Seeking Austen, from Abroad: Lori Smith’s Memoir 'A Walk with Jane Austen' (2007

Directory of Open Access Journals (Sweden)

Juliette Wells

2009-05-01

Full Text Available One outcome of Jane Austen’s popularity with present-day readers is their creation of books derived from and inspired by her own. This article examines a recent contribution to this increasingly crowded field: Lori Smith’s 2007 'A Walk with Jane Austen: A Journey into Adventure, Love & Faith', which depicts a thirtysomething American woman’s travel to England in the hopes of better understanding both Austen and herself. I consider this memoir in relation to other works created by Austen fans, including those who, like Smith, aim primarily at a Christian readership; I address as well this book’s significance as an account of literary pilgrimage and of personally transformative reading.

Does toxic defence in Nycticebus spp. relate to ectoparasites? The lethal effects of slow loris venom on arthropods.

Science.gov (United States)

Grow, Nanda B; Wirdateti; Nekaris, K A I

2015-03-01

The venom produced by slow lorises (Nycticebus spp.) is toxic both intra- and inter-specifically. In this study we assessed the ecoparasite repellent properties of their venom. We tested venom from two Indonesian slow loris species: Nycticebus javanicus and Nycticebus coucang. Arthropods directly exposed to brachial gland secretions mixed with saliva from both species were immediately impaired or exhibited reduced activity (76%), and often died as a result (61%). We found no significant difference in the result of 60-min trials between N. coucang and N. javanicus [X(2)(1, n = 140) = 2.110, p = 0.3482]. We found evidence that the degree of lethality of the venom varies according to the arthropod taxa to which it is exposed. While most maggots (84%) were initially impaired from the venom after 10 min, maggots died after a 1 h trial 42% of the time. In contrast, at the end of 1 h trial, spiders died 78% of the time. For all arthropods, the average time to death from exposure was less than 25 min (M = 24.40, SD = 22.60). Ectoparasites including ticks, members of the arachnid order, are known to transmit pathogens to hosts and may be an intended target of the toxic secretions. Our results suggest that one function of slow loris venom is to repel parasites that affect their fitness, and that their topical anointing behaviour may be an adaptive response to ectoparasites. Copyright © 2015 Elsevier Ltd. All rights reserved.

The role of nuclear in the US and in the world. Interview with Donald Hoffman

Energy Technology Data Exchange (ETDEWEB)

Mitev, Lubomir [NucNet, Brussels (Belgium)

2014-07-15

Donald Hoffman, outgoing president of the American Nuclear Society (ANS), talks to NucNet about the economics of nuclear energy in the US, the role of SMRs and the need for 'fair and appropriate' 123 Agreements (Section 123 of the United States Atomic Energy Act of 1954, titled 'Cooperation With Other Nations', establishes an agreement for cooperation as a prerequisite for nuclear deals between the US and any other nation. Such agreements are called '123 Agreements'). (orig.)

Cloning and sequencing of growth hormone gene of Iranian Lori Bakhtiari sheep

Directory of Open Access Journals (Sweden)

M Dayani-Nia

2010-05-01

Full Text Available Growth hormone (GH is a peptide hormone that stimulates growth and cell reproduction in humans and animals. It is a 191-amino acid, single chain polypeptide hormone which is synthesized, stored, and secreted by the somatotroph cells within the lateral wings of the anterior pituitary gland. The goal of this research was to clone and sequence sheep growth hormone of Lori Bakhtiary breed in Iran. For this purpose, RNA was extracted from the pituitary gland of freshly slaughtered sheep and cDNA of growth hormone produced. The T/A cloning technique was used to clone the cDNA of growth hormone and then the synthesized construct was transferred into E. coli as the host. Once the correct recombinants were further confirmed by colony PCR or restriction enzyme digestion, sequencing was done. The sequencing results showed that, the length of sheep growth hormone cDNA was 690 bp fragments. Comparison of sequence of growth hormone inside the synthesized construct with those recorded in Genebank (NCBI, Blast indicated high degrees of similarity between Iranian native sheep and other sheep breeds of the world.

Hoffman's syndrome: pseudohypertrophic myopathy as initial manifestation of hypothyroidism. Case report Síndrome de Hoffman: miopatia pseudohipertrófica como manifestação inicial de hipotireoidismo. Relato de caso

Directory of Open Access Journals (Sweden)

Luiz Felipe Rocha Vasconcellos

2003-09-01

Full Text Available The frequency of myopathy in hypothyroidism ranges from 30 to 80%. The major symptoms related are weakness, muscular cramps and myalgia. The pseudohyperthrophic form is called Hoffman's syndrome. The electrophysiological study reveals myopathy, neuropathy or mixed pattern. Laboratorial investigation generally shows increased levels of muscle enzymes and low serum thyroid hormones, with thyrotrophic-stimulating hormone (TSH elevated. The treatment consists in hormone replacement and the prognosis is good in most of the cases. We report an adult male who developed muscular cramps, myalgia, weakness, pseudohyperthrophy, associated with facial edema and alteration of his voice. The muscle enzymes were increased and T4 was undetectable with a raised level of TSH. The myopathy was the initial manifestation of hypothyroidism in this case.A frequência de miopatia no hipotireoidismo varia de 30% a 80%. Os sintomas relacionados ao acometimento muscular são fraqueza, cãimbras e mialgias. A forma pseudo-hipertrófica é denominada síndrome de Hoffman. O estudo eletrofisiológico pode revelar padrão miopático, neuropático ou misto. A investigação laboratorial em geral mostra aumento das enzimas musculares e redução dos níveis de hormônio tireoidiano com TSH elevado. O tratamento consiste na reposição oral de hormônio e o prognóstico é bom na maioria dos casos. Relatamos o caso de um adulto que apresentou cãimbras, mialgia, fraqueza com pseudohipertrofia muscular associados a edema facial e alteração da voz. As enzimas musculares estavam elevadas e o nível de T4 foi indetectável com aumento de TSH. A miopatia foi manifestação inicial de hipotireoidismo neste caso.

[Yearly changes in antibacterial activities of cefozopran against various clinical isolates between 1996 and 2000--I. Gram-positive bacteria].

Science.gov (United States)

Suzuki, Yumiko; Nishinari, Chisato; Endo, Harumi; Tamura, Chieko; Jinbo, Keiko; Hiramatsu, Nobuyoshi; Akiyama, Kazumitsu; Koyama, Tsuneo

2002-04-01

The in vitro antibacterial activities of cefozopran (CZOP), an agent of cephems, against various clinical isolates obtained between 1996 and 2000 were yearly evaluated and compared with those of other cephems, oxacephems, carbapenems, and penicillins. Fifteen species, 1,062 strains, of Gram-positive bacteria were isolated from the clinical materials annually collected from January to December, and consisted of methicillin-susceptible Staphylococcus aureus (MSSA; n = 127), methicillin-resistant Staphylococcus aureus (MRSA; n = 123), Staphylococcus epidermidis (n = 104), Staphylococcus haemolyticus (n = 58), Streptococcus pyogenes (n = 100), Streptococcus agalactiae (n = 50), Streptococcus pneumoniae (n = 125), Enterococcus faecalis (n = 150), Enterococcus faecium (n = 50), Enterococcus avium (n = 50), and Peptostreptococcus spp. (P. anaerobius, P. asaccharolyticus, P. magnus, P. micros, P. prevotii; n = 125). CZOP possessed stable antibacterial activities against all strains tested throughout 5 years. The MIC90 of CZOP against MRSA and S. haemolyticus tended to decrease while against S. pneumoniae and Peptostreptococcus spp., tended to increase year by year. However, the MIC90 just changed a little and were consistent with the results from the studies performed until the new drug application approval. Increases in the MIC90 against S. pneumoniae were also observed with cefpirome (CPR), cefepime (CFPM), flomoxef (FMOX), sulbactam/cefoperazone (SBT/CPZ), and imipenem (IPM). Increases in the MIC90 against Peptostreptococcus spp. were also observed with ceftazidime (CAZ), CPR, CFPM, FMOX, SBT/CPZ, and IPM. The decreases in the sensitivities were not always considered to depend upon generation of resistant bacteria because the annual MIC range of each antibacterial agent was almost generally wide every year and the annual sensitivity of each strain to the agents extremely varied. In conclusion, the annual antibacterial activities of CZOP against the Gram

Evolution and applications of radiochemical procedures. From Marie Curie to Darleane Hoffman

International Nuclear Information System (INIS)

Contis, E. T.; Rengan, K.

1996-01-01

Marie Curie carried out the first radiochemical separations which eventually lead to the discovery of polonium and radium, two new elements. Nearly a century later Darleane Hoffman and her collaborators are devising new radiochemical separation procedures for studying the chemical properties of newly discovered transactinide elements. Safety requirements as well as changes necessitated by fast decaying radionuclides have transformed the nature of radiochemical separations. Further, applications in a wide variety of areas such as analysis of trace elements in food to radioimmunoassay have broadened the use of radiochemical separations. Examples of some early, historically important, radiochemical separations are described in this article. In addition, recent trends in the use of radiochemical separations in neutron activation analysis, in dating applications, in fission product studies and in the study of transactinide elements are briefly described with specific examples. (author). 52 refs

Application of Hoffman modulation contrast microscopy coupled with three-wavelength two-beam interferometry to the in situ direct observation of the growth process of a crystal in microgravity

Science.gov (United States)

Tsukamoto, Katsuo

1988-01-01

Direct visualization of three dimensional transfer process of both heat and mass around a growing crystal and mono-molecular growth layers on the surface is possible in situ by means of high resolution Hoffman modulation contrast microscopy coupled with three wavelength two beam Mach-Zehnder interferometry. This in situ observation is very suitable for the verification of the growth mechanism of a crystal in a solution or a melt in microgravity.

Fatal infection in three Grey Slender Lorises (Loris lydekkerianus nordicus) caused by clonally related Trueperella pyogenes.

Science.gov (United States)

Nagib, Samy; Glaeser, Stefanie P; Eisenberg, Tobias; Sammra, Osama; Lämmler, Christoph; Kämpfer, Peter; Schauerte, Nicole; Geiger, Christina; Kaim, Ute; Prenger-Berninghoff, Ellen; Becker, André; Abdulmawjood, Amir

2017-08-29

Trueperella pyogenes is a worldwide known bacterium causing mastitis, abortion and various other pyogenic infections in domestic animals like ruminants and pigs. In this study we represent the first case report of three unusual fatal infections of Grey Slender Lorises caused by Trueperella pyogenes. Meanwhile, this study represents the first in-depth description of the multilocus sequence analysis (MLSA) on T. pyogenes species. Three Trueperella pyogenes were isolated from three different Grey Slender Lorises, which died within a period of two years at Frankfurt Zoo (Frankfurt am Main - Germany). The three Grey Slender Loris cases were suffering from severe sepsis and died from its complication. During the bacteriological investigation of the three cases, the T. pyogenes were isolated from different organisms in each case. The epidemiological relationship between the three isolates could be shown by four genomic DNA fingerprint methods (ERIC-PCR, BOX-PCR, (GTG) 5 -PCR, and RAPD-PCR) and by multilocus sequence analysis (MLSA) investigating four different housekeeping genes (fusA-tuf-metG-gyrA). In this study, we clearly showed by means of using three different rep-PCRs, by RAPD-PCR and by MLSA that the genomic fingerprinting of the investigated three T. pyogenes have the same clonal origin and are genetically identical. These results suggest that the same isolate contaminated the animal's facility and subsequently caused cross infection between the three different Grey Slender Lorises. To the best of our knowledge, this is the first epidemiological approach concentrating on T. pyogenes using MLSA.

Army Cyber Mission Force - Ambitions and Realities

Science.gov (United States)

2015-05-21

London: A & C Black, 2006), 219. 3 Ibid., 227. 4 Susan Pines, Veda Dickerson, and Lori Cates, eds., O*NET Dictionary of Occupational Titles, 2nd ed...Pines, Susan, Veda Dickerson, and Lori Cates. "Experience." In O*NET Dictionary of Occupational Titles

Exploring cultural drivers for wildlife trade via an ethnoprimatological approach: a case study of slender and slow lorises (Loris and Nycticebus) in South and Southeast Asia.

Science.gov (United States)

Nekaris, K A I; Shepherd, C R; Starr, C R; Nijman, V

2010-09-01

Illegal and unsustainable trade in wildlife is a major conservation challenge. For Asian primates, economic and cultural traditions, and increased forest access mean that trade may have become detrimental for certain species. Slow and slender lorises (Nycticebus and Loris) are primates particularly prevalent in trade, determined until now by focused counts of lorises in regional markets. Here, we use international trade statistics and a participant-observer approach to assess culturally specific drivers for trade in lorises in South and Southeast Asia, to provide a broader context to help mitigate this practice. Analysis of international records for the last 30 years revealed that live animal trade was more prevalent than trade in body parts (slow lorises, 86.4%; slender lorises, 91.4%), with Laos, Cambodia, and Thailand the largest exporters. We then examine drivers of international and domestic trade based on long-term data from 1994-2009 in Sri Lanka, Cambodia, and Indonesia. We show that slender lorises are important in Sri Lankan folklore, but their use as pets and for traditional medicine is rare. Trade in Bengal slow and pygmy lorises in Cambodia for use in traditional medicines, a practice with deeply historical roots, is widespread. Despite its own set of myths about the magical and curative properties of lorises, trade in Javan, Bornean, and greater slow lorises in Indonesia is largely for pets. Conservation practices in Asia are often generalized and linked with the region's major religions and economies. We show here that, in the case of wildlife trade, culturally specific patterns are evident among different ethnic groups, even within a country. Revealing such patterns is the foundation for developing conservation management plans for each species. We suggest some participatory methods for each country that may aid in this process. 2010 Wiley-Liss, Inc.

The Tomato Hoffman's Anthocyaninless Gene Encodes a bHLH Transcription Factor Involved in Anthocyanin Biosynthesis That Is Developmentally Regulated and Induced by Low Temperatures.

Science.gov (United States)

Qiu, Zhengkun; Wang, Xiaoxuan; Gao, Jianchang; Guo, Yanmei; Huang, Zejun; Du, Yongchen

2016-01-01

Anthocyanin pigments play many roles in plants, including providing protection against biotic and abiotic stresses. Many of the genes that mediate anthocyanin accumulation have been identified through studies of flowers and fruits; however, the mechanisms of genes involved in anthocyanin regulation in seedlings under low-temperature stimulus are less well understood. Genetic characterization of a tomato inbred line, FMTT271, which showed no anthocyanin pigmentation, revealed a mutation in a bHLH transcription factor (TF) gene, which corresponds to the ah (Hoffman's anthocyaninless) locus, and so the gene in FMTT271 at that locus was named ah. Overexpression of the wild type allele of AH in FMTT271 resulted in greater anthocyanin accumulation and increased expression of several genes in the anthocyanin biosynthetic pathway. The expression of AH and anthocyanin accumulation in seedlings was shown to be developmentally regulated and induced by low-temperature stress. Additionally, transcriptome analyses of hypocotyls and leaves from the near-isogenic lines seedlings revealed that AH not only influences the expression of anthocyanin biosynthetic genes, but also genes associated with responses to abiotic stress. Furthermore, the ah mutation was shown to cause accumulation of reactive oxidative species and the constitutive activation of defense responses under cold conditions. These results suggest that AH regulates anthocyanin biosynthesis, thereby playing a protective role, and that this function is particularly important in young seedlings that are particularly vulnerable to abiotic stresses.

The Tomato Hoffman's Anthocyaninless Gene Encodes a bHLH Transcription Factor Involved in Anthocyanin Biosynthesis That Is Developmentally Regulated and Induced by Low Temperatures.

Directory of Open Access Journals (Sweden)

Zhengkun Qiu

Full Text Available Anthocyanin pigments play many roles in plants, including providing protection against biotic and abiotic stresses. Many of the genes that mediate anthocyanin accumulation have been identified through studies of flowers and fruits; however, the mechanisms of genes involved in anthocyanin regulation in seedlings under low-temperature stimulus are less well understood. Genetic characterization of a tomato inbred line, FMTT271, which showed no anthocyanin pigmentation, revealed a mutation in a bHLH transcription factor (TF gene, which corresponds to the ah (Hoffman's anthocyaninless locus, and so the gene in FMTT271 at that locus was named ah. Overexpression of the wild type allele of AH in FMTT271 resulted in greater anthocyanin accumulation and increased expression of several genes in the anthocyanin biosynthetic pathway. The expression of AH and anthocyanin accumulation in seedlings was shown to be developmentally regulated and induced by low-temperature stress. Additionally, transcriptome analyses of hypocotyls and leaves from the near-isogenic lines seedlings revealed that AH not only influences the expression of anthocyanin biosynthetic genes, but also genes associated with responses to abiotic stress. Furthermore, the ah mutation was shown to cause accumulation of reactive oxidative species and the constitutive activation of defense responses under cold conditions. These results suggest that AH regulates anthocyanin biosynthesis, thereby playing a protective role, and that this function is particularly important in young seedlings that are particularly vulnerable to abiotic stresses.

Heritability estimates and correlations between production and ...

African Journals Online (AJOL)

Heritablities and correlations were estimated between lamb body weight at different ages and reproductive traits in the Lori-Bakhtiari sheep breed. Data and pedigree information for Lori-Bakhtiari sheep used in this study were 5826 records of body weight of lambs from 240 sires and 1627 dams, and 5741 records of ...

How Is Gender Self-Confidence Related to Subjective Well-Being?

Science.gov (United States)

Hoffman, Rose Marie

2006-01-01

This study of ethnically diverse participants explored the relationship of gender self-confidence to subjective well-being. The 2 components of gender self-confidence (gender self-definition and gender self-acceptance) were assessed using the Hoffman Gender Scale (R. M. Hoffman, 1996; R. M. Hoffman, L. D. Borders, & J. A. Hattie, 2000). The…

An integrated view of empathy: psychology, philosophy, and neuroscience.

Science.gov (United States)

Nakao, Hisashi; Itakura, Shoji

2009-03-01

In this paper, we will examine and untangle a conflict mainly between a developmental psychologist, Martin Hoffman and a social psychologist, Daniel Batson. According to Hoffman, empathic distress, a vicarious feeling through empathy, is transformed into an altruistic motivation. Batson and others on the other hand, criticize Hoffman, claiming that empathic altruism has no relation with empathic distress. We will point out some problems with Batson's position by referring to the results of fMRI experiments that suggest empathic distress and empathic altruism share a common basis, and defend Hoffman's argument. This will also offer new insights into the evolution of empathy.

Perdagangan burung-burung paruh bengkok di Bali

Directory of Open Access Journals (Sweden)

W Widodo

2012-02-01

Full Text Available The survey was carried out to know some aspects of the bird trade in Bali on May 2002, especially to observe the diversity and abundance of species of Psittacidae Family along with their problems. The survey was done by direct observations and interview to the traders in the Sanglah and Satria Bird Markets, Denpasar-Bali. The total of 80 spescies of birds were traded in Bali and most of them i.e.: 75 species or 1577 individuals were found in the Satria bird market, but only 37 species or 393 individuals traded in the Sanglah bird market. Psittacidae family was found more abundantly, i.e.: 428 individiuals in 13 species of parrots. Those spesies of parrots were: Violet-necked Lory (Eos squamata, Blue-streaked Lory (E. reticulata, Red Lory (E. bornea, Rainbow Lorikeet (Trichoglossus haematodus, Chattering Lory (Lorius garrulus, Cockatail Australia (Nymphicus hollandicus, Moustached Parrakeet (Psittacula alexandri, Peach-faced Lovebird (Agapornis roseicollis, Fischer’s Lovebird (A. fischeri, Masked Lovebird (A. personata, Bali Hanging Parrot (Loriculus pusillus and Budgerigar (Melopsittacus undulatus. The Rainbow Lorikeet was found more abundant than another species of parrots, but Bali or Javan Hanging Parrot was very rare. The most catching area of Psittacidae was about 45% from Moluccas Islands.

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available lori (strain J99) ... Length = 261 ... Query: 120 QIMAILNLTPDSFYEKSRFDSKKALEE...IYQWLEKGITLIDIGAASSRPQSEIIDPKVEQD 179 ... QIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQD Sbjct: 1 ... QIMAIL

Influence of frozen storage on the fatty acid composition of ostrich ...

African Journals Online (AJOL)

2015-05-16

May 16, 2015 ... the level of inclusion of oil seeds in the diet influences the level of fatty acid deposition (Hoffman et al., 2005;. Poławska et al., 2012; 2013) and it is therefore worthwhile to evaluate a range of oil seed inclusion levels. Ostrich meat is typically sold as entire muscles (Sales & Horbańczuk, 1998; Hoffman, 2008) ...

LOR-interleaving image reconstruction for PET imaging with fractional-crystal collimation

International Nuclear Information System (INIS)

Li, Yusheng; Matej, Samuel; Karp, Joel S; Metzler, Scott D

2015-01-01

Positron emission tomography (PET) has become an important modality in medical and molecular imaging. However, in most PET applications, the resolution is still mainly limited by the physical crystal sizes or the detector’s intrinsic spatial resolution. To achieve images with better spatial resolution in a central region of interest (ROI), we have previously proposed using collimation in PET scanners. The collimator is designed to partially mask detector crystals to detect lines of response (LORs) within fractional crystals. A sequence of collimator-encoded LORs is measured with different collimation configurations. This novel collimated scanner geometry makes the reconstruction problem challenging, as both detector and collimator effects need to be modeled to reconstruct high-resolution images from collimated LORs. In this paper, we present a LOR-interleaving (LORI) algorithm, which incorporates these effects and has the advantage of reusing existing reconstruction software, to reconstruct high-resolution images for PET with fractional-crystal collimation. We also develop a 3D ray-tracing model incorporating both the collimator and crystal penetration for simulations and reconstructions of the collimated PET. By registering the collimator-encoded LORs with the collimator configurations, high-resolution LORs are restored based on the modeled transfer matrices using the non-negative least-squares method and EM algorithm. The resolution-enhanced images are then reconstructed from the high-resolution LORs using the MLEM or OSEM algorithm. For validation, we applied the LORI method to a small-animal PET scanner, A-PET, with a specially designed collimator. We demonstrate through simulated reconstructions with a hot-rod phantom and MOBY phantom that the LORI reconstructions can substantially improve spatial resolution and quantification compared to the uncollimated reconstructions. The LORI algorithm is crucial to improve overall image quality of collimated PET, which

Tickled to death: analysing public perceptions of 'cute' videos of threatened species (slow lorises - Nycticebus spp.) on Web 2.0 sites.

Science.gov (United States)

Anne-Isola Nekaris, K; Nekaris, By K Anne-Isola; Campbell, Nicola; Coggins, Tim G; Rode, E Johanna; Nijman, Vincent

2013-01-01

The internet is gaining importance in global wildlife trade and changing perceptions of threatened species. There is little data available to examine the impact that popular Web 2.0 sites play on public perceptions of threatened species. YouTube videos portraying wildlife allow us to quantify these perceptions. Focussing on a group of threatened and globally protected primates, slow lorises, we quantify public attitudes towards wildlife conservation by analysing 12,411 comments and associated data posted on a viral YouTube video 'tickling slow loris' over a 33-months period. In the initial months a quarter of commentators indicated wanting a loris as a pet, but as facts about their conservation and ecology became more prevalent this dropped significantly. Endorsements, where people were directed to the site by celebrities, resulted mostly in numerous neutral responses with few links to conservation or awareness. Two conservation-related events, linked to Wikipedia and the airing of a television documentary, led to an increase in awareness, and ultimately to the removal of the analysed video. Slow loris videos that have gone viral have introduced these primates to a large cross-section of society that would not normally come into contact with them. Analyses of webometric data posted on the internet allow us quickly to gauge societal sentiments. We showed a clear temporal change in some views expressed but without an apparent increase in knowledge about the conservation plight of the species, or the illegal nature of slow loris trade. Celebrity endorsement of videos showing protected wildlife increases visits to such sites, but does not educate about conservation issues. The strong desire of commentators to express their want for one as a pet demonstrates the need for Web 2.0 sites to provide a mechanism via which illegal animal material can be identified and policed.

Tickled to death: analysing public perceptions of 'cute' videos of threatened species (slow lorises - Nycticebus spp. on Web 2.0 sites.

Directory of Open Access Journals (Sweden)

K Anne-Isola Nekaris

Full Text Available BACKGROUND: The internet is gaining importance in global wildlife trade and changing perceptions of threatened species. There is little data available to examine the impact that popular Web 2.0 sites play on public perceptions of threatened species. YouTube videos portraying wildlife allow us to quantify these perceptions. METHODOLOGY/PRINCIPAL FINDINGS: Focussing on a group of threatened and globally protected primates, slow lorises, we quantify public attitudes towards wildlife conservation by analysing 12,411 comments and associated data posted on a viral YouTube video 'tickling slow loris' over a 33-months period. In the initial months a quarter of commentators indicated wanting a loris as a pet, but as facts about their conservation and ecology became more prevalent this dropped significantly. Endorsements, where people were directed to the site by celebrities, resulted mostly in numerous neutral responses with few links to conservation or awareness. Two conservation-related events, linked to Wikipedia and the airing of a television documentary, led to an increase in awareness, and ultimately to the removal of the analysed video. CONCLUSIONS/SIGNIFICANCE: Slow loris videos that have gone viral have introduced these primates to a large cross-section of society that would not normally come into contact with them. Analyses of webometric data posted on the internet allow us quickly to gauge societal sentiments. We showed a clear temporal change in some views expressed but without an apparent increase in knowledge about the conservation plight of the species, or the illegal nature of slow loris trade. Celebrity endorsement of videos showing protected wildlife increases visits to such sites, but does not educate about conservation issues. The strong desire of commentators to express their want for one as a pet demonstrates the need for Web 2.0 sites to provide a mechanism via which illegal animal material can be identified and policed.

75 FR 20997 - Ocean Transportation Intermediary License Applicants

Science.gov (United States)

2010-04-22

... 77354. Officers: Thomas C. Gaze, President, Qualifying Individual). Lori L. Gaze, Secretary/Treasurer... Services, (Qualifying Individual). George T. Cook, President/Treasurer, Application Type: New OFF License...

Tokenless Biometric Electronic Transactions Using an Audio Signature to Identify the Transaction Processor

Science.gov (United States)

2002-05-28

28, 2002 Inventors: Hoffman; Ned (Sebastopol, CA); Pare, Jr.; David Ferrin (Berkeley, CA); Lee; Jonathan Alexander (Oakland, CA); Lapsley; Philip...Transaction Processor 5. FUNDING NUMBERS 6. AUTHOR(S) Hoffman, Ned; Pare Jr, David Ferrin; Lee, Jonathan Alexander; Lapsley, Philip Dean 7...408. 4845636 Jul., 1989 Walker 705/39. 4926480 May., 1990 Chaum 380/23. 4947028 Aug., 1990 Gorog 235/380. 4961142 Oct., 1990 Elliott et al. 364/408

Lone-Wolf Terrorist Radicalization and the Prisoner’s Dilemma: Ensuring Mutual Cooperation Between at-Risk Muslim Americans and Local Communities

Science.gov (United States)

2015-09-01

successful method of attack on American soil .2 In investigating the radicalization process, one approach that has not been applied is the “prisoner’s...Conflict and Terrorism (Forthcoming, November 2015), 5-6; Bruce Hoffman, Inside Terrorism, revised and expanded edition (New York: Colombia ...10, 2013. https://www.youtube.com/watch?v=px-lhuA1ZgA. Hoffman, Bruce. Inside Terrorism. Revised and expanded edition. New York: Colombia University

77 FR 49799 - Medicare and Medicaid Programs; Quarterly Listing of Program Issuances-April Through June 2012

Science.gov (United States)

2012-08-17

... Regarding Lori Ashby (410) 786-6322 National Coverage Provisions. XI National Oncologic Stuart Caplan, RN... Caplan, RN, (410) 786-8564 Positron Emission MAS. Tomography for Dementia Trials. All Other Information...

