding and cSDH recurrence and identified an effective perioperative strategy for cSDH patients. A retrospective study of patients who underwent bur hole craniostomy for cSDH between 2008 and 2012 was performed. A consecutive series of 303 cSDH patients (234 males and 69 females; mean age 67.17 years) was analyzed. Postoperative acute intracranial bleeding developed in 14 patients (4.57%) within a mean of 3.07 days and recurrence was observed in 37 patients (12.21%) within a mean of 31.69 days (range 10-104 days) after initial bur hole craniostomy. The comorbidities of hematological disease and prior shunt surgery were clinical factors associated with acute bleeding. There was a significant risk of recurrence in patients with diabetes mellitus, but recurrence did not affect the final neurological outcome (p = 0.776). Surgical details, including the number of operative bur holes, saline irrigation of the hematoma cavity, use of a drain, and type of postoperative ambulation, were not significantly associated with outcome. However, a large amount of drainage was associated with postoperative acute bleeding. Bur hole craniostomy is an effective surgical procedure for initial and recurrent cSDH. Patients with hematological disease or a history of prior shunt surgery are at risk for postoperative acute bleeding; therefore, these patients should be carefully monitored to avoid overdrainage. Surgeons should consider informing patients with diabetes mellitus that this comorbidity is associated with an increased likelihood of recurrence.

Charged topological black hole pair creation

International Nuclear Information System (INIS)

Mann, R.B.

1998-01-01

I examine the pair creation of black holes in space-times with a cosmological constant of either sign. I consider cosmological C-metrics and show that the conical singularities in this metric vanish only for three distinct classes of black hole metric, two of which have compact event horizons on each spatial slice. One class is a generalization of the Reissner-Nordstroem (anti-)de Sitter black holes in which the event horizons are the direct product of a null line with a 2-surface with topology of genus g. The other class consists of neutral black holes whose event horizons are the direct product of a null conoid with a circle. In the presence of a domain wall, black hole pairs of all possible types will be pair created for a wide range of mass and charge, including even negative mass black holes. I determine the relevant instantons and Euclidean actions for each case. (orig.)

χ_{c1} and χ_{c2} Resonance Parameters with the Decays χ_{c1,c2}→J/ψμ^{+}μ^{-}.

Science.gov (United States)

Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Luchinsky, A; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S

2017-12-01

The decays χ_{c1}→J/ψμ^{+}μ^{-} and χ_{c2}→J/ψμ^{+}μ^{-} are observed and used to study the resonance parameters of the χ_{c1} and χ_{c2} mesons. The masses of these states are measured to be m(χ_{c1})=3510.71±0.04(stat)±0.09(syst)  MeV and m(χ_{c2})=3556.10±0.06(stat)±0.11(syst)  MeV, where the knowledge of the momentum scale for charged particles dominates the systematic uncertainty. The momentum-scale uncertainties largely cancel in the mass difference m(χ_{c2})-m(χ_{c1})=45.39±0.07(stat)±0.03(syst)  MeV. The natural width of the χ_{c2} meson is measured to be Γ(χ_{c2})=2.10±0.20(stat)±0.02(syst)  MeV. These results are in good agreement with and have comparable precision to the current world averages.

Transport properties at 3C-SiC interfaces

OpenAIRE

Eriksson, Gustav Jens Peter

2011-01-01

For years cubic (3C) silicon carbide (SiC) has been believed to be a very promising wide bandgap semiconductor for high frequency and high power electronics. However, 3C-SiC is fraught with large concentrations of various defects, which have so far hindered the achievement of the predicted properties at a macroscopic level. These defects have properties that are inherently nanoscale and that will have a strong influence on the electrical behavior of the material, particularly at interfaces c...

Strong-coupling superconductivity in the two-dimensional t-J model supplemented by a hole-phonon interaction

International Nuclear Information System (INIS)

Sherman, A.; Schreiber, M.

1995-01-01

We use the Eliashberg formalism for calculating T c in a model of cuprate perovskites with pairing mediated by both magnons and apex-oxygen vibrations. The influence of strong correlations on the energy spectrum is taken into account in the spin-wave approximation. It is shown that the hole-magnon interaction alone cannot yield high T c . But together with a moderate hole-phonon interaction it does lead to d-wave superconductivity at temperatures and hole concentrations observed in cuprates. High T c are connected with a large density of states due to extended Van Hove singularities, a conformity of the two interactions for the d symmetry, and high phonon frequencies

Porous SiC/SiC composites development for industrial application

International Nuclear Information System (INIS)

Maeta, S.; Hinoki, T.

2014-01-01

Silicon carbide (SiC) is promising structural materials in nuclear fields due to an excellent irradiation resistance and low activation characteristics. Conventional SiC fibers reinforced SiC matrix (SiC/SiC composites) fabricated by liquid phase sintering (LPS-SiC/SiC composites) have been required high cost and long processing time. And microstructure and mechanical property data of finally obtained LPS-SiC/SiC composites are easily scattered, because quality of the composites depend on personal skill. Thus, conventional LPS-SiC/SiC composites are inadequate for industrial use. In order to overcome these issues, the novel “porous SiC/SiC composites” have been developed by means of liquid phase sintering fabrication process. The composites consist of porous SiC matrix and SiC fibers without conventional carbon interfacial layer. The composites don’t have concerns of the degradation interfacial layer at the severe accident. Porous SiC/SiC composites preform was prepared with a thin sheet shape of SiC, sintering additives and carbon powder mixture by tape casting process which was adopted because of productive and high yielding rate fabrication process. The preform was stacked with SiC fibers and sintered in hot-press at the high temperature in argon environment. The sintered preform was decarburized obtain porous matrix structure by heat-treatment in air. Moreover, mechanical property data scattering of the obtained porous SiC/SiC composites decreased. In the flexural test, the porous SiC/SiC composites showed pseudo-ductile behavior with sufficient strength even after heat treatment at high temperature in air. From these conclusions, it was proven that porous SiC/SiC composites were reliable material at severe environment such as high temperature in air, by introducing tape casting fabrication process that could produce reproducible materials with low cost and simple way. Therefore development of porous SiC/SiC composites for industrial application was

Mechanical behavior of SiCf/SiC composites with alternating PyC/SiC multilayer interphases

International Nuclear Information System (INIS)

Yu, Haijiao; Zhou, Xingui; Zhang, Wei; Peng, Huaxin; Zhang, Changrui

2013-01-01

Highlights: ► Superior combination of flexural strength and fracture toughness of the 3D SiC/SiC composite was achieved by interface tailoring. ► Resulted composite possesses a much higher flexural strength and fracture toughness than its counterparts in literatures. ► Mechanisms that PyC/SiC multilayer coatings improve the mechanical properties were illustrated. -- Abstract: In order to tailor the fiber–matrix interface of continuous silicon carbide fiber reinforced silicon carbide (SiC f /SiC) composites for improved fracture toughness, alternating pyrolytic carbon/silicon carbide (PyC/SiC) multilayer coatings were applied to the KD-I SiC fibers using chemical vapor deposition (CVD) method. Three dimensional (3D) KD-I SiC f /SiC composites reinforced by these coated fibers were fabricated using a precursor infiltration and pyrolysis (PIP) process. The interfacial characteristics were determined by the fiber push-out test and microstructural examination using scanning electron microscopy (SEM). The effect of interface coatings on composite mechanical properties was evaluated by single-edge notched beam (SENB) test and three-point bending test. The results indicate that the PyC/SiC multilayer coatings led to an optimum interfacial bonding between fibers and matrix and greatly improved the fracture toughness of the composites.

Efficient C/C++ programming smaller, faster, better

CERN Document Server

Heller, Steve

1994-01-01

Efficient C/C++ Programming describes a practical, real-world approach to efficient C/C++ programming. Topics covered range from how to save storage using a restricted character set and how to speed up access to records by employing hash coding and caching. A selective mailing list system is used to illustrate rapid access to and rearrangement of information selected by criteria specified at runtime.Comprised of eight chapters, this book begins by discussing factors to consider when deciding whether a program needs optimization. In the next chapter, a supermarket price lookup system is used to

The nature of holes in carbon doped titania

International Nuclear Information System (INIS)

Rabani, J.

2009-01-01

Complete text of publication follows. It is well known that semiconductors (SC) produce conduction band electrons and valence band holes upon band gap excitation. The mobile species become quickly trapped at the surface. The most popular semiconductor is titanium dioxide, where the reactive surface holes (h T + ) have been recently identified as surface -O ·- (or - · OH depending on pH) covalently linked to Ti atoms. Most organic compounds are oxidized by the holes. These holes react similarly to · OH radicals and hence there is some resemblance between the photochemistry of TiO 2 and radiolysis, although in the case of TiO 2 the reactions take place on the surface. Titanium dioxide has many favorable properties for application as a photocatalyst for decontamination of water from organic materials, but is lacking absorption in the visible range, where photons are relatively cheap. In addition the quantum yield of reaction with solutes in water is too low under conditions required by industrial water treatment due to the competition between electron-hole recombination and localization at the surface. The discovery that doping of TiO 2 leads to extension of the photoactive region from UV to visible light has remarkably increased the interest in such doped TiO 2 , and a large number of materials have been developed on the basis of this strategy. We'll focus on carbon doped TiO 2 where the visible photoactivity is attributed to introduction of intragap localized carbon states or organic segments. Visible photolysis of aerated carbon doped TiO 2 (C-TiO 2 ) aqueous suspensions induces oxidation of the model compound used, namely methanol. The effects of absorbed light density, added hydrogen peroxide and added catalase on the rate of HCHO formation have been studied. The mechanism has been shown to involve oxidation of CH 3 OH by surface trapped holes, although these holes have lower energy than those formed upon UV photolysis of undoped TiO 2 . The C-TiO 2 electrons

SiC/SiC Cladding Materials Properties Handbook

Energy Technology Data Exchange (ETDEWEB)

Snead, Mary A. [Brookhaven National Lab. (BNL), Upton, NY (United States); Katoh, Yutai [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Koyanagi, Takaaki [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Singh, Gyanender P. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2017-08-01

When a new class of material is considered for a nuclear core structure, the in-pile performance is usually assessed based on multi-physics modeling in coordination with experiments. This report aims to provide data for the mechanical and physical properties and environmental resistance of silicon carbide (SiC) fiber–reinforced SiC matrix (SiC/SiC) composites for use in modeling for their application as accidenttolerant fuel cladding for light water reactors (LWRs). The properties are specific for tube geometry, although many properties can be predicted from planar specimen data. This report presents various properties, including mechanical properties, thermal properties, chemical stability under normal and offnormal operation conditions, hermeticity, and irradiation resistance. Table S.1 summarizes those properties mainly for nuclear-grade SiC/SiC composites fabricated via chemical vapor infiltration (CVI). While most of the important properties are available, this work found that data for the in-pile hydrothermal corrosion resistance of SiC materials and for thermal properties of tube materials are lacking for evaluation of SiC-based cladding for LWR applications.

Speed of gravitational waves and black hole hair

Science.gov (United States)

Tattersall, Oliver J.; Ferreira, Pedro G.; Lagos, Macarena

2018-04-01

The recent detection of GRB 170817A and GW170817 constrains the speed of gravity waves cT to be that of light, which severely restricts the landscape of modified gravity theories that impact the cosmological evolution of the Universe. In this work, we investigate the presence of black hole hair in the remaining viable cosmological theories of modified gravity that respect the constraint cT=1 . We focus mainly on scalar-tensor theories of gravity, analyzing static, asymptotically flat black holes in Horndeski, Beyond Horndeski, Einstein-scalar-Gauss-Bonnet, and Chern-Simons theories. We find that in all of the cases considered here, theories that are cosmologically relevant and respect cT=1 do not allow for hair, or have negligible hair. We further comment on vector-tensor theories including Einstein-Yang-Mills, Einstein-Aether, and generalized Proca theories, as well as bimetric theories.

Identifying semiconductors by d.c. ionization conductivity

International Nuclear Information System (INIS)

Derenzo, Stephen E.; Bourret-Courchesne, Edith; James, Floyd J.; Klintenberg, Mattias K.; Porter-Chapman, Yetta; Wang, Jie; Weber, Marvin J.

2006-01-01

We describe a method for identifying semiconductor radiation detector materials based on the mobility of internally generated electrons and holes. It was designed for the early stages of exploration, when samples are not available as single crystals, but as crystalline powders. Samples are confined under pressure in an electric field and the increase in current resulting from exposure to a high-intensity source of 60Co gamma rays (i.e. the ionization current) is measured. We find that for known semiconductors the d.c. ionization current depends on voltage according to the Hecht equation, and for known insulators the d.c. ionization current is below our detection limits. This shows that the method can identify semiconductors in spite of significant carrier trapping. Using this method, we have determined that BiOI, PbIF,BiPbO2Cl, BiPbO2Br, BiPbO2I, Bi2GdO4Cl, Pb3O2I2, and Pb5O4I2 are semiconductors

Nanosized f.c.c. thallium inclusions in aluminium

International Nuclear Information System (INIS)

Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.

1993-01-01

Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)

Microscopic investigation of the 12C + 12C interaction

International Nuclear Information System (INIS)

Baye, D.; Pecher, N.; Brussels Univ.

1982-01-01

The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)

Kinetics for exchange of imino protons in the d(C-G-C-G-A-A-T-T-C-G-C-G) double helix and in two similar helices that contain a G . T base pair, d(C-G-T-G-A-A-T-T-C-G-C-G), and an extra adenine, d(C-G-C-A-G-A-A-T-T-C-G-C-G).

Science.gov (United States)

Pardi, A; Morden, K M; Patel, D J; Tinoco, I

1982-12-07

The relaxation lifetimes of imino protons from individual base pairs were measured in (I) a perfect helix, d(C-G-C-G-A-A-T-T-C-G-C-G), (II) this helix with a G . C base pair replaced with a G . T base pair, d(C-G-T-G-A-A-T-T-C-G-C-G), and (III) the perfect helix with an extra adenine base in a mismatch, d(C-G-C-A-G-A-A-T-T-C-G-C-G). The lifetimes were measured by saturation recovery proton nuclear magnetic resonance experiments performed on the imino protons of these duplexes. The measured lifetimes of the imino protons were shown to correspond to chemical exchange lifetimes at higher temperatures and spin-lattice relaxation times at lower temperatures. Comparison of the lifetimes in these duplexes showed that the destabilizing effect of the G . T base pair in II affected the opening rate of only the nearest-neighbor base pairs. For helix III, the extra adenine affected the opening rates of all the base pairs in the helix and thus was a larger perturbation for opening of the base pairs than the G . T base pair. The temperature dependence of the exchange rates of the imino proton in the perfect helix gives values of 14-15 kcal/mol for activation energies of A . T imino protons. These relaxation rates were shown to correspond to exchange involving individual base pair opening in this helix, which means that one base-paired imino proton can exchange independent of the others. For the other two helices that contain perturbations, much larger activation energies for exchange of the imino protons were found, indicating that a cooperative transition involving exchange of at least several base pairs was the exchange mechanism of the imino protons. The effects of a perturbation in a helix on the exchange rates and the mechanisms for exchange of imino protons from oligonucleotide helices are discussed.

Enhanced defects recombination in ion irradiated SiC

International Nuclear Information System (INIS)

Izzo, G.; Litrico, G.; Grassia, F.; Calcagno, L.; Foti, G.

2010-01-01

Point defects induced in SiC by ion irradiation show a recombination at temperatures as low as 320 K and this process is enhanced after running current density ranging from 80 to 120 A/cm 2 . Ion irradiation induces in SiC the formation of different defect levels and low-temperature annealing changes their concentration. Some levels (S 0 , S x and S 2 ) show a recombination and simultaneously a new level (S 1 ) is formed. An enhanced recombination of defects is besides observed after running current in the diode at room temperature. The carriers introduction reduces the S 2 trap concentration, while the remaining levels are not modified. The recombination is negligible up to a current density of 50 A/cm 2 and increases at higher current density. The enhanced recombination of the S 2 trap occurs at 300 K, which otherwise requires a 400 K annealing temperature. The process can be related to the electron-hole recombination at the associated defect.

High efficiency 4H-SiC betavoltaic power sources using tritium radioisotopes

Energy Technology Data Exchange (ETDEWEB)

Thomas, Christopher; Portnoff, Samuel [Widetronix Corp., Ithaca, New York 14850 (United States); Spencer, M. G. [Department of Electrical and Computer Engineering, Cornell University, Ithaca, New York 14850 (United States)

2016-01-04

Realization of an 18.6% efficient 4H-silicon carbide (4H-SiC) large area betavoltaic power source using the radioisotope tritium is reported. A 200 nm 4H-SiC P{sup +}N junction is used to collect high-energy electrons. The electron source is a titanium tritide (TiH{sup 3}{sub x}) foil, or an integrated titanium tritide region formed by the diffusion of tritium into titanium. The specific activity of the source is directly measured. Dark current measured under short circuit conditions was less than 6.1 pA/cm{sup 2}. Samples measured with an external tritium foil produced an open circuit voltage of 2.09 V, short circuit current of 75.47 nA/cm{sup 2}, fill factor of 0.86, and power efficiency of 18.6%. Samples measured with an integrated source produced power efficiencies of 12%. Simulations were done to determine the beta spectrum (modified by self absorption) exiting the source and the electron hole pair generation function in the 4H-SiC. The electron-hole pair generation function in 4H-SiC was modeled as a Gaussian distribution, and a closed form solution of the continuity equation was used to analyze the cell performance. The effective surface recombination velocity in our samples was found to be 10{sup 5}–10{sup 6 }cm/s. Our analysis demonstrated that the surface recombination dominates the performance of a tritium betavoltaic device but that using a thin P{sup +}N junction structure can mitigate some of the negative effects.

CO-Dark Star Formation and Black Hole Activity in 3C 368 at z = 1.131: Coeval Growth of Stellar and Supermassive Black Hole Masses

Energy Technology Data Exchange (ETDEWEB)

Lamarche, C.; Stacey, G.; Riechers, D.; Vishwas, A. [Department of Astronomy, Cornell University, Ithaca, NY 14853 (United States); Brisbin, D. [Núcleo de Astronomía, Facultad de Ingeniería y Ciencias, Universidad Diego Portales, Avenida Ejército 441, 8370191 Santiago (Chile); Ferkinhoff, C. [Department of Physics, Winona State University, Winona, MN, 55987 (United States); Hailey-Dunsheath, S. [California Institute of Technology, Mail Code 301-17, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Nikola, T.; Spoon, H. [Cornell Center for Astrophysics and Planetary Science, Cornell University, Ithaca, NY 14853 (United States); Sharon, C. E., E-mail: cjl272@cornell.edu [Department of Physics and Astronomy, McMaster University, 1280 Main Street West, Hamilton, ON L85-4M1 (Canada)

2017-02-10

We present the detection of four far-infrared fine-structure oxygen lines, as well as strong upper limits for the CO(2–1) and [N ii] 205 μ m lines, in 3C 368, a well-studied radio-loud galaxy at z = 1.131. These new oxygen lines, taken in conjunction with previously observed neon and carbon fine-structure lines, suggest a powerful active galactic nucleus (AGN), accompanied by vigorous and extended star formation. A starburst dominated by O8 stars, with an age of ∼6.5 Myr, provides a good fit to the fine-structure line data. This estimated age of the starburst makes it nearly concurrent with the latest episode of AGN activity, suggesting a link between the growth of the supermassive black hole and stellar population in this source. We do not detect the CO(2–1) line, down to a level twelve times lower than the expected value for star-forming galaxies. This lack of CO line emission is consistent with recent star formation activity if the star-forming molecular gas has low metallicity, is highly fractionated (such that CO is photodissociated throughout much of the clouds), or is chemically very young (such that CO has not yet had time to form). It is also possible, although we argue it is unlikely, that the ensemble of fine-structure lines is emitted from the region heated by the AGN.

A comparative study of the mechanical and thermal properties of defective ZrC, TiC and SiC.