Solar Insights from the 2016 RPS Summit | State, Local, and Tribal

Science.gov (United States)

educational two days of presentations, panels, group discussions and networking. Lori Bird, Principal Analyst community shared solar, which allows renters and others who do not have adequate roofs for solar panels to

STS-46 crewmembers participate in Fixed Base (FB) SMS training at JSC

Science.gov (United States)

1992-01-01

STS-46 Atlantis, Orbiter Vehicle (OV) 104, Pilot Andrew M. Allen hands Mission Specialist (MS) and Payload Commander (PLC) Jeffrey A. Hoffman checklists from middeck locker MF43E during training session in JSC's fixed base (FB) shuttle mission simulator (SMS) located in Mission Simulation and Training Facility Bldg 5. European Space Agency (ESA) MS Claude Nicollier outfitted with communications kit assembly headset (HDST) and equipment looks beyond Hoffman to the opposite side of the middeck.

Climate change and desertification in South Africa – science and response

CSIR Research Space (South Africa)

Archer van Garderen, Emma RM

2009-01-01

Full Text Available Africa (see, for example, Hoffman and Ashwell 2001, Meadows and Hoffman 2003, and further papers in this volume). Most recent literature on desertification, including the discussions at the November 2008 workshop on desertification described... in this volume, acknowledges a clear role of particular limits and thresholds in understanding both the processes of desertification, and the possibility of recovery (see, for example, Verstraete et al 2008 and Reynolds et al 2007; with particular relevance...

75 FR 18191 - City of Raleigh; Community Hydro, LLC; Notice of Competing Preliminary Permit Applications...

Science.gov (United States)

2010-04-09

...: Mr. Thomas A. McCormick, Raleigh City Attorney, P.O. Box 590, Raleigh, North Carolina 27601, e-mail tom.mccormick@ci.raleigh.nc.us . For Community Hydro, LLC: Lori Barg, Community Hydro, LLC, 113...

Brief Intervention Helps Adolescents Curb Substance Use

Science.gov (United States)

... January 02, 2013 Lori Whitten, NIDA Notes Contributing Writer Drug- and alcohol-involved middle and high school ... and Alaska Natives Asians Children College Students Employees Hispanics or Latinos Inmates and Parolees International Populations LGBT ...

75 FR 33317 - Antibacterial Resistance and Diagnostic Device and Drug Development Research for Bacterial...

Science.gov (United States)

2010-06-11

... name, title, firm name, address, telephone, and fax number) to [email protected] . Persons without access to the Internet can call Chris Moser or Lori Benner at 301-796-1300 to register. Persons needing a...

Boston in the 1970s: is there a lesbian community? And if there is, who is in it?

Science.gov (United States)

Hoffman, Amy

2014-01-01

This excerpt from Amy Hoffman's memoir, An Army of Ex-Lovers: My Life at the Gay Community News (University of Massachusetts Press, 2007), describes some of the alternative community institutions serving lesbian feminists in Boston in the late 1970s. Hoffman, in her twenties at the time and fairly newly out, is an enthusiastic patron of these institutions. However, after a while, she begins to wonder about them. Boston in the 1970s was racially segregated and tense; a judicial order to desegregate the schools led to racist riots. The women's community was, sadly, no more diverse than the city's neighborhoods, and the alternative institutions, Hoffman realizes, are organized by and cater mostly to young, white, middle-class women like her. They fail to appeal to the needs and interests of poor women of color-although of course some do participate, and others become active in service organizations such as battered women's shelters.

Genetics Home Reference: hypokalemic periodic paralysis

Science.gov (United States)

... M, Franques J, Bendahhou S, Lory P, Hainque B, Fournier E, Nicole S, Fontaine B. Hypokalemic Periodic Paralysis. 2002 ... related congenital muscular dystrophy Melorheostosis Rhabdoid tumor predisposition syndrome All New & Updated Pages Reviewed : October 2017 Published : ...

Determining the Threshold Value of Basil Yield Reduction and Evaluation of Water Uptake Models under Salinity Stress Condition

Directory of Open Access Journals (Sweden)

M. Sarai Tabrizi

2016-10-01

Full Text Available Introduction: Several mathematical models are being used for assessing the plant response to the salinity of the root zone. The salinity of the soil and water resources is a major challenge for agricultural sector in Iran. Several mathematical models have been developed for plant responses to the salinity stress. However, these models are often applicable in particular conditions. The objectives of this study were to evaluate the threshold value of Basil yield reduction, modeling Basil response to salinity and to evaluate the effectiveness of available mathematical models for the yield estimation of the Basil . Materials and Methods: The extensive experiments were conducted with 13 natural saline water treatments including 1.2, 1.8, 2, 2.2, 2.5, 2.8, 3, 3.5, 4, 5, 6, 8, and 10 dSm-1. Water salinity treatments were prepared by mixing Shoor River water with fresh water. In order to quantify the salinity effect on Basil yield, seven mathematical models including Maas and Hoffman (1977, van Genuchten and Hoffman (1984, Dirksen and Augustijn (1988, and Homaee et al., (2002 were used. One of the relatively recent methods for soil water content measurements is theta probes instrument. Theta probes instrument consists of four probes with 60 mm long and 3 mm diameter, a water proof container (probe structure, and a cable that links input and output signals to the data logger display. The advantages that have been attributed to this method are high precision and direct and rapid measurements in the field and greenhouse. The range of measurements is not limited like tensiometer and is from saturation to wilting point. In this study, Theta probes instrument was calibrated by weighing method for exact irrigation scheduling. Relative transpiration was calculated using daily soil water content changes. A coarse sand layer with 2 centimeters thick was used to decrease evaporation from the surface soil of the pots. Quantity comparison of the used models was done

Collimator Selection in Nuclear Medicine Imaging Using I-123 Generated by Te-124 Reaction

International Nuclear Information System (INIS)

Kim, Hee Joung; Son, Hye Kyung; Nam, Ki Pyo; Lee, Hee Kyung; Bong, Joung Kyun

1996-01-01

In the case of I-123 from the Te-124(p,2n)reaction, the radionuclidic impurity is the high-energy gamma-emitting I-124, which interferes greatly with nuclear medicine images. The choice of a collimator can affect the quality of clinical SPECT images of [I-123]MIBG, [I-123]μ-CIT, or [I-123]IPT. The tradeoffs that two different collimators make among spatial resolution, sensitivity, and scatter were studied by imaging a line source at 5 cm, 10 cm, 15 cm distance using a number of plexiglass sheets between source and collimator, petridish, two-dimensional Hoffman brain phantom, Jaszczak phantom, and three-dimensional Hoffman brain phantom after filling with I-123. (FWHM, FWTM, Sensitivity) for low-energy ultrahigh-resolution parallel-hole(LEUHRP) collimator and medium-energy general-purpose(MEGP) collimator were measured as (9.27 mm, 61.27 mm, 129 CPM/μCi) and (10.53 mm, 23.17 mm, 105CPM/μ/Ci), respectively. The image quality of two-dimensional Hoffman brain phantom with LEUHRP looked better than the one with MEGP. However, the image quality of Jaszczak phantom and three-dimensional Hoffman brain phantom with LEUHRP looked much worse than the one with MEGP because of scatter contributions in three-dimensional imaging situation. The results suggest that the MEGP is preferable to LEUHRP for three-dimensional imaging studies of [I-123]MIBG, [I-123] β-CIT, or [I-123] IPT.

Voice and silence in an autoethnography about chronic illness

African Journals Online (AJOL)

Kate H

a lecture by Lori Hartwell, a transplant recipient from America. When she told us of her .... surprises of Photovoice and film in a study of chronic illness. International ... Considering the violence of voicelessness: Censorship and self- censorship ...

HIV testing is associated with increased knowledge and reductions ...

African Journals Online (AJOL)

HIV testing is associated with increased knowledge and reductions in sexual risk behaviours among men in Cape Town, South Africa. Lori AJ Scott-Sheldon, Michael P Carey, Kate B Carey, Demetria Cain, Leickness C Simbayi, Vuyelwa Mehlomakhulu, Seth C Kalichman ...

76 FR 28121 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals

Science.gov (United States)

2011-05-13

... fencing. Acquire radio equipment for emergency operations center. Interactive employee training system... survey and wildlife assessment. Decision Date: March 17, 2011. FOR FURTHER INFORMATION CONTACT: Lori...: Aircraft rescue and firefighting facility. Determination: The approval of this project is limited to the...

75 FR 34282 - Federal Acquisition Regulation; FAR Case 2009-014, New Designated Country-Taiwan

Science.gov (United States)

2010-06-16

... Government Procurement. DATES: Effective Date: June 16, 2010. FOR FURTHER INFORMATION CONTACT: Ms. Lori... Government Procurement. The interim rule added Taiwan to the list of World Trade Organization Government... seq., because, although this rule opens up Government procurement to the goods and services of Taiwan...

78 FR 56710 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

Science.gov (United States)

2013-09-13

.... Type of Information Collection Request: Reinstatement without change of a previously approved... Lori Ashby at 410-786-6322.) 2. Type of Information Collection Request: Reinstatement with change of a... provide coverage for carotid artery stenting (CAS) with embolic protection for patients at high risk for...

(CaIman) (Crustacea, Decapoda, Branchiura)

African Journals Online (AJOL)

1994-01-25

Jan 25, 1994 ... (Crustacea, Decapoda, Branchiura), from industrial, mine and sewage-polluted .... and sex dependency in the bioaccumulation of copper were also examined. ...... factors. which include changes in salinity. water hardness. R eprodu ... lOry mechanism breaks down, resulting in an increase in copper levels ...

75 FR 37818 - Issues in the Design and Conduct of Clinical Trials for Antibacterial Drug Development; Public...

Science.gov (United States)

2010-06-30

... public workshop will help in developing topics for further discussion. Date and Time: The public workshop... Moser or Lori Benner, Center for Drug Evaluation and Research, Food and Drug Administration, Office of... of efficacy endpoints. Challenges in the conduct of clinical trials will be discussed, including good...

Evaluation of different parasitological techniques in the diagnosis of canine helminthiasis

Directory of Open Access Journals (Sweden)

Marcelle Temporim Novaes

2015-12-01

Full Text Available ABSTRACT. Novaes M.T. & Martins I.V.F. [Evaluation of different parasitological techniques in the diagnosis of canine helminthiasis.] Avaliação de diferentes técnicas parasitológicas no diagnóstico de helmintoses caninas. Revista Brasileira de Medicina Veterinária, 37(Supl.1:71-76, 2015. Laboratório de Parasitologia, Hospital Veterinário, Universidade Federal do Espírito Santo, Rua Alto Universitário, s/n, Guararema, Alegre, ES 29500-000, Brasil. E-mail: marcelle_temporim@hotmail.com Were collected 100 fecal samples from dogs from August 2014 to April 2015 from the Zoonosis Control Center (CCZ of Cachoeiro de Itapemirim-ES. These were sent to the laboratory of Parasitology of the Veterinary Hospital of UFES, and analyzed in duplicate by the techniques of Kato-Katz, Hoffman, TF-Test Modified/Dog and Willis in order to evaluate the technique that present higher sensitivity, convenience and lower expenses with materials for parasitological diagnosis. Statistical analysis was performed using Fisher’s exact test and kappa the 5% significance level. Together they showed up 68 positive samples, 31, 34, 26 and 62 for technical Kato-Katz, Hoffman, TF-Test and Willis respectively. The results showed that the use of Willis technique should be adopted as the standard for egg Ancylostoma spp., since the techniques Kato-Katz, Hoffman and TF-Test showed a low sensitivity for diagnosis of this parasite, and technic of Hoffman should be used as standard for Toxocara spp. In relation to convenience and lower expenses, Willis technique, should be preferred, because the runtime and the microscope slide reading is fast, requiring only the use of a supersaturated solution.

Developmental dysplasia of the hip: A computational biomechanical model of the path of least energy for closed reduction.

Science.gov (United States)

Zwawi, Mohammed A; Moslehy, Faissal A; Rose, Christopher; Huayamave, Victor; Kassab, Alain J; Divo, Eduardo; Jones, Brendan J; Price, Charles T

2017-08-01

This study utilized a computational biomechanical model and applied the least energy path principle to investigate two pathways for closed reduction of high grade infantile hip dislocation. The principle of least energy when applied to moving the femoral head from an initial to a final position considers all possible paths that connect them and identifies the path of least resistance. Clinical reports of severe hip dysplasia have concluded that reduction of the femoral head into the acetabulum may occur by a direct pathway over the posterior rim of the acetabulum when using the Pavlik harness, or by an indirect pathway with reduction through the acetabular notch when using the modified Hoffman-Daimler method. This computational study also compared the energy requirements for both pathways. The anatomical and muscular aspects of the model were derived using a combination of MRI and OpenSim data. Results of this study indicate that the path of least energy closely approximates the indirect pathway of the modified Hoffman-Daimler method. The direct pathway over the posterior rim of the acetabulum required more energy for reduction. This biomechanical analysis confirms the clinical observations of the two pathways for closed reduction of severe hip dysplasia. The path of least energy closely approximated the modified Hoffman-Daimler method. Further study of the modified Hoffman-Daimler method for reduction of severe hip dysplasia may be warranted based on this computational biomechanical analysis. © 2016 The Authors. Journal of Orthopaedic Research Published by Wiley Periodicals, Inc. on behalf of Orthopaedic Research Society. J Orthop Res 35:1799-1805, 2017. © 2016 The Authors. Journal of Orthopaedic Research Published by Wiley Periodicals, Inc. on behalf of Orthopaedic Research Society.

Fulltext PDF

Indian Academy of Sciences (India)

classroom discussion emphasizes the effect of titrated volume in potentiometric titrations. Nature Watch has always been the most popular section and, here Sindhu Radhakrishna traces the social behaviour of the slender Loris, a nocturnal prosimian found in India. She recounts the story of the various perils which threaten ...

Queer Girls in Class: Lesbian Teachers and Students Tell Their Classroom Stories

Science.gov (United States)

Bridgman, Becky L.

2012-01-01

Lori Horvitz's book contains 26 essays from queer students and educators exploring how sexuality can affect classroom dynamics. Although the book's title references lesbians, it also encompasses bisexuals and highlights friendships between gays and lesbians. In addition, many of the essays discuss social justice initiatives as well as illustrate…

Toward (Whose) Morality in Teacher Education?

Science.gov (United States)

Milner, H. Richard; Delale-O'Connor, Lori

2016-01-01

Richard Milner, and Lori Delale-O'Connor offer their remarks on Daniel Lapsley & Ryan Woodbury's commentary (available in this v38 n3 2016 issue of "Action in Teacher Education") entitled "Moral Character Development for Teacher Education." They begin the conversation by commenting that Lapsley and Woodbury raise some…

77 FR 3771 - Notice of Issuance of Final Outer Continental Shelf Air Permit for Shell Offshore, Inc.

Science.gov (United States)

2012-01-25

... locations within Shell's DeSoto Canyon and Lloyd Ridge lease locations on the OCS in the Gulf of Mexico... INFORMATION CONTACT: Lori Shepherd, Air Permits Section, Air Planning Branch, Air, Pesticides and Toxics... effective on December 30, 2011. Dated: January 12, 2012. Beverly H. Banister, Director, Air, Pesticides and...

Beautiful Minds—For How Long.

Directory of Open Access Journals (Sweden)

Lori Marino

2008-07-01

Full Text Available Lori Marino reviews the new bookBeautiful Minds, which investigates the "parallel lives" of primates and cetaceans and argues that despite the evolutionary distance of these large-brained mammals, they nevertheless share a capacity for complex communication and social behavior, representing a striking example of convergence in intelligence.

Konflikdinamika binne 'n staalmaatskappy te Potchefstroom / Leonora Hoffman

OpenAIRE

Hoffman, Leonora

2006-01-01

South African organizations experienced more conflict in the past ten years because of all the changes in the management of labour relations. Employees at lower, middle and upper management levels within organizations are not well informed about the different types of conflict, the functionality and dysfunctionality of conflict, how conflict takes place within the different job-levels and how to manage and resolve it. Dysfunctional conflict can be destructive and it can affect ...

Reproductive Effeciency of an Indigenous Irabian Goat ( Capra Hircus)

African Journals Online (AJOL)

It is well known that goat can tolerate harsh conditions; however there are little information about its reproduction functions such as testis histomorphometry and efficiency of sertoli cells. This study aimed to estimate germ cell types and number per sertoli cell of an indigenous Iranian goat (Lori goat). Semen was collected ...

Bone marrow transplant - discharge

Science.gov (United States)

... HE. Overview and choice of donor of hematopoietic stem cell transplantation. In: Hoffman R, Benz EJ, Silberstein ... lymphocytic leukemia (CLL) Chronic myelogenous leukemia (CML) Graft-versus-host ...

Tickled to Death: Analysing Public Perceptions of ‘Cute’ Videos of Threatened Species (Slow Lorises – Nycticebus spp.) on Web 2.0 Sites

Science.gov (United States)

Nekaris, By K. Anne-Isola; Campbell, Nicola; Coggins, Tim G.; Rode, E. Johanna; Nijman, Vincent

2013-01-01

Background The internet is gaining importance in global wildlife trade and changing perceptions of threatened species. There is little data available to examine the impact that popular Web 2.0 sites play on public perceptions of threatened species. YouTube videos portraying wildlife allow us to quantify these perceptions. Methodology/Principal Findings Focussing on a group of threatened and globally protected primates, slow lorises, we quantify public attitudes towards wildlife conservation by analysing 12,411 comments and associated data posted on a viral YouTube video ‘tickling slow loris’ over a 33-months period. In the initial months a quarter of commentators indicated wanting a loris as a pet, but as facts about their conservation and ecology became more prevalent this dropped significantly. Endorsements, where people were directed to the site by celebrities, resulted mostly in numerous neutral responses with few links to conservation or awareness. Two conservation-related events, linked to Wikipedia and the airing of a television documentary, led to an increase in awareness, and ultimately to the removal of the analysed video. Conclusions/Significance Slow loris videos that have gone viral have introduced these primates to a large cross-section of society that would not normally come into contact with them. Analyses of webometric data posted on the internet allow us quickly to gauge societal sentiments. We showed a clear temporal change in some views expressed but without an apparent increase in knowledge about the conservation plight of the species, or the illegal nature of slow loris trade. Celebrity endorsement of videos showing protected wildlife increases visits to such sites, but does not educate about conservation issues. The strong desire of commentators to express their want for one as a pet demonstrates the need for Web 2.0 sites to provide a mechanism via which illegal animal material can be identified and policed. PMID:23894432

Genotypic frequency of calpastatin gene in lori sheep by polymerase ...

African Journals Online (AJOL)

Article Metrics. Metrics Loading ... Metrics powered by PLOS ALM · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers · about Open Access · FAQ's · News · AJOL jobs · More about AJOL ...

Genotypic frequency of calpastatin gene in lori sheep by polymerase ...

African Journals Online (AJOL)

SAM

2014-05-07

May 7, 2014 ... rate of skeletal muscle growth can result from a decree- sed rate of muscle protein degradation, and this is asso- ciated with a decrease in activity of the calpain system, due principally to a large increase in calpastatin activity. (Goll et al., 1998). Associations have been reported between variation in. CAST ...

Inspiring Growth

Science.gov (United States)

Fink, Stephen; Markholt, Anneke

2017-01-01

In her 24 years as an educator, Principal Lori Duckstein has experienced many kinds of professional development aimed at improving leadership and instruction. And, like school leaders and teachers everywhere, she has completed many one- and two-day training workshops only to return to her school and reflect on her learning in isolation. Recently,…

PROBABILITY CALIBRATION BY THE MINIMUM AND MAXIMUM PROBABILITY SCORES IN ONE-CLASS BAYES LEARNING FOR ANOMALY DETECTION

Data.gov (United States)

National Aeronautics and Space Administration — PROBABILITY CALIBRATION BY THE MINIMUM AND MAXIMUM PROBABILITY SCORES IN ONE-CLASS BAYES LEARNING FOR ANOMALY DETECTION GUICHONG LI, NATHALIE JAPKOWICZ, IAN HOFFMAN,...

The effect of different dietary vitamin and mineral levels on certain ...

African Journals Online (AJOL)

The effect of different dietary vitamin and mineral levels on certain production parameters, including egg shell characteristics of breeding ostriches. TS Brand, GA Tesselaar, LC Hoffman, Z Brand ...

How Creativity Came to Reside in the Land of the Gifted (And How to Move It into a New Neighborhood)

Science.gov (United States)

Flint, Lori J.

2014-01-01

Author Lori Flint, has a PhD in educational psychology/ gifted and creative education and is a board member for the North Carolina Association for the Gifted and Talented. She advocates for students of all ages and abilities, especially the underdogs. She begins this article with a discussion of the origins of creativity in the world of education…

Not Too Big to Fail: How Teacher Education Killed the Foundations

Science.gov (United States)

Gabbard, David; Flint, Lori J.

2013-01-01

Nearly forty years ago, Jonathan Kozol wrote on the perennial question posed by children: "Why do I have to go to school?" Rightfully, in David Gabbard and Lori Flint's view, he admonishes those who would "act as though it were a foolish question." The authors of this article take issue, however, with his characterization…

Materiel Solutions for Special Operations Forces

Science.gov (United States)

2015-03-28

contract following the initial discussions and conceptualization efforts conducted under this grant. SME SUPPORT: • Dr. Lori Foster Thompson... reactors , and the design of stable nanostructured alloys for extreme temperatures and loading conditions. He has also worked extensively on carbon...modeling capabilities to identify technology trends and patterns relevant to USSOCOM mission requirements. • Business Modeling for Data Fusion

Fulltext PDF

Indian Academy of Sciences (India)

Six sigma (11) 72 (CR). Slender loris (1) 64 (FA). Slip velocity (5) 61 (GA). Social organisation (1) 64 (FA). ~oil fertility (6) 6 (GA). Soil science (1) 26 (GA). Solar atmosphere (12) 14 (GA). Solar neutrino detection puzzle (3) 8 (GA). Solar parallax (3) 65 (CR). Solid dispersion (12) 25 (GA). Special relativity. (7) 77, (11) 56 (CR).

Lihtsalt ja lakooniliselt : Capote / Andris Feldmanis

Index Scriptorium Estoniae

Feldmanis, Andris, 1982-

2006-01-01

Ameerika kirjanik Truman Capote (1924-1984) ja mängufilm kirjanikust "Capote" : režissöör Bennett Miller : kirjanik Truman Capote' rollis Philip Seymour Hoffman : Ameerika Ühendriigid - Kanada 2005

75 FR 4622 - Qualification of Drivers; Exemption Applications; Diabetes

Science.gov (United States)

2010-01-28

.... Bauer, Michael P. Berger, William D. Blosch, Michael Bohlen, Bradley N. Brown, Victor M. Brunner, Tom L..., Eugene G. Friedman, Edward L. Gilbert, Donald W. Hansen, Joseph S. Hernandez, Corrine J. Hoffman, Robert...

Detection of polymorphism in booroola gene and growth ...

African Journals Online (AJOL)

[12] and Davis et al [17], forced PCR–RFLP DNA test was used to detect the mutations of FecB and GDF9 in Lori breed sheep. The primer sequences used for the FecB AvaII site and. GDF9 HhaI site are presented in Table 1. Polymerase chain reactions were performed in a. 25 μL reaction mixture containing approximately.

Night Vision Goggles Objectives Lens Focusing Methodology

National Research Council Canada - National Science Library

Pinkus, Alan; Task, H. L

2000-01-01

...: interpupillary distance, tilt, eye relief, height, eyepiece and objective lens focus. Currently, aircrew use a Hoffman 20/20 test unit to pre-focus their NVG objective lenses at optical infinity before boarding their aircraft...

Yield, chemical composition, in vitro digestibility and

African Journals Online (AJOL)

reza

To provide balanced diets that include straw, it is important to know the nutritive value .... (2005) and Anderson & Hoffman (2006). .... the accuracy of voluntary DMI prediction of temperate, tropical crop residues and Mediterranean hays.

A case control study of breast cancer risk and exposure to injectable ...

African Journals Online (AJOL)

A case control study of breast cancer risk and exposure to injectable progestogen contraceptives. R. Bailie, J Katzenellenbogen, M. Hoffman, G Schierhout, H Truter, D Dent, A Gudgeon, J van Zyl, L Rosenberg, S Shapiro ...

Quick Statistics about Voice, Speech, and Language

Science.gov (United States)

... here Home » Health Info » Statistics and Epidemiology Quick Statistics About Voice, Speech, Language Voice, Speech, Language, and ... no 205. Hyattsville, MD: National Center for Health Statistics. 2015. Hoffman HJ, Li C-M, Losonczy K, ...

Regional District Attorney's Offices - Alaska Department of Law

Science.gov (United States)

District Stephen B. Wallace, District Attorney Physical Address: 204 Chief Eddie Hoffman Hwy. Bethel, AK Hours M-TH 8-4:30, F 8-12 Kenai - 3rd Judicial District Scot H. Leaders, District Attorney Trading Bay

Effect of days in feedlot on growth performance and carcass ...

African Journals Online (AJOL)

Effect of days in feedlot on growth performance and carcass characteristics of Merino, South African Mutton Merino and Dorper lambs. T.S. Brand, E.J. van der Westhuizen, D.A. van der Merwe, L.C. Hoffman ...

Analysing Afrikaans-English bilingual children's conversational code ...

African Journals Online (AJOL)

Chloros (2009:143) points out, the study of code switching (CS) is lacking in terms of research on children ...... Cutting, J. 2002. Pragmatics and Discourse: A resource book for students. ... MA: Harvard University Press. Hoffman, C. 1991.

Hazardous Waste Cleanup: DSM Nutritional Products Incorporated in Belvidere, New Jersey

Science.gov (United States)

DSM Nutritional Products, Inc., formerly Hoffman-LaRoche (Roche) Belvidere is located on Maunkachunk Road in White Township, New Jersey. The site occupies approximately 500 acres in Warren County. The facility has been manufacturing vitamins since 1961.

General family of preferential belief removal operators - [Workshop on LORI-II

CSIR Research Space (South Africa)

Booth, R

2009-09-01

Full Text Available Most belief change operators in the AGM tradition assume an underlying plausibility ordering over the possible worlds which is transitive and complete. A unifying structure for these operators, based on supplementing the plausibility ordering with a...

Seeing Through the Conflict: Military-Media Relations

National Research Council Canada - National Science Library

Snyder, John

2003-01-01

.... The media have often called this determination censorship." Since the U.S. military's 1983 invasion of Grenada, commanders have done a questionable job of accommodating the media, as evident by the findings of the Sidle and Hoffman Panels...

Ain't Necessarily So : Review and Critique of Recent Meta-Analyses of Behavioral Medicine Interventions in Health Psychology

NARCIS (Netherlands)

Coyne, James C.; Thombs, Brett D.; Hagedoorn, Mariet

Objective: We examined four meta-analyses of behavioral interventions for adults (Dixon, Keefe, Scipio, Perri, & Abernethy, 2007; Hoffman, Papas, Chatkoff, & Kerns, 2007; Irwin, Cole, & Nicassio, 2006; and Jacobsen, Donovan, Vadaparampil, & Small, 2007) that have appeared in the Evidence Based

Assessment of Peer-Based and Structural Strategies for Increasing ...

African Journals Online (AJOL)

Assessment of Peer-Based and Structural Strategies for Increasing Male Participation in an Antenatal Setting in Lilongwe, Malawi. SM Mphonda, NE Rosenberg, E Kamanga, I Mofolo, G Mwale, E Boa, M Mwale, F Martinson, I Hoffman, MC Hosseinipour ...

South African Journal of Animal Science - Vol 40, No 5 (2012)

African Journals Online (AJOL)

The effect of age and gender on the fat distribution in Merino lambs · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EJ van der Westhuizen, TS Brand, LC Hoffman, BB Aucamp, 459-461 ...

Nucleation, Melting Behaviour and Mechanical Properties of Poly(L ...

African Journals Online (AJOL)

NICO

Tianyi's work showed that the overall crystallization rate of. PLLA increased with an ... being compressed at room temperature under 20 MPa for. 10 min. All the ... PLLA/NA samples were obtained using Hoffman-Weeks plots. (see Fig. 3) and ...

The karoo biome: a preliminary synthesis. Part 2- vegetation and history

CSIR Research Space (South Africa)

Cowling, RM

1987-01-01

Full Text Available between soil ulinity d the incidence of succulence has already been amtioned. In the eastern Karoo the incidence of stem succulence is positively correlated with levels of soil phosphorus, potassium, calcium and magnesium (M T Hoffman unpublished...

Hypertension in Pregnancy among HIV-Infected Women in Sub ...

African Journals Online (AJOL)

Hypertension in Pregnancy among HIV-Infected Women in Sub-Saharan Africa: Prevalence and Infant Outcomes. C Kilewo, UCM Natchu, A Young, D Donnell, E Brown, JS Read, U Sharma, BH Chi, R Goldenberg, I Hoffman, TE Taha, WW Fawzi ...

After Saddam: Prewar Planning and the Occupation of Iraq

Science.gov (United States)

2008-01-01

Bernard Kerik; Lieutenant Colonel Chris Kinnan, USAF; Lewis Lucke; William Luti; Roman Martinez; Dayton Maxwell; Michael McNerney; Frank Miller...Post, April 12, 2003; Rupert Cornwell , “U.S.-Backed Iraqis Launch Bid for 28 After Saddam: Prewar Planning and the Occupation of Iraq from a lack...Lori Latif Shak Bernard Hanish Khalid Hassan Foreign procurement DoD DoD – TBD Garabeet Ishaqian Military Industriali- zation Military production

Defining Tailored Training Approaches for Army Institutional Training

Science.gov (United States)

2013-03-01

teachers object to being assigned to the lower ranking groups, which may further depress academic growth. Finally, critics say that ability grouping...for research, theory, and applications. In D. S. Gorfein and R. R. Hoffman (Eds.), Memory and learning: The Ebbinghaus centennial conference

Music Instruction for Elementary Students with Moderate to Severe Cognitive Impairments: A Case Study

Science.gov (United States)

Salvador, Karen

2015-01-01

Although elementary general music specialists teach students with a variety of exceptionalities every day (Chen, 2007; Hahn, 2010; Hoffman, 2011), many music teacher preparation programs do not adequately address exceptionality (Salvador, 2010). Articles regarding "strategies that work" appear perennially in the professional literature…

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 2157 ... TS Brand, WJ Kritzinger, LC Hoffman, RM Gous ... Vol 10, No 2 (1980): Symposium, A marketing and promotion strategy for wool .... Vol 36, No 3 (2006), A preliminary study on the application of image analysis for the ...

Underground nuclear waste storage backed

International Nuclear Information System (INIS)

Long, J.R.

1978-01-01

Latest to hold hearings on nuclear waste disposal problems is the Senate Commerce Subcommittee on Science, Technology and Space. Testimonies by John M. Deutch, Rustum Roy (presenting results of National Research Council panel on waste solidification), and Darleane C. Hoffman are summarized

A new iterative reconstruction technique for attenuation correction in high-resolution positron emission tomography

International Nuclear Information System (INIS)

Knesaurek, K.; Machac, J.; Vallabhajosula, S.; Buchsbaum, M.S.

1996-01-01

A new interative reconstruction technique (NIRT) for positron emission computed tomography (PET), which uses transmission data for nonuniform attenuation correction, is described. Utilizing the general inverse problem theory, a cost functional which includes a noise term was derived. The cost functional was minimized using a weighted-least-square maximum a posteriori conjugate gradient (CG) method. The procedure involves a change in the Hessian of the cost function by adding an additional term. Two phantoms were used in a real data acquisition. The first was a cylinder phantom filled with uniformly distributed activity of 74 MBq of fluorine-18. Two different inserts were placed in the phantom. The second was a Hoffman brain phantom filled with uniformly distributed activity of 7.4 MBq of 18 F. Resulting reconstructed images were used to test and compare a new interative reconstruction technique with a standard filtered backprojection (FBP) method. The results confirmed that NIRT, based on the conjugate gradient method, converges rapidly and provides good reconstructed images. In comaprison with standard results obtained by the FBP method, the images reconstructed by NIRT showed better noise properties. The noise was measured as rms% noise and was less, by a factor of 1.75, in images reconstructed by NIRT than in the same images reconstructed by FBP. The distance between the Hoffman brain slice created from the MRI image was 0.526, while the same distance for the Hoffman brain slice reconstructed by NIRT was 0.328. The NIRT method suppressed the propagation of the noise without visible loss of resolution in the reconstructed PET images. (orig.)

Is Tickling Torture? Assessing Welfare towards Slow Lorises (Nycticebus spp.) within Web 2.0 Videos.

Science.gov (United States)

Nekaris, K Anne I; Musing, Louisa; Vazquez, Asier Gil; Donati, Giuseppe

2015-01-01

Videos, memes and images of pet slow lorises have become increasingly popular on the Internet. Although some video sites allow viewers to tag material as 'animal cruelty', no site has yet acknowledged the presence of cruelty in slow loris videos. We examined 100 online videos to assess whether they violated the 'five freedoms' of animal welfare and whether presence or absence of these conditions contributed to the number of thumbs up and views received by the videos. We found that all 100 videos showed at least 1 condition known as negative for lorises, indicating absence of the necessary freedom; 4% showed only 1 condition, but in nearly one third (31.3%) all 5 chosen criteria were present, including human contact (57%), daylight (87%), signs of stress/ill health (53%), unnatural environment (91%) and isolation from conspecifics (77%). The public were more likely to like videos where a slow loris was kept in the light or displayed signs of stress. Recent work on primates has shown that imagery of primates in a human context can cause viewers to perceive them as less threatened. Prevalence of a positive public opinion of such videos is a real threat towards awareness of the conservation crisis faced by slow lorises. © 2016 S. Karger AG, Basel.

The Study of Nationalism. A Bibliographic Essay on the Literature Published in the English Language,

Science.gov (United States)

1975-01-01

accommodating sovereignty and the regional integration of Europe. (9) Jeremy Haritos, Nationalism and European Inteeration A Study of - 56 - French... Bentham van den Bergh, "Contemporary Nationalism in the Western World" in Stanley Hoffman (pd.), Conditions of World Order (New York: Simon and

Victim-orientated discipline, interpersonal understanding and guilt.

NARCIS (Netherlands)

Veer, A.J.E. de; Janssens, J.M.A.M.

1994-01-01

According to Hoffman's theory of moral internalisation, parents' victim-orientated disciplinary strategies may stimulate a child to take another's needs into account. To test this hypothesis a cross-lagged panel design was used with two measurements within a time interval of two years. Data were

Agro. no 1 June Latest

African Journals Online (AJOL)

2. Abu A. H , Ahemen T and IKPECHUKWU P. 1 Department of Veterinary ... weeks which weighed between 627.4g to 631.5g were used to evaluate the ..... Nouala, F. S., Akinbamijo, O. O., Adewumi A., Hoffman, E., Muetzel, S. and Becker, ...

South African Journal of Animal Science - Vol 48, No 3 (2018)

African Journals Online (AJOL)

Importance and implications of antibiotic resistance development in livestock and wildlife farming in South Africa: A Review · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M.S. van den Honert, P.A. Gouws, L.C. Hoffman, 401-412.

The interface theory of perception: the future of the science of the mind?

Science.gov (United States)

Hickok, Gregory

2015-12-01

Perception is typically conceptualized as a neurocognitive system that evolved to reveal the truth about objects and events in the world. Hoffman et al.'s Interface Theory of Perception questions this assumption. If true, the implications for the science of the mind are profound.

The Relationship between Attachment to Parents and Psychological Separation in College Students

Science.gov (United States)

Schwartz, Jonathan P.; Buboltz, Walter C.

2004-01-01

The purpose of this study was to investigate the relationship between attachment to parents and psychological separation in college students. Three hundred sixty-eight undergraduate students completed the Inventory of Parent and Peer Attachment (Armsden & Greenberg, 1987) and the Psychological Separation Inventory (Hoffman, 1984). Results…

Ensuring a Strong U.S. Defense for the Future: The National Defense Panel Review of the 2014 Quadrennial Defense Review

Science.gov (United States)

2014-07-31

territorial disputes with China. We note recent moves to station U.S. forces in Darwin , the plan to station a number of Littoral Combat Ships in Singapore...Under Secretary of Defense, Comptroller (C) Charles “Chuck” Hagel Secretary of Defense Mara Karlin Principal Director for Strategy, Policy (P...Support Staff to the Panel Charles Arnold George Sinks U.S. Government Liaison Officers Lori Abele Chief of Staff, Deputy Under Secretary of Defense

Naval Medical R and D News. March 2017, Volume 9, Issue 3

Science.gov (United States)

2017-03-01

Researchers from the Naval Surface Warfare Center Panama City Division and the Naval Postgraduate School spent the voyage conducting experiments to...Hoffman’s was the most cited author for scientific papers on malaria. As Director of the NMRI/NMRC malaria program from 1987-2000, Hoffman and his

The Nature of Empathy: Discriminant Analyses.

Science.gov (United States)

Jegerski, Jane A.; Upshaw, Harry S.

Hoffman's (1975) theory holds that altruism is based on cognitive development and mechanisms for empathic distress present from birth, with the individual going through stages of personal distress, empathic concern, and perspective taking. The Davis Interpersonal Reactivity Index (IRI), a measure of empathy, contains four subscales: personal…

Berlinale terad / Kadri Kõusaar

Index Scriptorium Estoniae

Kõusaar, Kadri

2006-01-01

56. Berliini festivali filme - Jasmila Zhbanici "Grbavica", Michael Winterbottomi, Mat Whitecrossi "Teekond Guantanamosse", tailase Pen-ek Ratanaruangi "Nähtamatud lained", John Hillcoati "Ettepanek" (stsenarist ja muusika autor Nick Cave), Bennett Milleri "Capote" (nimiosas P.S. Hoffman), Yang Yong-hi dokfilm "Kallis Pyongyang", Tomer Heymanni dokfilm "Pabernukud"

Joint Armaments Conference, Exhibition and Firing Demonstration

Science.gov (United States)

2010-05-20

water Initially Prepared in 1910 by Roth and Hoffman Has found use as primer sensitizer as it is “non-toxic” (mercury fulminate ) and non-corrosive...isolation/structure elucidation and synthesis of natural products with antineoplastic properties. Mike has a Ph.D. in Synthetic Organic Chemistry

The orthopaedic management of myelomeningocele | Horn | South ...

African Journals Online (AJOL)

The orthopaedic management of myelomeningocele. A Horn, S Dix-Peek, S Mears, EB Hoffman. Abstract. Despite improvement in antenatal care and screening, myelomeningocele remains the most common congenital birth defect, with a reported incidence of 1 - 2.5/1000 patients in the Western Cape, South Africa.

A "Sweet 16" of Rules About Teamwork

Science.gov (United States)

Laufer, Alexander (Editor)

2002-01-01

The following "Sweet 16" rules included in this paper derive from a longer paper by APPL Director Dr. Edward Hoffman and myself entitled " 99 Rules for Managing Faster, Better, Cheaper Projects." Our sources consisted mainly of "war stories" told by master project managers in my book Simultaneous Management: Managing Projects in a Dynamic Environment (AMACOM, The American Management Association, 1996). The Simultaneous Management model was a result of 10 years of intensive research and testing conducted with the active participation of master project managers from leading private organizations such as AT&T, DuPont, Exxon, General Motors, IBM, Motorola and Procter & Gamble. In a more recent study, led by Dr. Hoffman, we learned that master project managers in leading public organizations employ most of these rules as well. Both studies, in private and public organizations, found that a dynamic environment calls for dynamic management, and that is especially clear in how successful project managers think about their teams.

Loris Malaguzzi, Reggio Emilia and Democratic Alternatives to Early Childhood Education Assessment

Science.gov (United States)

Roberts-Holmes, Guy

2017-01-01

This article responds to the dangers arising from baseline assessment in reception classes. It contrasts predictive testing which claims to ascertain each child's ability and potential with the processes of observation, documentation and discussion developed in Reggio Emilia. It explores the two very different understandings of children which they…

77 FR 33143 - Endangered and Threatened Wildlife and Plants; 90-Day Finding on a Petition To List the Southern...

Science.gov (United States)

2012-06-05

... the conservation of the species.'' (5) What, if any, critical habitat you think we should propose for... vegetation growing seasons, low atmospheric oxygen concentrations, and intense solar radiation (Martin and... population at 2,000,000 birds (again, for all subspecies combined) (Rich et al. 2004; Hoffman 2006, p. 16...

Peak Experience Project

Science.gov (United States)

Scott, Daniel G.; Evans, Jessica

2010-01-01

This paper emerges from the continued analysis of data collected in a series of international studies concerning Childhood Peak Experiences (CPEs) based on developments in understanding peak experiences in Maslow's hierarchy of needs initiated by Dr Edward Hoffman. Bridging from the series of studies, Canadian researchers explore collected…

Studies in Intelligence. Volume 55, Number 3

Science.gov (United States)

2011-09-01

terrelationships and conflicts. This makes for slow reading, but the coverage is thorough. With the release of Nelson Mandela and the end of...Lies, and Bureaucratic Bungling Inside the FBI (Nashville, TN: Nelson Cur- rent, 2004); Dan Stober and Ian Hoffman, A Convenient Spy: Wen Ho Lee and the

Different Languages, Different Emotions? Perspectives from Autobiographical Literature

Science.gov (United States)

Besemeres, Mary

2004-01-01

Bilingual life writing offers a rare insight into the relationship between languages and emotions. This article explores ways in which some striking contemporary memoirs and novels of bilingual experience approach questions of cultural difference in emotion. The texts considered include memoirs by Eva Hoffman and Tim Parks, autobiographical…

Perspective taking and empathic concern in adolescence : Gender differences in developmental changes

NARCIS (Netherlands)

van der Graaff, J.; Branje, S.T.J.; de Wied, M.; Hawk, S.T.; van Lier, P.A.C.; Meeus, W.H.J.

2014-01-01

Empathy is an important social skill and is believed to play an essential role in moral development (Hoffman, 2000). In the present longitudinal study, the authors investigated adolescents' development of perspective taking and empathic concern from age 13 to 18 years (mean age at Wave 1 = 13 years,

Dollar Summary of Federal Supply Classification and Service Category by Company, FY83, Part 6 (W061-Z299).

Science.gov (United States)

1983-01-01

RENT OF FAC /FUEL SUPPLY 29 X299 AUTO TECHNIQUE BELGIQUE S A BELGIUM ARMY LEASE-RENT OF FAC /OTHER NON-BLDG STRUCT 31 HOFFMAN CO VIRGINIA ARMY LEASE...HARRISON & PALMI RIDGE ELECTRICAL E INC MISSOURI ARMY CONSTR: CONSTRUCTION/PARFING FACILITIES $ 123 SUSSEX ELECTRICO C MARYLAND ARMY CONSTR: CONSTRUCTION

South African Journal of Plant and Soil - Vol 32, No 3 (2015)

African Journals Online (AJOL)

The role of nutrient solution composition on the uptake of nutrients, growth and vase life of tulips grown hydroponically under South African conditions · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Geline Derbyshire, Eleanor W Hoffman, Estelle Kempen, 129–137.

Effect of conventional cooking methods on lipid oxidation indices in lamb meat

OpenAIRE

A Pourkhalili; M Mirlohi; E Rahimi; M Hojatoleslami

2012-01-01

Lipid oxidation is one of the most deteriorative reactions occurred in foodstuff which has harmful impacts on the both food quality and consumer's health. This study was designed to speculate the influence of three conventional cooking methods including boiling, frying and grilling on lipid oxidation parameters in cooked lamb meat. Sections of lamb meat from longissimus dorsi muscle, taken from native Lori-Bakhtiary sheep species were cut into uniform pieces and cooked using boiling, frying a...

South African Journal of Animal Science - Vol 47, No 4 (2017)

African Journals Online (AJOL)

Towards a regional beef carcass classification system for Southern Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G Chingala, E Raffrenato, K Dzama, L.C. Hoffman, C Mapiye, 408-423. http://dx.doi.org/10.4314/sajas.v47i4.1 ...

South African Medical Journal - Vol 100, No 1 (2010)

African Journals Online (AJOL)

Treatment of trichomoniasis in pregnancy in sub-Saharan Africa does not appear to be associated with low birth weight or preterm birth · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. E Stringer, JS Read, I Hoffman, M Valentine, S Aboud, RL Goldenberg ...

South African Journal of Animal Science - Vol 42, No 4 (2012)

African Journals Online (AJOL)

Physical and chemical properties of selected beef muscles infused with a phosphate and lactate blend · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. LC Hoffman, A Vermaak, N Muller, 317-340. http://dx.doi.org/10.4314/sajas.v42i4.1 ...

Relaxation of Shot-Peened Residual Stresses Under Creep Loading (Preprint)

Science.gov (United States)

2008-10-01

Residual Stresses,” SAE Technical Paper No. 710285, SAE , 1971. [8] Hoffman, J., Scholtes, B., Vöhringer, O., and Macherauch, E., “Thermal relaxation of...relaxation in an AISI 4140 steel due to quasistatic and cyclic loading at higher temperatures,” Material Science and Engineering A248, 1998, pp. 9

Electrolysis of Water in the Secondary School Science Laboratory with Inexpensive Microfluidics

Science.gov (United States)

Davis, T. A.; Athey, S. L.; Vandevender, M. L.; Crihfield, C. L.; Kolanko, C. C. E.; Shao, S.; Ellington, M. C. G.; Dicks, J. K.; Carver, J. S.; Holland, L. A.

2015-01-01

This activity allows students to visualize the electrolysis of water in a microfluidic device in under 1 min. Instructional materials are provided to demonstrate how the activity meets West Virginia content standards and objectives. Electrolysis of water is a standard chemistry experiment, but the typical laboratory apparatus (e.g., Hoffman cell)…

The Efficiency of Methionine as a Radioprotectant of Bacillus anthracis for Cell Viability and Outgrowth Time after UVC and Gamma Irradiation

Science.gov (United States)

2015-03-01

Qiagen, "EndoFree Plasmid Purification Handbook ," 2012. [Online]. Available: http://www.qiagen.com/resources/resourcedetail?id=f8ed5bab-15c3-4211 - bfa8...115] L. J. Hoffman, "Thermogravimetric Analysis of Bacillus anthracis Spores of DNA by Spectroscopy and Chromatography of Pyrolysis Products," M.S

STS-46 TCDT Slideware Training and Photo Session

Science.gov (United States)

1992-01-01

The crew of STS-46, Commander Loren J. Shriver, Pilot Andrew M. Allen, Payload Specialist Franco Malerba, Mission Specialists Jeffrey A. Hoffman, Franklin R. Chang-Diaz, Claude Nicollier, and Marsha S. Ivins are seen introducing themselves and discussing the mission during a photo session. The crew then answers questions from the press.

Bird species associated with green ash woodlands in the Slim Buttes, South Dakota

Science.gov (United States)

Robert A. Hodorff; Carolyn Hull Sieg

1986-01-01

In western South Dakota, native deciduous woodlands are uncommon, constituting less than 1% of the total land area (Boldt et al. 1978). The Green Ash/Common Chokecherry (Fraxinus pennsylvanica/Prunus virginiana) habitat type is the major deciduous habitat type in northwestern South Dakota (Hansen and Hoffman 1985). This type occurs in depressions,...

On finite capacity queueing systems with a general vacation policy

Directory of Open Access Journals (Sweden)

Jacqueline Loris-Teghem

2000-01-01

Full Text Available We consider a Poisson arrival queueing system with finite capacity and a general vacation policy as described in Loris-Teghem [Queueing Systems 3 (1988, 41-52]. From our previous results regarding the stationary queue length distributions immediately after a departure and at an arbitrary epoch, we derive a relation between both distributions which extends a result given in Frey and Takahashi [Operations Research Letters 21 (1997, 95-100] for the particular case of an exhaustive service multiple vacation policy.

Optimization of brain PET imaging for a multicentre trial: the French CATI experience.

Science.gov (United States)

Habert, Marie-Odile; Marie, Sullivan; Bertin, Hugo; Reynal, Moana; Martini, Jean-Baptiste; Diallo, Mamadou; Kas, Aurélie; Trébossen, Régine

2016-12-01

CATI is a French initiative launched in 2010 to handle the neuroimaging of a large cohort of subjects recruited for an Alzheimer's research program called MEMENTO. This paper presents our test protocol and results obtained for the 22 PET centres (overall 13 different scanners) involved in the MEMENTO cohort. We determined acquisition parameters using phantom experiments prior to patient studies, with the aim of optimizing PET quantitative values to the highest possible per site, while reducing, if possible, variability across centres. Jaszczak's and 3D-Hoffman's phantom measurements were used to assess image spatial resolution (ISR), recovery coefficients (RC) in hot and cold spheres, and signal-to-noise ratio (SNR). For each centre, the optimal reconstruction parameters were chosen as those maximizing ISR and RC without a noticeable decrease in SNR. Point-spread-function (PSF) modelling reconstructions were discarded. The three figures of merit extracted from the images reconstructed with optimized parameters and routine schemes were compared, as were volumes of interest ratios extracted from Hoffman acquisitions. The net effect of the 3D-OSEM reconstruction parameter optimization was investigated on a subset of 18 scanners without PSF modelling reconstruction. Compared to the routine parameters of the 22 PET centres, average RC in the two smallest hot and cold spheres and average ISR remained stable or were improved with the optimized reconstruction, at the expense of slight SNR degradation, while the dispersion of values was reduced. For the subset of scanners without PSF modelling, the mean RC of the smallest hot sphere obtained with the optimized reconstruction was significantly higher than with routine reconstruction. The putamen and caudate-to-white matter ratios measured on 3D-Hoffman acquisitions of all centres were also significantly improved by the optimization, while the variance was reduced. This study provides guidelines for optimizing quantitative

78 FR 43210 - Bracco Diagnostics et al.; Withdrawal of Approval of 52 New Drug Applications and 77 Abbreviated...

Science.gov (United States)

2013-07-19

...., 235 East 42nd 50 mg, 75 mg, and St., New York, NY 100 mg. 10017. NDA 020239 Kytril (granisetron... Kytril (granisetron Do. HCl) Tablets, EQ 1 mg (base), EQ 2 mg (base). NDA 020336 DynaCirc CR GlaxoSmith...) Abbott Laboratories. Capsules, 100 mg. NDA 021238 Kytril (granisetron Hoffman-La Roche, HCl) Oral...

Microplastics in the aquatic environment - Perspectives on the scope of the problem

Science.gov (United States)

Almost 50 yr ago, in the classic film The Graduate, the main character Ben (played by Dustin Hoffman) was advised that his future should be in “plastics.” That future may be coming back to haunt all of us now. It is estimated that 5 to 13 million metric tons of plastics enter the...

Homesick vulture moves into retirement village

African Journals Online (AJOL)

2007-03-01

Mar 1, 2007 ... contact him on (031) 785-2981. Raptor. Rescue is based at the newly opened. African Bird of Prey Centre on the Lion. Park road where other vultures and many species of hawks, owls and eagles are on display. This is also where Hoffman's wife, Shannon, and her team, present daily flying demonstrations.

Kirjanik Truman Capote ja tema teosed valgel linal / Aare Ermel

Index Scriptorium Estoniae

Ermel, Aare, 1957-2013

2006-01-01

Ameerika kirjanik Truman Capote (1924-1984) oli stsenarist viiele filmile. Tema kaks romaani on aluseks filmidele "Külmavereliselt" (RIchard Brooks, 1967) ja "Hommikueine Tiffany juures" (Blake Edwards, 1961). Edukas on mängufilm kirjanikust "Capote" : režissöör Bennett Miller : kirjanik Truman Capote' rollis Philip Seymour Hoffman : Ameerika Ühendriigid - Kanada 2005

Lignin-coated cellulose nanocrystals as promising nucleating agent for poly(lactic acid)

Science.gov (United States)

Anju Gupta; William Simmons; Gregory T. Schueneman; Eric A. Mintz

2016-01-01

We report the effect of lignin-coated cellulose nanocrystals (L-CNCs) on the crystallization behavior of poly(lactic acid) (PLA). PLA/L-CNC nanocomposites were prepared by melt mixing, and the crystallization behavior of PLA was investigated using differential scanning calorimetry. Isothermal crystallization data were analyzed using Avrami and Lauritzen–Hoffman...

Profile of Graduate and First-Professional Students: Trends from Selected Years, 1995-96 to 2007-08. Web Tables. NCES 2011-219

Science.gov (United States)

Chen, Xianglei

2010-01-01

Enrollment in graduate and first-professional education in the United States has increased in recent years--from about 2 million students in fall 1995 to more than 2.6 million students in fall 2007 (Snyder, Dillow, and Hoffman 2009, tables 206 and 207). Increasing enrollments overall raise questions regarding the types of students entering…

A Compression Algorithm in Wireless Sensor Networks of Bearing Monitoring

International Nuclear Information System (INIS)

Zheng Bin; Meng Qingfeng; Wang Nan; Li Zhi

2011-01-01

The energy consumption of wireless sensor networks (WSNs) is always an important problem in the application of wireless sensor networks. This paper proposes a data compression algorithm to reduce amount of data and energy consumption during the data transmission process in the on-line WSNs-based bearing monitoring system. The proposed compression algorithm is based on lifting wavelets, Zerotree coding and Hoffman coding. Among of that, 5/3 lifting wavelets is used for dividing data into different frequency bands to extract signal characteristics. Zerotree coding is applied to calculate the dynamic thresholds to retain the attribute data. The attribute data are then encoded by Hoffman coding to further enhance the compression ratio. In order to validate the algorithm, simulation is carried out by using Matlab. The result of simulation shows that the proposed algorithm is very suitable for the compression of bearing monitoring data. The algorithm has been successfully used in online WSNs-based bearing monitoring system, in which TI DSP TMS320F2812 is used to realize the algorithm.

Tantalum high-temperature oxidation kinetics

International Nuclear Information System (INIS)

Grigor'ev, Yu.M.; Sarkisyan, A.A.; Merzhanov, A.G.