Science.gov (United States)

Jiang, M; Zheng, J W; Xiao, H Y; Liu, Z J; Zu, X T

2017-08-24

ZrC and TiC have been proposed to be alternatives to SiC as fuel-cladding and structural materials in nuclear reactors due to their strong radiation tolerance and high thermal conductivity at high temperatures. To unravel how the presence of defects affects the thermo-physical properties under irradiation, first-principles calculations based on density function theory were carried out to investigate the mechanical and thermal properties of defective ZrC, TiC and SiC. As compared with the defective SiC, the ZrC and TiC always exhibit larger bulk modulus, smaller changes in the Young's and shear moduli, as well as better ductility. The total thermal conductivity of ZrC and TiC are much larger than that of SiC, implying that under radiation environment the ZrC and TiC will exhibit superior heat conduction ability than the SiC. One disadvantage for ZrC and TiC is that their Debye temperatures are generally lower than that of SiC. These results suggest that further improving the Debye temperature of ZrC and TiC will be more beneficial for their applications as fuel-cladding and structural materials in nuclear reactors.

Electronic structure of C28, Pa at sign C28, and U at sign C28

International Nuclear Information System (INIS)

Zhao, K.; Pitzer, R.M.

1996-01-01

Electronic structure calculations, including relativistic core potentials and the spin-orbit interaction, have been carried out on the C 28 , Pa at sign C 28 , and U at sign C 28 species. Excitation energies, spin-orbit splittings, the electron affinity, and the ionization potential are computed for C 28 . The ground state of C 28 is described well by the Hartree-Fock wave functions, but other states are not. The computed electron affinity and ionization potential are similar to those of C 60 . Strong metal-cage binding is found for Pa at sign C 28 and U at sign C 28 , similar to that in U(C 8 H 8 ) 2 . The ground electronic states depend on the order of the lowest-energy cage π * and metal 5f orbitals, with (π * ) 1 and (π * ) 1 (5f) 1 found to be the ground electronic configurations for the two complexes. U at sign C 28 is found to be diamagnetic. 30 refs., 1 fig., 13 tabs

Dicty_cDB: VHJ195 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -B/AFN547Q.Seq.d/ 1342 0.0 SLE172 (SLE172Q) /CSM/SL/SLE1-C/SLE172Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...8502 ) Dictyostelium discoideum cDNA clone:dda28m11, 5' ... 839 0.0 2 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492...2597 ) Dictyostelium discoideum slug cDNA, clone SLD569. 113 2e-20 1 ( AU061182 ) Dictyostelium discoideum slug cDNA, clone SLD492

Rhodium-Catalyzed C-C Bond Formation via Heteroatom-Directed C-H Bond Activation

Energy Technology Data Exchange (ETDEWEB)

Colby, Denise; Bergman, Robert; Ellman, Jonathan

2010-05-13

Once considered the 'holy grail' of organometallic chemistry, synthetically useful reactions employing C-H bond activation have increasingly been developed and applied to natural product and drug synthesis over the past decade. The ubiquity and relative low cost of hydrocarbons makes C-H bond functionalization an attractive alternative to classical C-C bond forming reactions such as cross-coupling, which require organohalides and organometallic reagents. In addition to providing an atom economical alternative to standard cross - coupling strategies, C-H bond functionalization also reduces the production of toxic by-products, thereby contributing to the growing field of reactions with decreased environmental impact. In the area of C-C bond forming reactions that proceed via a C-H activation mechanism, rhodium catalysts stand out for their functional group tolerance and wide range of synthetic utility. Over the course of the last decade, many Rh-catalyzed methods for heteroatom-directed C-H bond functionalization have been reported and will be the focus of this review. Material appearing in the literature prior to 2001 has been reviewed previously and will only be introduced as background when necessary. The synthesis of complex molecules from relatively simple precursors has long been a goal for many organic chemists. The ability to selectively functionalize a molecule with minimal pre-activation can streamline syntheses and expand the opportunities to explore the utility of complex molecules in areas ranging from the pharmaceutical industry to materials science. Indeed, the issue of selectivity is paramount in the development of all C-H bond functionalization methods. Several groups have developed elegant approaches towards achieving selectivity in molecules that possess many sterically and electronically similar C-H bonds. Many of these approaches are discussed in detail in the accompanying articles in this special issue of Chemical Reviews. One approach

Search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c .

Science.gov (United States)

Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Kiese, P.; Kliemt, R.; Kloss, B.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Y. Y.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, J. J.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B. T.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.; Besiii Collaboration

2017-12-01

Using the data samples of (1310.6 ±7.2 )×106 J /ψ events and (448.1 ±2.9 )×106 ψ (3686 ) events collected with the BESIII detector, we search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c . No significant signals are observed and the corresponding upper limits on the branching fractions at the 90% confidence level are determined to be B (J /ψ →D0e+e-+c .c .)<8.5 ×10-8 and B (ψ (3686 )→D0e+e-+c .c .)<1.4 ×10-7 , respectively. Our limit on B (J /ψ →D0e+e-+c .c .) is more stringent by 2 orders of magnitude than the previous results, and B (ψ (3686 )→D0e+e-+c .c .) is measured for the first time.

Dicty_cDB: CHR636 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

Theoretical study of actinide monocarbides (ThC, UC, PuC, and AmC)

Science.gov (United States)

Pogány, Peter; Kovács, Attila; Visscher, Lucas; Konings, Rudy J. M.

2016-12-01

A study of four representative actinide monocarbides, ThC, UC, PuC, and AmC, has been performed with relativistic quantum chemical calculations. The two applied methods were multireference complete active space second-order perturbation theory (CASPT2) including the Douglas-Kroll-Hess Hamiltonian with all-electron basis sets and density functional theory with the B3LYP exchange-correlation functional in conjunction with relativistic pseudopotentials. Beside the ground electronic states, the excited states up to 17 000 cm-1 have been determined. The molecular properties explored included the ground-state geometries, bonding properties, and the electronic absorption spectra. According to the occupation of the bonding orbitals, the calculated electronic states were classified into three groups, each leading to a characteristic bond distance range for the equilibrium geometry. The ground states of ThC, UC, and PuC have two doubly occupied π orbitals resulting in short bond distances between 1.8 and 2.0 Å, whereas the ground state of AmC has significant occupation of the antibonding orbitals, causing a bond distance of 2.15 Å.

A simple, versatile, low-cost and remotely operated apparatus for [11C]acetate, [11C]choline, [11C]methionine and [11C]PIB synthesis

International Nuclear Information System (INIS)

Cheung Manki; Ho Chilai

2009-01-01

A simple, efficient and remotely operated synthesis apparatus for carrying out routine [ 11 C]carboxylation, on-column and bubbling [ 11 C]methylation was essential for reliable, day-to-day production of [ 11 C]-labelled PET radiopharmaceuticals. We developed an in-house apparatus specifically applied to the synthesis of [ 11 C]acetate, [ 11 C]choline, [ 11 C]methionine and 2-(4'-N-[ 11 C]methylaminophenyl)-6-hydroxybenzothiazole ([ 11 C]PIB), where high radiochemical purity (≥97%) and moderate radiochemical yields (18% for [ 11 C]PIB, 41-55% for the others) could be achieved. These findings provided evidence that this was a fast, versatile and reliable apparatus suitable for a PET/CT centre with limited financial budget and hot cell space for synthesis of [ 11 C]-labelled radiopharmaceuticals

11C-acetate PET imaging in patients with multiple sclerosis.

Directory of Open Access Journals (Sweden)

Kazushiro Takata

Full Text Available BACKGROUND: Activation of glial cells is a cardinal feature in multiple sclerosis (MS pathology, and acetate has been reported to be selectively uptaken by astrocytes in the CNS. The aim of this study was to investigate the efficacy of PET with (11C-acetate for MS diagnosis. MATERIALS AND METHODS: Six patients with relapsing-remitting MS and 6 healthy volunteers (HV were enrolled. The (11C-acetate brain uptake on PET was measured in patients with MS and HV. Volume-of-interest analysis of cerebral gray and white matter based on the segmentation technique for co-registered MRI and voxel-based statistical parametric analysis were performed. Correlation between 11C-acetate uptake and the lesion number in T1- and T2- weighted MR images were also assessed. RESULTS: The standardized uptake value (SUV of 11C-acetate was increased in both white and gray matter in MS patients compared to HV. Voxel-based statistical analysis revealed a significantly increased SUV relative to that in the bilateral thalami (SUVt in a broad area of white matter, particularly in the subcortical white matter of MS patients. The numbers of T2 lesions and T1 black holes were significantly correlated with SUV of (11C-acetate in white and gray matter. CONCLUSIONS: The 11C-acetate uptake significantly increased in MS patients and correlated to the number of MRI lesions. These preliminary data suggest that (11C-acetate PET can be a useful clinical examination for MS patients.

C Borges

Indian Academy of Sciences (India)

C Borges. Articles written in Pramana – Journal of Physics. Volume 60 Issue 4 April 2003 pp 817-828. Study of deconfinement in NA50 · Paula bordalo M C Abreu B Alessandro C Alexa R Arnaldi M Atayan C Baglin A Baldit M Bedjidian S Beolé V Boldea Paula Bordalo S R Borenstein C Borges A Bussiére L Capelli C ...

Behaviors of 14C-butachlor, 14C-chlorpyrifos and 14C-DDT in Rana japonica japonica Guenther

International Nuclear Information System (INIS)

Zhang Yiqiang; Zhong Chuangguang; Zhao Xiaokui; Chen Shunhua

2002-01-01

The research on the behaviors of 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT in the frog Rana japonica japonica Guenther was carried out. After administrated per os to the frogs in doses of 380, 347, 363 Bq/g, 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT, were distributed respectively to various organs within 24 h with specific accumulating organs as gallbladder, intestine and intestine, relevantly to the pesticides described. Compared to that in gallbladder and intestine, the radioactivity of many organs was extremely low, and this might due to the characters of the pesticides. Analysis of the metabolites of 14 C-DDT in frog at 24 th hr demonstrated that DDT was difficult to be degraded. Most 14 C-butachlor, 14 C-chlorpyrifos 14 C-DDT in liver and fat or ovary of frog was extractable with acetone. However, there were some differences between the pesticides, and the organs as well. And 14 C-butachlor, 14 C-chlorpyrifos or 14 C-DDT were better bound in liver than in fat

C-metric solution for conformal gravity with a conformally coupled scalar field

Energy Technology Data Exchange (ETDEWEB)

Meng, Kun, E-mail: mengkun@tjpu.edu.cn [School of Science, Tianjin Polytechnic University, Tianjin 300387 (China); Zhao, Liu, E-mail: lzhao@nankai.edu.cn [School of Physics, Nankai University, Tianjin 300071 (China)

2017-02-15

The C-metric solution of conformal gravity with a conformally coupled scalar field is presented. The solution belongs to the class of Petrov type D spacetimes and is conformal to the standard AdS C-metric appeared in vacuum Einstein gravity. For all parameter ranges, we identify some of the physically interesting static regions and the corresponding coordinate ranges. The solution may contain a black hole event horizon, an acceleration horizon, either of which may be cut by the conformal infinity or be hidden behind the conformal infinity. Since the model is conformally invariant, we also discussed the possible effects of the conformal gauge choices on the structure of the spacetime.

METER-SIZED MOONLET POPULATION IN SATURN'S C RING AND CASSINI DIVISION

International Nuclear Information System (INIS)

Baillié, Kévin; Colwell, Joshua E.; Esposito, Larry W.; Lewis, Mark C.

2013-01-01

Stellar occultations observed by the Cassini Ultraviolet Imaging Spectrograph reveal the presence of transparent holes a few meters to a few tens of meters in radial extent in otherwise optically thick regions of the C ring and the Cassini Division. We attribute the holes to gravitational disturbances generated by a population of ∼10 m boulders in the rings that is intermediate in size between the background ring particle size distribution and the previously observed ∼100 m propeller moonlets in the A ring. The size distribution of these boulders is described by a shallower power-law than the one that describes the ring particle size distribution. The number and size distribution of these boulders could be explained by limited accretion processes deep within Saturn's Roche zone.

Search for C+ C clustering in Mg ground state

Indian Academy of Sciences (India)

2017-01-04

Jan 4, 2017 ... Finite-range knockout theory predictions were much larger for (12C,212C) reaction, indicating a very small 12C−12C clustering in 24Mg. (g.s.) . Our present results contradict most of the proposed heavy cluster (12C+12C) structure models for the ground state of 24Mg. Keywords. Direct nuclear reactions ...

Thermal fatigue behavior of C/C composites modified by SiC-MoSi2-CrSi2 coating

International Nuclear Information System (INIS)

Chu Yanhui; Fu Qiangang; Li Hejun; Li Kezhi

2011-01-01

Highlights: → The low-density C/C composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation. → The thermal fatigue behavior of the modified C/C composites was studied after undergoing thermal cycling for 20 times under the different environments. → The decrease of the flexural strength of the modified C/C composites during thermal cycle in air was primarily attributed to the partial oxidation of the modified C/C samples. - Abstract: Carbon/carbon (C/C) composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation, and their thermal fatigue behavior under thermal cycling in Ar and air environments was investigated. The modified C/C composites were characterized by scanning electron microscopy and X-ray diffraction. Results of tests show that, after 20-time thermal cycles between 1773 K and room temperature in Ar environment, the flexural strength of modified C/C samples decreased lightly and the percentage of remaining strength was 94.92%. While, after thermal cycling between 1773 K and room temperature in air for 20 times, the weight loss of modified C/C samples was 5.1%, and the flexural strength of the modified C/C samples reduced obviously and the percentage of remaining strength was only 75.22%. The fracture mode of modified C/C samples changed from a brittle behavior to a pseudo-plastic one as the service environment transformed from Ar to air. The decrease of the flexural strength during thermal cycle in air was primarily attributed to the partial oxidation of modified C/C samples.

Hot pressing of B{sub 4}C/SiC composites

Energy Technology Data Exchange (ETDEWEB)

Sahin, F.C.; Turhan, E.; Yesilcubuk, S.A.; Addemir, O. [Ystanbul Technical University, Faculty of Chemistry and Metallurgy, Materials and Metallurgical Engineering Dept., Maslak-Ystanbul (Turkey)

2005-07-01

B{sub 4}C/SiC ceramic composites containing 10-20-30 vol % SiC were prepared by hot pressing method. The effect of SiC addition and hot pressing temperature on sintering behaviour and mechanical properties of hot pressed composites were investigated. Microstructures of hot pressed samples were examined by SEM technique. Three different temperatures (2100 deg. C, 2200 deg. C and 2250 deg. C) were used to optimize hot pressing temperature applying 100 MPa pressure under argon atmosphere during the sintering procedure. The highest relative density of 98.44 % was obtained by hot pressing at 2250 deg. C. However, bending strengths of B{sub 4}C/SiC composite samples were lower than monolithic B{sub 4}C in all experimental conditions. (authors)

CONNECTION BETWEEN THE ACCRETION DISK AND JET IN THE RADIO GALAXY 3C 111

International Nuclear Information System (INIS)

Chatterjee, Ritaban; Marscher, Alan P.; Jorstad, Svetlana G.; Harrison, Brandon; Agudo, Ivan; Taylor, Brian W.; Markowitz, Alex; Rivers, Elizabeth; Rothschild, Richard E.; McHardy, Ian M.; Aller, Margo F.; Aller, Hugh D.; Laehteenmaeki, Anne; Tornikoski, Merja; Gomez, Jose L.; Gurwell, Mark

2011-01-01

We present the results of extensive multi-frequency monitoring of the radio galaxy 3C 111 between 2004 and 2010 at X-ray (2.4-10 keV), optical (R band), and radio (14.5, 37, and 230 GHz) wave bands, as well as multi-epoch imaging with the Very Long Baseline Array (VLBA) at 43 GHz. Over the six years of observation, significant dips in the X-ray light curve are followed by ejections of bright superluminal knots in the VLBA images. This shows a clear connection between the radiative state near the black hole, where the X-rays are produced, and events in the jet. The X-ray continuum flux and Fe line intensity are strongly correlated, with a time lag shorter than 90 days and consistent with zero. This implies that the Fe line is generated within 90 lt-day of the source of the X-ray continuum. The power spectral density function of X-ray variations contains a break, with a steeper slope at shorter timescales. The break timescale of 13 +12 -6 days is commensurate with scaling according to the mass of the central black hole based on observations of Seyfert galaxies and black hole X-ray binaries (BHXRBs). The data are consistent with the standard paradigm, in which the X-rays are predominantly produced by inverse Compton scattering of thermal optical/UV seed photons from the accretion disk by a distribution of hot electrons-the corona-situated near the disk. Most of the optical emission is generated in the accretion disk due to reprocessing of the X-ray emission. The relationships that we have uncovered between the accretion disk and the jet in 3C 111, as well as in the Fanaroff-Riley class I radio galaxy 3C 120 in a previous paper, support the paradigm that active galactic nuclei and Galactic BHXRBs are fundamentally similar, with characteristic time and size scales proportional to the mass of the central black hole.

30 CFR 18.29 - Access openings and covers, including unused lead-entrance holes.

Science.gov (United States)

2010-07-01

... lead-entrance holes. 18.29 Section 18.29 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION... unused lead-entrance holes. (a) Access openings in explosion-proof enclosures will be permitted only... Figure 1 in Appendix II.) (c) Holes in enclosures that are provided for lead entrances but which are not...

Studies on the selectivity of the reaction of (CO){sub 5}W=C(aryl)H with enynes: transfer of the carbene ligand to the C=C Bond versus insertion of the C triple bond C into the W=C Bond

Energy Technology Data Exchange (ETDEWEB)

Fischer, H.; Volkland, H.P.; Stumpf, R.

1996-10-01

The strongly electrophilic monophenylcarbene complex [(CO){sub 5}W=C(Ph)H] (2a) reacts with the enynes H-C triple bond C-R(R=-C(Me)=CH{sub 2})(3), -C{sub 6}H{sub 4}-CH=CH{sub 2}-p (5) and subsequently with PMe{sub 3} to form the C{sub a}lpha-PMe{sub 3} adducts of the vinylidene complexes [(CO){sub 5}W-{l_brace}C(PMe{sub 3})=CH-C{sub 3}H{sub 3}(Me)Ph{r_brace}] (4) and [(CO){sub 5}W {l_brace}C(PMe{sub 3})=CH-C{sub 6}H{sub 4}-C{sub 3}H{sub 4}Ph{r_brace}] (6). The reaction very likely proceeds by transfer of the carbene ligand to the C=C bond of the enyne to form a cyclopropyl-substituted alkyne complex which is in equilibrium with its vinylidene isomer.

Noncommutative geometry inspired Einstein–Gauss–Bonnet black holes

Science.gov (United States)

Ghosh, Sushant G.

2018-04-01

Low energy limits of a string theory suggests that the gravity action should include quadratic and higher-order curvature terms, in the form of dimensionally continued Gauss–Bonnet densities. Einstein–Gauss–Bonnet is a natural extension of the general relativity to higher dimensions in which the first and second-order terms correspond, respectively, to general relativity and Einstein–Gauss–Bonnet gravity. We obtain five-dimensional (5D) black hole solutions, inspired by a noncommutative geometry, with a static spherically symmetric, Gaussian mass distribution as a source both in the general relativity and Einstein–Gauss–Bonnet gravity cases, and we also analyzes their thermodynamical properties. Owing the noncommutative corrected black hole, the thermodynamic quantities have also been modified, and phase transition is shown to be achievable. The phase transitions for the thermodynamic stability, in both the theories, are characterized by a discontinuity in the specific heat at r_+=rC , with the stable (unstable) branch for r ) rC . The metric of the noncommutative inspired black holes smoothly goes over to the Boulware–Deser solution at large distance. The paper has been appended with a calculation of black hole mass using holographic renormalization.

Influence of the anisotropy on the performance of D-band SiC IMPATT diodes

Science.gov (United States)

Chen, Qing; Yang, Lin'an; Wang, Shulong; Zhang, Yue; Dai, Yang; Hao, Yue

2015-03-01

Numerical simulation has been made to predict the RF performance of direction and direction p+/n/n-/n+ (single drift region) 4H silicon carbide (4H-SiC) impact-ionization-avalanche-transit-time (IMPATT) diodes for operation at D-band frequencies. We observed that the output performance of 4H-SiC IMPATT diode is sensitive to the crystal direction of the one-dimensional current flow. The simulation results show that direction 4H-SiC IMPATT diode provides larger breakdown voltage for its lower electron and hole ionization rates and higher dc-to-rf conversion efficiency (η) for its higher ratio of drift zone voltage drop (VD) to breakdown voltage (VB) compared with those for direction 4H-SiC IMPATT diode, which lead to higher-millimeter-wave power output for direction 4H-SiC IMPATT compared to direction. However, the quality factor Q for the direction 4H-SiC IMPATT diode is lower than that of direction, which implies that the direction 4H-SiC IMPATT diode exhibits better stability and higher growth rate of microwave oscillation compared with direction 4H-SiC IMPATT diode.