1981-01-01

Kinetics of heat release and scale growth during tantalum oxidation within 650-1300 deg C temperature range in oxygen-containing media is investigated. Kinetic equations and temperature and pressure dependences of constants are ound Applicability of the kinetic Lorie mechanism for the description of the tantalum oxidation kinetics applicably to rapid-passing processes is shown. It is stated that the process rate (reaction ability) is determined by adsorption desorption factors on the external surface of the ''protective'' oxide for the ''linear'' oxidation stage [ru

Laser annealing of sputter-deposited a-SiC and a-SiCxNy films

Indian Academy of Sciences (India)

Administrator

Plasmas and Processes Laboratory, Technological Institute of Aeronautics, SJ dos Campos, Brazil. †Institute for Advanced Studies, .... Blum T, Dresler B, St Kabner and Hoffman M 1999 Surf. Coat. Technol. 116–119 1024. Costa A K and Camargo S S 2003 Surf. Coat. Technol. 163–164. 176. Czubatyj W et al 1991 J. Vac.

Author Details

African Journals Online (AJOL)

Hoffman, I. Vol 100, No 1 (2010) - Articles Treatment of trichomoniasis in pregnancy in sub-Saharan Africa does not appear to be associated with low birth weight or preterm birth. Abstract PDF. ISSN: 0256-95749. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

Systems Biology of Glucocorticoids in Muscle Disease

Science.gov (United States)

2010-10-01

Introduction Duchenne muscular dystrophy (DMD) is the most common and incurable muscular dystrophy of childhood. Muscle regeneration fails with...SUBJECT TERMS Duchenne Muscular dystrophy , Glucocorticoids, Systems biology, Drug mechanism 16. SECURITY CLASSIFICATION OF: U 17. LIMITATION...better targeted and more effective therapies for Duchenne muscular dystrophy dynamically. This MDA grant proposal is led by Dr. Eric Hoffman, and it

Sentimentalist Moral Education

Science.gov (United States)

Slote, Michael

2010-01-01

Care ethics, and moral sentimentalism more generally, have not developed a picture of moral education that is comparable in scope or depth to the rationalist/Kantian/Rawlsian account of moral education that has been offered by Lawrence Kohlberg. But it is possible to do so if one borrows from the work of Martin Hoffman and makes systematic use of…

Perspective Taking and Empathic Concern in Adolescence: Gender Differences in Developmental Changes

Science.gov (United States)

Van der Graaff, Jolien; Branje, Susan; De Wied, Minet; Hawk, Skyler; Van Lier, Pol; Meeus, Wim

2014-01-01

Empathy is an important social skill and is believed to play an essential role in moral development (Hoffman, 2000). In the present longitudinal study, the authors investigated adolescents' development of perspective taking and empathic concern from age 13 to 18 years (mean age at Wave 1 = 13 years, SD = 0.46) and examined its association with…

Mark Twain: A Collection of Critical Essays. Twentieth Century Views Series.

Science.gov (United States)

Smith, Henry Nash, Ed.

One of a series of works aimed at presenting contemporary critical opinion on major authors, this collection includes essays by Henry Nash Smith, Van Wyck Brooks, Maurice Le Breton, Kenneth Lynn, Leo Marx, Walter Blair, Daniel G. Hoffman, W. H. Auden, James M. Cox, Leslie Fiedler, Bernard DeVoto, and Tony Tanner--all dealing with the biography and…

Reliability of EP3OS symptom criteria and nasal endoscopy in the assessment of chronic rhinosinusitis - a GA(2) LEN study

DEFF Research Database (Denmark)

Tomassen, P; Newson, R B; Hoffmans, R

2011-01-01

To cite this article: Tomassen P, Newson RB, Hoffmans R, Lötvall J, Cardell LO, Gunnbjörnsdóttir M, Thilsing T, Matricardi P, Krämer U, Makowska JS, Brozek G, Gjomarkaj M, Howarth P, Loureiro C, Toskala E, Fokkens W, Bachert C, Burney P, Jarvis D. Reliability of EP3OS symptom criteria and nasal...

Reggio Emilia: una manera diferente de trabajar en Educaci??n Infantil

OpenAIRE

Bueno Rodr??guez, Isabel Mar??a

2015-01-01

El enfoque de atenci??n educativa a la infancia de Reggio Emilia es una forma de interpretar la educaci??n que surge despu??s de la Segunda Guerra Mundial, del deseo de un pueblo de cambiar la sociedad. Loris Malaguzzi es considerado el impulsor y creador de esta pedagog??a, basada en la escucha activa, interpretada ??sta como la habilidad de comprender al ni??o en sus cien lenguajes. Y de esta visi??n del ni??o, surge el atelier y atelierista, otra de las se??as de identidad de esta pedagog?...

Validation and calculation of uncertainties of the method of determination of creatinine in urine in internal dosimetry

International Nuclear Information System (INIS)

Sierra Barcedo, I.; Hernandez Gonzalez, C.; Benito Alonso, P.; Lopez Zarza, C.

2011-01-01

This paper describes the methodology used Lo conduct the validation of the quantification technique of content by specLrophoLomeLry creatinine in urine sarnples of exposed workers at risk of internal counterirritant, and the sludgy of ah sources uncertainty that influence in the proceas. This technique is used Lo carry ouL Lhe normahizaLion of Lhe amount of urine to urinary 24h, necessary for dosimeLric purposes, as well as a criterion for accepLance ox rejecLion of urine specimens received by the laboraLory.

RFID in libraries a step toward interoperability

CERN Document Server

Ayre, Lori Bowen

2012-01-01

The approval by The National Information Standards Organization (NISO) of a new standard for RFID in libraries is a big step toward interoperability among libraries and vendors. By following this set of practices and procedures, libraries can ensure that an RFID tag in one library can be used seamlessly by another, assuming both comply, even if they have different suppliers for tags, hardware, and software. In this issue of Library Technology Reports, Lori Bowen Ayre, an experienced implementer of automated materials handling systems, Provides background on the evolution of the standard

Fulltext PDF

Indian Academy of Sciences (India)

Several organic etchants were employed with different etching time to select suitable ... a = 12·036 Å, b = 5·450 Å, c = 8·299 Å and β = 97·86◦ .... Figure 2. (a) Optimized ampoule shape used for growth of 4-. ABP single crystal by vertical Bridgman .... Driscoll T A, Hoffman H J, Stone R E and Perkins P E 1986 J. Opt. Soc.

Combining Ketamine and Virtual Reality Pain Control During Severe Burn Wound Care: One Military and One Civilian Patient

Science.gov (United States)

2011-01-01

effects include nausea/ vomiting, constipation , sedation, interference with sleep cycles, increased irritability, itching, urinary retention, cog...Xia J, Hailan W. Ketamine and lornoxicam for preventing a fentanyl-induced increase in postoperative morphine requirement. Anesth Analg 2008;107(6...verbal pain descriptors. Pain 1978;5:5–18. 30 Hoffman HG, Patterson DR, Magula J, et al. Water - friendly virtual reality pain control during wound

Army Synthetic Validity Project Report of Phase 2 Results. Volume 2. Appendixes

Science.gov (United States)

1990-10-01

to Equipment & Food o Personal Hygine - Field & Garrison (4) o Kitchen Equipment - Garrison o Field Preparation of Foods & Equipment o Food, Field...Results: Volume II: Appendi i 12. PERSONAL AUTHOR(S) Wise, Lauress L. (AIR); Peterson, Norman G.; Houston, Janis (PDRI); Hoffman, R. Gene Campbell, John...o Handling KIA o Personal Hygiene & Preventive Medicine Numbers in parentheses indicate the number of participants that identified the task as

The Algebra of a q-Analogue of Multiple Harmonic Series

Directory of Open Access Journals (Sweden)

Yoshihiro Takeyama

2013-10-01

Full Text Available We introduce an algebra which describes the multiplication structure of a family of q-series containing a q-analogue of multiple zeta values. The double shuffle relations are formulated in our framework. They contain a q-analogue of Hoffman's identity for multiple zeta values. We also discuss the dimension of the space spanned by the linear relations realized in our algebra.

Evaluation of Antibacterial and Antifungal Properties of Alchornea laxiflora (Benth. Pax. & Hoffman

Directory of Open Access Journals (Sweden)

David A. Akinpelu

2015-01-01

Full Text Available Alchornea laxiflora leaf extract was tested against a range of microorganisms using standard microbiological methods for antimicrobial activities. The extract inhibited the growth of all the bacterial and 15 fungal isolates tested. The zones of inhibition exhibited against the test bacteria ranged between 12 mm and 24 mm and between 11 mm and 24 mm for the extract and the antibiotic streptomycin, respectively. The zones of inhibition observed against the fungal isolates by the extract ranged between 12 mm and 23 mm. The minimum inhibitory concentrations (MICs and the minimum bactericidal concentrations (MBCs exhibited by the extract against test bacteria ranged between 0.78 mg/mL–25 mg/mL and 1.56 mg/mL–25 mg/mL, respectively, while the MICs and minimum fungicidal concentrations (MFCs values for the test fungi ranged between 8.75 mg/mL–35.00 mg/mL and 8.75 mg/mL–35.00 mg/L, respectively. The preliminary phytochemical screening of the extract revealed the presence of alkaloids, tannins, flavonoids, saponins, and reducing sugars as major phytoconstituents in the extract. A. laxiflora leaf extract is a potent source of antibacterial and antifungal compounds; further studies on the extract are ongoing in our laboratories to elucidate the probable mechanism(s of action on bacteria and fungi found to be susceptible to the extract.

Violence Against Women

Science.gov (United States)

Fulu, Emma; Miedema, Stephanie

2015-01-01

Globalization theories have proliferated over the past two decades. However, global developments have yet to be systematically incorporated into theories around violence against women. This article proposes to add a global level to the existing ecological model framework, popularized by Lori Heise in 1998, to explore the relationships between global processes and experiences of violence against women. Data from the Maldives and Cambodia are used to assess how globalized ideologies, economic development and integration, religious fundamentalisms, and global cultural exchange, as components of a larger globalization process, have affected men and women’s experiences and perceptions of violence against women. PMID:26215287

Clinical Investigation Program.

Science.gov (United States)

1981-10-01

0. Effect of VaStUS Medialis £1 Obliquus Strength on Chondromalacia Patella. (0) 17,󈨒 Kearney, J. 3. Human Irplantation of Intraocular q, Lenses. (C...to: . 8i I - rot rlo Sat : Te (,t- i ricl teo TI~i:I valuation of Iowor caitruiitctiral leediro (I o occpy Wie v,, I(V O V as an /’.,i~nct Lu Lori!;i...ntrations. Pht [l /, ’A ,,T-: ipididyral fat pads arc re ovcd fr . ra ;vit’ rI.1 . I -l fat cells are -repared Ly shakir c at 7 t for (f, "i. ,tcs iv

Talking about Life

Science.gov (United States)

Impey, Chris

2010-08-01

Preface; Part I. Introduction Timothy Ferris, Iris Fry, Steven Dick, Ann Druyan, Pinky Nelson, Neil Tyson, Steve Benner and William Bains; Part II. Earth Roger Buick, Lynn Rothschild, John Baross, Joe Kirschvink, Andrew Knoll, Simon Conway Morris, Roger Hanlon and Lori Marino; Part III. Solar System Chris McKay, David Grinspoon, Jonathan Lunine, Carolyn Porco, Laurie Leshin, Guy Consolmagno and Peter Smith; Part IV. Exoplanets Alan Boss, Geoff Marcy, Debra Fischer, Sara Seager, David Charbonneau and Vikki Meadows; Part V. Frontiers Jill Tarter, Seth Shostak, Ray Kurzweil, Nick Bostrom, Paul Davies, Martin Rees, Ben Bova and Jennifer Michael Hecht; Reading list; Glossary; Index.

Creating Environments Through the Art of Occupational Therapy

Directory of Open Access Journals (Sweden)

Lydia Royeen

2016-07-01

Full Text Available Dr. Lori Reynolds has an interest in therapeutic gardens and the creation of living spaces that promote wellbeing for older adults. Dr. Reynolds educates various stakeholders on the benefits of occupational therapy, including landscape architects and senior living administrators. Her advocacy to expand occupational therapy beyond its mainstream roles is infectious. She speaks passionately about her work in helping to create therapeutic gardens and how her role as an occupational therapist offers great perspective in this process. She appreciates the environmental impact on an individual’s health and well-being and practices from a personenvironment-occupation theory

Research Using In Vivo Simulation of Meta-Organizational Shared Decision Making (SDM). Task 5: Creation of a User Friendly Knowledge Tool

Science.gov (United States)

2011-12-01

http://www.tribuneindia.com/2004/20041227/main1.htm Chang, S. E., McDaniels, T. L., Mikawoz, J., & Peterson , K. (2007). Infrastructure failure...University. Hind, P., Frost, M., & Rowley, S. ( 1996 ). The resilience audit and the psychological contract. Journal of Managerial Psychology, 11, 18-29...globalization by more globalization. Asian Perspective, 28, 19-44. Hurwitt, J. M., Bolotnick, T. J., Corsetti, B. A., Hershey , D. A., Hoffman, K. T

Use of a Vaccinia Construct Expressing the Circumsporozoite Protein in the Analysis of Protective Immunity to Plasmodium yoelii

Science.gov (United States)

1988-01-01

William R. Majarian, 2 ,5 Frank A. Robey, 3 Walter Weiss, 1 and Stephen L. Hoffman 1 lInfectious Diseases Department, Naval Medical Research Institute...autoradiography. Recombinant viruses which were positive in this assay were subject to 3 rounds of plaque purification. Finally, plaque purified virus was...mechanisms in the protective immunity elicited by inmunization with irradiated sporozoites (3,7,8,9). In an attempt to induce a protective cellular immune

Plastic bowing of the ribs in children

Energy Technology Data Exchange (ETDEWEB)

Caro, P.A.; Borden, S. IV

1988-06-01

Four cases of plastic bowing of the ribs are presented. In three patients with Werdnig-Hoffman disease, plastic curvatures were associated with chronic pneumonia and atelectasis. We postulate that intrapulmonary retractive forces can deform ribs thinned by muscular atrophy. In turn, thoracic collapse can perpetuate lobar and segmental atelectasis. In one case of osteogenesis imperfecta without pneumonia, we believe normal muscle forces bent ribs weakened by deficiency of normal cortical architecture.

Antecedents of ADHD: a historical account of diagnostic concepts.

Science.gov (United States)

Taylor, Eric

2011-06-01

The concept of ADHD has evolved gradually and still carries some traces of its origins. The idea of uncontrolled behaviour as a medical problem arose in eighteenth and nineteenth century accounts. It raised cultural issues about how far control was expected of children. This article traces the development of ideas with particular references to Hoffman's "Struwwelpeter", Frederick Still's "Disorders of Moral Control", minimal brain damage, and the hyperkinetic syndrome.

Challenges, Benefits, and Recommendations for Continued Nigerian Peacekeeping

Science.gov (United States)

2012-11-02

Lazarus Long”, Time Enough For Love (1973), http://en.wikiquote.org/wiki/ Robert_A._Heinlein. 1. Severine M. Rugumamu, “ Conflict Management in...Capabilities and Culpabilities, (Geneva, Switzerland: United Nations Institute for Disarmament Research, 2000), 13, 15. 3. Rugumamu, “ Conflict Management in...Africa,” 5. 4. Ibid. 5. Rugumamu, “ Conflict Management in Africa,” 7. 6. Frank G. Hoffman, “One Decade Later – Debacle in Somalia”, Proceedings

A Concept Map Knowledge Model of Intelligence Analysis

Science.gov (United States)

2011-05-01

Hoffman and Lintern 2006), cognitive task analysis (Crandall et al. 2006), expert systems (e.g., Coffey et al. 2003), and knowledge visualisation (e.g...information visualisation , application of CMapping is likely to continue expanding. 2.3 Components and properties of CMaps The main components of a...and relationships, e.g., images, texts, video and audio files, and Internet links, and enables the construction and sharing of CMap KMs. CMap KMs are

DoD Civilian Training: Source, Content, Frequency and Cost

Science.gov (United States)

1994-03-01

statistics. This especially includes Mr. Mike Dove, Ms. Kris Hoffman, Ms. Ninfa Camargo , Mr. Edward Christie, Ms. Rebecca Tag, Ms. Elizabeth Kundift Ms...Center, San Francisco , CA, will close. DoD Civilian Training Study Page 10 Chapter 2: Source There were 1,507 civilians trained We learned that 166...San Diego, CA Service School Command 13 60 San Diego, CA Submarine Training Facility 4 61 San Francisco , CA Naval Technical Training Center 13 62

Carter Stresses Importance of Innovation to Warfighters

Science.gov (United States)

2016-10-01

other members at the summit. The board will include Reid Hoffman, the head of LinkedIn ; former U.S. Special Opera- tions Command chief retired Navy...manufacturing and other types of related ad- vanced manufacturing technology,” said Dr . Dennis Butcher, the America Makes program manager. The University of...Calif. DoD photo Defense AT&L: September-October 2016 8 In the News techniques to support sustainment activities,” said Dr . Mary Kinsella, the

Vitamin D-Prostaglandin Interactions and Effects on Prostate Cancer

Science.gov (United States)

2005-10-01

fibroblasts (red) cocultured with CHO-p stably if they establish an intimately registered vicinity (Figure 3D ). expressing the P1-subunit (green) of dog Na...and Hoffman, J. F. (1978). Characterization of Tecnologia ) and a travel award for L. S. from The Royal Society (London) and a new photoaffinity...caused a significant reduction in PGE2 shown in Fig. 3D , in vehicle pretreated cells arachidonic acid secretion with the maximal decrease (.- 34

Development of an Autodiagnostic Adaptive Precision Trainer for Decision Making (ADAPT-DM)

Science.gov (United States)

2010-06-01

limitation of behavioral measures is that they are limited in their ability to discriminate performance within the ‘‘good’’ or ‘‘ bad ’’ performance... Berka et al. 2007; Klein and Hoffman 1992). In rule-based control mode, rules are consciously retrieved from memory and applied to gathered...because studies have shown a trend for decreasing EEG engagement with increasing task proficiency ( Berka et al. 2007; Stevens, Galloway, and Berka 2007). N

Plastic bowing of the ribs in children

International Nuclear Information System (INIS)

Caro, P.A.; Borden, S. IV

1988-01-01

Four cases of plastic bowing of the ribs are presented. In three patients with Werdnig-Hoffman disease, plastic curvatures were associated with chronic pneumonia and atelectasis. We postulate that intrapulmonary retractive forces can deform ribs thinned by muscular atrophy. In turn, thoracic collapse can perpetuate lobar and segmental atelectasis. In one case of osteogenesis imperfecta without pneumonia, we believe normal muscle forces bent ribs weakened by deficiency of normal cortical architecture. (orig.)

An Assessment of the 2006 Lebanon-Israeli War

Science.gov (United States)

2009-05-29

across the region. This “tactical plagiarism ” includes the successful use of improvised explosive devices and suicide bombers in Iraq, which have...tactical plagiarism ” comes from Hoffman, 16. For a discussion of the rise of suicide bombings in Afghanistan see Brian Glyn Williams, “Suicide Bombings in...18 Scott Macleod, “What Makes Lebanon so Skeptical About the Peace,” Time (August 2006), http://www.time.com/time/world/ article

Analysis to Inform Defense Planning Despite Austerity

Science.gov (United States)

2014-01-01

proved false : The “worst case” was much worse than planned for (Bensahel, Oliker, and Peterson, 2009, pp. 233ff). 26 Hoffman, 2009. 27 Ross, 2005...wisdom. Such work often has well-identified threats (named countries or groups), but not stereotyped point-case scenarios. Is such work threat-based...should be used only for narrow purposes and advertised as such. Endnotes 1 Gates, 2010, p. 90. 2 Kendall, 2013. 3 Boerman, 2013; Tompkins, Boerman, and

What the QDR Ought to Say about Landpower

Science.gov (United States)

2013-01-01

debates center on the missions, costs, or effectiveness, one should be wary of those critics pro- moting a new “Vietnam syndrome ,” arguing the United...States should never again go down the path it did over the last decade.6 Playing to this syndrome led directly to the problems encountered before...an even greater burden for the United States in allied and partner operations. 22 Frank G. Hoffman and Mike Noonan , “Defense Reorganization

Injury Control Part 2: Strategies for Prevention

Science.gov (United States)

2000-01-01

the cumulative effect of sustaining repeated blows to the head may still result in long-term neurological consequences or even death. Risk...military and civilian worlds include the following: ■ a ban on assault weapons ■ the elimination of trampolines in secondary schools ■ a ban on the...Hoffman, M. Cook, and L Stallones. Relationship of helmet use and head injuries among motorcycle crash victims in El Paso County, Colorado, 1989-1990

Feasibility of the Less Is More Approach in Treating Low-Risk Ductal Carcinoma In Situ Diagnosed on Core Needle Biopsy: Ten-Year Review of Ductal Carcinoma In Situ Upgraded to Invasion at Surgery.

Science.gov (United States)

Podoll, Mirna B; Reisenbichler, Emily S; Roland, Lania; Bruner, Andrew; Mizuguchi, Sarah; Sanders, Mary Ann G

2018-03-27

- Ductal carcinoma in situ (DCIS) represents 20% of screen-detected breast cancers. The likelihood that certain types of DCIS are slow growing and may never progress to invasion suggests that our current standards of treating DCIS could result in overtreatment. The LORIS (LOw RISk DCIS) and LORD (LOw Risk DCIS) trials address these concerns by randomizing patients with low-risk DCIS to either active surveillance or conventional treatment. - To determine the upgrade rate of DCIS diagnosed on core needle biopsy to invasive carcinoma at surgery and to evaluate the safety of managing low-risk DCIS with surveillance alone, by characterizing the pathologic and clinical features of upgraded cases and applying criteria of the LORD and LORIS trials to these cases. - A 10-year retrospective analysis of DCIS on core needle biopsy with subsequent surgery. - We identified 1271 cases of DCIS on core needle biopsy: 200 (16%) low grade, 649 (51%) intermediate grade, and 422 (33%) high grade. Of the 1271 cases, we found an 8% upgrade rate to invasive carcinoma (n = 105). Nineteen of the 105 upgraded cases (18%) had positive lymph nodes. Low-grade DCIS was least likely to upgrade to invasion, comprising 10% (10 of 105) of upgraded cases. Three of the 105 upgraded cases (3%) met criteria for the LORD trial, and all were low-grade DCIS on core needle biopsy with favorable biology on follow-up. - There is a clear risk of upgrade to invasion on follow-up excision; however, applying strict criteria of the LORD trial effectively decreases the likelihood of a missed invasive component or missed aggressive pathologic features.

Abundance and natural food resources of birds in Manusela National Park, Seram, Central Mollucas

Directory of Open Access Journals (Sweden)

WAHYU WIDODO

2006-01-01

Full Text Available The aim of this research was to know the abundance and natural food resources of birds in the Manusela National Park, Seram (Ceram, Central Moluccas. The observations were done by “line-transect methods”, which in observe 70.50 hours totality. The results were found 51 species of birds in area of the national parks and 4 of all, namely red lory (Eos bornea, papuan hornbill (Rhyticeros plicatus, shining starling (Aplonis metallica, and grey-necked friarbird (Philemon subcorniculatus were abundant. Fourty seven species of plants were known useful for 19 species of birds as the natural food resources, nesting-sites and roosting trees.

A Biological Model of the Effects of Toxic Substances

Science.gov (United States)

1990-02-28

show uner te hghes aenifia in (lwerrigh) te neron (arows ar ofte ovl i shpe nd "igh~up wih pace pti. mgniicaion Fig, 12 A neuron viewed under Hoffman...keyhole), the neurons seem to form a more substantial network . Scratches in the collagen surface controlled the direction of axon sprouting such that...Fig. 5). Templates could be removed without disturbing the neural network and hence might be a valuable tool in the future to focus the growth of

Poéticas de lo indecidible: Roberto Bolaño y la re-narración post-dictatorial

OpenAIRE

Eugenio Santangelo

2013-01-01

This paper examines Roberto Bolaño's rewriting of his own short story "Ramírez Hoffman, el infame" in the novel Estrella distante. It considers the re-narration of historical catastrophes as an ethical and political scheme, exploring Bolaño's poetics of narrative pluralization, as well as his ethics of reading as a critical experience. Following Idelber Avelar's theories on postdictatorial fiction, the paper highlights the author's effort to impede the resolution of the mourning process, oppo...

Germany at CERN

CERN Document Server

2001-01-01

The Eighth Exhibition of German Industry, "Germany at CERN" started this week and offers German companies the opportunity to establish professional contacts with CERN. From left to right in the foreground: Maximilian Metzger (BMBF), Bettinna Schöneseffen (BMBF), Karl-Heinz Kissler (SPL division leader), Horst Wenninger, and Hans Hoffman. Behind and to the right of Karl-Heinz Kissler is His Excellency Mr Walter Lewalter, Ambassador and permanent representative of Germany to the UN office in Geneva.

Growth and development of the impala Aepyceros melampus

Directory of Open Access Journals (Sweden)

N. Fairall

1976-08-01

Full Text Available Growth and development of the prenatal impala has been described by Fairall (1969 and Roettcher, Hoffman and Kayanja (1970 while weights and measurements of the mature animal have been reported by Sachs (1967 and Talbot and McCulloch (1965. Child (1964 has investigated growth in this species. This paper serves as a baseline for comparison of future changes in morphology of the species, as the animals were all obtained at the beginning of the culling programme.

Durability Testing of Additively Manufactured High Power Microwave Structures

Science.gov (United States)

2017-10-29

D. Hoffman, B. Singh and J. Thomas, Handbook of vacuum science and technology . San Diego, CA: Academic Press, 1998. [17] M. Cuneo, "The effect of...the higher He diffusion rate through rubber o-rings, its lower pumping speed within the cryopump and possibly saturation of the charcoal arrays...Third Edition, CRC Press (Boca Raton, FL, USA, 2016). [3] J. C. Whitaker, “Power Vacuum Tubes Handbook ”, Second Edition, CRC Press (New York, NY, USA

Efficacy of parasitological diagnosis methods in wild animals kept in captivity

OpenAIRE

Carvalho, Aline Feola; Barnabe, Anderson Sena; Federsoni, Igor Popovic; Ferraz, Renato Ribeiro Nogueira; Marco, Rogerio Milton De; Garcia, Isabel Priscilla

2018-01-01

ABSTRACT: Parasitic diseases are common in wild animals kept in captivity, and the research of these parasites is a tool used in wildlife management actions. Once the method most used in the practice of veterinary laboratories is the direct examination, it was considered appropriate to report the parasitism in captivity wildlife comparing this technique with modified methods of Hoffman, Pons and Janer (HPJ) and Willis. Fresh feces were surveyed in eleven precincts with specimens of the class ...

A comparison of mini-FLOTAC and FLOTAC with classic methods to diagnosing intestinal parasites of dogs from Brazil.