Objective-C

CERN Document Server

DeVoe, Jiva

2011-01-01

A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

Fracture behavior of C/SiC composites at elevated temperature

Energy Technology Data Exchange (ETDEWEB)

Yoon, Dong Hyun; Lee, Jeong Won; Kim, Jae Hoon; Shin, Ihn Cheol; Lim, Byung Joo [Chungnam National University, Daejeon (Korea, Republic of)

2017-08-15

The fracture behavior of carbon fiber-reinforced silicon carbide (C/SiC) composites used in rocket nozzles has been investigated under tension, compression, and fracture conditions at room temperature, 773 K and 1173 K. The C/SiC composites used in this study were manufactured by liquid silicon infiltration process at ~1723 K. All experiments were conducted using two types of specimens, considering fiber direction and oxidation condition. Experimental results show that temperature, fiber direction, and oxidation condition affect the behavior of C/SiC composites. Oxidation was found to be the main factor that changes the strength of C/SiC composites. By applying an anti-oxidation coating, the tensile and compressive strengths of the C/SiC composites increased with temperature. The fracture toughness of the C/SiC composites also increased with increase temperature. A fractography analysis of the fractured specimens was conducted using a scanning electron microscope.

Volume properties and refraction of aqueous solutions of bisadducts of light fullerene C60 and essential amino acids lysine, threonine, and oxyproline (C60(C6H13N2O2)2, C60(C4H8NO3)2, and C60(C5H9NO2)2) at 25°C

Science.gov (United States)

Semenov, K. N.; Ivanova, N. M.; Charykov, N. A.; Keskinov, V. A.; Kalacheva, S. S.; Duryagina, N. N.; Garamova, P. V.; Kulenova, N. A.; Nabieva, A.

2017-02-01

Concentration dependences of the density of aqueous solutions of bisadducts of light fullerene C60 and essential amino acids are studied by pycnometry. Concentration dependences of the average molar volumes and partial volumes of components (H2O and corresponding bisadducts) are calculated for C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems at 25°C. Concentration dependences of the indices of refraction of C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems are determined at 25°C. The concentration dependences of specific refraction and molar refraction of bisadducts and aqueous solutions of them are calculated.

Thermochemistry analyses for transformation of C6 glucose compound into C9, C12 and C15 alkanes using density functional theory

Science.gov (United States)

Verma, Anand Mohan; Kishore, Nanda

2017-02-01

The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.

Mass spectra for q c q ¯ c ¯, s c s ¯ c ¯, q b q ¯ ¯, s b s ¯ ¯ tetraquark states with JP C=0++ and 2++

Science.gov (United States)

Chen, Wei; Chen, Hua-Xing; Liu, Xiang; Steele, T. G.; Zhu, Shi-Lin

2017-12-01

We have studied the mass spectra of the hidden-charm/bottom q c q ¯c ¯, s c s ¯c ¯ and q b q ¯b ¯, s b s ¯b ¯ tetraquark states with JP C=0++ and 2++ in the framework of QCD sum rules. We construct ten scalar and four tensor interpolating currents in a systematic way and calculate the mass spectra for these tetraquark states. The X*(3860 ) may be either an isoscalar tetraquark state or χc 0(2 P ). If the X*(3860 ) is a tetraquark candidate, our results prefer the 0++ option over the 2++ one. The X (4160 ) may be classified as either the scalar or tensor q c q ¯c ¯ tetraquark state, while the X (3915 ) favors a 0++ q c q ¯c ¯ or s c s ¯c ¯ tetraquark assignment over the tensor one. The X (4350 ) cannot be interpreted as a s c s ¯c ¯ tetraquark with either JP C=0++ or 2++.

Caffeine-11C, ephedrine-11C and methylephedrine-11C: synthesis and distribution in mice

International Nuclear Information System (INIS)

Saji, Hideo; Ido, Tatsuo; Iwata, Ren; Suzuki, Kazutoshi; Tamate, Kazuhiko

1978-01-01

Caffeine, ephedrine and methylephedrine were labeled with carbon-11 by the action of methyliodide- 11 C on theophylline, norephedrine and ephedrine, respectively. Caffeine- 11 C was prepared in 44 min. with a radiochemical yield of 40%, ephedrine- 11 C in 45 min. with a 11% radiochemical yield and methylephedrine- 11 C in 36 min. with a 43% radiochemical yield. When injected in mice intravenously, these products show a high uptake in the liver, the kidney and the blood for caffeine- 11 C and in the liver and the kidney for ephedrine- 11 C and methylephedrine- 11 C. The brain uptake for these products was found to be 2.4 to 3.9% of the injected dose per gram at 5 min. after injection. These studies in mice have demonstrated that these products are potentially useful agents for the dynamic studies of the brain. (auth.)

Sim3C: simulation of Hi-C and Meta3C proximity ligation sequencing technologies.

Science.gov (United States)

DeMaere, Matthew Z; Darling, Aaron E

2018-02-01

Chromosome conformation capture (3C) and Hi-C DNA sequencing methods have rapidly advanced our understanding of the spatial organization of genomes and metagenomes. Many variants of these protocols have been developed, each with their own strengths. Currently there is no systematic means for simulating sequence data from this family of sequencing protocols, potentially hindering the advancement of algorithms to exploit this new datatype. We describe a computational simulator that, given simple parameters and reference genome sequences, will simulate Hi-C sequencing on those sequences. The simulator models the basic spatial structure in genomes that is commonly observed in Hi-C and 3C datasets, including the distance-decay relationship in proximity ligation, differences in the frequency of interaction within and across chromosomes, and the structure imposed by cells. A means to model the 3D structure of randomly generated topologically associating domains is provided. The simulator considers several sources of error common to 3C and Hi-C library preparation and sequencing methods, including spurious proximity ligation events and sequencing error. We have introduced the first comprehensive simulator for 3C and Hi-C sequencing protocols. We expect the simulator to have use in testing of Hi-C data analysis algorithms, as well as more general value for experimental design, where questions such as the required depth of sequencing, enzyme choice, and other decisions can be made in advance in order to ensure adequate statistical power with respect to experimental hypothesis testing.

Hole-assisted fiber based fiber fuse terminator supporting 22 W input

Science.gov (United States)

Tsujikawa, Kyozo; Kurokawa, Kenji; Hanzawa, Nobutomo; Nozoe, Saki; Matsui, Takashi; Nakajima, Kazuhide

2018-05-01

We investigated the air hole structure in hole-assisted fiber (HAF) with the aim of terminating fiber fuse propagation. We focused on two structural parameters c/MFD and S1/S2, which are related respectively to the position and area of the air holes, and mapped their appropriate values for terminating fiber fuse propagation. Here, MFD is the mode field diameter, c is the diameter of an inscribed circle linking the air holes, S1 is the total area of the air holes, and S2 is the area of a circumscribed circle linking the air holes. On the basis of these results, we successfully realized a compact fiber fuse terminator consisting of a 1.35 mm-long HAF, which can terminate fiber fuse propagation even with a 22 W input. In addition, we observed fiber fuse termination using a high-speed camera. We additionally confirmed that the HAF-based fiber fuse terminator is effective under various input power conditions. The penetration length of the optical discharge in the HAF was only less than 300 μm when the input power was from 2 to 22 W.

Detailed low-energy electron diffraction analysis of the (4×4) surface structure of C60 on Cu(111): Seven-atom-vacancy reconstruction

Science.gov (United States)

Xu, Geng; Shi, Xing-Qiang; Zhang, R. Q.; Pai, Woei Wu; Jeng, H. T.; Van Hove, M. A.

2012-08-01

A detailed and exhaustive structural analysis by low-energy electron diffraction (LEED) is reported for the C60-induced reconstruction of Cu(111), in the system Cu(111) + (4 × 4)-C60. A wide LEED energy range allows enhanced sensitivity to the crucial C60-metal interface that is buried below the 7-Å-thick molecular layer. The analysis clearly favors a seven-Cu-atom vacancy model (with Pendry R-factor Rp = 0.376) over a one-Cu-atom vacancy model (Rp = 0.608) and over nonreconstructed models (Rp = 0.671 for atop site and Rp = 0.536 for hcp site). The seven-Cu-atom vacancy forms a (4 × 4) lattice of bowl-like holes. In each hole, a C60 molecule can nestle by forming strong bonds (shorter than 2.30 Å) between 15 C atoms of the molecule and 12 Cu atoms of the outermost and second Cu layers.

C&S Enterprise, L.L.C.

Science.gov (United States)

The EPA is providing notice of a proposed Administrative Penalty Assessment against C & S Enterprise, L.L.C. (“Respondent”), a business located at 2454 480th Ave, Deep River, IA 52222, for alleged violations of the Clean Water Act at property owned by Resp

Generation of Anaphylatoxins by Human β-Tryptase from C3, C4, and C51

Science.gov (United States)

Fukuoka, Yoshihiro; Xia, Han-Zhang; Sanchez-Muñoz, Laura B.; Dellinger, Anthony L.; Escribano, Luis; Schwartz, Lawrence B.

2009-01-01

Both mast cells and complement participate in innate and acquired immunity. The current study examines whether β-tryptase, the major protease of human mast cells, can directly generate bioactive complement anaphylatoxins. Important variables included pH, monomeric vs tetrameric forms of β-tryptase, and the β-tryptase-activating polyanion. The B12 mAb was used to stabilize β-tryptase in its monomeric form. C3a and C4a were best generated from C3 and C4, respectively, by monomeric β-tryptase in the presence of low molecular weight dextran sulfate or heparin at acidic pH. High molecular weight polyanions increased degradation of these anaphylatoxins. C5a was optimally generated from C5 at acidic pH by β-tryptase monomers in the presence of high molecular weight dextran sulfate and heparin polyanions, but also was produced by β-tryptase tetramers under these conditions. Mass spectrometry verified that the molecular mass of each anaphylatoxin was correct. Both β-tryptase-generated C5a and C3a (but not C4a) were potent activators of human skin mast cells. These complement anaphylatoxins also could be generated by β-tryptase in releasates of activated skin mast cells. Of further biologic interest, β-tryptase also generated C3a from C3 in human plasma at acidic pH. These results suggest β-tryptase might generate complement anaphylatoxins in vivo at sites of inflammation, such as the airway of active asthma patients where the pH is acidic and where elevated levels of β-tryptase and complement anaphylatoxins are detected. PMID:18424754

New charged black holes with conformal scalar hair

International Nuclear Information System (INIS)

Anabalon, Andres; Maeda, Hideki

2010-01-01

A new class of four-dimensional, hairy, stationary solutions of the Einstein-Maxwell-Λ system with a conformally coupled scalar field is obtained. The metric belongs to the Plebanski-Demianski family and hence its static limit has the form of the charged (A)dS C metric. It is shown that, in the static case, a new family of hairy black holes arises. They turn out to be cohomogeneity-two, with horizons that are neither Einstein nor homogenous manifolds. The conical singularities in the C metric can be removed due to the backreaction of the scalar field providing a new kind of regular, radiative spacetime. The scalar field carries a continuous parameter proportional to the usual acceleration present in the C metric. In the zero-acceleration limit, the static solution reduces to the dyonic Bocharova-Bronnikov-Melnikov-Bekenstein solution or the dyonic extension of the Martinez-Troncoso-Zanelli black holes, depending on the value of the cosmological constant.

Thermochemical instability effects in SiC-based fibers and SiC{sub f}/SiC composites

Energy Technology Data Exchange (ETDEWEB)

Youngblood, G.E.; Henager, C.H.; Jones, R.H. [Pacific Northwest National Laboratory, Richland, WA (United States)

1997-08-01

Thermochemical instability in irradiated SiC-based fibers with an amorphous silicon oxycarbide phase leads to shrinkage and mass loss. SiC{sub f}/SiC composites made with these fibers also exhibit mass loss as well as severe mechanical property degradation when irradiated at 800{degrees}C, a temperature much below the generally accepted 1100{degrees}C threshold for thermomechanical degradation alone. The mass loss is due to an internal oxidation mechanism within these fibers which likely degrades the carbon interphase as well as the fibers in SiC{sub f}/SiC composites even in so-called {open_quotes}inert{close_quotes} gas environments. Furthermore, the mechanism must be accelerated by the irradiation environment.

Synthesis of [21-14C]-fusarin C by enzymic demethylation and remethylation with [14C]-diazomethane

International Nuclear Information System (INIS)

Lu, S.-J.; Li, M.H.

1989-01-01

Fusarin C, a potent mutagen isolated from Fusarium moniliforme culture extracts, has been prepared radiolabeled in two steps by enzymic hydrolysis of the 21-methyl ester group, using phenobarbital induced microsomal preparations, followed by remethylation using [ 14 F]-diazomethane. Yields, based upon fusarin C, were essentially quantitative and approximately 10% of the [ 14 C]-methyl-nitrosourea, converted to diazomethane, reacted to yield [ 14 C]-fusarin C. (author)

Demonstration of SiC Pressure Sensors at 750 C

Science.gov (United States)

Okojie, Robert S.; Lukco, Dorothy; Nguyen, Vu; Savrun, Ender

2014-01-01

We report the first demonstration of MEMS-based 4H-SiC piezoresistive pressure sensors tested at 750 C and in the process confirmed the existence of strain sensitivity recovery with increasing temperature above 400 C, eventually achieving near or up to 100% of the room temperature values at 750 C. This strain sensitivity recovery phenomenon in 4H-SiC is uncharacteristic of the well-known monotonic decrease in strain sensitivity with increasing temperature in silicon piezoresistors. For the three sensors tested, the room temperature full-scale output (FSO) at 200 psig ranged between 29 and 36 mV. Although the FSO at 400 C dropped by about 60%, full recovery was achieved at 750 C. This result will allow the operation of SiC pressure sensors at higher temperatures, thereby permitting deeper insertion into the engine combustion chamber to improve the accurate quantification of combustor dynamics.

Recent topics in {mu}SR studies on high-T{sub c} Superconductors

Energy Technology Data Exchange (ETDEWEB)

Watanabe, Isao; Nagamine, Kanetada [Institute of Physical and Chemical Research, Wako, Saitama (Japan); Akoshima, Megumi; Koike, Yoji

1999-03-01

We report the recent topics in {mu}SR studies on the high-T{sub c} Superconductors, especially about the studies on Zn-doped Bi-2212 system, Bi{sub 2}Sr{sub 2}Ca{sub 1-x}Y{sub x}(Cu{sub 1-y}Zn{sub y})O{sub 8+{delta}}. Zero-field muon spin relaxation ({mu}SR) measurement was applied to this Zn-doped Bi2212 system to study a possibility of the so called `1/8 problem` which was established in high-T{sub c} La-systems. The muon spin depolarization rate increased with decreasing temperature below 10 K in only the Zn-doped (y=0.025) system in which the hole density was 1/8 (x=0.3125), indicating the slowing down behavior of the Cu-spin fluctuations. A long range coherent ordering of the Cu-spins which were the similar to the one observed in the La-systems was not confirmed down to 0.3 K. Both of the Zn-doping and the 1/8 hole density were essential for the freezing of the Cu-spin fluctuations in also the Zn-doped Bi2212 system. (author)

Dicty_cDB: VSI127 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available w*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwy...ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**tses s*twcnnsicwirkykn*itpsiwr*itn*kffkkesirwyssylfrs**ys...scsqnfis rkc*ny*sntkdwcsw*TSCFLTSKINEWCFSRIRRKIKIIYRIFFKKK--- ---lnk**ii*yqyrkw*qnw*yyw*nwnw*iksccnchtkftrvngfiqkcfwc*c**t sess*twcnn

Dicty_cDB: VHE759 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0

Preparation of PtSn/C, PtRu/C, PtRh/C, PtRuRh/C and PtSnRh/C electrocatalysts using an alcohol-reduction process for methanol and ethanol oxidation

International Nuclear Information System (INIS)

Dias, Ricardo Rodrigues

2009-01-01

In this work, Pt/C, PtRh (90:10), PtRh/C (50:50), PtSn/C (50:50), PtRu (50:50)/C, PtRuRh/C (50:40:10) and PtSnRh/C (50:40:10) were prepared by an alcohol-reduction process with metal loading of 20 wt.% using H 2 PtCl 6 .6H 2 O (Aldrich), SnCl 2 .2H 2 O (Aldrich),and RhCl 2 .XH 2 O (Aldrich) as metals sources and Vulcan XC72 as support. The electrocatalysts were characterized by EDX, XRD and cyclic voltammetry (CV). The electro-oxidation of ethanol was studied by CV, chronoamperomety at room temperature in acid medium and tests at 100 deg C on a single cell of a direct methanol or ethanol fuel cell. The EDX analysis showed that the metal atomic ratios of the obtained electrocatalysts were similar to the nominal atomic ratios used in the preparation. The diffractograms of electrocatalysts prepared showed four peaks at approximately 2θ = 40 0 , 47 0 , 67 0 and 82 0 , which are associated with the (111), (200), (220) and (311) planes, respectively, of a face cubic-centered (fcc) structure characteristic of platinum and platinum alloys. The average crystallite sizes using the Scherrer equation and the calculated values were in the range of 2–3 nm. For PtSn/C and PtSnRh/C two additional peaks were observed at 2θ = 34 0 and 52 0 that were identified as a SnO 2 phase. PtSn/C (50:50) and PtSnRh/C (50:40:10) electrocatalyst showed the best performance for ethanol oxidation at room temperature. For methanol oxidation at room temperature PtRu/C, PtSn/C and PtRuRh/C electrocatalysts showed the best performance. Tests at 100 deg C on a single cell of a direct ethanol fuel cell PtSnRh/C showed the best performance, for methanol oxidation PtRuRh/C showed the best performance. (author)

Study of the unimolecular decompositions of the (C3H6)+2 and (c-C3H6)+2 complexes

International Nuclear Information System (INIS)

Tzeng, W.; Ono, Y.; Linn, S.H.; Ng, C.Y.

1985-01-01

The major product channels identified in the unimolecular decompositions ofC 3 H + 6 xC 3 H 6 and c-C 3 H + 6 xc-C 3 H 6 in the total energy [neutral (C 3 H 6 ) 2 or (c-C 3 H 6 ) 2 heat of formation plus excitation energy] range of approx.230--450 kcal/mol are C 3 H + 7 +C 3 H 5 , C 4 H + 7 +C 2 H 5 , C 4 H + 8 +C 2 H 4 , and C 5 H + 9 +CH 3 . The measured appearance energy for C 4 H + 7 (9.54 +- 0.04 eV) from (C 3 H 6 ) 2 is equal to the thermochemical threshold for the formation of C 4 H + 7 +C 2 H 5 from (C 3 H 6 ) 2 , indicating that the exit potential energy barrier for the ion--molecule reaction C 3 H + 6 +C 3 H 6 →C 4 H + 7 +C 2 H 5 is negligible. There is evidence that the formations of C 4 H + 7 +C 2 H 4 +H from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 also proceed with high probabilities when they are energetically allowed. The variations of the relative abundances for C 4 H + 7 ,C 4 H + 8 , and C 5 H + 9 from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 as a function of ionizing photon energy are in qualitative agreement, suggesting that (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 rearrange to similar C 6 H + 12 isomers prior to fragmentation. The fact that C 6 H + 11 is found to be a primary ion from the unimolecular decomposition of (c-C 3 H 6 ) + 2 but not (C 3 H 6 ) + 2 supports the conclusion that the distribution of C 6 H + 12 collision complexes involved in the C 3 H + 6 +C 3 H 6 reactions is different from that in the cyclopropane ion--molecule reactions

Competitive Interactions between C. albicans, C. glabrata and C. krusei during Biofilm Formation and Development of Experimental Candidiasis

Science.gov (United States)

Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos

2015-01-01

In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis. PMID:26146832

Competitive Interactions between C. albicans, C. glabrata and C. krusei during Biofilm Formation and Development of Experimental Candidiasis.

Science.gov (United States)

Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos

2015-01-01

In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis.

High-T /SUB c/ Superconducting integrated circuit: a dc SQUID with input coil

International Nuclear Information System (INIS)

Di Iorio, M.S.; Beasley, M.R.

1985-01-01

We have fabricated a high transition temperature superconducting integrated circuit consisting of a dc SQUID and an input coupling coil. The purpose is to ascertain the generic problems associated with constructing a high-T /SUB c/ circuit as well as to fabricate a high performance dc SQUID. The superconductor used for both the SQUID and the input coil is Nb 3 Sn which must be deposited at 800 0 C. Importantly, the insulator separating SQUID and input coil maintains its integrity at this elevated temperature. A hole in the insulator permits contact to the innermost winding of the coil. This contact has been achieved without significant degradation of the superconductivity. Consequently, the device operates over a wide temperature range, from below 4.2 K to near T /SUB c/

Synchrotron radiation from spherically accreting black holes

International Nuclear Information System (INIS)

Ipser, J.R.; Price, R.H.

1982-01-01

Spherical accretion onto a Schwartzchild black hole, of gas with frozen-in magnetic field, is studied numerically and analytically for a range of hole masses and accretion rates in which synchrotron emission is the dominant radiative mechanism. At small radii the equipartition of magnetic, kinetic, and gravitational energy is assumed to apply, and the gas is heated by dissipation of infalling magnetic energy, turbulent energy, etc. The models can be classified into three types: (a) synchrotron cooling negligible, (b) synchrotron cooling important but synchrotron self-absorption negligible, (c) synchrotron cooling and self-absorption important. In the first case gas temperatures become very high near the horizon but luminosity efficiencies (luminosity/mass-energy accretion rate) are low. In cases (b) and (c) the gas flow near the horizon is essentially isothermal and luminosity efficiencies are fairly high. The analysis and results for the isothermal cases (b) and (c) are valid only for moderate dissipative heating and synchrotron self-absorption. If self-absorption is very strong or if dissipated energy is comparable to infall energy, Comptonization effects, not included in the analysis, become important

Ionospheric effects of rocket exhaust products: Skylab and HEAO-C

International Nuclear Information System (INIS)

Zinn, J.; Sutherland, C.D.; Duncan, L.M.; Stone, S.N.

1981-01-01

This paper is about ionospheric F-layer depletions produced by chemical reactions with exhaust gases from large rockets. It describes a 2-dimensional computer model of the ionosphere, and it compares model results with experimental data on the structure and variability of the natural ionosphere, as well as data on ionospheric holes produced by the launches of Skylab (May, 1973) and HEAO-C (September, 1979). It also describes measurements made in conjunction with the HEAO-C launch. The computer model includes an approximate representation of thermospheric tidal winds and E fields in addition to vertical motions associated with diurnal changes in temperature. The computed ionospheric structure is sensitive to all the above. For a small number of cases, results are compared of computations of the normal diurnal variations of ionospheric structure with incoherent scatter and total electron content data. Computations of ionospheric depletions from the Skylab and HEAO-C launches are in satisfactory agreement with the observations. The winds appear to be essential for interpretation of the Skylab results

On wormholes and black holes solutions of Einstein gravity coupled to a K-massless scalar field

International Nuclear Information System (INIS)

Estevez-Delgado, J; Zannias, T

2007-01-01

We investigate the nature of black holes and wormholes admitted by a K-essence model involving a massless scalar field φ, minimally coupled to gravity. Via Weyl's formalism, we show that any axial wormhole of the theory can be generated by a unique pair of harmonic functions: U(λ) = π/2 C + C arctan(λ/λ 0 ), φ(λ) = π/2 D + D arctan(λ/λ 0 ) where λ is one of the oblate coordinate, λ 0 > 0 and (C, D) real parameters. The properties of the wormholes depends crucially upon the values of the parameters (C, D). Whenever (C, D) are chosen so that 2C 2 - kD 2 = -2 the wormhole is spherical, while for the case where 2C 2 - kD 2 = -4 or 2C 2 - kD 2 = -6 the wormhole throat possesses toroidal topology. Those two families of wormholes exhaust all regular static and axisymmetric wormholes admitted by this theory. For completeness we add that whenever (C, D) satisfy 2C 2 - kD 2 = -2l with l ≥ 3/2 one still generates a spacetime possessing two asymptotically flat but the throat connecting the two ends contains a string like singularity. For the refined case where 2C 2 - kD 2 = -2l with l = 4,5, ... the resulting spacetime represents a multi-sheeted configuration which even though free of curvature singularities nevertheless the spacetime topology is distinct to so far accepted wormhole topology. Spacetimes generated by the pair (U(λ), φ(λ)) and parameters (C, D) subject to 2C 2 - kD 2 = -2l with l 2 bifurcating, regular Killing horizon necessary possesses a constant exterior scalar field. Under the assumption that the event horizon of any static black hole of this theory is a Killing horizon, the results show that the only static black hole admitted by this K-essence model, is the Schwarzschild black hole

Macular hole surgery with short-acting gas and short-duration face-down positioning

Directory of Open Access Journals (Sweden)

Xirou T

2012-07-01

Full Text Available Tina Xirou,1 Panagiotis G Theodossiadis,2 Michael Apostolopoulos,3 A Stamatina Kabanarou,1 Elias Feretis,1 Ioannis D Ladas,3 Chrysanthi Koutsandrea31Vitreoretinal Unit, Red Cross Hospital, 2B Department of Ophthalmology, University of Athens, Greece; 3A Department of Ophthalmology, University of Athens, GreecePurpose: To report on the outcomes of vitrectomy and sulfur hexafluoride (SF6 gas tamponade for idiopathic macular holes with 2 days of face-down positioning.Patients and methods: This was a prospective, nonrandomized, observational sequential case-series study on 23 consecutive patients receiving macular hole surgery using 20% SF6 and advised to stay in a face-down position for 2 days postoperatively (SF6 group. These patients were compared to 23 consecutive patients who had previously undergone macular hole surgery, had received 14% C3F8, and were advised to maintain a face-down position for 2 days (C3F8 group. Patients in both groups underwent vitrectomy, internal limiting membrane peeling, and fluid gas exchange using either SF6 or C3F8. Preoperative and postoperative data included best corrected visual acuity recorded in LogMAR units, slit-lamp biomicroscopy, and optical coherence tomography.Results: At a 6-month follow-up, macular hole closure was noted in 23/23 eyes (100% and in 22/23 eyes (96% in the SF6 and C3F8 groups, respectively. The improvement in visual acuity (measured through Snellen acuity lines both preoperatively until 6 months postoperatively was 4.08 ± 2.31 (95% confidence interval [CI]: 3.08–5.08 for the SF6 group and 2.87 ± 2.30 (95% CI: 1.87–3.86 for the C3F8 group; this difference was not statistically significant (P = 0.06.Conclusion: Vitrectomy with internal limiting membrane peeling and a short-acting gas tamponade using SF6 with posture limitation for 2 days may give a high success rate in macular hole surgery.Keywords: idiopathic macular holes, SF6 gas tamponade, C3F8 gas tamponade

Dicty_cDB: SHJ446 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available X4, complete sequence. 42 0.41 8 CX076494 |CX076494.1 UCRCS08_50C12_g Parent Washington Navel Orange Callus ... |CX076493.1 UCRCS08_50C12_b Parent Washington Navel Orange Callus cDNA Library U

Speciation of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis by Matrix-Assisted Laser Desorption Ionization-Time of Flight Mass Spectrometry†

Science.gov (United States)

Mandrell, Robert E.; Harden, Leslie A.; Bates, Anna; Miller, William G.; Haddon, William F.; Fagerquist, Clifton K.

2005-01-01

Multiple strains of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis isolated from animal, clinical, or food samples have been analyzed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS). Whole bacterial cells were harvested from colonies or confluent growth on agar and transferred directly into solvent and then to a spot of dried 3-methoxy-4-hydroxycinnamic acid (matrix). Multiple ions in the 5,000- to 15,000-Da mass range were evident in spectra for each strain; one or two ions in the 9,500- to 11,000-Da range were consistently high intensity. “Species-identifying” biomarker ions (SIBIs) were evident from analyses of multiple reference strains for each of the six species, including the genome strains C. jejuni NCTC 11168 and C. jejuni RM1221. Strains grown on nine different combinations of media and atmospheres yielded SIBI masses within ±5 Da with external instrument calibration. The highest-intensity C. jejuni SIBIs were cytosolic proteins, including GroES, HU/HCj, and RplL. Multiple intraspecies SIBIs, corresponding probably to nonsynonymous nucleotide polymorphisms, also provided some intraspecies strain differentiation. MALDI-TOF MS analysis of 75 additional Campylobacter strains isolated from humans, poultry, swine, dogs, and cats revealed (i) associations of SIBI type with source, (ii) strains previously speciated incorrectly, and (iii) “strains” composed of more than one species. MALDI-TOF MS provides an accurate, sensitive, and rapid method for identification of multiple Campylobacter species relevant to public health and food safety. PMID:16204551

Speciation of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis by matrix-assisted laser desorption ionization-time of flight mass spectrometry.

Science.gov (United States)

Mandrell, Robert E; Harden, Leslie A; Bates, Anna; Miller, William G; Haddon, William F; Fagerquist, Clifton K

2005-10-01

Multiple strains of Campylobacter coli, C. jejuni, C. helveticus, C. lari, C. sputorum, and C. upsaliensis isolated from animal, clinical, or food samples have been analyzed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS). Whole bacterial cells were harvested from colonies or confluent growth on agar and transferred directly into solvent and then to a spot of dried 3-methoxy-4-hydroxycinnamic acid (matrix). Multiple ions in the 5,000- to 15,000-Da mass range were evident in spectra for each strain; one or two ions in the 9,500- to 11,000-Da range were consistently high intensity. "Species-identifying" biomarker ions (SIBIs) were evident from analyses of multiple reference strains for each of the six species, including the genome strains C. jejuni NCTC 11168 and C. jejuni RM1221. Strains grown on nine different combinations of media and atmospheres yielded SIBI masses within +/-5 Da with external instrument calibration. The highest-intensity C. jejuni SIBIs were cytosolic proteins, including GroES, HU/HCj, and RplL. Multiple intraspecies SIBIs, corresponding probably to nonsynonymous nucleotide polymorphisms, also provided some intraspecies strain differentiation. MALDI-TOF MS analysis of 75 additional Campylobacter strains isolated from humans, poultry, swine, dogs, and cats revealed (i) associations of SIBI type with source, (ii) strains previously speciated incorrectly, and (iii) "strains" composed of more than one species. MALDI-TOF MS provides an accurate, sensitive, and rapid method for identification of multiple Campylobacter species relevant to public health and food safety.

Potential Hazards Relating to Pyrolysis of c-C4F8O, n-C4F10 and c-C4F8 in selected gaseous diffusion plant operations

International Nuclear Information System (INIS)

Trowbridge, L.D.

2000-01-01

As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations

Dicty_cDB: VSD136 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 8 |CB290208.1 UCRCS01_01aa10_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus....1 UCRCS01_04cd07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis c

Dicty_cDB: SHJ838 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Libra

Dicty_cDB: CHN523 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA... 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA L

Oxidation of C/SiC Composites at Reduced Oxygen Partial Pressures

Science.gov (United States)

Opila, Elizabeth J.; Serra, Jessica

2009-01-01

Carbon-fiber reinforced SiC (C/SiC) composites are proposed for leading edge applications of hypersonic vehicles due to the superior strength of carbon fibers at high temperatures (greater than 1500 C). However, the vulnerability of the carbon fibers in C/SiC to oxidation over a wide range of temperatures remains a problem. Previous oxidation studies of C/SiC have mainly been conducted in air or oxygen, so that the oxidation behavior of C/SiC at reduced oxygen partial pressures of the hypersonic flight regime are less well understood. In this study, both carbon fibers and C/SiC composites were oxidized over a wide range of temperatures and oxygen partial pressures to facilitate the understanding and modeling of C/SiC oxidation kinetics for hypersonic flight conditions.

Dicty_cDB: Contig-U03072-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available verselong Onychiurus arcticus d... 38 0.010 2 ( CF439672 ) EST676017 normalized cDNA library of ...ornis cDN... 68 8e-07 1 ( BU884919 ) R017H10 Populus root cDNA library Populus tremula... 68 8e-07 1 ( ...us dormant bud cDNA library Populus ... 60 2e-04 1 ( CK110478 ) N067A08 Populus bark cDNA library Populus tremul...04 1 ( BU887484 ) R062A08 Populus root cDNA library Populus tremula... 60 2e-04 1 ( BU880608 ) UM52TC12 Populus flower cDNA library...us tremula cambium cDNA library Po... 60 2e-04 1 ( BU819297 ) UA42BPA08 Populus tremula cambium cDNA library

C and C* among intermediate rings

NARCIS (Netherlands)

Sack, J.; Watson, S.

2014-01-01

Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA,

Competitive cAMP Antagonists for cAMP-Receptor Proteins

NARCIS (Netherlands)

Haastert, Peter J.M. van; Driel, Roel van; Jastorff, Bernd; Baraniak, Janina; Stec, Wojciech J.; Wit, René J.W. de

1984-01-01

The two exocyclic oxygen atoms at phosphorus of cAMP have been replaced by a sulfur atom or by a dimethylamino group. These substitutions introduce chirality at the phosphorus atom; therefore, two diastereoisomers are known for each derivative: (SP)-cAMPS, (RP)-cAMPS, (SP)-cAMPN(CH3)2, and

Fabrication of Z-scheme plasmonic photocatalyst Ag@AgBr/g-C3N4 with enhanced visible-light photocatalytic activity

International Nuclear Information System (INIS)

Yang, Yuxin; Guo, Wan; Guo, Yingna; Zhao, Yahui; Yuan, Xing; Guo, Yihang

2014-01-01

Graphical abstract: - Highlights: • Z-scheme plasmonic photocatalyst of Ag@AgBr/g-C 3 N 4 is prepared for the first time. • Ag@AgBr/g-C 3 N 4 shows enhanced visible-light photocatalytic activity. • Photocatalytic mechanism based on the experimental results is revealed. • Photocatalytic degradation pathway of MO is put forward. - Abstract: A series of Ag@AgBr grafted graphitic carbon nitride (Ag@AgBr/g-C 3 N 4 ) plasmonic photocatalysts are fabricated through photoreducing AgBr/g-C 3 N 4 hybrids prepared by deposition–precipitation method. The phase and chemical structures, electronic and optical properties as well as morphologies of Ag@AgBr/g-C 3 N 4 heterostructures are well-characterized. Subsequently, the photocatalytic activity of Ag@AgBr/g-C 3 N 4 is evaluated by the degradation of methyl orange (MO) and rhodamin B (RB) under visible-light irradiation. The enhanced photocatalytic activity of Ag@AgBr/g-C 3 N 4 compared with g-C 3 N 4 and Ag@AgBr is obtained and explained in terms of the efficient visible-light utilization efficiency as well as the construction of Z-scheme, which keeps photogenerated electrons and holes with high reduction and oxidation capability, evidenced by photoelectrochemical tests and free radical and hole scavenging experiments. Based on the intermediates identified in the reaction system, the photocatalytic degradation pathway of MO is put forward

Electrical resistivity and thermal conductivity of SiC/Si ecoceramics prepared from sapele wood biocarbon

Science.gov (United States)

Parfen'eva, L. S.; Orlova, T. S.; Smirnov, B. I.; Smirnov, I. A.; Misiorek, H.; Mucha, J.; Jezowski, A.; Gutierrez-Pardo, A.; Ramirez-Rico, J.

2012-10-01

Samples of β-SiC/Si ecoceramics with a silicon concentration of ˜21 vol % have been prepared using a series of consecutive procedures (carbonization of sapele wood biocarbon, synthesis of high-porosity biocarbon with channel-type pores, infiltration of molten silicon into empty channels of the biocarbon, formation of β-SiC, and retention of residual silicon in channels of β-SiC). The electrical resistivity ρ and thermal conductivity κ of the β-SiC/Si ecoceramic samples have been measured in the temperature range 5-300 K. The values of ρ{Si/chan}( T) and κ{Si/chan}( T) have been determined for silicon Sichan located in β-SiC channels of the synthesized β-SiC/Si ecoceramics. Based on the performed analysis of the obtained results, the concentration of charge carriers (holes) in Sichan has been estimated as p ˜ 1019 cm-3. The factors that can be responsible for such a high value of p have been discussed. The prospects for practical application of β-SiC/Si ecoceramics have been considered.

A new SiC/C bulk FGM for fusion reactor

International Nuclear Information System (INIS)

Changchun, G.; Anhua, W.; Wenbin, C.; Jiangtao, L.

2001-01-01

Graphite is widely used in present Tokamak facilities and a C/C composite has been selected as one of the candidate materials for the ITER. But C-based material has an excessive chemical sputtering yield at 600-1000 K and exhibits irradiation enhanced sublimation at >1200 K under plasma erosion condition, causing serious C-contamination of plasma. Low Z material SiC has several advantages for use in fusion reactor, such as excellent high temperature properties, corrosion resistance, low density, and especially its low activation irradiation. To reduce C contamination during plasma exposure, previously SiC coatings were chemically deposited on the surface of C-substrate, however, the thermal stresses arise on the interface between the coating layers and the substrate under high temperature. Heating/cooling cycle leading to cracks in SiC/C interface, small thickness of coating and long processing time are limiting factors for FGM made with CVD process. In this paper, a new SiC/C bulk FGM has been successfully fabricated with P/M hot pressing process. The chemical sputtering yield, gas desorption performance, thermal shock resistance and physical sputtering performance in Tokamak are outlined in this paper. (author)

Interfacial chemistry and energy band alignment of TiAlO on 4H-SiC determined by X-ray photoelectron spectroscopy

International Nuclear Information System (INIS)

Wang, Qian; Cheng, Xinhong; Zheng, Li; Ye, Peiyi; Li, Menglu; Shen, Lingyan; Li, Jingjie; Zhang, Dongliang; Gu, Ziyue; Yu, Yuehui

2017-01-01

Highlights: • Composite TiAlO rather than TiO_2-Al_2O_3 laminations is deposited on 4H-SiC by PEALD. • An interfacial layer composed of Ti, Si, O and C forms between TiAlO and 4H-SiC. • TiAlO offers competitive barrier heights (>1 eV) for both electrons and holes. - Abstract: Intermixing of TiO_2 with Al_2O_3 to form TiAlO films on 4H-SiC is expected to simultaneously boost the dielectric constant and achieve sufficient conduction/valence band offsets (CBO/VBO) between dielectrics and 4H-SiC. In this work, a composite TiAlO film rather than TiO_2-Al_2O_3 laminations is deposited on 4H-SiC by plasma enhanced atomic layer deposition (PEALD). X-ray photoelectron spectroscopy (XPS) is performed to systematically analyze the interfacial chemistry and energy band alignment between TiAlO and 4H-SiC. An interfacial layer composed of Ti, Si, O and C forms between TiAlO and 4H-SiC during PEALD process. The VBO and CBO between TiAlO and 4H-SiC are determined to be 1.45 eV and 1.10 eV, respectively, which offer competitive barrier heights (>1 eV) for both electrons and holes and make it suitable for the fabrication of 4H-SiC metal-oxide-semiconductor field effect transistors (MOSFETs).

Interfacial chemistry and energy band alignment of TiAlO on 4H-SiC determined by X-ray photoelectron spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Wang, Qian [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Micro-System & Information Technology, Chinese Academy of Sciences, Changning Road 865, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Cheng, Xinhong, E-mail: xh_cheng@mail.sim.ac.cn [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Micro-System & Information Technology, Chinese Academy of Sciences, Changning Road 865, Shanghai 200050 (China); Zheng, Li, E-mail: zhengli@mail.sim.ac.cn [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Micro-System & Information Technology, Chinese Academy of Sciences, Changning Road 865, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Ye, Peiyi; Li, Menglu [Department of Materials Science and Engineering, University of California, Los Angeles, CA, 90095 (United States); Shen, Lingyan; Li, Jingjie; Zhang, Dongliang; Gu, Ziyue [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Micro-System & Information Technology, Chinese Academy of Sciences, Changning Road 865, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Yu, Yuehui [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Micro-System & Information Technology, Chinese Academy of Sciences, Changning Road 865, Shanghai 200050 (China)

2017-07-01

Highlights: • Composite TiAlO rather than TiO{sub 2}-Al{sub 2}O{sub 3} laminations is deposited on 4H-SiC by PEALD. • An interfacial layer composed of Ti, Si, O and C forms between TiAlO and 4H-SiC. • TiAlO offers competitive barrier heights (>1 eV) for both electrons and holes. - Abstract: Intermixing of TiO{sub 2} with Al{sub 2}O{sub 3} to form TiAlO films on 4H-SiC is expected to simultaneously boost the dielectric constant and achieve sufficient conduction/valence band offsets (CBO/VBO) between dielectrics and 4H-SiC. In this work, a composite TiAlO film rather than TiO{sub 2}-Al{sub 2}O{sub 3} laminations is deposited on 4H-SiC by plasma enhanced atomic layer deposition (PEALD). X-ray photoelectron spectroscopy (XPS) is performed to systematically analyze the interfacial chemistry and energy band alignment between TiAlO and 4H-SiC. An interfacial layer composed of Ti, Si, O and C forms between TiAlO and 4H-SiC during PEALD process. The VBO and CBO between TiAlO and 4H-SiC are determined to be 1.45 eV and 1.10 eV, respectively, which offer competitive barrier heights (>1 eV) for both electrons and holes and make it suitable for the fabrication of 4H-SiC metal-oxide-semiconductor field effect transistors (MOSFETs).