Science.gov (United States)

Lima, Victor Fernando Santana; Cringoli, Giuseppe; Rinaldi, Laura; Monteiro, Maria Fernanda Melo; Calado, Andréa Maria Campos; Ramos, Rafael Antonio Nascimento; Meira-Santos, Patrícia Oliveira; Alves, Leucio Câmara

2015-09-01

Dogs may be affected by different species of gastrointestinal parasites which present great importance in veterinary medicine and public health. Several techniques to diagnosing these parasites have been proposed, but different performances achieved by each method make difficult the choice of the best technique to be used. In this study, the performance of two classic methods (i.e., Willis and Hoffman techniques) and two recent techniques (i.e., FLOTAC and Mini-FLOTAC) to diagnosing gastrointestinal parasites of dogs was evaluated. Fecal samples (n = 127) of dogs divided in pools (n = 30) were collected and analyzed using four different techniques (see above). Eggs and/or oocysts of gastrointestinal parasites were detected in 93.3 % (28/30) of the samples. In particular, 20 % (6/30) were detected through the method of Hoffman, 53.3 % (16/30) by the Willis technique, and 63.3 % (19/30) and 90 % (27/30) by Mini-FLOTAC and FLOTAC, respectively. Ancylostomatidae, Trichuris vulpis and Toxocara canis were the most frequent parasites herein detected. The FLOTAC and Mini-FLOTAC techniques were the most efficient tools to detect eggs and/or oocysts of gastrointestinal parasites of dogs, therefore their use is recommended in the laboratorial routine of veterinary medicine. This study is the first report of the use of both techniques (i.e., FLOTAC and Mini-FLOTAC) to diagnosing parasites of dogs in Brazil.

Collusion, torture, and inequality: Understanding the actions of the American Psychological Association as institutional betrayal.

Science.gov (United States)

Gómez, Jennifer M; Smith, Carly P; Gobin, Robyn L; Tang, Shin Shin; Freyd, Jennifer J

2016-01-01

The Hoffman Report (Hoffman et al., 2015) documented devastating information about the American Psychological Association (APA) and the profession of psychology in the United States, prompting a public apology and a formal commitment by APA to correct its mistakes (APA, 2015). In the current article, we utilize betrayal trauma theory (Freyd, 1997), including betrayal blindness (e.g., Freyd, 1996; Tang, 2015) and institutional betrayal (Smith & Freyd, 2014b), to understand and learn from APA's behaviors. We further situate this discussion in the context of inequality, both within APA and in American society generally. We detail how the impact of APA's institutional betrayals extended beyond the organization, its members, and the psychology profession, highlighting the potential for disproportionate harm to minorities, including those who were tortured; Muslims, Middle Easterners, Afghans, and non-Americans who were not tortured; and other minority individuals (Gómez, 2015d). Acknowledging, understanding, and addressing its institutional betrayals offers APA the opportunity to take meaningful corrective and preventive measures. We propose several institutional reparations, including making concrete changes with transparency and conducting self-assessments to inform further needed changes (Freyd & Birrell, 2013). By engaging in institutional courage, APA has the potential to grow into an ethical governing body that fulfills its mission to "advance the creation, communication and application of psychological knowledge to benefit society and improve people's lives" (APA, 2016).

A new image reconstruction method for 3-D PET based upon pairs of near-missing lines of response

Energy Technology Data Exchange (ETDEWEB)

Kawatsu, Shoji [Department of Radiology, Kyoritu General Hospital, 4-33 Go-bancho, Atsuta-ku, Nagoya-shi, Aichi 456-8611 (Japan) and Department of Brain Science and Molecular Imaging, National Institute for Longevity Sciences, National Center for Geriatrics and Gerontology, 36-3, Gengo Moriaka-cho, Obu-shi, Aichi 474-8522 (Japan)]. E-mail: b6rgw@fantasy.plala.or.jp; Ushiroya, Noboru [Department of General Education, Wakayama National College of Technology, 77 Noshima, Nada-cho, Gobo-shi, Wakayama 644-0023 (Japan)

2007-02-01

We formerly introduced a new image reconstruction method for three-dimensional positron emission tomography, which is based upon pairs of near-missing lines of response. This method uses an elementary geometric property of lines of response, namely that two lines of response which originate from radioactive isotopes located within a sufficiently small voxel, will lie within a few millimeters of each other. The effectiveness of this method was verified by performing a simulation using GATE software and a digital Hoffman phantom.

Increased tree densities in South African savannas: >50 years of data suggests CO2 as driver

CSIR Research Space (South Africa)

Buitenwerf, R

2012-02-01

Full Text Available EC et al. (2007) Effects of four decades of fire manipulation on woody vegetation structure in savanna. Ecology, 88, 1119-1125. Hoffman MT, O'Connor TG (1999) Vegetation change over 40 years in the Weenen/Muden area, KwaZulu-Natal: evidence from... response of savanna woody plant species following harvesting: the value of persistence. Forest Ecology and Management, 232, 114-123. O'Connor TG (1985) A synthesis of field experiments concerning the grass layer in the savanna regions of southern...

Changes in Hormonal Concentrations after Different Heavy-Resistance Exercise Protocols in Women

Science.gov (United States)

1993-01-01

men, we values were 62.1 ± 5.6% (SD) carbohydrate , 13.5 ± 2.3% have previously demonstrated that these two acute pro- protein, and 24.4 ± 6.3% fat...growth hormone. These find- hormone has a complex influence on carbohydrate me- ings may be due to the much higher resting baseline of tabolism, with its...A. WESEMAN. B. P. CONROY, S. E. acteristics of national -caliber United States women weightlifters . GORDON. J. R. HOFFMAN, AND C. M. MARESH. The

Fundamentals of quantum chemistry

CERN Document Server

House, J E

2004-01-01

An introduction to the principles of quantum mechanics needed in physical chemistry. Mathematical tools are presented and developed as needed and only basic calculus, chemistry, and physics is assumed. Applications include atomic and molecular structure, spectroscopy, alpha decay, tunneling, and superconductivity. New edition includes sections on perturbation theory, orbital symmetry of diatomic molecules, the Huckel MO method and Woodward/Hoffman rules as well as a new chapter on SCF and Hartree-Fock methods. * This revised text clearly presents basic q

It's Different People Who Are Down Here:  Portraits of Three Young Women of Color Who Work in a Science Museum

OpenAIRE

Motto, Andrea Marie

2016-01-01

Eldora, Neethi and Seraphina are three young women who work as science interpreters at a large metropolitan museum. Each woman began her tenure at the age of 15, as part of an employment program for low-income and minority youth, and have since grown to become leaders within the program. Using autoethnography (Ellis, 2004) and portraiture (Lawrence-Lightfoot and Hoffman Davis, 1997), I explore the rich cultures and histories that each woman brings to her work, present stories that counter the...

Lead-Users vs. Emergent Nature Consumers for Marketing Co-Creation: Are They Really Different?

OpenAIRE

Vernette, Eric; Hamdi-Kidar, Linda

2014-01-01

This research extends Hoffman et al (2010)'s work on the relationship between two key targets for co-creation: Emergent-Nature Consumers (ENC) and Lead-Users (LU). These authors have shown that an ENC - who can innovate in any domain, could be more effective than a LU- who innovates in one specific-domain, for the development of new product concepts. We show that these two innovating users have common conceptual roots and that ENC character trait corresponds to an extension of LU characterist...

Behavioral, Ecological, and Evolutionary Aspects of Meat-Eating by Sumatran Orangutans (Pongo abelii).

Science.gov (United States)

Hardus, Madeleine E; Lameira, Adriano R; Zulfa, Astri; Atmoko, S Suci Utami; de Vries, Han; Wich, Serge A

2012-04-01

Meat-eating is an important aspect of human evolution, but how meat became a substantial component of the human diet is still poorly understood. Meat-eating in our closest relatives, the great apes, may provide insight into the emergence of this trait, but most existing data are for chimpanzees. We report 3 rare cases of meat-eating of slow lorises, Nycticebus coucang, by 1 Sumatran orangutan mother-infant dyad in Ketambe, Indonesia, to examine how orangutans find slow lorises and share meat. We combine these 3 cases with 2 previous ones to test the hypothesis that slow loris captures by orangutans are seasonal and dependent on fruit availability. We also provide the first (to our knowledge) quantitative data and high-definition video recordings of meat chewing rates by great apes, which we use to estimate the minimum time necessary for a female Australopithecus africanus to reach its daily energy requirements when feeding partially on raw meat. Captures seemed to be opportunistic but orangutans may have used olfactory cues to detect the prey. The mother often rejected meat sharing requests and only the infant initiated meat sharing. Slow loris captures occurred only during low ripe fruit availability, suggesting that meat may represent a filler fallback food for orangutans. Orangutans ate meat more than twice as slowly as chimpanzees (Pan troglodytes), suggesting that group living may function as a meat intake accelerator in hominoids. Using orangutan data as a model, time spent chewing per day would not require an excessive amount of time for our social ancestors (australopithecines and hominids), as long as meat represented no more than a quarter of their diet. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1007/s10764-011-9574-z) contains supplementary material, which is available to authorized users.

Trialling nutrient recommendations for slow lorises (Nycticebus spp.) based on wild feeding ecology.

Science.gov (United States)

Cabana, F; Dierenfeld, E; Wirdateti, W; Donati, G; Nekaris, K A I

2018-02-01

Slow loris (Nycticebus spp.) captive diets have been based on routine and anecdotes rather than scientific fact. The growing body of evidence contradicts the high fruit diet supported by such anecdotes. Non-human primate nutrient requirements are grouped into new (based on the common marmoset Callithrix jacchus) or old world (based on rhesus macaques Macaca mulatta) primates. Slow lorises are known to suffer from many health ailments in captivity such as dental disease, obesity, wasting and kidney issues all of which have been linked to diet. This study aimed to estimate nutrient intake from free-ranging slow lorises and to determine whether this intake can be used as nutrient recommendations. We collected data of nutrient intake, food passage rate and digestibility of captive slow lorises on three diet treatments 1: current captive type diet which is mostly fruits, 2: wild-type diet made only of food items from their natural diet, 3: new diet made to reflect wild slow loris nutrient intake. In order to validate our nutrient recommendations, diets 2 and 3 would have to be significantly different to Diet 1 in terms of nutrients, but not different from each other. Captive diets were significantly higher in soluble carbohydrates and lower in minerals and fibre fractions than both diets 2 and 3. Diets 2 and 3 led to a significantly increased food passage time and to more effective fibre and calcium digestion compared to Diet 1. We also observed obese individuals lost weight and underweight individuals gained weight. Our nutrient recommendations have been validated by our trials, and new or old world monkey nutrient recommendations are not consistent with our results. Diets should be high in protein and fibre and low in soluble carbohydrates and fats. © 2017 Blackwell Verlag GmbH.

Øjet springer over muren

DEFF Research Database (Denmark)

Kragh-Müller, Grethe

2010-01-01

artiklen omhandler "rummet som den tredje pædagog". Her beskrives, hvordan man i det pædagogiske arbejde i Reggio Emilia i Italien lægger vægt på indrette gode læringsmiljøer for børn. Der er en beskrivelse af, hvordan læring tænkes og tilrettelægges ud fra et konstruktivistisk grundlag, hvor der...... lægges vægt på en forståelse af, at barnet aktivt konstruerer sin viden. Endelig kan der læses om den kritik, som Loris Malaguzzi, en af grundlæggerne af og inspirator for det pædagogiske arbejde i Reggio Emilie, har givet af traditionel skoleundervisning....

A Study on Knowledge Gain and Retention when Using Multimedia Learning Materials of Different Quality

Directory of Open Access Journals (Sweden)

Maja Gligora Marković

2015-07-01

The results of an experimental study that involves low-quality and high-quality MLMs for two different topics and their effects on knowledge gain and retention of the polytechnic school students are presented. For the purpose of the research the LORI assessment tool was used to evaluate the quality of MLMs. The analysis of research data shows that MLMs developed according to the principles of multimedia learning and principles for reducing cognitive load were perceived as being of higher quality than those that were not developed using multimedia principles. Furthermore, the students’ usage of high-quality MLMs during treatment resulted in better knowledge acquisition and retention indicated by significantly higher scores in the three knowledge assessments.

Legalization of abortion doubtful in Italy.

Science.gov (United States)

1973-09-03

A proposal to legalize abortion has been presented to the Italian parliament by Representative Loris Fortuna. Thus far, the bill has the whole-hearted support of only the Radical Party. The Vatican has already voiced its strong opposition to this legislation. "The proposal to legalize abortion, even in certain circumstances, must inevitably be met with resistance and refusal," said Father Concetti, the Vatican representative. Professor Emanuele Lauricella, secretary of the Italian Obstetrics and Gynecology Society, on the other hand, claimed that abortion should be permitted, not only when an immediate danger to the mother's life exists, but also when there are other, simpler health risks. The passage of the bill in the near future, however, is very doubtful.

Analysis of Air Force Secondary Power Logistics Solution Contract

Science.gov (United States)

2010-05-21

for the F-1 5 award that thc SPLS contract has 9 option years during which the contracting offi cer mUSI determine whether the price for each option...slaled III part 2. $p..",:lal ..!lOrIS muSI he la ~cn 10 m:lkc ~ure Ihal i lone~’\\\\ e ll 0.11)1.𔄀 nOI "prolif ’ ’’l th ;l t\\ tr ForN’, .:~p.:n6...Iludil r~’I,:Oll1mendfllioll thai prup;:r dtlenlli’lO’ll\\)ll for hundling mUSI ~ obl:ained. NOfl-OOIlcur 11’,lh Ic \\’el 01 dclCnlllnftltOTl rtl

Kenneth W. Kizer on a national quality strategy. Interview by Lori Blades and Patricia A. Cholewka.

Science.gov (United States)

Kizer, K W

2000-01-01

Kenneth W. Kizer, MD MPH, is president and chief executive officer (CEO) of the National Forum for Health Care Quality Measurement and Reporting (National Quality Forum [NQF]), a not-for-profit membership organization created to develop and implement a national strategy for measuring and reporting healthcare quality. Dr. Kizer previously served as Under Secretary for Health in the U.S. Department of Veterans Affairs (VA) and is widely credited as being the chief architect of and driving force behind the greatest transformation of VA healthcare since its creation in 1946. NQF is a public-private partnership designed to involve all segments of the nation's healthcare system. The organization was proposed as part of the findings of the President's Advisory Commission on Consumer Protection and Quality in the Health Care Industry (1998). Since the release of those findings, leaders from consumer, purchaser, provider, health plan, and health services research organizations, as well as from government, have met to define the mission, structure, and financing of NQF, and staff support has been provided by the United Hospital Fund of New York. NQF is primarily a membership dues- and grant-financed organization and has received significant public and private funding from foundation and corporate grants, including a $2.5-million founding grant from the Robert-Wood Johnson Foundation and a $1-million founding grant from the California Healthcare Foundation. NQF also received initial financial support from The Commonwealth Fund and United Hospital Fund.

Persistent viremia by a novel parvovirus in a slow loris (Nycticebus coucang) with diffuse histiocytic sarcoma

NARCIS (Netherlands)

Canuti, Marta; Williams, Cathy V.; Gadi, Sashi R.; Jebbink, Maarten F.; Oude Munnink, Bas B.; Jazaeri Farsani, Seyed Mohammad; Cullen, John M.; van der Hoek, Lia

2014-01-01

Cancer is one of the leading health concerns for human and animal health. Since the tumorigenesis process is not completely understood and it is known that some viruses can induce carcinogenesis, it is highly important to identify novel oncoviruses and extensively study underlying oncogenic

Physical and subjective evaluation of a three-detector (TRIAD 88) SPECT system

International Nuclear Information System (INIS)

D'Souza, M.F.; Mumma, C.G.; Allen, E.W.; Phal, J.J.; Prince, J.R.

1995-01-01

The three-detector TRIAD 88 is a variable cylindrical FOV whole-body SPECT system designed for both brain as well as body organ imaging. The system performance was assessed in terms of physical indices and clinical quality. Measures of low contrast resolution using contrast-detail curves, high contrast resolution using LSFs and associated frequency descriptors, display characteristics, system sensitivity, energy resolution and uniformity analysis were utilized. In addition, images of Carlson phantom, Hoffman brain phantom and clinical brain images were used to compare two collimators subjectively. Measurements and calculations were obtained for two sets of parallel hole collimators, i.e., LEUR P AR and LEHR P AR. Of special interest is the consistency among the three detectors. The planar and volume sensitivities for the LEUR P AR collimator were about 58% of those of the LEHR P AR collimator. The planar spatial resolution of the two collimators differed by about 14%. The display was characterized by a logistic model H and D curve. The planar contrast-detail curves demonstrated no statistical difference in lesion detectability between the two collimator types, however SPECT phantom and clinical images demonstrated improved performance with the LEUR P AR collimator. Images of Hoffman single slice brain and Carlson phantoms and Tc-99m (HMPAO) brain images demonstrated excellent image quality. There was similarity in performance parameters of the three detector heads. 49 refs., 6 tabs., 8 figs

Occupational noise exposure, hearing loss, and notched audiograms in the HUNT Nord‐Trøndelag hearing loss study, 1996–1998

Science.gov (United States)

Engdahl, Bo; Hoffman, Howard J.; Li, Chuan‐Ming; Tambs, Kristian

2016-01-01

Objectives/Hypothesis To study the prevalence and usefulness of audiometric notches in the diagnosis of noise‐induced hearing loss (NIHL). Study Design Audiograms and data on noise exposure from 23,297 men and 26,477 women, aged 20 to 101 years, from the Nord‐Trøndelag Hearing Loss Study, 1996–1998. Methods The prevalence of four types of audiometric notches (Coles, Hoffman, Wilson) and 4 kHz notch were computed in relation to occupational noise exposure, age, sex, and report of recurrent ear infections. Results The prevalence of notches in the 3 to 6 kHz range (Wilson, Hoffman, and Coles) ranged from 50% to 60% in subjects without occupational noise exposure, and 60% to 70% in the most occupationally noise‐exposed men. The differences were statistically significant only for bilateral notches. For 4 kHz notches, the prevalence varied from 25% in occupationally nonexposed to 35% in the most occupationally exposed men, and the differences were statistically significant for both bilateral and unilateral notches. For women, the prevalence of notches was lower than in men, especially for 4 kHz notches, and the differences between occupationally noise exposed and nonexposed were smaller. Recreational exposure to high music was not associated with notched audiograms. Conclusions The detection of bilateral notches and unilateral 4 kHz notches is of some value in diagnosing NIHL, especially in men. Level of Evidence 4 Laryngoscope, 127:1442–1450, 2017 PMID:27696439

THE PROBLEM OF SUPPLIER

OpenAIRE

Raffo Lecca, Eduardo

2014-01-01

This is a famous problem from the annals of literature in operations research. G. Dantzig in [1] refers to W.W. Jacobs with his paper "The Caterer Problem" Nav. Log Res. Quart. 1 1954; as well as Gaddum, Hoffman and Sokolowsky "On the Solution of the Caterer Problem" Naval Res Logist. Quart., Vol.1, No. 3, september, 1954, and William Prager "On the Caterer Problem" of Management Sci, Vol 3, No. 1 october 1956 and Management Sci, Vol 3, No. 2 january 1957. Subsequently both G. Hadley presents...

Poéticas de lo indecidible: Roberto Bolaño y la re-narración post-dictatorial

Directory of Open Access Journals (Sweden)

Eugenio Santangelo

2013-01-01

Full Text Available This paper examines Roberto Bolaño's rewriting of his own short story "Ramírez Hoffman, el infame" in the novel Estrella distante. It considers the re-narration of historical catastrophes as an ethical and political scheme, exploring Bolaño's poetics of narrative pluralization, as well as his ethics of reading as a critical experience. Following Idelber Avelar's theories on postdictatorial fiction, the paper highlights the author's effort to impede the resolution of the mourning process, opposing the politics of memory of the so-called Latin American democratic transition.

Hybrid Maritime Warfare

DEFF Research Database (Denmark)

Schaub Jr, Gary John; Murphy, Martin; Hoffman, Frank

2017-01-01

Russia’s use of hybrid warfare techniques has raised concerns about the security of the Baltic States. Gary Schaub, Jr, Martin Murphy and Frank G Hoffman recommend a series of measures to augment NATO’s Readiness Action Plan in the Baltic region, including increasing the breadth and depth of naval...... exercises, and improving maritime domain awareness through cooperative programmes. They also suggest unilateral and cooperative measures to develop a sound strategic communications strategy to counter Moscow’s information operations, reduce dependence on Russian energy supplies and build the resilience...

Everything you might want to know about the Internet but are afraid to ask!. A new users resource

Energy Technology Data Exchange (ETDEWEB)

Thiel, E.

1993-09-01

This document is a guide to accessing the Internet and the services available on Internet. The document contains a short explanation of the Internet by E. Kroll and E. Hoffman, brief descriptions of the primary access tools, a glossary, answers to frequently asked questions about the Internet, J. Martin`s `Search for Internet Treasure` and other helpful information. The data access tools discussed in this document include Gopher, World Wide Web, WAIS, ASTRA, ARCHIE, WHOIS, NETSERV, and TRICKLE. The file transfer tool discussed is BITFTP. The two communication services discussed are NETNEWS and LISTSERV.

Transfection and imaging of diamond nanocrystals as scattering optical labels

International Nuclear Information System (INIS)

Smith, Bradley R.; Niebert, Marcus; Plakhotnik, Taras; Zvyagin, Andrei V.

2007-01-01

We report on the first demonstration of nanodiamond (ND) as a scattering optical label in a biological environment. NDs were efficiently transfected into cells using cationic liposomes, and imaged using differential interference and Hoffman modulation 'space' contrast microscopy techniques. We have shown that 55 nm NDs are biologically inert and produce a bright signal compared to the cell background. ND as a scattering label presents the possibility for extended biological imaging with relatively little thermal or biochemical perturbations due to the optical transparency and biologically inert nature of diamond

Predictores antropométricos de rendimiento en corredores de montaña

OpenAIRE

Alvero-Cruz, Jose Ramon; Parent Mathias, Veronica

2016-01-01

Introducción: Los corredores de fondo se caracterizan por poseer adecuados valores de grasa corporal, masa muscular y un bajo peso proporcional (Hoffman, 2010).El objetivo del presente trabajo fue analizar las relaciones entre variables antropométricas y de composición corporal con el rendimiento en una prueba de trail en corredores de montaña. Material y métodos: Han participado en este estudio 14 corredores de montaña, varones, de nivel competitivo regional-nacional de 36,1 ± 5,6 años ...

CMV information: print, online, phone, video.

Science.gov (United States)

1996-10-04

There are a number of treatment options available for cytomegalovirus (CMV) and approved preventive treatments for persons at high risk. Partnership in Vision has published a CMV Retinitis Report. A one-hour continuing medication education course entitled CMV Prophylaxis and Intraocular Therapy is available on the World Wide Web. The National Association of People with AIDS (NAPWA) has extended its CMV information hotline. Cidofovir is a new drug approved for marketing for CMV treatment. It is infused only once every two weeks. CMV videotapes are available from Hoffman-La Roche.

Notions such as "truth" or "correspondence to the objective world" play no role in explanatory accounts of perception.

Science.gov (United States)

Mausfeld, Rainer

2015-12-01

Hoffman, Singh, and Prakash (Psychonomic Review and Bulletin, 2015, in press) intend to show that perceptions are evolutionarily tuned to fitness rather than to truth. I argue, partly in accordance with their objective, that issues of 'truth' or 'veridicality' have no place in explanatory accounts of perception theory, and rather belong to either ordinary discourse or to philosophy. I regard, however, their general presumption that the evolutionary development of core achievements of the human perceptual system would be primarily determined by aspects of fitness and adaption as unwarranted in light of the evidence available.

If it doesn’t spread it’s dead  : En kvalitativ studie över hur unga entreprenörer positionerar sig på marknaden och med hjälp av sociala medier sprider sitt varumärke

OpenAIRE

Hoffman, Anna; Ahlinder, Sandra

2013-01-01

Abstract Title: If it doesn’t spread it’s dead - a qualitative study on how young entrepreneurs are positioning themselves in the marketplace and with the help of social media spreading their brand. (If it doesn’t spread it’s dead ­- en kvalitativ studie om hur unga entreprenörer positionerar sig på marknaden, med hjälp av sociala medier sprider sitt varumärke).   Number of pages: 48   Author: Sandra Ahlinder, Anna Hoffman   Tutor: Peder Hård af Segerstad Course: Media and Communications Stud...

Infant with MRSA necrotizing fasciitis

Directory of Open Access Journals (Sweden)

Panglao Rajan M

2014-05-01

Full Text Available Maria Panglao Rajan,1 Pinkal Patel,1 Lori Cash,1 Anjali Parish,2 Scott Darby,1 Jack Yu,3 Jatinder Bhatia11Department of Pediatrics, Children's Hospital of Georgia, Augusta, GA, USA; 2Medical Center of Central Georgia, Augusta, GA, USA; 3Department of Plastic Surgery, Children's Hospital of Georgia, Augusta, GA, USAAbstract: This is an unusual case of necrotizing fasciitis caused by methicillin resistant Staphylococcus aureus in this premature infant, which highlights severity, rapid progression of this disease and shows outcome if intervention is initiated at an early stage. This case also highlights one of the possible serious complications of percutaneous inserted central catheter (PICC line, which can be life threatening.Keywords: necrotizing fasciitis, methicillin resistant Staphylococcus aureus, PICC, premature infant

Impact of climate and moonlight on a venomous mammal, the Javan slow loris (Nycticebus javanicus Geoffroy, 1812)

NARCIS (Netherlands)

Rode-Margono, E.J.; Nekaris, K.A.-I.

2014-01-01

Predation pressure, food availability, and activity may be affected by level of moonlight and climatic conditions. While many nocturnal mammals reduce activity at high lunar illumination to avoid predators (lunarphobia), most visually-oriented nocturnal primates and birds increase activity in bright

Occupational noise exposure, hearing loss, and notched audiograms in the HUNT Nord-Trøndelag hearing loss study, 1996-1998.

Science.gov (United States)

Lie, Arve; Engdahl, Bo; Hoffman, Howard J; Li, Chuan-Ming; Tambs, Kristian

2017-06-01

To study the prevalence and usefulness of audiometric notches in the diagnosis of noise-induced hearing loss (NIHL). Audiograms and data on noise exposure from 23,297 men and 26,477 women, aged 20 to 101 years, from the Nord-Trøndelag Hearing Loss Study, 1996-1998. The prevalence of four types of audiometric notches (Coles, Hoffman, Wilson) and 4 kHz notch were computed in relation to occupational noise exposure, age, sex, and report of recurrent ear infections. The prevalence of notches in the 3 to 6 kHz range (Wilson, Hoffman, and Coles) ranged from 50% to 60% in subjects without occupational noise exposure, and 60% to 70% in the most occupationally noise-exposed men. The differences were statistically significant only for bilateral notches. For 4 kHz notches, the prevalence varied from 25% in occupationally nonexposed to 35% in the most occupationally exposed men, and the differences were statistically significant for both bilateral and unilateral notches. For women, the prevalence of notches was lower than in men, especially for 4 kHz notches, and the differences between occupationally noise exposed and nonexposed were smaller. Recreational exposure to high music was not associated with notched audiograms. The detection of bilateral notches and unilateral 4 kHz notches is of some value in diagnosing NIHL, especially in men. 4 Laryngoscope, 127:1442-1450, 2017. © 2016 The Authors. The Laryngoscope published by Wiley Periodicals, Inc. on behalf of American Laryngological, Rhinological and Otological Society Inc, “The Triological Society” and American Laryngological Association (ALA).

Kas sotsiaalmeedias turundamiseks tehtud investeeringu tootlust saab mõõta? Donna L. Hoffman, Marek Fodor

Index Scriptorium Estoniae

Hoffmann, Donna L.

2010-01-01

Sotsiaalmeedia vahendusel toimuva turunduse efektiivsuse mõõtmise võimalustest. Lisatud tabel : Sotsiaalmeediarakenduste olulisemad mõõdikud, süstematiseerituna võtmetähtsusega sotsiaalmeedia eesmärkide järgi

78 FR 31590 - Sears Holdings Management Corporation, A Division Of Sears Holdings Corporation, Hoffman Estates...

Science.gov (United States)

2013-05-24

... (``My position at Sears had nothing to do with Analytics or space Management. I worked in Marketing... firm clarified that one petitioner supplied print marketing management services, another petitioner... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-81,253] Sears Holdings Management...