Dicty_cDB: SHE451 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu

Dicty_cDB: SFE866 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...protein. 94 1e-21 2 AL385573 |AL385573.1 Medicago truncatula EST MtBC29C12F1 : T3 end of clone MtBC29C12 of

Dicty_cDB: SSJ172 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago tru...te cds. 494 e-147 3 AL386374 |AL386374.1 Medicago truncatula EST MtBC34C06F1 : T3 end of clone MtBC34C06 of

Mol 7C/6; Mol 7C/6

Energy Technology Data Exchange (ETDEWEB)

Aberle, J.; Schleisiek, K.; Schmuck, I.; Schmidt, L.; Romer, O.; Weih, G.

1995-08-01

The Mol 7C/6 coolant blockage experiment in the Belgian BR2 reactor yielded results different from Mol 7C experiments with low burnup pins: At 10% burnup local failure is not self-limiting, but requires active systems for detection and scram. The Mol 7C series was finished in 1991. In each of the test bundles Mol 7C/4, /5 and /6, 30 Mk I pins pre-irradiated in KNK II were used. The central blockage consisted of enriched UO{sub 2} covering 30 percent of the bundle cross-section, with a height of 40 mm. The most important system for timely detection of coolant blockages of the type studied in Mol 7C/6 is based on DND. (orig.)

Reassessment of the C-13/C-12 and C-14/C-12 isotopic fractionation ratio and its impact on high-precision radiocarbon dating

NARCIS (Netherlands)

Fahrni, Simon M.; Southon, John R.; Santos, Guaciara M.; Palstra, Sanne W. L.; Meijer, Harro A. J.; Xu, Xiaomei

2017-01-01

The vast majority of radiocarbon measurement results (C-14/C-12 isotopic ratios or sample activities) are corrected for isotopic fractionation processes (measured as C-13/C-12 isotopic ratios) that occur in nature, in sample preparation and measurement. In 1954 Harmon Craig suggested a value of 2.0

Selective terminal C–C scission of C5-carbohydrates

NARCIS (Netherlands)

Klis, van der F.; Gootjes, L.; Haveren, van J.; Es, van D.S.; Bitter, J.H.

2015-01-01

The selective catalytic production of C4-tetritols (erythritol and threitol) from C5-sugars is an attractive route for the conversion of non-digestible sugars to C4-building blocks from agro residues. Here we show that an unprecedented high selectivity of 20–25% C4-tertritols can be achieved under

The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation

Energy Technology Data Exchange (ETDEWEB)

Krishnan, Vengadesan [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Xu, Yuanyuan [Division of Clinical Immunology and Rheumatology, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Macon, Kevin [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Volanakis, John E. [Department of Medicine, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Narayana, Sthanam V. L., E-mail: narayana@uab.edu [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States)

2009-03-01

The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg{sup 2+}-dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein.

The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation

International Nuclear Information System (INIS)

Krishnan, Vengadesan; Xu, Yuanyuan; Macon, Kevin; Volanakis, John E.; Narayana, Sthanam V. L.

2009-01-01

The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg 2+ -dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein

A complex of cardiac cytochrome c1 and cytochrome c.

Science.gov (United States)

Chiang, Y L; Kaminsky, L S; King, T E

1976-01-10

The interactions of cytochrome c1 and cytochrome c from bovine cardiac mitochondria were investigated. Cytochrome c1 and cytochrome c formed a 1:1 molecular complex in aqueous solutions of low ionic strength. The complex was stable to Sephadex G-75 chromatography. The formation and stability of the complex were independent of the oxidation state of the cytochrome components as far as those reactions studied were concerned. The complex was dissociated in solutions of ionic strength higher than 0.07 or pH exceeding 10 and only partially dissociated in 8 M urea. No complexation occurred when cytochrome c was acetylated on 64% of its lysine residues or photooxidized on its 2 methionine residues. Complexes with molecular ratios of less than 1:1 (i.e. more cytochrome c) were obtained when polymerized cytochrome c, or cytochrome c with all lysine residues guanidinated, or a "1-65 heme peptide" from cyanogen bromide cleavage of cytochrome c was used. These results were interpreted to imply that the complex was predominantly maintained by ionic interactions probably involving some of the lysine residues of cytochrome c but with major stabilization dependent on the native conformations of both cytochromes. The reduced complex was autooxidizable with biphasic kinetics with first order rate constants of 6 X 10(-5) and 5 X U0(-5) s-1 but did not react with carbon monoxide. The complex reacted with cyanide and was reduced by ascorbate at about 32% and 40% respectively, of the rates of reaction with cytochrome c alone. The complex was less photoreducible than cytochrome c1 alone. The complex exhibited remarkably different circular dichroic behavior from that of the summation of cytochrome c1 plus cytochrome c. We concluded that when cytochromes c1 and c interacted they underwent dramatic conformational changes resulting in weakening of their heme crevices. All results available would indicate that in the complex cytochrome c1 was bound at the entrance to the heme crevice of

Screening effects on 12C+12C fusion reaction

Science.gov (United States)

Koyuncu, F.; Soylu, A.

2018-05-01

One of the important reactions for nucleosynthesis in the carbon burning phase in high-mass stars is the 12C+12C fusion reaction. In this study, we investigate the influences of the nuclear potentials and screening effect on astrophysically interesting 12C+12C fusion reaction observables at sub-barrier energies by using the microscopic α–α double folding cluster (DFC) potential and the proximity potential. In order to model the screening effects on the experimental data, a more general exponential cosine screened Coulomb (MGECSC) potential including Debye and quantum plasma cases has been considered in the calculations for the 12C+12C fusion reaction. In the calculations of the reaction observables, the semi-classical Wentzel-Kramers-Brillouin (WKB) approach and coupled channel (CC) formalism have been used. Moreover, in order to investigate how the potentials between 12C nuclei produce molecular cluster states of 24Mg, the normalized resonant energy states of 24Mg cluster bands have been calculated for the DFC potential. By analyzing the results produced from the fusion of 12C+12C, it is found that taking into account the screening effects in terms of MGECSC is important for explaining the 12C+12C fusion data, and the microscopic DFC potential is better than the proximity potential in explaining the experimental data, also considering that clustering is dominant for the structure of the 24Mg nucleus. Supported by the Turkish Science and Research Council (TÜBİTAK) with (117R015)

Dicty_cDB: Contig-U15640-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -15 3 ( EX266810 ) 1447411_5_I01_007 PY06 Carica papaya cDNA, mRNA s... 86 4e-15 3 ( EX123475 ) BR107305 mature green leaf cDNA libra....2 1 ( CN487418 ) EST2064 Puccinellia tenuiflora cDNA library Pucci... 48 1.2 1 ( CJ870341 ) Triticu...m cDNA, RIKEN fu... 44 2.2 2 ( CB283146 ) BT1417 Blomia tropicalis cDNA library Blomia trop... 40 2.4 2 ( AB174436 ) Macaca fascicul...malized ... 62 1e-08 2 ( CK265529 ) EST711607 potato abiotic stress cDNA library Sola... 62 1e-08 2 ( DV6022...45C09.g Maize Endosperm cDNA Library Zea ... 56 2e-07 4 ( CK259915 ) EST705993 potato abiotic stress cDNA library

Chemical vapor deposition of SiC on C-C composites as plasma facing materials for fusion application

International Nuclear Information System (INIS)

Kim, W. J.; Lee, M. Y.; Park, J. Y.; Hong, G. W.; Kim, J. I.; Choi, D. J.

2000-01-01

Because of the low activation and excellent mechanical properties at elevated temperatures, carbon-fiber reinforced carbon(C-C) composites have received much attention for plasma facing materials for fusion reactor and high-temperature structural applications such as aircrafts and space vehicles. These proposed applications have been frustrated by the lack of resistance to hydrogen erosion and oxidation on exposure to ambient oxidizing conditions at high temperature. Although Silicon Carbide (SiC) has shown excellent properties as an effective erosion-and oxidation-protection coating, many cracks are developed during fabrication and thermal cycles in use due to the Coefficients of Thermal Expansion(CTE) mismatch between SiC and C-C composite. In this study, we adopted a pyrolitic carbon as an interlayer between SiC and C-C substrate in order to minimize the CTE mismatch. The oxidation-protection performance of this composite was investigated as well

Dicty_cDB: CHJ706 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 09 6 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA ...5', mRNA sequence. 54 2e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiz

Metal-organic cooperative catalysis in C-H and C-C bond activation and its concurrent recovery.

Science.gov (United States)

Park, Young Jun; Park, Jung-Woo; Jun, Chul-Ho

2008-02-01

The development of an efficient catalytic activation (cleavage) system for C-H and C-C bonds is an important challenge in organic synthesis, because these bonds comprise a variety of organic molecules such as natural products, petroleum oils, and polymers on the earth. Among many elegant approaches utilizing transition metals to activate C-H and C-C bonds facilely, chelation-assisted protocols based on the coordinating ability of an organic moiety have attracted great attention, though they have often suffered from the need for an intact coordinating group in a substrate. In this Account, we describe our entire efforts to activate C-H or C-C bonds adjacent to carbonyl groups by employing a new concept of metal-organic cooperative catalysis (MOCC), which enables the temporal installation of a 2-aminopyridyl group into common aldehydes or ketones in a catalytic way. Consequently, a series of new catalytic reactions such as alcohol hydroacylation, oxo-ester synthesis, C-C triple bond cleavage, hydrative dimerization of alkynes, and skeletal rearrangements of cyclic ketones was realized through MOCC. In particular, in the quest for an optimized MOCC system composed of a Wilkinson's catalyst (Ph 3P) 3RhCl and an organic catalyst (2-amino-3-picoline), surprising efficiency enhancements could be achieved when benzoic acid and aniline were introduced as promoters for the aldimine formation process. Furthermore, a notable accomplishment of C-C bond activation has been made using 2-amino-3-picoline as a temporary chelating auxiliary in the reactions of unstrained ketones with various terminal olefins and Wilkinson's catalyst. In the case of seven-membered cyclic ketones, an interesting ring contraction to five- or six-membered ones takes place through skeletal rearrangements initiated by the C-C bond activation of MOCC. On the other hand, the fundamental advances of these catalytic systems into recyclable processes could be achieved by immobilizing both metal and organic

Accelerated C# 2010

CERN Document Server

Nash, Trey

2010-01-01

C# 2010 offers powerful new features, and this book is the fastest path to mastering them-and the rest of C#-for both experienced C# programmers moving to C# 2010 and programmers moving to C# from another object-oriented language. Many books introduce C#, but very few also explain how to use it optimally with the .NET Common Language Runtime (CLR). This book teaches both core C# language concepts and how to wisely employ C# idioms and object-oriented design patterns to exploit the power of C# and the CLR. This book is both a rapid tutorial and a permanent reference. You'll quickly master C# sy

Electronically excited C 2 from laser photodissociated C 60

Science.gov (United States)

Arepalli, S.; Scott, C. D.; Nikolaev, P.; Smalley, R. E.

2000-03-01

Spectral and transient emission measurements are made of radiation from products of laser excitation of buckminsterfullerene (C 60) vapor diluted in argon at 973 K. The principal radiation is from the Swan band system of C 2 and, at early times, also from a black-body continuum. Transient measurements indicate two characteristic periods of decay 2 and 50 μs long, with characteristic decay times of ˜0.3 and 5 μs, respectively. The first period is thought to be associated with decomposition and radiative cooling of C 60 molecules or nano-sized carbon particles and the second period continues with decomposition products of laser excited C 60, C 58, C 56, etc.

Josephson effect in superfluid helium 3 during flow through small hole

International Nuclear Information System (INIS)

Kopnin, N.B.

1986-01-01

The Josephson current flowing in helium 3 through a small hole near the critical temperature is calculated. In diffusion particle reflection from vessel walls the critical current is proportional to (T c -T) 2 , and in mirror reflection it is proportional to (T c -T)

GEMINI PLANET IMAGER SPECTROSCOPY OF THE HR 8799 PLANETS c AND d

International Nuclear Information System (INIS)

Ingraham, Patrick; Macintosh, Bruce; Marley, Mark S.; Saumon, Didier; Marois, Christian; Dunn, Jennifer; Erikson, Darren; Barman, Travis; Bauman, Brian; Burrows, Adam; Chilcote, Jeffrey K.; Fitzgerald, Michael P.; De Rosa, Robert J.; Dillon, Daren; Gavel, Donald; Doyon, René; Goodsell, Stephen J.; Hartung, Markus; Hibon, Pascale; Graham, James R.

2014-01-01

During the first-light run of the Gemini Planet Imager we obtained K-band spectra of exoplanets HR 8799 c and d. Analysis of the spectra indicates that planet d may be warmer than planet c. Comparisons to recent patchy cloud models and previously obtained observations over multiple wavelengths confirm that thick clouds combined with horizontal variation in the cloud cover generally reproduce the planets' spectral energy distributions. When combined with the 3 to 4 μm photometric data points, the observations provide strong constraints on the atmospheric methane content for both planets. The data also provide further evidence that future modeling efforts must include cloud opacity, possibly including cloud holes, disequilibrium chemistry, and super-solar metallicity

Dicty_cDB: Contig-U16300-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 632 ) 95999.1 Cold Sweetening C Solanum tuberosum cDNA ... 62 2e-14 3 ( CK280013 ) EST726091 potato abiotic stress cDNA library...(Normalize... 72 6e-18 4 ( CK277106 ) EST723184 potato abiotic stress cDNA library Sola... 56 7e-18 4 ( CK25...na cDNA 5', ... 74 5e-14 4 ( CX082679 ) EHAB017TR E. histolytica Normalized cDNA library ... 52...( CX089904 ) EHAE563TR E. histolytica Normalized cDNA library ... 52 7e-14 4 ( EB...a strain T4 cDNA library. 56 1e-12 4 ( AB077052 ) Nicotiana tabacum NtCK2a3 mRNA for casein kina

OPTICAL MONITORING OF THE BROAD-LINE RADIO GALAXY 3C 390.3

International Nuclear Information System (INIS)

Dietrich, Matthias; Peterson, Bradley M.; Grier, Catherine J.; Bentz, Misty C.; Eastman, Jason; Frank, Stephan; Gonzalez, Raymond; Marshall, Jennifer L.; DePoy, Darren L.; Prieto, Jose L.

2012-01-01

We have undertaken a new ground-based monitoring campaign on the broad-line radio galaxy 3C 390.3 to improve the measurement of the size of the broad emission-line region and to estimate the black hole mass. Optical spectra and g-band images were observed in late 2005 for three months using the 2.4 m telescope at MDM Observatory. Integrated emission-line flux variations were measured for the hydrogen Balmer lines Hα, Hβ, Hγ, and for the helium line He IIλ4686, as well as g-band fluxes and the optical active galactic nucleus (AGN) continuum at λ = 5100 Å. The g-band fluxes and the optical AGN continuum vary simultaneously within the uncertainties, τ cent (0.2 ± 1.1) days. We find that the emission-line variations are delayed with respect to the variable g-band continuum by τ(Hα) 56.3 +2.4 –6.6 days, τ(Hβ) = 44.3 +3.0 –3.3 days, τ(Hγ) = 58.1 +4.3 –6.1 days, and τ(He II 4686) = 22.3 +6.5 –3.8 days. The blue and red peaks in the double-peaked line profiles, as well as the blue and red outer profile wings, vary simultaneously within ±3 days. This provides strong support for gravitationally bound orbital motion of the dominant part of the line-emitting gas. Combining the time delay of the strong Balmer emission lines of Hα and Hβ and the separation of the blue and red peaks in the broad double-peaked profiles in their rms spectra, we determine M vir bh = 1.77 +0.29 –0.31 × 10 8 M ☉ and using σ line of the rms spectra M vir bh 2.60 +0.23 –0.31 × 10 8 M ☉ for the central black hole of 3C 390.3, respectively. Using the inclination angle of the line-emitting region which is measured from superluminal motion detected in the radio range, accretion disk models to fit the optical double-peaked emission-line profiles, and X-ray observations, the mass of the black hole amounts to M bh = 0.86 +0.19 –0.18 × 10 9 M ☉ (peak separation) and M bh 1.26 +0.21 –0.16 × 10 9 M ☉ (σ line ), respectively. This result is consistent with the black

Mechanical properties of hot-pressed SiC-TiC composites

Directory of Open Access Journals (Sweden)

Kamil Kornaus

2017-12-01

Full Text Available SiC-TiC composites, with 0, 5, 10 and 20 vol.% of TiC, were sintered by the hot-pressing technique at temperature of 2000 °C under argon atmosphere. SiC sintering process was activated by liquid phase created by the reaction between Al2O3 and Y2O3, in which it is possible to dissolve passivating oxide layers (SiO2 and TiO2 and partially SiC and TiC carbides. Microstructure observation and density measurements confirmed that the composites were dense with uniformly distributed components. Differences in thermal expansion coefficients between SiC and TiC led to complex stress state occurrence. These stresses combined with the liquid-derived separate phase between grains boundaries increased fracture toughness of the composites, which ranged from 5.8 to 6.3 MPa·m0.5. Opposite to the bending strength, fracture toughness increased with the TiC volume fraction. By means of simulation of residual thermal stresses in the composites, it was found that with the increasing volume fraction of TiC, tensile stress in TiC grains is reduced simultaneously with strong rise of compressive stresses in the matrix.

Dysfunctional C8 beta chain in patients with C8 deficiency.

Science.gov (United States)

Tschopp, J; Penea, F; Schifferli, J; Späth, P

1986-12-01

Two sera from unrelated individuals, each lacking C8 activity, were examined by Western blot analysis. Using antisera raised against whole C8, the two sera are shown to lack the C8 beta chain, indicating a C8 beta deficiency, which is frequently observed in cases of dysfunctional C8. In contrast, by means of a specific anti-C8-beta antiserum, a C8 beta-like polypeptide chain of apparently identical molecular weight compared to normal C8 beta was detected. Digestion of normal and dysfunctional C8 beta with Staphylococcus aureus V8 protease revealed distinct differences in the enzymatic digestion pattern. We conclude that the dysfunction in the C8 protein in these two patients resides in the dysfunctional C8 beta chain, and that this form of C8 deficiency is distinct from C8 deficiencies previously reported, in which one or both C8 subunits are lacking.

Professional C++

CERN Document Server

Gregoire, Marc; Kleper, Scott J

2011-01-01

Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that

Complete cDNA sequence of human complement C1s and close physical linkage of the homologous genes C1s and C1r

International Nuclear Information System (INIS)

Tosi, M.; Duponchel, C.; Meo, T.; Julier, C.