PLA Philosophy, Policy, and Practice Implications: Revisiting the 2009 Hoffman, Travers, Evans, and Treadwell Study

Science.gov (United States)

Travers, Nan L.

2013-01-01

The heart of prior learning assessment (PLA) is the quality and validity of the academic evaluation process itself. Institutions providing PLA opportunities are faced with issues of accountability from all constituents: students, faculty, state systems, and accrediting agencies. Increasingly, institutions are more and more accepting of different…

Desarrollo del razonamiento moral, razonamiento moral prosocial y empatía en la adolescencia y juventud

OpenAIRE

Retuerto Pastor, Angel

2002-01-01

RESUMEN DE LA TESIS «DESARROLLO DEL RAZONAMIENTO MORAL, RAZONAMIENTO MORAL PROSOCIAL Y EMPATÍA EN LA ADOLESCENCIA Y JUVENTUD» La tesis consta de una parte teórica y de una parte empírica. En la parte teórica se describe el enfoque cognitivo-evolutivo de Kohlberg (capítulo 1), el planteamiento cognitivo-afectivo de Eisenberg (capítulo 2), la teoría de Hoffman y otras sobre la empatía (capítulo 3) y la relación teórica entre el desarrollo del razonamiento moral, el razonamiento moral prosoci...

RECSI 2010. IX Reunión Española sobre Criptología y Seguridad de la Información

OpenAIRE

Diversos Autors

2010-01-01

La seguridad y la privacidad han preocupado a la Humanidad desde tiempos inmemoriales. A lo largo de la historia, se han diseñado y aplicado distintas estrategias, herramientas y técnicas para hacer frente a espías y enemigos. En los albores de la computación y la Ingeniería Informática, el profesor Lance Hoffman ya destacó la importancia de velar por la seguridad en todo lo referente a la computación para garantizar el éxito de ésta. Así pues, una gran comunidad de científicos e ingenieros h...

Reverse engineering the world: a commentary on Hoffman, Singh, and Prakash, "The interface theory of perception".

Science.gov (United States)

Fields, Chris

2015-12-01

Does perception hide the truth? Information theory, computer science, and quantum theory all suggest that the answer is "yes." They suggest, indeed, that useful perception is only feasible because the truth can be hidden.

Dynamic wetting and spreading and the role of topography

International Nuclear Information System (INIS)

McHale, Glen; Newton, Michael I; Shirtcliffe, Neil J

2009-01-01

The spreading of a droplet of a liquid on a smooth solid surface is often described by the Hoffman-de Gennes law, which relates the edge speed, v e , to the dynamic and equilibrium contact angles θ and θ e through v e ∝θ(θ 2 -θ e 2 ). When the liquid wets the surface completely and the equilibrium contact angle vanishes, the edge speed is proportional to the cube of the dynamic contact angle. When the droplets are non-volatile this law gives rise to simple power laws with time for the contact angle and other parameters in both the capillary and gravity dominated regimes. On a textured surface, the equilibrium state of a droplet is strongly modified due to the amplification of the surface chemistry induced tendencies by the topography. The most common example is the conversion of hydrophobicity into superhydrophobicity. However, when the surface chemistry favors partial wetting, topography can result in a droplet spreading completely. A further, frequently overlooked consequence of topography is that the rate at which an out-of-equilibrium droplet spreads should also be modified. In this report, we review ideas related to the idea of topography induced wetting and consider how this may relate to dynamic wetting and the rate of droplet spreading. We consider the effect of the Wenzel and Cassie-Baxter equations on the driving forces and discuss how these may modify power laws for spreading. We relate the ideas to both the hydrodynamic viscous dissipation model and the molecular-kinetic theory of spreading. This suggests roughness and solid surface fraction modified Hoffman-de Gennes laws relating the edge speed to the dynamic and equilibrium contact angle. We also consider the spreading of small droplets and stripes of non-volatile liquids in the capillary regime and large droplets in the gravity regime. In the case of small non-volatile droplets spreading completely, a roughness modified Tanner's law giving the dependence of dynamic contact angle on time is

Effect of clay structure and type of organomodifier on the thermal properties of poly(ethylene terephthalate) based nanocomposites

International Nuclear Information System (INIS)

Papageorgiou, George Z.; Karandrea, Eva; Giliopoulos, Dimitrios; Papageorgiou, Dimitrios G.; Ladavos, Athanasios; Katerinopoulou, Aikaterini; Achilias, Dimitris S.; Triantafyllidis, Konstantinos S.; Bikiaris, Dimitrios N.

2014-01-01

Graphical abstract: - Highlights: • Poly(ethylene terephthalate) nanocomposites were prepared using 4 different clay types. • Nanomer I30E clay was exfoliated into PET, as it was found from XRD. • The intercalation of Kunipia-CTAB resulted in less pronounced effect on PET crystallization. • The immobilized amorphous fraction, activation energy and nucleation activity were calculated. • Nanomer I30E clay facilitated the crystallization process. - Abstract: In the current investigation, nanocomposites of poly(ethylene terephthalate) (PET) with different types of organo-clays were produced using the melt mixing technique. Two types of commercial inorganic clays (Laponite-synthetic hectorite and Kunipia-montmorillonite) were studied after cation-exchange with hexadecyltrimethylammonium bromide (CTAB) while two commercial organo-modified montmorillonite clays (Nanomer I.30E modified with primary octadecylammonium ions and Cloisite 10A modified with quaternary dimethyl benzyl hydrogenated-tallow ammonium ions) were also investigated. The structure of the nanocomposites was studied by X-ray diffraction measurements. A detailed crystallization analysis was carried out by means of both isothermal and non-isothermal (melt and cold) measurements. All data were analyzed using the simple Avrami equation along with advanced isoconversional methods. The nucleation activity of the filler was investigated in every case. Lauritzen–Hoffman analysis was employed to isothermal data to estimate the nucleation parameters. From all these measurements it was found that the organo-clay I.30E induces the higher crystallization rates and lower activation energy and is more effective regarding the PET crystallization compared to the other types of organo-clays. The I.30E organo-clay nanocomposite exhibited also the higher immobilized amorphous fraction and the higher nucleation parameter K g in the Lauritzen–Hoffman analysis. This is due to its better dispersion and exfoliation

Enteroparasitoses em escolares do Distrito de Martinésia, Uberlândia, MG: um estudo piloto

Directory of Open Access Journals (Sweden)

Carla Borges Ferreira

1997-10-01

Full Text Available Este trabalho avalia a ocorrência de parasitas intestinais em estudantes do Distrito de Martinésia, município de Uberlândia (MG. Foram examinadas 103 crianças, no período de setembro a novembro de 1995, segundo o método de Lutz ou Hoffman, Pons & Janer. O coeficiente geral de prevalência foi de 22,3% e os índices de infecção mais elevados foram observados no grupo etário 8 a 9 anos (34,8%, nos moradores da vila (30,0% e no sexo feminino (26,9%. Helmintoses e protozooses apresentaram taxas de prevalência similares (10,7% e 12,6%, respectivamente. Giardia lamblia foi o único protozoário parasito verificado e apenas um caso de poliparasitismo foi encontrado. Conclui-se que a prevalência de enteroparasitoses no grupo estudado é menor do que o esperado para uma comunidade rural, o que é, provavelmente, uma conseqüência das boas condições sanitárias presentes naquele distrito.This work evaluates the occurence of intestinal parasites in the students of the Martinesia district, Uberlândia municipality, Minas Gerais State. A total of 103 children were examined, from september to november 1995, according to Lutz or Hoffman, Pons and Janer method. The overall prevalence rate was 22.3% and the highest indices of infection were observed in 8-9 age group (34.8%, in village dwellers (30.0% and in females (26.9%. Helminthosis and protozoosis showed similar prevalence rates (10.7% and 12.6%, respectively. Giardia lamblia was the unique protozoan parasite verified and only one case of poliparasitism was found. We concluded that: the prevalence of enteroparasitosis in the studied group is lower than expectations for a rural community, what is, probably, a consequence of the good sanitary conditions presenting in that district.

Effect of clay structure and type of organomodifier on the thermal properties of poly(ethylene terephthalate) based nanocomposites

Energy Technology Data Exchange (ETDEWEB)

Papageorgiou, George Z.; Karandrea, Eva; Giliopoulos, Dimitrios [Department of Chemistry, Aristotle University of Thessaloniki (AUTH), GR-54124 Thessaloniki (Greece); Papageorgiou, Dimitrios G. [Solid State Physics Department, School of Physics, Aristotle University of Thessaloniki AUTH, GR-54124 Thessaloniki (Greece); Ladavos, Athanasios; Katerinopoulou, Aikaterini [University of Patras, Agrinio 30100 (Greece); Achilias, Dimitris S.; Triantafyllidis, Konstantinos S. [Department of Chemistry, Aristotle University of Thessaloniki (AUTH), GR-54124 Thessaloniki (Greece); Bikiaris, Dimitrios N., E-mail: dbic@chem.auth.gr [Department of Chemistry, Aristotle University of Thessaloniki (AUTH), GR-54124 Thessaloniki (Greece)

2014-01-20

Graphical abstract: - Highlights: • Poly(ethylene terephthalate) nanocomposites were prepared using 4 different clay types. • Nanomer I30E clay was exfoliated into PET, as it was found from XRD. • The intercalation of Kunipia-CTAB resulted in less pronounced effect on PET crystallization. • The immobilized amorphous fraction, activation energy and nucleation activity were calculated. • Nanomer I30E clay facilitated the crystallization process. - Abstract: In the current investigation, nanocomposites of poly(ethylene terephthalate) (PET) with different types of organo-clays were produced using the melt mixing technique. Two types of commercial inorganic clays (Laponite-synthetic hectorite and Kunipia-montmorillonite) were studied after cation-exchange with hexadecyltrimethylammonium bromide (CTAB) while two commercial organo-modified montmorillonite clays (Nanomer I.30E modified with primary octadecylammonium ions and Cloisite 10A modified with quaternary dimethyl benzyl hydrogenated-tallow ammonium ions) were also investigated. The structure of the nanocomposites was studied by X-ray diffraction measurements. A detailed crystallization analysis was carried out by means of both isothermal and non-isothermal (melt and cold) measurements. All data were analyzed using the simple Avrami equation along with advanced isoconversional methods. The nucleation activity of the filler was investigated in every case. Lauritzen–Hoffman analysis was employed to isothermal data to estimate the nucleation parameters. From all these measurements it was found that the organo-clay I.30E induces the higher crystallization rates and lower activation energy and is more effective regarding the PET crystallization compared to the other types of organo-clays. The I.30E organo-clay nanocomposite exhibited also the higher immobilized amorphous fraction and the higher nucleation parameter K{sub g} in the Lauritzen–Hoffman analysis. This is due to its better dispersion and

Estudio clínico, genético y molecular en un paciente con atrofia muscular espinal

Directory of Open Access Journals (Sweden)

Ibis Menéndez Alejo

1998-03-01

Full Text Available Las atrofias musculares espinales (AME infantiles son enfermedades neuromusculares hereditarias caracterizadas por la degeneración de las motoneuronas alfa del asta anterior de la médula espinal. La enfermedad de Werdnig-Hoffmann, AME tipo I, es la forma más grave, se transmite como un carácter autosómico recesivo y los afectados suelen fallecer durante el primer año de vida por fallo respiratorio. En este trabajo se presenta una familia cubana con 2 hijos con AME tipo I, en la cual el estudio molecular en uno de ellos permitió identificar los 2 cromosomas parentales asociados con ésta. Se encontró además en el paciente una deleción de ambas copias del gen SMN (exón 8 y del gen NAIP (exón 5. Los hallazgos ilustran la utilidad de estos estudios, con vistas a posibilitar el diagnóstico prenatal de la enfermedad.The infantile spinal muscular atrophies (SMA are hereditary neuromuscular diseases characterized by degenerated Alfa-motoneurons of the anterior spinal marrow horn. Werdning-Hoffman disease, Type 1 SMA, is the most serious affection being transmitted as an autosomal recessive character, so those affected may die from respiratory failures in the first year of life. This paper presents a Cuban family with two kids who suffer from Type-1 SMA; the molecular analysis carried out in one of them identified two parental chromosomes responsible for the disease. Also, a deletion of both copies of SMN gene (exon 8 and NAIP gene (exon 5 were discovered in this patient. These findings showed the usefulness of this kind of studies with a view to making a prenatal diagnosis of Werdning-Hoffman disease.

Review of foreign approaches to development of communication in children with autistic spectrum disorders

Directory of Open Access Journals (Sweden)

Soldatenkova E.N.

2015-03-01

Full Text Available The article presents a generalized overview of international approaches to the evaluation and formation of communication in children with autism spectrum disor ders (ASD. Described radicals communication disorders in children with ASD. Analyzed foreign approaches (Communication system for the exchange of images (PECS Lori Frost and Andrew Bondy; options piktogramme6ideogrammic communication (bliss6symbolism, Loeb system, a system of sign language; Program in Applied verbal behavior; a Method of facilitating communication (FC and others used for the development of communication in children with ASD and donditions underlying these approaches. Examined differences in focus for the development of communication in children with ASD in domestic and foreign schools. The main conditions for the development of communication in children with ASD described in the framework of cultural historical psychology and activity approach, ensuring the inclusion of children with ASD in education.

Multiparasitism in a wild cat (Leopardus colocolo (Carnivora: Felidae in southern Brazil

Directory of Open Access Journals (Sweden)

Lucas Trevisan Gressler

Full Text Available Abstract Parasitic diseases reflect the health and balance of ecosystems, affecting not only individuals but also entire populations or communities. The aim of this study was to report on the diversity of parasitic helminths detected in the feces of a wild feline in southern Brazil. Parasites were obtained from fecal samples, and four techniques were used for parasitological examination: direct examination, centrifugal flotation with zinc sulfate (Faust technique, simple sedimentation (Hoffman technique and Baermann-Moraes. The parasites were identified through micrometry and morphology, as follows: Ancylostoma sp., Toxocara sp., Trichuridae, Aelurostrongylus abstrusus, Alaria sp., and Spirometra sp. We recorded the genus Ancylostoma parasitizing L. colocolo for the first time.

Reevaluation of the case, de Hoffman, and Placzek one-group neutron transport benchmark solution in plane geometry

International Nuclear Information System (INIS)

Ganapol, B.D.

1986-01-01

In a course on neutron transport theory and also in the analytical neutron transport theory literature, the pioneering work of Case et al. (CdHP) is often referenced. This work was truly a monumental effort in that it treated the fundamental mathematical properties of the one-group neutron Boltzmann equation in detail as well as the numerical evaluation of most of the resulting solutions. Many mathematically and numerically oriented dissertations were based on this classic monograph. In light of the considerable advances made both in numerical methods and computer technology since 1953, when the historic CdHP monograph first appeared, it seems appropriate to reevaluate the numerical benchmark solutions found therein with present-day computational technology. In most transport theory courses, the subject of proper benchmarking of numerical algorithms and transport codes is seldom addressed at any great length. This may be the reason that the benchmarking procedure is so rarely practiced in the nuclear community and when practiced is improperly applied. In this presentation, the development of a new benchmark for the one-group neutron flux in an infinite medium will be detailed with emphasis placed on the educational aspects of the benchmarking activity

Produtividade, necessidade e afetividade: justiça distributiva e empatia em jovens brasileiros Productividad, necesidad y afectividad: justicia distributiva y empatía en jóvenes brasileños Productivity, necessity and affectivity: distributive justice and empathy in brazilian youth

Directory of Open Access Journals (Sweden)

Leonardo Rodrigues Sampaio

2010-03-01

Full Text Available Ao longo dos anos, os pesquisadores vêm estudando a influência do desenvolvimento cognitivo e de diferentes variáveis sociodemográficas e culturais sobre os julgamentos distributivos, porém o estudo da influência do desenvolvimento afetivo sobre noções de justiça distributiva não tem constituído uma preocupação dos pesquisadores. Procurando preencher esta lacuna, o objetivo principal desta pesquisa foi investigar se a empatia influenciava significativamente as decisões distributivas de 107 jovens. A justiça distributiva foi avaliada através de uma situação-problema que envolvia um contexto empresarial, e a empatia, por meio da Escala Multidimensional de Reatividade Interpessoal - EMRI. Nos resultados, observou-se que as dimensões afetivas da empatia influenciaram a distribuição de dinheiro entre os personagens da situação-problema. Estes resultados foram discutidos à luz das teorias de Piaget e Hoffman e dos dados de pesquisas anteriores.Lo largo de los años, los investigadores han estado estudiando la influencia del desarrollo cognitivo y de diferentes variables socio demográficas y culturales sobre los jueces distributivos. Sin embargo, el estudio de la influencia del desarrollo emocional en los conceptos de justicia distributiva no ha sido una preocupación de los investigadores. Buscando llenar este vacío, el objetivo principal de esta investigación fue investigar si la empatía influyó significativamente en las decisiones de 107 jóvenes brasileños. La justicia distributiva se evaluó por medio de una situación-problema en un contexto empresarial, y la empatía a través de la Escala Multidimensional de Reatividade Interpessoal - EMRI. En los resultados, se observó que las dimensiones emocionais de la empatía influyeron en la distribución de dinero entre los caracteres da situación-problema. Estos resultados fueron discutidos a la luz de las teorías de Piaget y Hoffman, y los datos de estudios anteriores

REGGIO EMILIA, LUGAR DONDE LA INFANCIA VIVE LA CIENCIA

Directory of Open Access Journals (Sweden)

Lilian Narváez Prosser

2009-01-01

Full Text Available La ciudad italiana de Reggio Emilia, situada a 60 kilómetros de Bolonia que alberga a poco más de 140.000 personas, fue punto de encuentro con especialistas en Educación de la primera infancia, quienes compartieron el conocimiento, in situ, de la metodología de trabajo que Loris Malaguzzy creó e implementó en dicha ciudad y que ha sido reconocida a nivel mundial como la mejor calidad de trabajo en la primera infancia en todo el mundo. Dicha metodología está basada en su ley fundamental de la realidad, la que su creador clarifi ca al escribir "Si se hacen cosas reales, también son reales sus consecuencias" en el respeto, en donde la construcción del pensamiento y la ciencia como proyectos de trabajo son elementos permanentes en una pedagogía relacional con agentes educativos activos y comprometidos que incluye a la comunidad en pleno.

FRAUD/SABOTAGE Killing Nuclear-Reactors Need Modeling!!!: "Super"alloys GENERIC ENDEMIC Wigner's-Disease/.../IN-stability: Ethics? SHMETHICS!!!

Science.gov (United States)

Asphahani, Aziz; Siegel, Sidney; Siegel, Edward

2010-03-01

Carbides solid-state chemistry domination of old/new nuclear- reactors/spent-fuel-casks/refineries/jet/missile/rocket-engines in austenitic/FCC Ni/Fe-based(so miscalled)``super"alloys(182/82; Hastelloy-X,600,304/304L-SSs,...,690!!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's-diseas(WD)[J.Appl.Phys.17,857 (1946)]/Ostwald-ripening/spinodal-decomposition/overageing- embrittlement/thermal-leading-to-mechanical(TLTM)-INstability: Mayo[Google:``If Leaks Could Kill"; at flickr.com search on ``Giant-Magnotoresistance"; find: Siegel[J.Mag.Mag.Mtls.7,312 (1978)]Politics(1979)]-Hoffman[animatedsoftware.com], what DOE/NRC MISlabels as ``butt-welds" ``stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embritt- lement caused brittle-fracture cracking from early/ongoing AEC/ DOE-n"u"tional-la"v"atories sabotage!!!

Narrativas dos movimentos de uma tese: apresentar as entrevistadas e narrar o narrado

Directory of Open Access Journals (Sweden)

Maria Cecilia de Araujo Rodrigues Torres

2017-10-01

Full Text Available O presente artigo é uma síntese revisitada de um capítulo de uma tese de doutorado o qual apresenta as entrevistadas da pesquisa na perspectiva de uma abordagem com narrativas de si e (autobiografias. O grupo é composto por vinte mulheres, todas estudantes de um Curso de Graduação em Pedagogia e com a grande maioria que já atua como professora da educação infantil ou das séries iniciais do ensino fundamental. Como um trabalho que dialoga a partir do campo dos Estudos Culturais em Educação e da Pesquisa Biográfica, destaco autores como Arfuch (2010, Délory-Momberger (2012, Souza (2014, Abrahão (2014 , dentre outros, para compor o embasamento teórico. As entrevistadas são apresentadas através de suas narrativas das memórias musicais de diferentes fases da vida, com lembranças de sons, melodias, discos e cantores. No momento da análise dos dados que emergiram com as entrevistas e as autobiografias musicais foram organizados mapas com dados de cada entrevistada, no sentido de poder conhecer as trilhas sonoras de cada etapa de suas vidas e as articulações destas com as práticas pedagógico musicais. Abstract This is a revisited synthesis of a chapter of a PhD thesis which introduces the research interviews in the perspective of an approach with self narratives and autobiogaphies. The group i, being the vast majority already working as college teachers or teachers in the initial series of elementar school. As a study that inserts itself in the field of Cultural studies in education and Biographic research, authors as Josso (2004, Arfuch (2010, Délory-Momberger (2006, Souza (2014, Maffioletti, and Abrahão (2016 are pointed among others as the theoretical basis. The interviewed subjects are presented through its narratives of musical memories in the diferente phases of their lives, with remembrances of sounds, melodiees, recorded material, and singers. In the moment of data analysis based upon the interviews and musical

Field Marks of a Celebration: Roger Tory Peterson's Centennial Birthday

Science.gov (United States)

Dunlap, J.; Robbins, C.S.

2008-01-01

A red letter day in my life was April 27, 1934, the day I first met Roger. A birding friend, Elisha Atkins, had invited Clinton Reynolds and me to dinner to meet a famous ornithologist. We would all be going on a field trip to Newburyport on the Massachusetts coast the next day. The dinner conversation revolved about a new field guide that Mr. Peterson had just completed and that would be available in a few days. I couldn?t wait to see it! I had been birding since 1930, keying out live birds with Chapman?s Handbook of Birds of Eastern North America (1912) and Hoffman?s Guide to the Birds of New England and Eastern New York (1904). Both books had extensive keys based on color, size, bill shape and season, and pictures of heads or feet of some species. Positive bird identification was a long and tedious process. The field trip the next day with Roger was memorable, not for finding any rare or unusual birds, but for learning how to identify birds to species at a single good glance. I recall asking Roger if he could find a ring-billed gull among a group of gulls resting on a roof beside the Merrimac River. He immediately said, ?No there aren?t any ring-bills there; they would be immediately apparent by their slimmer shape.? There was no need to check the foot color on each bird. While it is easy to say that Roger revolutionized field guides, I truly believe there are few people worldwide under the age of 90 who can really appreciate the difference between the old way of keying out birds and the instant recognition promoted by the Peterson system. Today we take for granted that amateurs can identify birds accurately. Monitoring bird populations by Breeding Bird Surveys, atlas studies, Breeding Bird Censuses, migration banding, and many other studies relies on it. None of these would be possible if we were still keying out live birds using books designed to identify dead birds in the hand.

Prevalência de enteroparasitas na população urbana do 2.° subdistrito de Botucatu, SP (Brasil Prevalence of intestinal parasites on the populations of Botucatu, SP (Brazil

Directory of Open Access Journals (Sweden)

Mauro R. de Oliveira

1974-06-01

Full Text Available Procurou-se conhecer a prevalência de enteroparasitoses na população urbana do 2.° subdistrito de Botucatu, SP (Brasil através de exames coprológicos realizados pelos métodos de FAUST, HOFFMAN e processo de tamização. A prevalência de enteroparasitoses foi relacionada com atributos da população, tais como sexo, idade, cor e com fatores ligados ao meio ambiente. O processo de amostragem empregado foi o casual simples em duplo estágio, sendo o quarteirão a unidade primária do primeiro estágio e o domicílio a unidade do segundo estágio. Os resultados mostraram que 53,76% das 895 pessoas amostradas apresentavam-se infestadas por uma ou mais espécies de parasitas intestinais. As prevalências foram as seguintes: Ancylostomidae, 17,54%; T. trichiurus, 13,63%; A. lumbricoides, 10,69%; S. stercoralis, 6,03%; E. vermicularis, 3,69%; H. nana, 1,79%; Taenia sp, 1,22%; S. mansoni, 0,22%; E. coli, 15,53%; G. lamblia, 14,07%; E. nana, 2,35%; I. bütschlii, 1,01% e E. histolytica, 0,22%.A study of the prevalence of intestinal parasitosis on the population of Botucatu's 2nd Subdistrict, S. Paulo, Brazil, is presented. Passed stool was examined by using FAUST, HOFFMAN and tamization techniques. The prevalence of intestinal parasites is related to population characteristics such as sex, age, race and some environmental features. Simple random sampling technique in double stage was applied. Among 895 examined persons, 53,76% were infected by intestinal parasites. The prevalence of the various parasites were: Ancylostomydae, 17,54%; T. trichiurus, 13,63%; A. lumbricoides, 10,39%; E. vermiculares, 3,69%; H. nana, 1,79%; Taenia sp, 1,22%; E. coli, 15,53%; G. lamblia, 14,07%; E. nana, 2,35%; I. bütschlii, 1,01% and E. histolytica, 0,22%.

A construção da experiência perceptiva: o que isso quer dizer?

Directory of Open Access Journals (Sweden)

Gary Hatfield

2017-12-01

Full Text Available Classical constructivists such as Rock and Hoffman contend that the processes of perception are intelligent and construct perceptual experience by going beyond the stimulus information or by creating a percept that deviates from the physical properties of the object. On these terms, Gibson’s theory of perception is anti-constructivist. After reviewing classical constructivism, this article maintains, first, that the phenomenology of visual space shows a deviation from physical spatial properties, by being contracted in depth, even under fullcue conditions, a fact that makes trouble for Gibson’s version of direct realism. Second, independently of the first argument, it contends that perception is pervasively constructed in the sense that stimulus information must be transformed to yield perception. Accordingly, perception is radically constructed in its very bones.

Ebola… How far away are we?

Directory of Open Access Journals (Sweden)

Salim Mattar V.

2014-09-01

Full Text Available Hollywood adores an infectious disease film. One of the most shocking was the 1995 film “Outbreak”, in which Dustin Hoffman and Rene Russo worked to stop a fictional virus similar to Ebola. In the movie the virus is introduced from Africa to the US by a monkey. In another film, “28 Days Later,” a virus from experimental monkeys infects humans in London. Several additional films about the human fear of “killer viruses” have been released. A real-life scare to the US and the western world came when two American Ebola patients were recently transported from West Africa to an Atlanta hospital for treatment. Currently, there is a pervasive public fear of the dissemination of Ebola in the US and the rest of the world.

CERT TST December 2015 Visit Summary

Energy Technology Data Exchange (ETDEWEB)

Little, Robert Currier [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bailey, Teresa S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gamblin, G. Todd [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Olinger, Chad Tracy [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Pautz, Shawn D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Williams, Alan B. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2016-01-25

The annual PSAAP II TST visit to Texas A&M’s CERT Center was held on December 1-3, 2015. The agenda for the visit is attached. Non-TAMU attendees were: TST Members – Teresa Bailey (LLNL), Todd Gamblin (LLNL), Bob Little (LANL) – Chair, Chad Olinger (LANL), Shawn Pautz (SNL), Alan Williams (SNL);Other Lab staff – Skip Kahler (LANL), Ana Kupresanin (LLNL), and Rob Lowrie (LANL); AST Members – Nelson Hoffman (LANL) and Bob Voigt (Leidos) The TST wishes to express our appreciation to all involved with CERT for the high-quality posters and presentations and for the attention to logistics that enabled a successful visit. We have broken our comments into four sections: (1) Kudos, (2) Recommendations, (3) Feedback on Priorities for April Review, and (4) Follow-Up Activities with Labs.

Vector entropy imaging theory with application to computerized tomography

International Nuclear Information System (INIS)

Wang Yuanmei; Cheng Jianping; Heng, Pheng Ann

2002-01-01

Medical imaging theory for x-ray CT and PET is based on image reconstruction from projections. In this paper a novel vector entropy imaging theory under the framework of multiple criteria decision making is presented. We also study the most frequently used image reconstruction methods, namely, least square, maximum entropy, and filtered back-projection methods under the framework of the single performance criterion optimization. Finally, we introduce some of the results obtained by various reconstruction algorithms using computer-generated noisy projection data from the Hoffman phantom and real CT scanner data. Comparison of the reconstructed images indicates that the vector entropy method gives the best in error (difference between the original phantom data and reconstruction), smoothness (suppression of noise), grey value resolution and is free of ghost images. (author)

Ion distributions at the dayside magnetopause

International Nuclear Information System (INIS)

Smith, M.F.; Rodgers, D.J.

1991-01-01

The authors present ion phase space distributions, from the AMPTE UKS ion instrument, for a crossing of the dayside magnetopause on October 2, 1984, during typical southward IMF conditions. They observed D-shaped field-aligned phase space distributions of magnetosheath plasma earthward of and hot magnetospheric ions sunward of the magnetopause current layer. The existence of such D-shaped magnetosheath plasma distributions has been predicted as a signature of reconnection. In addition, the observed ion distributions are in stress balance across the magnetopause, and the de Hoffman-Teller frame velocity obtained from the stress balance calculation is in agreement with the observed distribution function cutoff speed. These new observations thus provide further evidence that, at least for southward IMF conditions, reconnection is an important mechanism by which solar wind plasma penetrates into the magnetosphere

The Politics of Stakeholder Influence in Corporate Environmental Governance

DEFF Research Database (Denmark)

Backer, Lise

In this article I analyse how the multinational oil company Shell has responded to the increasing institutional pressures (DiMaggio and Powell, 1983) related to corporate environmental governance. The corporate culture in Shell appears favourable (Hoffman, 2001) towards the adoption of corporate...... environmental governance practices. The Shell top management is to this end appearing sincere in the way they monitor (Meyer and Rowan, 1977) the progress in giving secondary stakeholders (Clarkson, 1995) access to environmental information and to environmental decision-making in Shell. Based on the Shell case...... I contribute in this article to descriptive stakeholder engagement theory by conceptualising a number of new internal influence strategies that engaged secondary stakeholders can use in their new face-to-face interactions with the corporations. These internal stakeholder influence strategies should...

Effect of conventional cooking methods on lipid oxidation indices in lamb meat

Directory of Open Access Journals (Sweden)

A Pourkhalili

2012-05-01

Full Text Available Lipid oxidation is one of the most deteriorative reactions occurred in foodstuff which has harmful impacts on the both food quality and consumer's health. This study was designed to speculate the influence of three conventional cooking methods including boiling, frying and grilling on lipid oxidation parameters in cooked lamb meat. Sections of lamb meat from longissimus dorsi muscle, taken from native Lori-Bakhtiary sheep species were cut into uniform pieces and cooked using boiling, frying and roasting methods according to the cooking routine and tradition in Iranian society, in terms of temperature and time. Proximate compositions (moisture, lipid, ash and protein in the raw and cooked meat were determined using the standard methods of analysis. Moreover, weight loss was measured after each treatment. Lipid oxidation parameters such as peroxide value, conjugated diene and TBARS indices were measured in the raw and cooked samples. Evaluation of lipid oxidation parameters showed that peroxide value was significantly decreased in all cooked samples. In contrast, conjugated diene value was significantly increased in the fried and grilled samples (p

A PROPÓSITO DE UNA FUENTE DE LOS PENSADORES DE LA ESCUELA DOMINICA DE COLONIA: EL ANÓNIMO LIBER VIGINTI QUATTUOR PHILOSOPHORUM

Directory of Open Access Journals (Sweden)

José González Ríos

2015-07-01

Full Text Available El estudio de las fuentes de los filósofos de la Escuela dominica de Colonia, y entre ellos especialmente Eckhart, ha adquirido gran relevancia en la investigación más reciente, como se desprende, entre otros, de los aportes de Loris Sturlese, Alessandra Beccarisi y su equipo de trabajo. Si bien son muchas y diversas las fuentes que concurren de modo productivo en la elaboración de su pensamiento, ocupa un lugar destacado aquel pequeño y singular escrito que irrumpe, junto con otros, en el occidente latino durante la segunda mitad del siglo XII. Llamado por Eckhart mismo Liber vigenti quattuor philosophorum este texto ofrece un compendio de veinticuatro definiciones acerca de qué sea lo divino. El esfuerzo de esa presentación es ofrecer una aproximación a esta fuente, repetidamente citada pero poco estudiada. Intentaremos mostrar los problemas que irrumpen con su estudio, a la vez que algunos elementos de su presencia en diversos nudos temáticos de la teología especulativa del Maestro Eckhart.

CERN Women's club

CERN Multimedia

CERN Women's club

2010-01-01

The Welcome Center The Welcome Center website for CERN newcomers – and everyone else at CERN – has celebrated its first anniversary in operation. It began as a project to organize all the various information available at CERN into an easy to use site, with advice to help you make the most of your time here. It continues to be updated as new information becomes available. Lori Hakulinen and her helpers offer to meet with anyone who has questions. They can advise you on weekend activities, local restaurants and where to buy hard to find items or some of your favorite things from home, in addition to all of the practicalities you need to know, such as how to find housing or have a telephone installed, where to take language classes and much, much more. It’s all listed at: http://cern.ch/club-cwc-newcomers In general, meetings take place the first and third Thursdays in the month at Restaurant No. 1 in the Children’s Dining Room. (Please consult the Homepage for schedu...

Chiron Vision files FDA application to market intraocular implant for CMV retinitis. Food and Drug Administration.

Science.gov (United States)

1995-07-01

Chiron Corporation and Hoffman-LaRoche announced a filing of a New Drug Application with the Food and Drug Administration (FDA) to market Vitrasert, its intraocular implant which delivers ganciclovir directly to the eye for treatment of CMV retinitis. Clinical trials show that Vitrasert offers a clinical improvement versus intravenous ganciclovir in further delaying progression of CMV retinitis in the treated eye. One study reported that the median time to progression of CMV retinitis was 186 days for eyes receiving Vitrasert compared to 72 days for eyes receiving intravenous ganciclovir therapy. Chiron's intraocular implant contains ganciclovir embedded in a polymer-based system that slowly releases the drug into the eye for up to eight months. Two additional trials are underway. For further information contact the Professional Services Group at Chiron Corporation at (800) 244-7668, select 2.

In vivo cellular imaging using fluorescent proteins - Methods and Protocols

Directory of Open Access Journals (Sweden)

M. Monti

2012-12-01

Full Text Available The discovery and genetic engineering of fluorescent proteins has revolutionized cell biology. What was previously invisible to the cell often can be made visible with the use of fluorescent proteins. With this words, Robert M. Hoffman introduces In vivo Cellular Imaging Using Fluorescent proteins, the eighteen chapters book dedicated to the description of how fluorescence proteins have changed the way to analyze cellular processes in vivo. Modern researches aim to study new and less invasive methods able to follow the behavior of different cell types in different biological contexts: for example, how cancer cells migrate or how they respond to different therapies. Also, in vivo systems can help researchers to better understand animal embryonic development so as how fluorescence proteins may be used to monitor different processes in living organisms at the molecular and cellular level.

Global surface wind and flux fields from model assimilation of Seasat data

Science.gov (United States)

Atlas, R.; Busalacchi, A. J.; Kalnay, E.; Bloom, S.; Ghil, M.

1986-01-01

Procedures for dealiasing Seasat data and developing global surface wind and latent and sensible heat flux fields are discussed. Seasat data from September 20, 1978 was dealiased using the Goddard Laboratory for Atmospheres (GLA) analysis/forecast system. The wind data obtained with the objective GLA forecast model are compared to the data subjectively dealiased by Peteherych et al. (1984) and Hoffman (1982, 1984). The GLA procedure is also verified using simulated Seasat data. The areas of high and low heat fluxes and cyclonic and anticyclonic wind stresses detected in the generated fields are analyzed and compared to climatological fields. It is observed that there is good correlation between the time-averaged analyses of wind stress obtained subjectively and objectively, and the monthly mean wind stress and latent fluxes agree with climatological fields and atmospheric and oceanic features.

FRAUD/SABOTAGE Killing Nuclear-Reactors!!! ``Super"alloys GENERIC ENDEMIC Wigner's-Disease IN-stability!!!

Science.gov (United States)

Asphahani, Aziz; Siegel, Sidney; Siegel, Edward

2010-03-01

Siegel [[J.Mag.Mag.Mtls.7,312(78); PSS(a)11,45(72); Semis.& Insuls.5(79)] (at: ORNL, ANS, Westin``KL"ouse, PSEG, IAEA, ABB) warning of old/new nuclear-reactors/spent-fuel-casks/refineries/ jet/missile/rocket-engines austenitic/FCC Ni/Fe-based (so MIS- called)``super"alloys(182/82;Hastelloy-X; 600;304/304L-SSs; 690 !!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's- diseas(WD)[J.Appl.Phys.17,857(46)]; Ostwald-ripening; spinodal- decomposition; overageing-embrittlement; thermomechanical- INstability: Mayo[Google: ``If Leaks Could Kill"; at flickr.com search on ``Giant-Magnotoresistance"; find: [SiegelPolitics(79)]; Hoffman[animatedsoftware.com],...what DOE/NRC MISlabels as ``butt-welds" ``stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embrit- tlement caused brittle-fracture cracking from early/ongoing AEC/DOE-n``u''tional-la``v''atories sabotage!!!

A general class of preconditioners for statistical iterative reconstruction of emission computed tomography

International Nuclear Information System (INIS)

Chinn, G.; Huang, S.C.

1997-01-01

A major drawback of statistical iterative image reconstruction for emission computed tomography is its high computational cost. The ill-posed nature of tomography leads to slow convergence for standard gradient-based iterative approaches such as the steepest descent or the conjugate gradient algorithm. In this paper new theory and methods for a class of preconditioners are developed for accelerating the convergence rate of iterative reconstruction. To demonstrate the potential of this class of preconditioners, a preconditioned conjugate gradient (PCG) iterative algorithm for weighted least squares reconstruction (WLS) was formulated for emission tomography. Using simulated positron emission tomography (PET) data of the Hoffman brain phantom, it was shown that the convergence rate of the PCG can reduce the number of iterations of the standard conjugate gradient algorithm by a factor of 2--8 times depending on the convergence criterion

Occurrence of enteroparasites in day care centers in Botucatu (São Paulo State, Brazil with emphasis on Cryptosporidium sp., Giardia duodenalis and Enterobius vermicularis Ocorrência de enteroparasitas em creches de Botucatu (Estado de São Paulo, Brasil com ênfase em Cryptosporidium sp., Giardia duodenalis e Enterobius vermicularis

Directory of Open Access Journals (Sweden)

Thaís Batista de Carvalho

2006-10-01

Full Text Available The occurrence of the enteroparasites was verified in 279 children (0 to 6 years of four municipal day cares of Botucatu/SP. Three samples of each child's feces were collected and processed by the methods of Hoffman-Pons-Janner, Faust and Ritchie and subsequent coloration of the fecal smear by the methods of Auramina-O and Ziehl-Neelsen modified for diagnosis of Cryptosporidium sp. and Graham method for diagnosis of Enterobius vermicularis. Of the analyzed children we verified a prevalence of intestinal parasitism in 53.40%, and the most frequent parasite was Giardia duodenalis (26.88%. Significant association was verified among enteroparasitosis, family income, maternal education and age; the lowest enteroparasite frequency occurred in children of families with larger income and higher education. It was observed that G. duodenalis is more prevalent in children from 0 to 4 years and E. vermicularis is more frequent in children between three and four years old. The high enteroparasite prevalence in day cares suggests complex structure in its epidemiology, where factors beyond sanitation should be considered.Verificou-se a prevalência dos enteroparasitas em 279 crianças (0 a 6 anos de quatro creches municipais de Botucatu/SP. Foram coletadas três amostras de fezes de cada criança e processadas pelos métodos Hoffman, Faust e Ritchie e posterior coloração do esfregaço fecal pelos métodos de Auramina-O e Ziehl-Neelsen modificado para diagnóstico de Cryptosporidium sp. e método da fita gomada para diagnóstico de Enterobius vermicularis. Das crianças analisadas apresentaram-se parasitadas 53.40%, sendo que o parasita mais freqüente foi Giardia duodenalis (26.88%. Verificou-se associação significativa entre enteroparasitose, renda familiar, escolaridade materna e idade; quanto maior a renda e o grau escolar, menor a freqüência de enteroparasitas. Observou-se que G. duodenalis é mais prevalente em crianças de 0 a 4 anos e E

Enteroparasitoses, Anemia e Estado Nutricional em Grávidas Atendidas em Serviço Público de Saúde Intestinal Parasites, Anemia and Nutritional Status in Pregnant Women in a Public Health Care Unit

Directory of Open Access Journals (Sweden)

Ariani Impieri de Souza

2002-05-01

Full Text Available Objetivos: estimar a freqüência de enteroparasitoses em gestantes de pré-natal de baixo risco e sua associação com anemia, estado nutricional, escolaridade e saneamento (fossa sanitária no domicílio. Métodos: a partir de amostra de 316 gestantes que iniciaram o pré-natal de baixo risco do ambulatório de pré-natal do Instituto Materno Infantil de Pernambuco (IMIP no período de maio de 2000 a julho de 2001, determinaram-se, por meio de um desenho de corte transversal, as freqüências de enteroparasitoses (método Hoffman, em única amostra e de anemia (Hb Purpose: to determine the frequency of enteroparasitoses in a group of pregnant women undergoing low-risk antenatal care and their association with anemia, maternal nutritional status, schooling and the existence of a bathroom in the home. Methods: to a sample of pregnant women who had begun low-risk antenatal care at IMIP's Maternal Health Care Center between May 2000 and July 2001, a cross-sectional design was applied to determine the frequencies of enteroparasitoses (Hoffman method, in a single sample and anemia (Hb <11.0 g/dL, nutritional status (through BMI standardized for stage of pregnancy and social indicators (schooling and the existence of a bathroom in the home. Results: in a sample of 316 pregnant women, a rate of 37.4% enteroparasitosis was detected, of which 31.6% was infestation by a single parasite. The most commonly found parasite species were Entamoeba histolytica (13.3% and Ascaris lumbricoides (12.0%. Anemia was detected in 55.4% of the pregnant women, malnutrition in 25.0% and overweight or obesity in 24.1%. There was a statistically significant association between enteroparasitosis and schooling. However, no association of, enteroparasitosis, anemia, maternal nutritional status with the existence of a bathroom in the home was noted. Conclusions: The prevalence of enteroparasitoses and anemia is high, albeit without any association of the two conditions, while

Perceptual representation, veridicality, and the interface theory of perception.

Science.gov (United States)

Cohen, Jonathan

2015-12-01

Hoffman, Singh, and Prakash (henceforth, HSP) argue that perception was not selected for veridical representation, hence that, contrary to a very widespread consensus, there's much less of the latter than you might expect in perception. And they put forward an alternative "interface" theory, on which perception is an adaptively useful but truth-obscuring veil between perceiver and perceived. But HSP's case against veridical perception, and their case for an alternative account, turn crucially on significant misapprehensions in the early going about what veridicality amounts to. In this paper I'll identify this mistake, and then argue that it both undercuts HSP's arguments against perceptual veridicality and prevents them from seeing that their own preferred conception of perception is itself committed to veridical representation, rather than an alternative to it. In the end, I'll conclude, HSP give us no reasons to abandon the standard view that perception veridically represents the world.

Cluster observations of reconnection due to the Kelvin-Helmholtz instability at the dawnside magnetospheric flank

Directory of Open Access Journals (Sweden)

K. Nykyri

2006-10-01

Full Text Available On 3 July 2001, the four Cluster satellites traversed along the dawnside magnetospheric flank and observed large variations in all plasma parameters. The estimated magnetopause boundary normals were oscillating in the z-direction and the normal component of the magnetic field showed systematic  2–3 min bipolar variations for 1 h when the IMF had a small positive b_z-component and a Parker-spiral orientation in the x,y-plane. Brief  33 s intervals with excellent deHoffman Teller frames were observed satisfying the Walén relation. Detailed comparisons with 2-D MHD simulations indicate that Cluster encountered rotational discontinuities generated by Kelvin-Helmholtz instability. We estimate a wave length of  6 R_E and a wave vector with a significant z-component.

FIREBIRD - a conceptual design of a field reversed configuration compact torus fusion reactor (CTFR)

International Nuclear Information System (INIS)

Raman, R.; Zubrin, R.M.

1987-01-01

This paper is a summary of the work carried out by the Nuclear Engineering 512 design team at the University of Washington on a conceptual design study of a Compact-Torus (Field-Reversed) Fusion Reactor Configuration (CTFR). The primary objective of the study was to develop a reactor design that strived for high engineering power density, modest recirculating power and competitive cost of electrical power. A Conceptual design was developed for a translating field-reversed configuration reactor; based on the Physics developed by Tuszewski and Lindford at LANL and by Hoffman and Milroy at MSNW. Furthermore, it also appears possible to operate a simplified form of this reactor using a pure D-D fuel cycle after an initial D-T ignition ramp to reach the advanced fuel operating regime. One optimistic reactor so designed has a length of about 35 meters, producing a net electrical power of about 375 MWe

Positive emotional change: mediating effects of forgiveness and spirituality.

Science.gov (United States)

Levenson, Michael R; Aldwin, Carolyn M; Yancura, Loriena

2006-01-01

We evaluated the efficacy of an emotional education program that seeks to reduce the intergenerational transmission of negative interaction patterns by increasing forgiveness and spirituality. We examined both reduction of psychological symptoms and increase in positive psychological outcomes over the course of a year, as well as the mediators of this change. At baseline, the sample consisted of 99 participants and 47 waiting list controls. Comparisons of scores from baseline (Time 1) to one week after the Hoffman Quadrinity Process (Time 2) showed large declines in negative affect (depressive symptoms) and increases in both positive outcomes (mastery, empathy, emotional intelligence, life satisfaction, forgiveness, and spiritual experience) and health and well-being. Over the course of a year, most of these gains were sustained, in comparison with the control group. Further, increases in forgiveness and spirituality mediated the effect of program participation on depressive symptoms.

Morphology, melting behavior, and non-isothermal crystallization of poly(butylene terephthalate)/poly(ethylene-co-methacrylic acid) blends

International Nuclear Information System (INIS)

Huang, J.-W.; Wen, Y.-L.; Kang, C.-C.; Yeh, M.-Y.; Wen, S.-B.

2007-01-01

The morphology, melting behavior, and non-isothermal crystallization of poly(butylene terephthalate) (PBT) and poly(ethylene-co-methacrylic acid) (PEMA) blends were studied with scanning electron microscopy, X-ray diffraction and differential scanning calorimetry (DSC). PEMA forms immiscible, yet compatible, blends with PBT. Subsequent DSC scans on melt-crystallized samples exhibited two melting endotherms (T mI and T mII ). The presence of PEMA would facilitate the recrystallization during heating scan and retard PBT molecular chains to form a perfect crystal in cooling crystallization. The dispersion phases of molten PEMA acts as nucleating agents to enhance the crystallization rate of PBT. The solidified PBT could act as nucleating agents to enhance the crystallization of PEMA, but also retard the molecular mobility to reduce crystallization rate. The U* and K g of Hoffman-Lauritzen theory were also determined by Vyazovkin's methods to support the interpretation

Ohio State University Nuclear Reactor Laboratory HEU fuel shipment summary. Final

International Nuclear Information System (INIS)

1997-01-01

In November 1988, OSURR converted from HEU fuel to LEU fuel. As a result they needed to get rid of their HEU fuel by shipping it to Savannah River. The players in the fuel shipping game are: OSURR as the keeper of the fuel; DOE as the owner of fuel and shipper of record; Tri-State Motor Transit Co. for transporting the cask; Muth Brothers as the rigger responsible for getting the cask on and off the truck and in and out of the building; Hoffman LaRoche/Cintichem as the owner of the cask; Savannah River as the receiver of the fuel; and the NRC for approval of the Security Plan, QA Plan, etc. This report gives a chronological history of the events from February 1989 to June 1, 1995, the actual day of shipment. The cask was received at Savannah River on June 2, 1995

Scleral fixation of a subluxated intraocular lens-capsular bag complex through a fibrotic continuous curvilinear capsulorhexis.

Science.gov (United States)

Gimbel, Howard V; Brucks, Matthew; Dardzhikova, Albena A; Camoriano, Gerardo D

2011-04-01

Several strategies have been devised to manage in-the-bag intraocular lens (IOL) subluxation. We describe a method of fixating the IOL-capsular bag complex to the sclera using the fibrotic ring that develops around the continuous curvilinear capsulorhexis (CCC). Two, preferably 3, double-armed 10-0 polypropylene sutures are passed around the fibrotic CCC rim of the capsule and out the Hoffman scleral pockets and then tied in the scleral tunnels to center the IOL-bag complex. This technique provides an alternative approach to repositioning and fixating the IOL-bag complex that is especially useful in cases in which removal and replacement of the IOL would be difficult. It also provides more than 2-point fixation to achieve perfect IOL centration. No author has a financial or proprietary interest in any material or method mentioned. Copyright © 2011 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

Conference Session II: Creation or Evolution: Can Copyright Bring the Peace? Presented by Kenneth D. Crews, attorney, Gipson Hoffman & Pancione

Directory of Open Access Journals (Sweden)

Marley C. Nelson

2018-02-01

Full Text Available Dr. Kenneth Crews gives an overview of the history of copyright law, using creation and evolution as touchstones for the quick leaps and long crawls made in this discipline.  Using multiple examples, the often-contentious history of copyright law is presented in an approachable and understandable manner.  Tensions between many of the forces that have shaped, and still are shaping, copyright law are discussed, including the tension between creators and consumers of copyrightable materials.  In the end, both forces are shown to be not only important to, but necessary for, the development of U.S. copyright law.  The program closed with a call to action for attendees to speak out on copyright law and to become part of the forces that continue to create change in this discipline.

Hoffman Valerie J., The Essentials of Ibâḍî Islam, Syracuse NY, Syracuse University Press, 2012, xii + 344 p.

Directory of Open Access Journals (Sweden)

Mohamed Meouak

2013-04-01

Full Text Available L’ibadisme est une tendance de l’islam tout à fait singulière qui se distingue du sunnisme et du chiisme sur divers points doctrinaux. Il subsiste essentiellement en Oman, en Afrique de l’Est, dans la vallée du M’zāb en Algérie, dans les montagnes de Nafūsa en Libye, et sur l’île de Djerba en Tunisie. Les communautés ibadites se sont développées à partir d’une autre tendance de l’islam du viie siècle connue sous le nom de khārijisme, et elle partage avec ce groupe le désir de fonder une socié...

Cryptococcosis outbreak in psittacine birds in Brazil.

Science.gov (United States)

Raso, T F; Werther, K; Miranda, E T; Mendes-Giannini, M J S

2004-08-01

An outbreak of cryptococcosis occurred in a breeding aviary in São Paulo, Brazil. Seven psittacine birds (of species Charmosyna papou, Lorius lory, Trichoglossus goldiei, Psittacula krameri and Psittacus erithacus) died of disseminated cryptococcosis. Incoordination, progressive paralysis and difficulty in flying were seen in five birds, whereas superficial lesions coincident with respiratory alterations were seen in two birds. Encapsulated yeasts suggestive of Cryptococcus sp. were seen in faecal smears stained with India ink in two cases. Histological examination of the birds showed cryptococcal cells in various tissues, including the beak, choana, sinus, lungs, air sacs, heart, liver, spleen, kidneys, intestines and central nervous system. High titres of cryptococcal antigen were observed in the serum of an affected bird. In this case, titres increased during treatment and the bird eventually died. Yeasts were isolated from the nasal mass, faeces and liver of one bird. Cryptococcus neoformans var. gattii serovar B was identified based on biochemical, physiological and serological tests. These strains were resistant (minimum inhibitory concentration 64 microg/ml) to fluconazole. This is the first report of C. neoformans var. gattii occurring in psittacine birds in Brazil.

Applying systems thinking to inform studies of wildlife trade in primates.

Science.gov (United States)

Blair, Mary E; Le, Minh D; Thạch, Hoàng M; Panariello, Anna; Vũ, Ngọc B; Birchette, Mark G; Sethi, Gautam; Sterling, Eleanor J

2017-11-01

Wildlife trade presents a major threat to primate populations, which are in demand from local to international scales for a variety of uses from food and traditional medicine to the exotic pet trade. We argue that an interdisciplinary framework to facilitate integration of socioeconomic, anthropological, and biological data across multiple spatial and temporal scales is essential to guide the study of wildlife trade dynamics and its impacts on primate populations. Here, we present a new way to design research on wildlife trade in primates using a systems thinking framework. We discuss how we constructed our framework, which follows a social-ecological system framework, to design an ongoing study of local, regional, and international slow loris (Nycticebus spp.) trade in Vietnam. We outline the process of iterative variable exploration and selection via this framework to inform study design. Our framework, guided by systems thinking, enables recognition of complexity in study design, from which the results can inform more holistic, site-appropriate, and effective trade management practices. We place our framework in the context of other approaches to studying wildlife trade and discuss options to address foreseeable challenges to implementing this new framework. © 2017 Wiley Periodicals, Inc.

Hubble 3D: A Science and Hollywood Collaboration Made (Nearly) in Heaven

Science.gov (United States)

Showstack, Randy

2010-04-01

Just 2 days after the 2010 Academy Awards® ceremony in early March bestowed Oscars® for motion picture achievements, NASA deputy administrator Lori Garver touted a new film about the Hubble Space Telescope, Hubble 3D, for best drama, special effects, screenplay, actors and actress, and director and producer. The 43-minute IMAX and Warner Brothers Pictures production, which opened in theaters on 19 March, is an example of the ability of Hollywood and the science community to partner in providing a dynamic educational and entertaining product, according to a number of people associated with the film. Sharing the red carpet at the Smithsonian National Air and Space Museum in Washington, D. C., with astronauts and others to mark the world premiere, Garver said the film shows the drama of the astronauts’ efforts to repair the telescope while traveling 17,000 miles per hour and performing grueling space walks (see Figure 1). “We have literally opened our eyes on the universe through this telescope,” she said. “This is a taxpayer-funded agency, and we are giving back to the public the very story that they paid for.”