1987-01-01

Overlapping molecular clones encoding the complement subcomponent C1s were isolated from a human liver cDNA library. The nucleotide sequence reconstructed from these clones spans about 85% of the length of the liver C1s messenger RNAs, which occur in three distinct size classes around 3 kilobases in length. Comparisons with the sequence of C1r, the other enzymatic subcomponent of C1, reveal 40% amino acid identity and conservation of all the cysteine residues. Beside the serine protease domain, the following sequence motifs, previously described in C1r, were also found in C1s: (a) two repeats of the type found in the Ba fragment of complement factor B and in several other complement but also noncomplement proteins, (b) a cysteine-rich segment homologous to the repeats of epidermal growth factor precursor, and (c) a duplicated segment found only in C1r and C1s. Differences in each of these structural motifs provide significant clues for the interpretation of the functional divergence of these interacting serine protease zymogens. Hybridizations of C1r and C1s probes to restriction endonuclease fragments of genomic DNA demonstrate close physical linkage of the corresponding genes. The implications of this finding are discussed with respect to the evolution of C1r and C1s after their origin by tandem gene duplication and to the previously observed combined hereditary deficiencies of Clr and Cls

Warped AdS3 black holes

International Nuclear Information System (INIS)

Anninos, Dionysios; Li Wei; Padi, Megha; Song Wei; Strominger, Andrew

2009-01-01

Three dimensional topologically massive gravity (TMG) with a negative cosmological constant -l -2 and positive Newton constant G admits an AdS 3 vacuum solution for any value of the graviton mass μ. These are all known to be perturbatively unstable except at the recently explored chiral point μl = 1. However we show herein that for every value of μl ≠ 3 there are two other (potentially stable) vacuum solutions given by SL(2,R) x U(1)-invariant warped AdS 3 geometries, with a timelike or spacelike U(1) isometry. Critical behavior occurs at μl = 3, where the warping transitions from a stretching to a squashing, and there are a pair of warped solutions with a null U(1) isometry. For μl > 3, there are known warped black hole solutions which are asymptotic to warped AdS 3 . We show that these black holes are discrete quotients of warped AdS 3 just as BTZ black holes are discrete quotients of ordinary AdS 3 . Moreover new solutions of this type, relevant to any theory with warped AdS 3 solutions, are exhibited. Finally we note that the black hole thermodynamics is consistent with the hypothesis that, for μl > 3, the warped AdS 3 ground state of TMG is holographically dual to a 2D boundary CFT with central charges c R -formula and c L -formula.

Effect of sintering temperature on structure of C-B4C-SiC composites with silicon additive

International Nuclear Information System (INIS)

Wu Lijun; Academia Sinica, Shenyang; Huang Qizhong; Yang Qiaoqin; Zhao Lihu; Xu Zhongyu

1996-01-01

Carbon materials possess good electric conductivity, heat conductivity, corrosion-resistance, self-lubrication and hot-shocking resistance, and are easily machined. However, they have low mechanical strength, and are easily oxidized in air at high temperature. On the contrary, ceramic materials have high mechanical strength and hardness, and have good wear-resistance and oxidation-resistance. However, they have the shortages of poor thermal-shock resistance lubrication, and are difficult to machine. Therefore, carbon/ceramic composites with the advantages of both carbon and ceramic materials have been widely studied in the recent years. Huang prepared C-B 4 C-SiC composites with the free sintering method and the hot pressing method, and studied the effects of Si, Al, Al 2 O 3 , Ni and Ti additives on the properties of the composites. The results showed that these additives could improve the properties of the composites. Zhao et al. studies the structure of C-B 4 C-SiC composites with Si additive sintered at 2,000 C and found two c-center monoclinic phases. In this paper, the authors discussed the effect of the sintering temperature on the structure of C-B 4 C-SiC composites with Si additive by means of transmission electron microscope (TEM) and x-ray diffractometer (XRD)

New class of accelerating black hole solutions

International Nuclear Information System (INIS)

Camps, Joan; Emparan, Roberto

2010-01-01

We construct several new families of vacuum solutions that describe black holes in uniformly accelerated motion. They generalize the C metric to the case where the energy density and tension of the strings that pull (or push) on the black holes are independent parameters. These strings create large curvatures near their axis and when they have infinite length they modify the asymptotic properties of the spacetime, but we discuss how these features can be dealt with physically, in particular, in terms of 'wiggly cosmic strings'. We comment on possible extensions and extract lessons for the problem of finding higher-dimensional accelerating black hole solutions.

C.C.D. readout of a picosecond streak camera with an intensified C.C.D

International Nuclear Information System (INIS)

Lemonier, M.; Richard, J.C.; Cavailler, C.; Mens, A.; Raze, G.

1984-08-01

This paper deals with a digital streak camera readout device. The device consists in a low light level television camera made of a solid state C.C.D. array coupled to an image intensifier associated to a video-digitizer coupled to a micro-computer system. The streak camera images are picked-up as a video signal, digitized and stored. This system allows the fast recording and the automatic processing of the data provided by the streak tube

Investigation of low spin resonances in the 12C+12C and 16O+12C systems

International Nuclear Information System (INIS)

Uzureau, J.L.; Fieni, J.M.; Cocu, F.; Michaudon, A.

1979-01-01

The excitation functions of the 12 C( 12 C,α) 20 Ne and 12 C( 16 O,α) 24 Mg reactions were measured at different angles below the Coulomb barrier. Resonant structures were found at Esub(cm)=5.80 MeV in the 12 C+ 12 C system and at Esub(cm)=6.10 MeV in the 16 O+ 12 C system. From the analysis of angular distributions measured at the previous resonant energies, values of respectively Jsup(π)=0 + and 2 + have been deduced [fr

Dicty_cDB: CHM552 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available actuca sativa cDNA clone QGB20J11, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA ...Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 3e-09 3 CV172465 |CV172465.1 rsmsx

Dicty_cDB: SHL126 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ce. 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorr...hiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia m

Dicty_cDB: SHG607 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available sativa cDNA clone QGJ1L02, mRNA sequence. 80 9e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library... of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre

Dicty_cDB: Contig-U14038-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW708366 ) EST031847 Tric...hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW693636 ) EST017117 Trichophyton rubrum cDNA library 3 Tric...... 54 0.006 1 ( DW688891 ) EST012372 Trichophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW688872 ) EST012353 Tric...hophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW686711 ) EST010192 Tric...hophyton rubrum cDNA library 1 Tric... 54 0.006 1 ( DW685118 ) EST008599 Trichophyton rubrum cDNA library 1 Tric

Dicty_cDB: Contig-U05851-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 92694 ) ENTMF30TR Entamoeba histolytica Sheared DNA Entam... 36 2.2 2 ( DT758331 ) EST1192180 Aquilegia cDNA library...CX093708 ) EHAFO88TR E. histolytica Normalized cDNA library ... 56 7e-04 2 ( CX084682 ) EHABU33TR E. histolytica Normalized cDNA libr...ary ... 56 7e-04 2 ( CX084490 ) EHABR37TR E. histolytica Normalized cDNA library .....a Normalized cDNA library ... 56 0.001 2 ( CX085755 ) EHAC996TR E. histolytica Normalized cDNA library... 2 ( DT754356 ) EST1188205 Aquilegia cDNA library Aquilegia formo... 46 0.010 2 (

Dicty_cDB: Contig-U15146-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available us BAC clone RP24-129G21 from chromosom... 38 1.7 4 ( FG066604 ) dlbw0_003512 cDNA library... of cambium of Betula pl... 40 2.6 2 ( FG065202 ) dlbw0_000186 cDNA library of cambium of Betul...0 2 ( FG065344 ) dlbw0_000454 cDNA library of cambium of Betula pl... 40 3.1 2 ( FG067998 ) dlbw0_005638 cDNA library...vus cDNA 3', mRNA ... 34 3.7 2 ( BU836156 ) T083C10 Populus apical shoot cDNA library Popul... 1 ( BU572652 ) PA__Ea0001H21f Almond developing seed Prunus dulc... 48 0.25 1 ( BQ641167 ) EST290 almond cDNA library Prunus dul

High-temperature protective coatings for C/SiC composites

Directory of Open Access Journals (Sweden)

Xiang Yang

2014-12-01

Full Text Available Carbon fiber-reinforced silicon carbide (C/SiC composites were well-established light weight materials combining high specific strength and damage tolerance. For high-temperature applications, protective coatings had to provide oxidation and corrosion resistance. The literature data introduced various technologies and materials, which were suitable for the application of coatings. Coating procedures and conditions, materials design limitations related to the reactivity of the components of C/SiC composites, new approaches and coating systems to the selection of protective coatings materials were examined. The focus of future work was on optimization by further multilayer coating systems and the anti-oxidation ability of C/SiC composites at temperatures up to 2073 K or higher in water vapor.

Energy level alignment at C{sub 60}/DTDCTB/PEDOT:PSS interfaces in organic photovoltaics

Energy Technology Data Exchange (ETDEWEB)

Yoo, Jisu; Jung, Kwanwook; Jeong, Junkyeong; Hyun, Gyeongho [Institute of Physics and Applied Physics, Yonsei University, 50 Yonsei-ro, Seodaemun-gu, Seoul 03722 (Korea, Republic of); Lee, Hyunbok, E-mail: hyunbok@kangwon.ac.kr [Department of Physics, Kangwon National University, Chuncheon-si, Gangwon-do 24341 (Korea, Republic of); Yi, Yeonjin, E-mail: yeonjin@yonsei.ac.kr [Institute of Physics and Applied Physics, Yonsei University, 50 Yonsei-ro, Seodaemun-gu, Seoul 03722 (Korea, Republic of)

2017-04-30

Highlights: • The interfacial energy level alignment of C{sub 60}/DTDCTB/PEDOT:PSS was determined via in situ UPS and IPES measurements. • A large photovoltaic gap of 1.30 eV was evaluated between the DTDCTB donor and C{sub 60} acceptor. • A low hole extraction barrier of 0.42 eV from DTDCTB to PEDOT:PSS was evaluated. • The excellent electronic properties of DTDCTB with a narrow band gap were the source of its high OPV power conversion efficiencies. - Abstract: The electronic structure of a narrow band gap small molecule ditolylaminothienyl–benzothiadiazole–dicyanovinylene (DTDCTB), possessing a donor-acceptor-acceptor configuration, was investigated with regard to its application as an efficient donor material in organic photovoltaics (OPVs). The interfacial orbital alignment of C{sub 60}/DTDCTB/poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS) was determined using in situ ultraviolet photoelectron and inverse photoelectron spectroscopic methods. The ionization energy and electron affinity values of DTDCTB were measured to be 5.27 eV and 3.65 eV, respectively, and thus a very small transport gap of 1.62 eV was evaluated. Large band bending of DTDCTB on PEDOT:PSS was observed, resulting in a low hole extraction barrier. Additionally, the photovoltaic gap between the highest occupied molecular orbital level of the DTDCTB donor and the lowest unoccupied molecular orbital level of the C{sub 60} acceptor was estimated to be 1.30 eV, which is known to be the theoretical maximum open-circuit voltage in OPVs employing the C{sub 60}/DTDCTB active layer. The unique electronic structures of DTDCTB contributed toward the recently reported excellent power conversion efficiencies of OPVs containing a DTDCTB donor material.

Synthesis of (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolic acid, methyl (1'-/sup 13/C)olivetolate and (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolic acid

Energy Technology Data Exchange (ETDEWEB)

Porwoll, J P; Leete, E [Minnesota Univ., Minneapolis (USA). Dept. of Chemistry

1985-03-01

Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.

Efficient processing of two-dimensional arrays with C or C++

Science.gov (United States)

Donato, David I.

2017-07-20

Because fast and efficient serial processing of raster-graphic images and other two-dimensional arrays is a requirement in land-change modeling and other applications, the effects of 10 factors on the runtimes for processing two-dimensional arrays with C and C++ are evaluated in a comparative factorial study. This study’s factors include the choice among three C or C++ source-code techniques for array processing; the choice of Microsoft Windows 7 or a Linux operating system; the choice of 4-byte or 8-byte array elements and indexes; and the choice of 32-bit or 64-bit memory addressing. This study demonstrates how programmer choices can reduce runtimes by 75 percent or more, even after compiler optimizations. Ten points of practical advice for faster processing of two-dimensional arrays are offered to C and C++ programmers. Further study and the development of a C and C++ software test suite are recommended.Key words: array processing, C, C++, compiler, computational speed, land-change modeling, raster-graphic image, two-dimensional array, software efficiency

Dicty_cDB: SLA508 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e-101 SLD569 (SLD569Q) /CSM/SL/SLD5-C/SLD569Q.Seq.d/ 250 1e-65 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...oideum slug cDNA, clone SLD569. 250 2e-62 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 7

Boron-Based Catalysts for C-C Bond-Formation Reactions.

Science.gov (United States)

Rao, Bin; Kinjo, Rei

2018-05-02

Because the construction of the C-C bond is one of the most significant reactions in organic chemistry, the development of an efficient strategy has attracted much attention throughout the synthetic community. Among various protocols to form C-C bonds, organoboron compounds are not just limited to stoichiometric reagents, but have also made great achievements as catalysts because of the easy modification of the electronic and steric impacts on the boron center. This review presents recent developments of boron-based catalysts applied in the field of C-C bond-formation reactions, which are classified into four kinds on the basis of the type of boron catalyst: 1) highly Lewis acidic borane, B(C 6 F 5 ) 3 ; 2) organoboron acids, RB(OH) 2 , and their ester derivatives; 3) borenium ions, (R 2 BL)X; and 4) other miscellaneous kinds. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox

International Nuclear Information System (INIS)

Maul, W.; Scherling, D.; Seng, F.

1981-01-01

Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)

Rapid radioimmunoassay of human apolipoproteins C-II and C-III

Energy Technology Data Exchange (ETDEWEB)

Gustafson, S; Oestlund-Lindqvist, A M; Vessby, B [Uppsala Univ. (Sweden)

1984-06-01

Apolipoprotein (apo) C-II is an activator of lipoprotein lipase, while apo C-III has the ability to inhibit apo C-II activated lipolysis. In order to study further the relationship between lipoprotein lipase mediated hydrolysis and the serum concentrations of apo C-II and apo C-III radioimmunoassays for these apolipoproteins have been developed. Formalin-treated Staphylococcus aureus Cowan I was used for immunoprecipitation and were shown to give rapid uptake of immune complexes that could easily be harvested by centrifugation. The assays were shown to be sensitive (10 ..mu..g/1), specific, precise (inter- and intra-assay coefficients of variation below 10%), rapid (completed in less than 6 h) and simple to perform. Delipidation of serum and lipoproteins had no effect on the results, indicating that the immunologically active sites of apo C-II and apo C-III are exposed to the aqueous environment under assay conditions. Serum apo C-II and apo C-III levels of normolipidaemic subjects were approximately 25 mg/1 and 110 mg/1, respectively. Highly significant positive correlations were found between VLDL apo C-II and VLDL apo C-III, respectively, and VLDL triglycerides, VLDL cholesterol and total serum TG. There was also a highly significant correlation between the HDL cholesterol concentration and the HDL apo C-III concentration.

Room-temperature in situ fabrication of Bi2O3/g-C3N4 direct Z-scheme photocatalyst with enhanced photocatalytic activity

Science.gov (United States)

He, Rongan; Zhou, Jiaqian; Fu, Huiqing; Zhang, Shiying; Jiang, Chuanjia

2018-02-01

Constructing direct Z-scheme heterojunction is an effective approach to separating photogenerated charge carriers and improving the activity of semiconductor photocatalysts. Herein, a composite of bismuth(III) oxide (Bi2O3) and graphitic carbon nitride (g-C3N4) was in situ fabricated at room temperature by photoreductive deposition of Bi3+ and subsequent air-oxidation of the resultant metallic Bi. Quantum-sized ω-Bi2O3 nanoparticles approximately 6 nm in diameter were uniformly distributed on the surface of mesoporous g-C3N4. The as-prepared Bi2O3/g-C3N4 composite exhibited higher photocatalytic activity than pure Bi2O3 and g-C3N4 for photocatalytic degradation of phenol under visible light. Reactive species trapping experiments revealed that superoxide radicals and photogenerated holes played important roles in the photocatalytic degradation of phenol. The enhanced photocatalytic activity, identification of reactive species and higher rate of charge carrier recombination (as indicated by stronger photoluminescence intensity) collectively suggest that the charge migration within the Bi2O3/g-C3N4 composite followed a Z-scheme mechanism. Photogenerated electrons on the conduction band of Bi2O3 migrate to the valence band of g-C3N4 and combine with photogenerated holes therein. At the cost of these less reactive charge carriers, the Z-scheme heterojunction enables efficient charge separation, while preserving the photogenerated electrons and holes with stronger redox abilities, which is beneficial for enhanced photocatalytic activity.

Direct approaches to nitriles via highly efficient nitrogenation strategy through C-H or C-C bond cleavage.

Science.gov (United States)

Wang, Teng; Jiao, Ning

2014-04-15

Because of the importance of nitrogen-containing compounds in chemistry and biology, organic chemists have long focused on the development of novel methodologies for their synthesis. For example, nitrogen-containing compounds show up within functional materials, as top-selling drugs, and as bioactive molecules. To synthesize these compounds in a green and sustainable way, researchers have focused on the direct functionalization of hydrocarbons via C-H or C-C bond cleavage. Although researchers have made significant progress in the direct functionalization of simple hydrocarbons, direct C-N bond formation via C-H or C-C bond cleavage remains challenging, in part because of the unstable character of some N-nucleophiles under oxidative conditions. The nitriles are versatile building blocks and precursors in organic synthesis. Recently, chemists have achieved the direct C-H cyanation with toxic cyanide salts in the presence of stoichiometric metal oxidants. In this Account, we describe recent progress made by our group in nitrile synthesis. C-H or C-C bond cleavage is a key process in our strategy, and azides or DMF serve as the nitrogen source. In these reactions, we successfully realized direct nitrile synthesis using a variety of hydrocarbon groups as nitrile precursors, including methyl, alkenyl, and alkynyl groups. We could carry out C(sp(3))-H functionalization on benzylic, allylic, and propargylic C-H bonds to produce diverse valuable synthetic nitriles. Mild oxidation of C═C double-bonds and C≡C triple-bonds also produced nitriles. The incorporation of nitrogen within the carbon skeleton typically involved the participation of azide reagents. Although some mechanistic details remain unclear, studies of these nitrogenation reactions implicate the involvement of a cation or radical intermediate, and an oxidative rearrangement of azide intermediate produced the nitrile. We also explored environmentally friendly oxidants, such as molecular oxygen, to make our

Electronic structure and static dipole polarizability of C60-C240

International Nuclear Information System (INIS)

Zope, Rajendra R

2008-01-01

The electronic structure of C 60 -C 240 and its first-order response to a static electric field is studied by an all-electron density functional theory calculation using large polarized Gaussian basis sets. Our results show that the outer C 240 shell almost completely shields the inner C 60 as inferred from the practically identical values of dipole polarizability of the C 60 -C 240 onion (449 A 3 ) and that of the isolated C 240 fullerene (441 A 3 ). The C 60 -C 240 is thus a near-perfect Faraday cage

Dicty_cDB: VSA784 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available tula EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...C10B03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrh... cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 62...13 |AL382813.1 Medicago truncatula EST MtBC10B03R1 : T7 end of clone MtBC10B03 of

Dicty_cDB: Contig-U12612-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 50 2e-14 5 ( DW406140 ) EST000561 Trichophyton rubrum cDNA library Tricho... 50 2e-14 5 ( C... CAPH Naegleria gruberi amoeba stage ... 48 2e-15 6 ( DW703626 ) EST027107 Trichophyton rubrum cDNA library 7 Tric...... 50 7e-15 5 ( DW405704 ) EST000125 Trichophyton rubrum cDNA library Tric...ho... 50 1e-14 5 ( DW683765 ) EST007246 Trichophyton rubrum cDNA library 1 Tric... 50 1e-14 5 ( DW678803 ) EST002284 Tric...hophyton rubrum cDNA library 0 Tric... 50 1e-14 5 ( DW697736 ) EST021217 Trichophyton rubrum cDNA library 6 Tric

Dicty_cDB: Contig-U15176-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available m... 52 0.039 1 ( CX098067 ) EHAHG37TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX097486 ) EHAH754TR E. histolytic...a Normalized cDNA library ... 52 0.039 1 ( CX097433 ) EHAH676TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097412 ) EHAH643TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097231 ) EHAH379TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX...096775 ) EHAGX23TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX096109 ) EHAGN19TR E. histolytica Normalized cDNA librar

Dicty_cDB: SFC593 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available IIIIIIIIIXXHXHX A Frame B: ---sssssssssssssssssssssssssssssssssssssssssssssssssssvxixix l Frame C: ---hhhh...hhhhhhhxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhxssssss s Homology vs CSM-cDNA *****

Vitamin C

Science.gov (United States)

... values to calculate your total daily recommended amount. What foods provide vitamin C? Fruits and vegetables are the ... lessen cooking losses. Fortunately, many of the best food sources of vitamin C, ... raw. What kinds of vitamin C dietary supplements are available? ...

Hepatitis C

Science.gov (United States)

... an inflammation of the liver. One type, hepatitis C, is caused by the hepatitis C virus (HCV). It usually spreads through contact with ... childbirth. Most people who are infected with hepatitis C don't have any symptoms for years. If ...

Schwarzschild black holes as unipolar inductors: Expected electromagnetic power of a merger

International Nuclear Information System (INIS)

Lyutikov, Maxim

2011-01-01

The motion of a Schwarzschild black hole with velocity v 0 =β 0 c through a constant magnetic field B 0 in vacuum induces a component of the electric field along the magnetic field, generating a nonzero second Poincare electromagnetic invariant * F·F≠0. This will produce (e.g., via radiative effects and vacuum breakdown) an electric charge density of the order of ρ ind =B 0 β 0 /(2πeR G ), where R G =2GM/c 2 is the Schwarzschild radius and M is the mass of the black hole; the charge density ρ ind is similar to the Goldreich-Julian density. The magnetospheres of moving black holes resemble in many respects the magnetospheres of rotationally-powered pulsars, with pair formation fronts and outer gaps, where the sign of the induced charge changes. As a result, the black hole will generate bipolar electromagnetic jets each consisting of two counter-aligned current flows (four current flows total), each carrying an electric current of the order I≅eB 0 R G β 0 . The electromagnetic power of the jets is L≅(GM) 2 B 0 2 β 0 2 /c 3 ; for a particular case of merging black holes the resulting Poynting power is L≅(GM) 3 B 0 2 /(c 5 R), where R is the radius of the orbit. In addition, in limited regions near the horizon the first electromagnetic invariant changes sign, so that the induced electric field becomes larger than the magnetic field, E>B. As a result, there will be local dissipation of the magnetic field close to the horizon, within a region with the radial extent ΔR≅R G β 0 . The total energy loss from a system of merging black holes is a sum of two components with similar powers, one due to the rotation of space-time within the orbit, driven by the nonzero angular momentum in the system, and the other due to the linear motion of the black holes through the magnetic field. Since the resulting electrodynamics is in many respects similar to pulsars, merging black holes may generate coherent radio and high energy emission beamed approximately along the

Hagedorn temperature and physics of black holes

International Nuclear Information System (INIS)

Zakharov, V.I.; Mertens, Thomas G.; Verschelde, Henri

2016-01-01

A mini-review devoted to some implications of the Hagedorn temperature for black hole physics. The existence of a limiting temperature is a generic feature of string models. The Hagedorn temperature was introduced first in the context of hadronic physics. Nowadays, the emphasis is shifted to fundamental strings which might be a necessary ingredient to obtain a consistent theory of black holes. The point is that, in field theory, the local temperature close to the horizon could be arbitrarily high, and this observation is difficult to reconcile with the finiteness of the entropy of black holes. After preliminary remarks, we review our recent attempt to evaluate the entropy of large black holes in terms of fundamental strings. We also speculate on implications for dynamics of large-N_c gauge theories arising within holographic models

Application of C/C composites to the combustion chamber of rocket engines. Part 1: Heating tests of C/C composites with high temperature combustion gases

Science.gov (United States)

Tadano, Makoto; Sato, Masahiro; Kuroda, Yukio; Kusaka, Kazuo; Ueda, Shuichi; Suemitsu, Takeshi; Hasegawa, Satoshi; Kude, Yukinori

1995-04-01

Carbon fiber reinforced carbon composite (C/C composite) has various superior properties, such as high specific strength, specific modulus, and fracture strength at high temperatures of more than 1800 K. Therefore, C/C composite is expected to be useful for many structural applications, such as combustion chambers of rocket engines and nose-cones of space-planes, but C/C composite lacks oxidation resistivity in high temperature environments. To meet the lifespan requirement for thermal barrier coatings, a ceramic coating has been employed in the hot-gas side wall. However, the main drawback to the use of C/C composite is the tendency for delamination to occur between the coating layer on the hot-gas side and the base materials on the cooling side during repeated thermal heating loads. To improve the thermal properties of the thermal barrier coating, five different types of 30-mm diameter C/C composite specimens constructed with functionally gradient materials (FGM's) and a modified matrix coating layer were fabricated. In this test, these specimens were exposed to the combustion gases of the rocket engine using nitrogen tetroxide (NTO) / monomethyl hydrazine (MMH) to evaluate the properties of thermal and erosive resistance on the thermal barrier coating after the heating test. It was observed that modified matrix and coating with FGM's are effective in improving the thermal properties of C/C composite.

Studies on 14C-extractable residue, 14C-bound residue and mineralization of 14C-labeled chlorsulfuron in soils

International Nuclear Information System (INIS)

Ye Qingfu; Sun Jinhe; Qi Wenyuan; Wu Jianmin

2003-01-01

The purpose of the present study was to investigate 14 C-extractable residue ( 14 C-ER), 14 C-bound residue ( 14 C-BR) and mineralization of 14 C-labeled chlorsulfuron in soils by using isotope technique. The main factors affecting 14 C-BR formation and the distribution pattern of 14 C-BR in humus were also discussed in details. The results were as follows: (1) The 14 C-ER content of 14 C-chlorsulfuron in seven kinds of soil was positively related to soil pH and negatively related to clay content and organic matter content significantly. Moreover. the decrease rate of 14 C-chlorsulfuron parent compound derived from 14 C-ER in soils followed the first order rate reaction, the half-life in Soil 1-Soil 7 were 13.0, 13.1, 17.7, 133.3, 21.8, 22.1, 33.2 days, respectively. It was concluded that soil pH was the main factor affecting the degradation of 14 C-chlorsulfuron. (2) The 14 C-BR content of 14 C-chlorsulfuron in soils increased sharply with the incubation time during the initial 20 days, then changed slowly with time. However, 14 C-BR content during the whole incubation depended on soil types. The order of 14 C-BR content followed Soil 1 > Soil 2, Soil 5 and Soil 6 > Soil 3 > Soil 7 > Soil 4. The maximum values of 14 C-BR content of 14 C-chlorsulfuron in Soil 1-Soil 7 were 53.3%, 40.9%, 37.8%, 16.4%, 42.5%, 41.0% and 31.3% of applied amount. In addition, the 14 C-BR content of 14 C-chlorsulfuron in soils was negatively related to soil pH significantly, and positively related to the clay content. The soil pH was found to be the main factor affecting BR formation of 14 C-chlorsulfuron among the basic properties of soil. (3) During the whole periods of the incubation, the 14 C-BR of 14 C-chlorsulfuron in soils was mainly distributed in fulvic acid and humin. The relative percent of 14 C-BR in fulvic acid was higher than in humin. While the relative percentage of the 14 C-BR in humic acid only account for 2%. It was suggested that fulvic acid played an important role

Elevated c-Src and c-Yes expression in malignant skin cancers

Directory of Open Access Journals (Sweden)

Lee Jang

2010-08-01

Full Text Available Abstracts Background Src family kinases (SFKs play an important role in cancer proliferation, survival, motility, invasiveness, metastasis, and angiogenesis. Among the SFKs, c-Src and c-Yes are particularly over-expressed or hyper-activated in many human epithelial cancers. However, only a few studies have attempted to define the expression and role of c-Src and c-Yes in cutaneous carcinomas. Objectives To investigate the expression of c-Src and c-Yes in cutaneous carcinomas to include malignant melanoma (MM, squamous cell carcinoma (SCC and basal cell carcinoma (BCC. Methods We examined 6 normal skin tissues and 18 malignant skin tumor tissues using western blotting for the expression of c-Src and c-Yes. In another set, 16 specimens of MM, 16 SCCs and 16 BCCs were analyzed for the expression of c-Src and c-Yes using immunohistochemical staining. Results Western blotting showed that c-Src was expressed in all malignant skin tumors, but not in normal skin, while c-Yes was expressed in MM and SCC, but not in BCC and normal skin. Immunohistochemical staining results of c-Src and c-Yes in MM, SCC, and BCC mirrored those of the western blot analysis. Conclusions c-Src, rather than c-Yes, plays a key role in the proliferation and progression of malignant skin cancers.

Effects of low atmospheric CO2 and elevated temperature during growth on the gas exchange responses of C3, C3-C4 intermediate, and C4 species from three evolutionary lineages of C4 photosynthesis.

Science.gov (United States)

Vogan, Patrick J; Sage, Rowan F

2012-06-01

This study evaluates acclimation of photosynthesis and stomatal conductance in three evolutionary lineages of C(3), C(3)-C(4) intermediate, and C(4) species grown in the low CO(2) and hot conditions proposed to favo r the evolution of C(4) photosynthesis. Closely related C(3), C(3)-C(4), and C(4) species in the genera Flaveria, Heliotropium, and Alternanthera were grown near 380 and 180 μmol CO(2) mol(-1) air and day/night temperatures of 37/29°C. Growth CO(2) had no effect on photosynthetic capacity or nitrogen allocation to Rubisco and electron transport in any of the species. There was also no effect of growth CO(2) on photosynthetic and stomatal responses to intercellular CO(2) concentration. These results demonstrate little ability to acclimate to low CO(2) growth conditions in closely related C(3) and C(3)-C(4) species, indicating that, during past episodes of low CO(2), individual C(3) plants had little ability to adjust their photosynthetic physiology to compensate for carbon starvation. This deficiency could have favored selection for more efficient modes of carbon assimilation, such as C(3)-C(4) intermediacy. The C(3)-C(4) species had approximately 50% greater rates of net CO(2) assimilation than the C(3) species when measured at the growth conditions of 180 μmol mol(-1) and 37°C, demonstrating the superiority of the C(3)-C(4) pathway in low atmospheric CO(2) and hot climates of recent geological time.

Dicty_cDB: SLH810 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available frhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Translated Amino Acid sequence (Al...rame C: *fncyfrhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Homology vs CSM-cDNA

Neutron tolerance of advanced SiC-fiber/CVI-SiC composites

International Nuclear Information System (INIS)

Katoh, Y.; Kohyama, A.; Snead, L.L.; Hinoki, T.; Hasegawa, A.

2003-01-01

Fusion blankets employing a silicon carbide (SiC) fiber-reinforced SiC matrix composite (SiC/SiC composite) as the structural material provide attractive features represented by high cycle efficiency and extremely low induced radioactivity. Recent advancement in processing and utilization techniques and application studies in ceramic gas turbine and advanced transportation systems, SiC/SiC composites are steadily getting matured as industrial materials. Reference SiC/SiC composites for fusion structural applications have been produced by a forced-flow chemical vapor infiltration (FCVI) method using conventional and advanced near-stoichiometric SiC fibers and extensively evaluated primarily in Japan-US collaborative JUPITER program. In this work, effect of neutron irradiation at elevated temperatures on mechanical property of these composites is characterized. Unlike in conventional SiC/SiC composites, practically no property degradation was identified in advanced composites with a thin carbon interphase by a neutron fluence level of approximately 8dpa at 800C. (author)

Materials and mechanisms of hole superconductivity

Energy Technology Data Exchange (ETDEWEB)

Hirsch, J.E., E-mail: jhirsch@ucsd.edu [Department of Physics, University of California, San Diego, La Jolla, CA 92093-0319 (United States)

2012-01-15

We study the applicability of the model of hole superconductivity to materials. Both conventional and unconventional materials are considered. Many different classes of materials are discussed. The theory is found suitable to describe all of them. No other theory of superconductivity can describe all these classes of materials. The theory of hole superconductivity proposes that there is a single mechanism of superconductivity that applies to all superconducting materials. This paper discusses several material families where superconductivity occurs and how they can be understood within this theory. Materials discussed include the elements, transition metal alloys, high T{sub c} cuprates both hole-doped and electron-doped, MgB{sub 2}, iron pnictides and iron chalcogenides, doped semiconductors, and elements under high pressure.

Dicty_cDB: Contig-U16006-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ne 01 Psig64s-55C regio... 50 0.22 1 ( EU648429 ) Psiguria umbrosa clone 05 Psig6...4s-55C region geno... 50 0.22 1 ( EU648428 ) Psiguria umbrosa clone 04 Psig64s-55C region geno... 50 0.22 1 ( EU648427 ) Psiguri...a umbrosa clone 03 Psig64s-55C region geno... 50 0.22 1 ( EU648426 ) Psiguria umbrosa cl...one 02 Psig64s-55C region geno... 50 0.22 1 ( EU648425 ) Psiguria umbrosa clone 0...1 Psig64s-55C region geno... 50 0.22 1 ( EU648423 ) Psiguria pedata clone 07 Psig64s-55C region genom... 50

Dicty_cDB: Contig-U02963-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 3 ( CK246139 ) EST729776 potato callus cDNA library, normalized ... 36 0.066 2 ( CK260957 ) EST707035 potato abiotic stress cDNA libr...ary Sola... 36 0.066 2 ( CK264509 ) EST710587 potato abiotic stress cDNA library So...la... 36 0.066 2 ( CK270438 ) EST716516 potato abiotic stress cDNA library Sola.....e-12 3 ( FD432325 ) Atr01b_127_E02_C010.g1 FGP Male Amborella trichop... 50 4e-09 2 ( CF450348 ) EST686693 normalized cDNA library...GE498851 ) CCFT1427.b1_E22.ab1 CCF(STU) sunflower Helianthus... 42 0.005 2 ( DV105288 ) chiou01187 Subtractive cDNA library

Thermodynamic description of the C-Ge and C-Mg systems

Directory of Open Access Journals (Sweden)

Hu B.

2010-01-01

Full Text Available The thermodynamic modeling for the C-Ge and C-Mg systems is performed by the CALPHAD method. The enthalpy of formation for Mg2C3, the experimental value of which is not available in the literature, is obtained via first-principles calculation to refine the thermodynamic modeling of the C-Mg system. A comparison of the thermodynamic calculations with the available literature data shows that the presently obtained two sets of thermodynamic parameters for the C-Ge and C-Mg systems can well describe the these two systems.

Dicty_cDB: Contig-U03055-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -67 2 ( FG284490 ) 1108770671670 New World Screwworm Egg 9261 ESTs C... 143 7e-67... 3 ( FG286862 ) 1108770727001 New World Screwworm Egg 9261 ESTs C... 143 9e-67 3 ( FG284489 ) 1108770671669 New World...ld Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG286245 ) 1108770714398 New World... Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG290225 ) 1108793315348 New World Screw...T1 Hydractinia echinata cD... 147 1e-64 4 ( FG285211 ) 1108770694495 New World Screwworm Egg 9261 ESTs C...

Interfacial chemical and electronic structure of cobalt deposition on 2,7-dioctyl[1]benzothieno[3,2-b]benzothiophene (C8-BTBT)

Energy Technology Data Exchange (ETDEWEB)

Zhu, Menglong; Lyu, Lu [Institute of Super-Microstructure and Ultrafast Process in Advanced Materials, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Hunan Key Laboratory for Super-Microstructure and Ultrafast Process, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Niu, Dongmei, E-mail: mayee@csu.edu.cn [Institute of Super-Microstructure and Ultrafast Process in Advanced Materials, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Hunan Key Laboratory for Super-Microstructure and Ultrafast Process, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Zhang, Hong; Zhang, Yuhe; Liu, Peng [Institute of Super-Microstructure and Ultrafast Process in Advanced Materials, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Hunan Key Laboratory for Super-Microstructure and Ultrafast Process, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Gao, Yongli, E-mail: ygao@pas.rochester.edu [Institute of Super-Microstructure and Ultrafast Process in Advanced Materials, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Hunan Key Laboratory for Super-Microstructure and Ultrafast Process, School of Physics and Electronics, Central South University, Changsha, Hunan 410083 (China); Department of Physics and Astronomy, University of Rochester, Rochester NY14627 (United States)

2017-04-30

Highlights: • Chemical reaction and band bending at the interface are confirmed by the UPS and XPS. • Co atoms mostly accumulate at or near the interface and penetration into sublayer is weak. • The electron and hole barriers are too high and interfacial buffer layer is needed for device design. - Abstract: Interfacial chemical and electronic structure of Co deposition on 2,7-dioctyl[1]benzothieno[3,2-b]benzothiophene(C8-BTBT) was investigated by ultraviolet photoemission spectroscopy (UPS) and X-ray photoemission spectroscopy (XPS). Chemical reaction of cobalt with C8-BTBT at the interface is confirmed by a new component of S 2s peak which is electron-rich compared to the original one of C8-BTBT molecules. Intensity evolution of the core level in XPS indicates that the adsorption of Co atoms is mainly at the surface without deeper diffusion into C8-BTBT layer. Initial deposition of Co atoms downward shifts the core levels of C8-BTBT by electron transfer from isolated Co atoms or clusters to the C8-BTBT. Further deposition of Co upward shifts the core levels of C8-BTBT because of the neutralization of the thicker metal Co film. Our investigation suggests an inert buffer layer inserted to protect organic layer from reaction or decomposition and to lower the carrier barriers for both the electron and hole to improve the performance of Co/C8-BTBT-based OFETs.

Interfacial chemical and electronic structure of cobalt deposition on 2,7-dioctyl[1]benzothieno[3,2-b]benzothiophene (C8-BTBT)

International Nuclear Information System (INIS)

Zhu, Menglong; Lyu, Lu; Niu, Dongmei; Zhang, Hong; Zhang, Yuhe; Liu, Peng; Gao, Yongli

2017-01-01

Highlights: • Chemical reaction and band bending at the interface are confirmed by the UPS and XPS. • Co atoms mostly accumulate at or near the interface and penetration into sublayer is weak. • The electron and hole barriers are too high and interfacial buffer layer is needed for device design. - Abstract: Interfacial chemical and electronic structure of Co deposition on 2,7-dioctyl[1]benzothieno[3,2-b]benzothiophene(C8-BTBT) was investigated by ultraviolet photoemission spectroscopy (UPS) and X-ray photoemission spectroscopy (XPS). Chemical reaction of cobalt with C8-BTBT at the interface is confirmed by a new component of S 2s peak which is electron-rich compared to the original one of C8-BTBT molecules. Intensity evolution of the core level in XPS indicates that the adsorption of Co atoms is mainly at the surface without deeper diffusion into C8-BTBT layer. Initial deposition of Co atoms downward shifts the core levels of C8-BTBT by electron transfer from isolated Co atoms or clusters to the C8-BTBT. Further deposition of Co upward shifts the core levels of C8-BTBT because of the neutralization of the thicker metal Co film. Our investigation suggests an inert buffer layer inserted to protect organic layer from reaction or decomposition and to lower the carrier barriers for both the electron and hole to improve the performance of Co/C8-BTBT-based OFETs.

C++ evolves!

International Nuclear Information System (INIS)

Naumann, Axel

2014-01-01

C++ is used throughout High Energy Physics. CERN participates in the development of its standard. There has been a major shift in standardization procedures that will be visible starting 2014 with an increase rate of new standardized features. Already the current C++11 has major improvements, also for coding novices, related to simplicity, expressiveness, performance and robustness. Other major improvements are in the area of concurrency, where C++ is now on par with most other high level languages. To benefit from these language improvements and from the massive improvements in compiler technology for instance in usability, access to current compilers is crucial. Use of current C++ compiled with current compilers can considerably improve C++ for the HEP physicist community.

High thermal conductivity SiC/SiC composites for fusion applications -- 2

International Nuclear Information System (INIS)

Kowbel, W.; Tsou, K.T.; Withers, J.C.; Youngblood, G.E.

1998-01-01

This report covers material presented at the IEA/Jupiter Joint International Workshop on SiC/SiC Composites for Fusion Structural Applications held in conjunction with ICFRM-8, Sendai, Japan, Oct. 23--24, 1997. An unirradiated SiC/SiC composite made with MER-developed CVR SiC fiber and a hybrid PIP/CVI SiC matrix exhibited room temperature transverse thermal conductivity of 45 W/mK. An unirradiated SiC/SiC composite made from C/C composite totally CVR-converted to a SiC/SiC composite exhibited transverse thermal conductivity values of 75 and 35 W/mK at 25 and 1000 C, respectively. Both types of SiC/SiC composites exhibited non-brittle failure in flexure testing

Dicty_cDB: VSG286 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami

Dicty_cDB: CHJ796 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHJ796 (Link to dictyBase) - - - - - (Link to Original site) -... - CHJ796Z 123 - - - - Show CHJ796 Library CH (Link to library) Clone ID CHJ796 (Link to dictyBase) Atlas ID - NBRP ID - dic...ssues normalized and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 5prim end (...ed and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 3prim end (M13F primer). 36 0.47 2 AF239838...0804 |pid:none) Roseiflexus castenholzii DSM 139... 33 2.3 AY714838_16( AY714838 |pid:none) Uncultured archa

Dicty_cDB: SLC455 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLC455 (Link to dictyBase) - - - Contig-U16584-1 SLC455Z (Link... to Original site) - - SLC455Z 379 - - - - Show SLC455 Library SL (Link to library) Clone ID SLC455 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC455Q.Seq.d/ Representative seq. ID SLC45...5Z (Link to Original site) Representative DNA sequence >SLC455 (SLC455Q) /CSM/SL/SLC4-C/SLC455Q.Seq.d/ XXXXX...57 ) Dictyostelium discoideum slug cDNA, clone SLC469. 468 e-177 3 ( AU034549 ) Dictyostelium discoideum slug cDNA, clone SLC4

Thermal stability of nanocomposite CrC/a-C:H thin films

International Nuclear Information System (INIS)

Gassner, G.; Mayrhofer, P.H.; Patscheider, J.; Mitterer, C.

2007-01-01

The thermal stability of low-friction Me-C/a-C:H coatings is important for their potential applications in the tool and automotive industry. Recently we showed that CrC x /a-C:H coatings prepared by unbalanced magnetron sputtering of a Cr target in Ar + CH 4 glow discharges exhibit a nanocomposite structure where metastable fcc CrC nanocrystals are encapsulated by an a-C:H phase. Here, we present the structural evolution of these nanocomposite CrC/a-C:H coatings during annealing. High-temperature X-ray diffraction in vacuum and differential scanning calorimetry (DSC) combined with thermo-gravimetric analysis in Ar atmosphere indicate decomposition of the formed metastable fcc CrC phase and subsequent formation of Cr 3 C 2 and Cr 7 C 3 and structural transformation of the a-C:H matrix phase towards higher sp 2 bonding contents at temperatures above 450 deg. C. Combined DSC and mass spectrometer analysis as well as elemental profiling after annealing in vacuum by elastic recoil detection analysis relate this transformation to the loss of bonded hydrogen at temperatures above 200 deg. C. Due to these structural changes the coefficient of friction depends on the annealing temperature of the nanocomposite a-C:H coatings and shows a minimum of ∼ 0.13 for T = 200 deg. C. The more complex tribochemical reactions, influenced by the hydrogen loss from the coating during in-situ high temperatures ball-on disc tests, result in coefficient of friction values below 0.05 for T < 120 deg. C

Cyclic voltammetric analysis of C 1-C 4 alcohol electrooxidations with Pt/C and Pt-Ru/C microporous electrodes

Science.gov (United States)

Lee, Choong-Gon; Umeda, Minoru; Uchida, Isamu

The effect of temperature on methanol, ethanol, 2-propanol, and 2-butanol electrooxidation is investigated with Pt/C and Pt-Ru/C microporous electrodes. Cyclic voltammetry is employed in temperatures ranging from 25 to 80 °C to provide quantitative and qualitative information on the kinetics of alcohol oxidation. Methanol displays the greatest activity atom alcohols. The addition of ruthenium reduces the poisoning effect, although it is ineffective with secondary alcohols. Secondary alcohols undergo a different oxidation mechanism at higher temperatures. Microporous electrodes provide detailed information on alcohol oxidation.

Practical C++ programming

National Research Council Canada - National Science Library

Oualline, Steve

2003-01-01

... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xv Part I. The Basics 1. What Is C++? A Brief History of C++ C++ Organization How to Learn C++...

Rhenium-Promoted C-C Bond-Cleavage Reactions of Internal Propargyl Alcohols.

Science.gov (United States)

Lee, Kui Fun; Bai, Wei; Sung, Herman H Y; Williams, Ian D; Lin, Zhenyang; Jia, Guochen

2018-06-07

The first examples of C-C bond cleavage reactions of internal propargyl alcohols to give vinylidene complexes are described. Treatment of [Re(dppm) 3 ]I with RC≡CC(OH)R'R'' (R=aryl, alkyl; C(OH)R'R''=C(OH)Ph 2, C(OH)Me 2 , C(OH)HPh, C(OH)H 2 ) produced the vinylidene complexes ReI(=C=CHR)(dppm) 2 with the elimination of C(O)R'R''. Computational studies support that the reactions proceed through a β-alkynyl elimination of alkoxide intermediates Re{OC(R')(R'')C≡CR}(dppm) 2 . © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Ti-decorated graphitic-C{sub 3}N{sub 4} monolayer: A promising material for hydrogen storage

Energy Technology Data Exchange (ETDEWEB)

Zhang, Weibin [Department of Physics, Dongguk University, Seoul 04620 (Korea, Republic of); Zhang, Zhijun [Department of Physics, Dongguk University, Seoul 04620 (Korea, Republic of); School of Materials Science and Engineering, Shanghai University, Shanghai 200072 (China); Zhang, Fuchun [College of Physics and Electronic Information, Yan’an University, Yan’an 716000 (China); Yang, Woochul, E-mail: wyang@dongguk.edu [Department of Physics, Dongguk University, Seoul 04620 (Korea, Republic of)

2016-11-15

Highlights: • Ti atoms are stably decorated at the triangular N hole in g-C{sub 3}N{sub 4} with an adsorption energy of −7.58 eV. • Electron redistribution of Ti-adsorbed porous g-C{sub 3}N{sub 4} significantly enhanced hydrogen adsorption up to five H{sub 2} molecules at each Ti atom. • The hydrogen capacity of the Ti-decorated g-C{sub 3}N{sub 4} system reaches up to 9.70 wt%. • All H{sub 2} absorbed in the Ti/g-C{sub 3}N{sub 4} system can be released at 393 K according to the molecular dynamic analysis. • Ti/g-C{sub 3}N{sub 4} as a hydrogen storage system is suitable and reversible at the temperature range required for practical applications. - Abstract: Ti-decorated graphitic carbon nitride (g-C{sub 3}N{sub 4}) monolayer as a promising material system for high-capacity hydrogen storage is proposed through density functional theory calculations. The stability and hydrogen adsorption of Ti-decorated g-C{sub 3}N{sub 4} is analyzed by computing the adsorption energy, the charge population, and electronic density of states. The most stable decoration site of Ti atom is the triangular N hole in g-C{sub 3}N{sub 4} with an adsorption energy of −7.58 eV. The large diffusion energy barrier of the adsorbed Ti atom of ∼6.00 eV prohibits the cluster formation of Ti atoms. The electric field induced by electron redistribution of Ti-adsorbed porous g-C{sub 3}N{sub 4} significantly enhanced hydrogen adsorption up to five H{sub 2} molecules at each Ti atom with an average adsorption energy of −0.30 eV/H{sub 2}. The corresponding hydrogen capacity reaches up to 9.70 wt% at 0 K. In addition, the hydrogen capacity is predicted to be 6.30 wt% at 233 K and all adsorbed H{sub 2} are released at 393 K according to molecular dynamics simulation. Thus, the Ti-decorated g-C{sub 3}N{sub 4} monolayer is suggested to be a promising material for hydrogen storage suggested by the DOE for commercial applications.

C anti c q anti q states

Energy Technology Data Exchange (ETDEWEB)

Chao, K T [Oxford Univ. (UK). Dept. of Theoretical Physics; Science Research Council, Chilton (UK). Rutherford and Appleton Labs.)

1980-07-01

Taking account of the colour magnetic and electric forces, we discuss the spectroscopy of various types of c anti c q anti q states. Their decay, hadronic production, production in e/sup +/e/sup -/ annihilation as well as photoproduction are also studied.

Dicty_cDB: AFH538 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e-165 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 7...ge Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehydr...ation Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK030146.1

Dicty_cDB: SLJ419 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clon...ly-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm

Fabrication of SiC Composites with Synergistic Toughening of Carbon Whisker and In Situ 3C-SiC Nanowire

Directory of Open Access Journals (Sweden)

Zhang Yunlong

2016-01-01

Full Text Available The SiC composites with synergistic toughening of carbon whisker and in situ 3C-SiC nanowire have been fabricated by hot press sinter technology and annealed treatment technology. Effect of annealed time on the morphology of SiC nanowires and mechanical properties of the Cw/SiC composites was surveyed in detail. The appropriate annealed time improved mechanical properties of the Cw/SiC composites. The synergistic effect of carbon whisker and SiC nanowire can improve the fracture toughness for Cw/SiC composites. The vapor-liquid-solid growth (VLS mechanism was proposed. TEM photo showed that 3C-SiC nanowire can be obtained with preferential growth plane ({111}, which corresponded to interplanar spacing about 0.25 nm.

Activated Integrin-Linked Kinase Negatively Regulates Muscle Cell Enhancement Factor 2C in C2C12 Cells

Directory of Open Access Journals (Sweden)

Zhenguo Dong

2015-01-01

Full Text Available Our previous study reported that muscle cell enhancement factor 2C (MEF2C was fully activated after inhibition of the phosphorylation activity of integrin-linked kinase (ILK in the skeletal muscle cells of goats. It enhanced the binding of promoter or enhancer of transcription factor related to proliferation of muscle cells and then regulated the expression of these genes. In the present investigation, we explored whether ILK activation depended on PI3K to regulate the phosphorylation and transcriptional activity of MEF2C during C2C12 cell proliferation. We inhibited PI3K activity in C2C12 with LY294002 and then found that ILK phosphorylation levels and MEF2C phosphorylation were decreased and that MCK mRNA expression was suppressed significantly. After inhibiting ILK phosphorylation activity with Cpd22 and ILK-shRNA, we found MEF2C phosphorylation activity and MCK mRNA expression were increased extremely significantly. In the presence of Cpd22, PI3K activity inhibition increased MEF2C phosphorylation and MCK mRNA expression indistinctively. We conclude that ILK negatively and independently of PI3K regulated MEF2C phosphorylation activity and MCK mRNA expression in C2C12 cells. The results provide new ideas for the study of classical signaling pathway of PI3K-ILK-related proteins and transcription factors.

P-wave excited {B}_{c}^{* * } meson photoproduction at the LHeC

Science.gov (United States)

Kai, He; Huan-Yu, Bi; Ren-You, Zhang; Xiao-Zhou, Li; Wen-Gan, Ma

2018-05-01

As an important sequential work of the S-wave {B}c(* ) ({}1{S}0({}3{S}1) ) meson production at the large hadron electron collider (LHeC), we investigate the production of the P-wave excited {B}c* * states (1 P 1 and 3 P J with J = 0, 1, 2) via photoproduction mechanism within the framework of nonrelativistic QCD at the LHeC. Generally, the {e}-+P\\to γ +g\\to {B}c* * +b+\\bar{c} process is considered as the main production mechanism at an electron–proton collider due to the large luminosity of the gluon. However, according to our experience on the S-wave {B}c(* ) meson production at the LHeC, the extrinsic production mechanism, i.e., {e}-+P\\to γ +c\\to {B}c* * +b and {e}-+P\\to γ +\\bar{b} \\to {B}c* * +\\bar{c}, could also provide dominating contributions at low p T region. A careful treatment between these channels is performed and the results on total and differential cross sections, together with main uncertainties are discussed. Taking the quark masses m b = 4.90 ± 0.40 GeV and m c = 1.50 ± 0.20 GeV into account and summing up all the production channels, we expect to accumulate ({2.48}-1.75+3.55)× {10}4 {B}c* * ({}1{P}1), ({1.14}-0.82+1.49)× {10}4 {B}c* * ({}3{P}0),({2.38}-1.74+3.39)× {10}4 {B}c* * ({}3{P}1) and ({5.59}-3.93+7.84)× {10}4 {B}c* * ({}3{P}2) events at the \\sqrt{S}=1.30 {{T}}{{e}}{{V}} LHeC in one operation year with luminosity { \\mathcal L }={10}33 cm‑2 s‑1. With such sizable events, it is worth studying the properties of excited P-wave {B}c* * states at the LHeC.

Synthesis of (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolic acid, methyl (1'-/sup 13/C)olivetolate and (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolic acid

Energy Technology Data Exchange (ETDEWEB)

Porwoll, J.P.; Leete, E. (Minnesota Univ., Minneapolis (USA). Dept. of Chemistry)

1985-03-01

Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.

Dicty_cDB: VSJ516 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mlhqv ntlvtllspiktmlkspvlmliltckrik*nkik*khtix*iiy Frame C: neiiisplfrscfsfpifhps...kqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqciry sr*nr

Assessment of Durable SiC JFET Technology for +600 C to -125 C Integrated Circuit Operation

Science.gov (United States)

Neudeck, P. G.; Krasowski, M. J.; Prokop, N. F.

2011-01-01

Electrical characteristics and circuit design considerations for prototype 6H-SiC JFET integrated circuits (ICs) operating over the broad temperature range of -125 C to +600 C are described. Strategic implementation of circuits with transistors and resistors in the same 6H-SiC n-channel layer enabled ICs with nearly temperature-independent functionality to be achieved. The frequency performance of the circuits declined at temperatures increasingly below or above room temperature, roughly corresponding to the change in 6H-SiC n-channel resistance arising from incomplete carrier ionization at low temperature and decreased electron mobility at high temperature. In addition to very broad temperature functionality, these simple digital and analog demonstration integrated circuits successfully operated with little change in functional characteristics over the course of thousands of hours at 500 C before experiencing interconnect-related failures. With appropriate further development, these initial results establish a new technology foundation for realizing durable 500 C ICs for combustion engine sensing and control, deep-well drilling, and other harsh-environment applications.

Dicty_cDB: Contig-U04229-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 9 ) HAE00002983 Home-made, regular (lib1_ha) Histiona... 44 0.001 2 ( CK888692 ) SGP160684 Atlantic salmon Liver cDNA library...2 ( DE224908 ) Trifolium pratense DNA, clone:RCG16896. 42 4e-04 2 ( CK888010 ) SGP149211 Atlantic salmon Liver cDNA library...A for TCP1 protein. 46 6e-04 2 ( CK887535 ) SGP164401 Atlantic salmon Kidney cDNA library Sal... 44 6e-04 2 ...mo salar cDNA, mRNA sequence. 44 0.001 2 ( CK889382 ) SGP161400 Atlantic salmon Liver cDNA library Salm... 4... salmon Liver cDNA library Salm... 44 0.001 2 ( CK888710 ) SGP160704 Atlantic salmon Liver cDNA library

Dicty_cDB: Contig-U01201-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca

Some fundamental and applicative properties of [polymer/nano-SiC] hybrid nanocomposites

International Nuclear Information System (INIS)

Kassiba, A; Boucle, J; Makowska-Janusik, M; Errien, N

2007-01-01

Hybrid nanocomposites which combine polymer as host matrix and nanocrystals as active elements are promising functional materials for electronics, optics or photonics. In these systems, the physical response is governed by the nanocrystal features (size, surface and defect states), the polymer properties and the polymer-nanocrystal interface. This work reviews some selective nanostructured architectures based on active elements such as silicon carbide (SiC) nanocrystals and polymer host matrices. Beyond an overview of some key properties of the nanocrystals, a main part will be devoted to the electro-optical (EO) properties of SiC based hybrid systems where SiC nanocrystals are embedded in polymer matrices of different chemical nature such as poly-(methylmethacrylate) (PMMA), poly-vinylcarbazole (PVK) or polycarbonate. Using this approach, the organic-inorganic interface effects are emphasised with regard to the dielectric or hole transporting behaviour of PMMA and PVK respectively. These effects are illustrated through different EO responses associated with hybrid composites based on PMMA or PVK

Some fundamental and applicative properties of [polymer/nano-SiC] hybrid nanocomposites

Science.gov (United States)

Kassiba, A.; Bouclé, J.; Makowska-Janusik, M.; Errien, N.

2007-08-01

Hybrid nanocomposites which combine polymer as host matrix and nanocrystals as active elements are promising functional materials for electronics, optics or photonics. In these systems, the physical response is governed by the nanocrystal features (size, surface and defect states), the polymer properties and the polymer-nanocrystal interface. This work reviews some selective nanostructured architectures based on active elements such as silicon carbide (SiC) nanocrystals and polymer host matrices. Beyond an overview of some key properties of the nanocrystals, a main part will be devoted to the electro-optical (EO) properties of SiC based hybrid systems where SiC nanocrystals are embedded in polymer matrices of different chemical nature such as poly-(methylmethacrylate) (PMMA), poly-vinylcarbazole (PVK) or polycarbonate. Using this approach, the organic-inorganic interface effects are emphasised with regard to the dielectric or hole transporting behaviour of PMMA and PVK respectively. These effects are illustrated through different EO responses associated with hybrid composites based on PMMA or PVK.

Dicty_cDB: Contig-U16395-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available virus 241ext gene for puta... 41 0.060 C72174( C72174 ) D8R protein - variola minor virus (strain Garcia...rio proteasome (prosome, m... 40 0.10 C72175( C72175 ) G1R protein - variola minor virus (strain Garcia-...

Dicty_cDB: AFG169 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available --LMKNLN*twllihhhc*krnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rf...rnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rfirqcrliwwyny vpryc*s

Dicty_cDB: VFL581 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mgc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewl...gc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewla

Spirobifluorene Core-Based Novel Hole Transporting Materials for Red Phosphorescence OLEDs

Directory of Open Access Journals (Sweden)

Ramanaskanda Braveenth

2017-03-01

Full Text Available Two new hole transporting materials, named HTM 1A and HTM 1B, were designed and synthesized in significant yields using the well-known Buchwald Hartwig and Suzuki cross- coupling reactions. Both materials showed higher decomposition temperatures (over 450 °C at 5% weight reduction and HTM 1B exhibited a higher glass transition temperature of 180 °C. Red phosphorescence-based OLED devices were fabricated to analyze the device performances compared to Spiro-NPB and NPB as reference hole transporting materials. Devices consist of hole transporting material as HTM 1B showed better maximum current and power efficiencies of 16.16 cd/A and 11.17 lm/W, at the same time it revealed an improved external quantum efficiency of 13.64%. This efficiency is considerably higher than that of Spiro-NPB and NPB-based reference devices.

Major alterations in transcript profiles between C3-C4 and C4 photosynthesis of an amphibious species Eleocharis baldwinii.

Science.gov (United States)

Chen, Taiyu; Zhu, Xin-Guang; Lin, Yongjun

2014-09-01

Engineering C4 photosynthetic metabolism into C3 crops is regarded as a major strategy to increase crop productivity, and clarification of the evolutionary processes of C4 photosynthesis can help the better use of this strategy. Here, Eleocharis baldwinii, a species in which C4 photosynthesis can be induced from a C3-C4 state under either environmental or ABA treatments, was used to identify the major transcriptional modifications during the process from C3-C4 to C4. The transcriptomic comparison suggested that in addition to the major differences in C4 core pathway, the pathways of glycolysis, citrate acid metabolism and protein synthesis were dramatically modified during the inducement of C4 photosynthetic states. Transcripts of many transporters, including not only metabolite transporters but also ion transporters, were dramatically increased in C4 photosynthetic state. Many candidate regulatory genes with unidentified functions were differentially expressed in C3-C4 and C4 photosynthetic states. Finally, it was indicated that ABA, auxin signaling and DNA methylation play critical roles in the regulation of C4 photosynthesis. In summary, by studying the different photosynthetic states of the same species, this work provides the major transcriptional differences between C3-C4 and C4 photosynthesis, and many of the transcriptional differences are potentially related to C4 development and therefore are the potential targets for reverse genetics studies.

Forging C-C Bonds Through Decarbonylation of Aryl Ketones.

Science.gov (United States)

Somerville, Rosie J; Martin, Ruben

2017-06-06

The ability of nickel to cleave strong σ-bonds is again in the spotlight after a recent report that demonstrates the feasibility of using nickel complexes to promote decarbonylation of diaryl ketones. This transformation involves the cleavage of two strong C-C(O) bonds and avoids the use of noble metals, hence reinforcing the potential of decarbonylation as a technique for forging C-C bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

Science.gov (United States)

Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

2016-09-05

The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.

Dicty_cDB: AFH685 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 99 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence....dration Library Tortula ruralis cDNA, mRNA sequence. 70 4e-08 1 CK030146 |CK030146.....1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834.1 Tor7258 Gametophyte rehy

Dicty_cDB: AFK467 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequenc....1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK030146 |CK03014...55.1 TTE00006978 Normalized large Tetrahymena thermophila cDNA, mRNA sequence. 74 3e-09 1 CN206834 |CN206834