Spin and energy evolution equations for a wide class of extended bodies

International Nuclear Information System (INIS)

Racine, Etienne

2006-01-01

We give a surface integral derivation of the leading-order evolution equations for the spin and energy of a relativistic body interacting with other bodies in the post-Newtonian expansion scheme. The bodies can be arbitrarily shaped and can be strongly self-gravitating. The effects of all mass and current multipoles are taken into account. As part of the computation one of the 2PN potentials parametrizing the metric is obtained. The formulae obtained here for spin and energy evolution coincide with those obtained by Damour, Soffel and Xu for the case of weakly self-gravitating bodies. By combining an Einstein-Infeld-Hoffman-type surface integral approach with multipolar expansions we extend the domain of validity of these evolution equations to a wide class of strongly self-gravitating bodies. This paper completes in a self-contained way a previous work by Racine and Flanagan on translational equations of motion for compact objects

Global Data Grid Efforts for ATLAS

CERN Multimedia

Gardner, R.

2001-01-01

Over the past two years computational data grids have emerged as a promising new technology for large scale, data-intensive computing required by the LHC experiments, as outlined by the recent "Hoffman" review panel that addressed the LHC computing challenge. The problem essentially is to seamlessly link physicists to petabyte-scale data and computing resources, distributed worldwide, and connected by high-bandwidth research networks. Several new collaborative initiatives in Europe, the United States, and Asia have formed to address the problem. These projects are of great interest to ATLAS physicists and software developers since their objective is to offer tools that can be integrated into the core ATLAS application framework for distributed event reconstruction, Monte Carlo simulation, and data analysis, making it possible for individuals and groups of physicists to share information, data, and computing resources in new ways and at scales not previously attempted. In addition, much of the distributed IT...

Formation of polyelectrolyte complexes with diethylaminoethyl dextran: charge ratio and molar mass effect.

Science.gov (United States)

Le Cerf, Didier; Pepin, Anne Sophie; Niang, Pape Momar; Cristea, Mariana; Karakasyan-Dia, Carole; Picton, Luc

2014-11-26

The formation of polyelectrolyte complexes (PECs) between carboxymethyl pullulan and DEAE Dextran, was investigated, in dilute solution, with emphasis on the effect of charge density (molar ratio or pH) and molar masses. Electrophoretic mobility measurements have evidenced that insoluble PECs (neutral electrophoretic mobility) occurs for charge ratio between 0.6 (excess of polycation) and 1 (stoichiometry usual value) according to the pH. This atypical result is explained by the inaccessibility of some permanent cationic charge when screened by pH dependant cationic ones (due to the Hoffman alkylation). Isothermal titration calorimetry (ITC) indicates an endothermic formation of PEC with a binding constant around 10(5) L mol(-1). Finally asymmetrical flow field flow fractionation coupled on line with static multi angle light scattering (AF4/MALS) evidences soluble PECs with very large average molar masses and size around 100 nm, in agreement with scrambled eggs multi-association between various polyelectrolyte chains. Copyright © 2014 Elsevier Ltd. All rights reserved.

Receiver operating characteristic analysis and its potential role in evaluating the effect of head movement in PET of the brain

International Nuclear Information System (INIS)

Patterson, H.; Clarke, G.H.; Lombardo, P.; McKay, W.J.; Austin and Repatriation Medical Centre, Heidelberg, VIC

1999-01-01

Full text: We outline an example of receiver operating characteristic (ROC) analysis in the assessment of image quality. ROC analysis is a measure of image quality that accounts for the consequences of the decision and the role of the observer. Kim and Haynie (Nuclear Diagnostic Imaging: Practical Clinical Applications. Melbourne: Macmillan, 1987) describe ROC analysis as an 'objective approach to the evaluation of diagnostic decision making'. ROC analysis is an ideal technique for evaluating images of a Hoffman brain phantom obtained using positron emission tomography. Images have been acquired with the phantom in different positions. The position of the phantom and the time the phantom remained in each position was based on the measurements of head movement during simulated brain imaging (Patterson et al., Technologists Symposium, ANZSNM, 1998). This study was undertaken to explore the potential of ROC analysis in determining the effect of movement on the ability to detect lesions of various sizes

On The Determinant of q-Distance Matrix of a Graph

Directory of Open Access Journals (Sweden)

Li Hong-Hai

2014-02-01

Full Text Available In this note, we show how the determinant of the q-distance matrix Dq(T of a weighted directed graph G can be expressed in terms of the corresponding determinants for the blocks of G, and thus generalize the results obtained by Graham et al. [R.L. Graham, A.J. Hoffman and H. Hosoya, On the distance matrix of a directed graph, J. Graph Theory 1 (1977 85-88]. Further, by means of the result, we determine the determinant of the q-distance matrix of the graph obtained from a connected weighted graph G by adding the weighted branches to G, and so generalize in part the results obtained by Bapat et al. [R.B. Bapat, S. Kirkland and M. Neumann, On distance matrices and Laplacians, Linear Algebra Appl. 401 (2005 193- 209]. In particular, as a consequence, determinantal formulae of q-distance matrices for unicyclic graphs and one class of bicyclic graphs are presented.

Energy Materials Coordinating Committee (EMACC). Annual Technical Report, Fiscal Year 1978

Energy Technology Data Exchange (ETDEWEB)

none,

1978-08-01

The Department of Energy Materials Coordinating Committee (EMACC) completed its first year of activity in FY 1978. A major project during the year was to conduct a survey of topical areas and prepare the report, Survey and Analysis of Selected Topics within the Department of Energy's Materials Research and Development Programs. Seven topics selected were those that had a high level of Divisional interest and supplement those reported in FY 1977 in DOE/ET-0006. The topics and the EMACC panel leaders in charge of compiling information were: 1. Joining of Materials, E.E. Hoffman and E. Dalder; 2. Elastomers R. Nelson; 3. Catalysts and Catalytic Effects R. Epple; 4. Radiation Effects K. Zwilsky; 5. Superconductivity W. Clinton; 6. Cement and Concrete L. Kukacka BNL/R. Reeber; and 7. Alternate Materials R.R. Reeber The report summarizes over 250 projects in these areas and completes the initial review started by James Swisher FY 1977 EMACC Chairman.

“To the glory that was Greece": Hellenic patterns in Poe's poetry

Directory of Open Access Journals (Sweden)

Dimitrios Tsokanos

2015-12-01

Full Text Available Edgar Allan Poe’s poetry has repeatedly drawn the attention of many literary critics since his poems have meticulously been delved into from different perspectives. Undeniably, a multitude of references that allude to ancient Greek mythology and classical literature are present within his verses. These have been noticed and delineated by noteworthy Poe scholars such as Scott Peeples, Kenneth Silverman, Daniel Hoffman and Kevin Hayes in several of their researches in the past. However, despite the wide range of studies that have been published, one cannot encounter any mention regarding the existence of Hellenic motifs or even a reference to an apparent Hellenism in Poe’s poetry. In an effort to outline what has already been affirmed with respect to this topic and to unearth additional links between Poe’s works and Greece, the present essay aims to determine the presence of Hellenic motifs in Poe’s “To Helen” and “Lenore”.

Analysis of the accuracy of different laboratory methods for the diagnosis of intestinal parasites from stray and domiciled cats (Felis catus domesticus in Goiânia, Goiás, Brazil

Directory of Open Access Journals (Sweden)

Jaqueline Ataíde Silva Lima

2018-02-01

Full Text Available Abstract Cats are carriers of zoonotic agents to humans, including intestinal parasites. The purpose of this study was to analyze the accuracy of different laboratory methods for the diagnosis of intestinal parasites. Fecal samples were processed by the Willis, Sheather, Faust and Hoffman-Janer-Pons-Lutz (HJPL methods. Accuracy analysis was performed determining the sensitivity, specificity, positive and negative predictive value and Kappa. A total of 149 fecal samples were collected, 65 from stray cats and 84 from domiciled cats. The prevalence of intestinal parasites in stray cats was 60% while in domiciled cats it was 17%. In the analysis of accuracy, the techniques that showed the greatest accuracy for Ancylostomids were Willis and Faust, for Cystoisospora spp. Sheather with Faust or HPJL, and Toxoplasma gondii/Hammondia hammondi the association between Willis and Faust. Therefore, for a reliable evaluation of the prevalence of intestinal parasites, at least two different techniques should be used in parasitological exams of feces.

Pseudarthrosis due to galvanic corrosion presenting as subarachnoid hemorrhage

Directory of Open Access Journals (Sweden)

Rosemary Noel Beavers

2017-01-01

Full Text Available Two unlike metals near one another can break down as they move toward electrochemical equilibrium resulting in galvanic corrosion. We describe a case of electrochemical corrosion resulting in pseudarthrosis, followed by instrumentation failure leading to subarachnoid hemorrhage. A 53-year-old female with a history of cervical instability and two separate prior cervical fusion surgery with sublaminar cables presented with new onset severe neck pain. Restricted range of motion in her neck and bilateral Hoffman's was noted. X-ray of her cervical spine was negative. A noncontrast CT scan of her head and neck showed subarachnoid hemorrhage in the prepontine and cervicomedullary cisterns. Neurosurgical intervention involved removal of prior stainless steel and titanium cables, repair of cerebrospinal fluid leak, and nonsegmental C1–C3 instrumented fusion. She tolerated the surgery well and followed up without complication. Galvanic corrosion of the Brook's fusion secondary to current flow between dissimilar metal alloys resulted in catastrophic instrumentation failure and subarachnoid hemorrhage.

Direct cone beam SPECT reconstruction with camera tilt

International Nuclear Information System (INIS)

Jianying Li; Jaszczak, R.J.; Greer, K.L.; Coleman, R.E.; Zongjian Cao; Tsui, B.M.W.

1993-01-01

A filtered backprojection (FBP) algorithm is derived to perform cone beam (CB) single-photon emission computed tomography (SPECT) reconstruction with camera tilt using circular orbits. This algorithm reconstructs the tilted angle CB projection data directly by incorporating the tilt angle into it. When the tilt angle becomes zero, this algorithm reduces to that of Feldkamp. Experimentally acquired phantom studies using both a two-point source and the three-dimensional Hoffman brain phantom have been performed. The transaxial tilted cone beam brain images and profiles obtained using the new algorithm are compared with those without camera tilt. For those slices which have approximately the same distance from the detector in both tilt and non-tilt set-ups, the two transaxial reconstructions have similar profiles. The two-point source images reconstructed from this new algorithm and the tilted cone beam brain images are also compared with those reconstructed from the existing tilted cone beam algorithm. (author)

Kinetics of oriented crystallization of polymers in the linear stress-orientation range in the series expansion approach

Directory of Open Access Journals (Sweden)

L. Jarecki

2018-04-01

Full Text Available An analytical formula is derived for the oriented crystallization coefficient governing kinetics of oriented crystallization under uniaxial amorphous orientation in the entire temperature range. A series expansion approach is applied to the free energy of crystallization in the Hoffman-Lauritzen kinetic model of crystallization at accounting for the entropy of orientation of the amorphous chains. The series expansion coefficients are calculated for systems of Gaussian chains in linear stress-orientation range. Oriented crystallization rate functions are determined basing on the ‘proportional expansion’ approach proposed by Ziabicki in the steady-state limit. Crystallization kinetics controlled by separate predetermined and sporadic primary nucleation is considered, as well as the kinetics involving both nucleation mechanisms potentially present in oriented systems. The involvement of sporadic nucleation in the transformation kinetics is predicted to increase with increasing amorphous orientation. Example computations illustrate the dependence of the calculated functions on temperature and amorphous orientation, as well as qualitative agreement of the calculations with experimental results.

Intestinal Parasites Prevalence in Children from Day Care Centers in Sinop City-MT

Directory of Open Access Journals (Sweden)

B. Muchiutti

2013-03-01

Full Text Available Abstract: The aim of this study was to investigate the intestinal parasitosis prevalence of children from municipal day care centers in Sinop MT. Respecting ethical principles established by Resolution 196/96 of Health National Council/Ministry of Health of quantitative research, the anonymity of participants, as well accept and signature of parents of the Term of Free and Enlightened Consent were performed. Between Junes to October 2012 were applied coproparasitological methods for investigation. Fecal samples were analyzed by Hoffmans methods. From 103 students examined observed the prevalence rate of 19.42% of intestinal parasites. The intestinal parasites with highest prevalence rate were: Giardia lamblia (9.70% and Endolimax nana (5.82%. The results of this study demonstrate the need for sensitization of the population front of diagnosis importance, treatment and monitoring of positive cases and the necessity of more health professionals attention, especially with children.Key-words: Intestinal parasites, day care centers, children.

Creep Modeling in a Composite Rotating Disc with Thickness Variation in Presence of Residual Stress

Directory of Open Access Journals (Sweden)

Vandana Gupta

2012-01-01

Full Text Available Steady-state creep response in a rotating disc made of Al-SiC (particle composite having linearly varying thickness has been carried out using isotropic/anisotropic Hoffman yield criterion and results are compared with those using von Mises yield criterion/Hill's criterion ignoring difference in yield stresses. The steady-state creep behavior has been described by Sherby's creep law. The material parameters characterizing difference in yield stresses have been used from the available experimental results in literature. Stress and strain rate distributions developed due to rotation have been calculated. It is concluded that the stress and strain distributions got affected from the thermal residual stress in an isotropic/anisotropic rotating disc, although the effect of residual stress on creep behavior in an anisotropic rotating disc is observed to be lower than those observed in an isotropic disc. Thus, the presence of residual stress in composite rotating disc with varying thickness needs attention for designing a disc.

Klimaschutz im Verkehrssektor - Die Umsetzung der Richtlinie 1999/94/EG in Deutschland und Polen im Vergleich / Jan Hoffman, Monika Nafalska-Zgolak

Index Scriptorium Estoniae

Hoffman, Jan

2011-01-01

ELi direktiivist (1999/94), milles käsitletakse kütusesäästuga ja süsinikdioksiidi heitmetega seotud andmete tarbijale kättesaadavust uute sõiduautode turustamisel, rakendamisest Poolas ja Saksamaal

The interface theory of perception leaves me hungry for more: Commentary on Hoffman, Singh, and Prakash, "The interface theory of perception".

Science.gov (United States)

Schlesinger, Matthew

2015-12-01

The interface theory offers a rich blend of logic and mathematical modeling with a dash of evolutionary story-telling, leading to the conclusion that perceptual experience and physical reality are only loosely related. Is the theory convincing? I would have to say "almost"; although it certainly has many elements working in its favor, ultimately, I also found that some important questions were ignored or left unanswered (e.g., a more fully articulated account of how evolutionary mechanisms operate on perception). I am quite optimistic that the next iteration of the theory will be able to address these issues.

MRI-assisted PET motion correction for neurologic studies in an integrated MR-PET scanner.

Science.gov (United States)

Catana, Ciprian; Benner, Thomas; van der Kouwe, Andre; Byars, Larry; Hamm, Michael; Chonde, Daniel B; Michel, Christian J; El Fakhri, Georges; Schmand, Matthias; Sorensen, A Gregory

2011-01-01

Head motion is difficult to avoid in long PET studies, degrading the image quality and offsetting the benefit of using a high-resolution scanner. As a potential solution in an integrated MR-PET scanner, the simultaneously acquired MRI data can be used for motion tracking. In this work, a novel algorithm for data processing and rigid-body motion correction (MC) for the MRI-compatible BrainPET prototype scanner is described, and proof-of-principle phantom and human studies are presented. To account for motion, the PET prompt and random coincidences and sensitivity data for postnormalization were processed in the line-of-response (LOR) space according to the MRI-derived motion estimates. The processing time on the standard BrainPET workstation is approximately 16 s for each motion estimate. After rebinning in the sinogram space, the motion corrected data were summed, and the PET volume was reconstructed using the attenuation and scatter sinograms in the reference position. The accuracy of the MC algorithm was first tested using a Hoffman phantom. Next, human volunteer studies were performed, and motion estimates were obtained using 2 high-temporal-resolution MRI-based motion-tracking techniques. After accounting for the misalignment between the 2 scanners, perfectly coregistered MRI and PET volumes were reproducibly obtained. The MRI output gates inserted into the PET list-mode allow the temporal correlation of the 2 datasets within 0.2 ms. The Hoffman phantom volume reconstructed by processing the PET data in the LOR space was similar to the one obtained by processing the data using the standard methods and applying the MC in the image space, demonstrating the quantitative accuracy of the procedure. In human volunteer studies, motion estimates were obtained from echo planar imaging and cloverleaf navigator sequences every 3 s and 20 ms, respectively. Motion-deblurred PET images, with excellent delineation of specific brain structures, were obtained using these 2 MRI

MR-assisted PET Motion Correction for eurological Studies in an Integrated MR-PET Scanner

Science.gov (United States)

Catana, Ciprian; Benner, Thomas; van der Kouwe, Andre; Byars, Larry; Hamm, Michael; Chonde, Daniel B.; Michel, Christian J.; El Fakhri, Georges; Schmand, Matthias; Sorensen, A. Gregory

2011-01-01

Head motion is difficult to avoid in long PET studies, degrading the image quality and offsetting the benefit of using a high-resolution scanner. As a potential solution in an integrated MR-PET scanner, the simultaneously acquired MR data can be used for motion tracking. In this work, a novel data processing and rigid-body motion correction (MC) algorithm for the MR-compatible BrainPET prototype scanner is described and proof-of-principle phantom and human studies are presented. Methods To account for motion, the PET prompts and randoms coincidences as well as the sensitivity data are processed in the line or response (LOR) space according to the MR-derived motion estimates. After sinogram space rebinning, the corrected data are summed and the motion corrected PET volume is reconstructed from these sinograms and the attenuation and scatter sinograms in the reference position. The accuracy of the MC algorithm was first tested using a Hoffman phantom. Next, human volunteer studies were performed and motion estimates were obtained using two high temporal resolution MR-based motion tracking techniques. Results After accounting for the physical mismatch between the two scanners, perfectly co-registered MR and PET volumes are reproducibly obtained. The MR output gates inserted in to the PET list-mode allow the temporal correlation of the two data sets within 0.2 s. The Hoffman phantom volume reconstructed processing the PET data in the LOR space was similar to the one obtained processing the data using the standard methods and applying the MC in the image space, demonstrating the quantitative accuracy of the novel MC algorithm. In human volunteer studies, motion estimates were obtained from echo planar imaging and cloverleaf navigator sequences every 3 seconds and 20 ms, respectively. Substantially improved PET images with excellent delineation of specific brain structures were obtained after applying the MC using these MR-based estimates. Conclusion A novel MR-based MC

Selecting a Conservation Surrogate Species for Small Fragmented Habitats Using Ecological Niche Modelling

Directory of Open Access Journals (Sweden)

K. Anne-Isola Nekaris

2015-01-01

Full Text Available Flagship species are traditionally large, charismatic animals used to rally conservation efforts. Accepted flagship definitions suggest they need only fulfil a strategic role, unlike umbrella species that are used to shelter cohabitant taxa. The criteria used to select both flagship and umbrella species may not stand up in the face of dramatic forest loss, where remaining fragments may only contain species that do not suit either set of criteria. The Cinderella species concept covers aesthetically pleasing and overlooked species that fulfil the criteria of flagships or umbrellas. Such species are also more likely to occur in fragmented habitats. We tested Cinderella criteria on mammals in the fragmented forests of the Sri Lankan Wet Zone. We selected taxa that fulfilled both strategic and ecological roles. We created a shortlist of ten species, and from a survey of local perceptions highlighted two finalists. We tested these for umbrella characteristics against the original shortlist, utilizing Maximum Entropy (MaxEnt modelling, and analysed distribution overlap using ArcGIS. The criteria highlighted Loris tardigradus tardigradus and Prionailurus viverrinus as finalists, with the former having highest flagship potential. We suggest Cinderella species can be effective conservation surrogates especially in habitats where traditional flagship species have been extirpated.

The multiple languages in the daily of the children

Directory of Open Access Journals (Sweden)

Cristiane Januário Gonçalves

2008-04-01

Full Text Available The language permeates the work in the infantile education and with the game and the interaction, constitutes one of the axes of the pedagogic action close to the children. When we spoke in language it is common we send ourselves to the verbal language and writing that, without a doubt, is fundamental for the infantile development, however, some pedagogic proposals end up just prioritizing those two language forms in the work with the children, in detriment of another possibilities.So, they end up depriving them of new existences and new experiences that favor the amplification of their knowledge. In that sense, they exist proposed in infantile education that have been looking for to just overcome the most restricted understanding of language as oral and writing, trying to enlarge it face to the perception that the child communicates and expressed himself by means of multiple languages, “a hundred languages”, as writes Loris Malaguzzi in his poetry. The content of that article seeks to present and to promote the reflection on some of the multiple present languages in the children's expression. It approaches the importance and the possibilities of working those communication forms and expression as possible languages in the small children's education.

Morphology and molecules reveal the alien Posthodiplostomum centrarchi Hoffman, 1958 as the third species of Posthodiplostomum Dubois, 1936 (Digenea: Diplostomidae) in Europe

Czech Academy of Sciences Publication Activity Database

Stoyanov, B.; Georgieva, Simona; Pankov, P.; Kudlai, Olena; Kostadinova, Aneta; Georgiev, B. B.

2017-01-01

Roč. 94, č. 1 (2017), s. 1-20 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : maximum likelihood * host specificity * platyhelminthes * phylogenies * systematics * trematoda Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.181, year: 2016

2010 Panel on the Biomaterials Grand Challenges

Science.gov (United States)

Reichert, William “Monty”; Ratner, Buddy D.; Anderson, James; Coury, Art; Hoffman, Allan S.; Laurencin, Cato T.; Tirrell, David

2014-01-01

In 2009, the National Academy for Engineering issued the Grand Challenges for Engineering in the 21st Century comprised of 14 technical challenges that must be addressed to build a healthy, profitable, sustainable, and secure global community (http://www.engineeringchallenges.org). Although crucial, none of the NEA Grand Challenges adequately addressed the challenges that face the biomaterials community. In response to the NAE Grand Challenges, Monty Reichert of Duke University organized a panel entitled Grand Challenges in Biomaterials at the at the 2010 Society for Biomaterials Annual Meeting in Seattle. Six members of the National Academies—Buddy Ratner, James Anderson, Allan Hoffman, Art Coury, Cato Laurencin, and David Tirrell—were asked to propose a grand challenge to the audience that, if met, would significantly impact the future of biomaterials and medical devices. Successfully meeting these challenges will speed the 60-plus year transition from commodity, off-the-shelf biomaterials to bioengineered chemistries, and biomaterial devices that will significantly advance our ability to address patient needs and also to create new market opportunities. PMID:21171147

Sulla soglia dell’esilio. Scritture di donne della ex Jugoslavia

Directory of Open Access Journals (Sweden)

Melita Richter

2007-11-01

Full Text Available The essay focuses on the experience of women authors emigrated from former Yugoslavia, and their writing from the exile... The concept of threshold (soglia and of crossing thresholds as the essential characteristic of women’s activism and communication is central to the essay. The author explores the concept of threshold across some literary texts and includes the autobiographical aspects of experienced migration from her native city Zagreb to Trieste, Italy, developing in a form of dialogue the “conversation” with a polish-American author Eva Hoffman who moved from Krakow, Poland to Canada and USA. In spite the differences of the two paths of integration in new social environments, many similitudes will be found between the life experiences of the two authors. Particularly will emerge the history of belonging to two different separated worlds, the appropriation of the new language, the reduction of plural identities, the role of memory and nostalgia in the integration process and the meaning of citizenship in a specific cultural and historical contexts.

Gamma irradiation of meat

International Nuclear Information System (INIS)

Whitburn, K.D.; Hoffman, M.Z.; Taub, I.A.

1982-01-01

In ''A Re-Evaluation of the Products of Gamma Irradiation of Beef Ferrimyoglobin'', J. Food Sci. 46:1814 (1981), authors Whitburn, Hoffman and Taub state that color pigment myoglobin (Mb) undergoes chemical changes during irradiation that cause color changes in meat. They also state that they are in disagreement with Giddings and Markakis, J. Food Sci. 47:361 (1972) in regard to generation of MbO 2 in deaerated solutions, claiming their analysis demonstrates only Mb and Mb(IV) production. Giddings, in a letter, suggests that Whitburn, et al may have used differing systems and approaches which critically changed the radiation chemistry. He also states that radiation sterilization of aerobically packaged meats affects color only slightly. Whitburn, in a reply, shares Dr. Giddings concern for caution in interpretation of results for this system. The compositional changes are dependent on identity of free radicals, dose, O 2 and the time of analysis after irradiation. The quantification of these parameters in pure systems, sarcoplasma extracts and in meat samples should lead to a better understanding of color change mechanisms and how to minimize them

Evaluation of a 32 x 32 InSb CCD for use in astronomy

Science.gov (United States)

Forrest, W. J.; Pipher, J. L.

1983-01-01

We have been fortunate to receive several infrared CCD array detectors on loan from Santa Barbara Research Center. The devices are evaluation samples, not commercially available at this time. Dr. Alan Hoffman of SBRC has made the arrangements for this loan and provided considerable technical support to this project. One aim of this project has been to evaluate the performance potential of this array technology, using astronomical objects. A quick summary of our findings is given. In short, we have found the imaging properties to be excellent under both low and high background conditions and the sensitivity to be quite good (each pixel is competitive with current InSb single-detector systems in use for astronomy). We anticipate improved low-background performance when we run these detectors at a lower and more stable temperature. The device characteristics are described, laboratory testing is summarized, and the first astronomical imaging is presented. Various circuits developed (clocks, clock drivers, DC supplies, clamp-amplifier, and a real time display system) are given.

A técnica de Kato para o diagnóstico coprológico de infecções parasitárias

Directory of Open Access Journals (Sweden)

Jairo Gonçalves Molina

1971-02-01

Full Text Available Empregando-se 76 espécimenis de fezes examinados velo método de Kato modificiado por Martin e Beaver (4, fêz-se a comparação com a técnica da sedimentação pelo método de Hoffman, Pons e Janer. Excetuando o diagnóstico das infecções pelo T. trichurus, nas quais houve evidentes vantagens do método de Kato, não se pode confirmar a superioridade do método de Kato, pelo menos nas condições do laboratório clínico normal. O autor frisa porém, que por falta de espécimens adequados não foi possível testar o método nas infecções pelo S. mansoni, campo que se ressente da falta de técnicas adequadas para o diagnóstico de infecções discretas e no qual se antecipam maiores virtudes do método de Kato.

The second immanant of some combinatorial matrices

Directory of Open Access Journals (Sweden)

R. B. Bapat

2015-06-01

Full Text Available Let $A = (a_{i,j}_{1 leq i,j leq n}$ be an $n times n$ matrix where $n geq 2$. Let $dt(A$, its second immanant be the immanant corresponding to the partition $lambda_2 = 2,1^{n-2}$. Let $G$ be a connected graph with blocks $B_1, B_2, ldots B_p$ and with $q$-exponential distance matrix $ED_G$. We given an explicit formula for $dt(ED_G$ which shows that $dt(ED_G$ is independent of the manner in which the blocks are connected. Our result is similar in form to the result of Graham, Hoffman and Hosoya and in spirit to that of Bapat, Lal and Pati who show that $det ED_T$ where $T$ is a tree is independent of the structure of $T$ and only its number of vertices. Our result extends more generally to a product distance matrix associated to a connected graph $G$. Similar results are shown for the $q$-analogue of $T$'s laplacian and a suitably defined matrix for arbitrary connected graphs.

Estudos sobre a dimensionalidade da empatia: tradução e adaptação do Interpersonal Reactivity Index (IRI

Directory of Open Access Journals (Sweden)

Sampaio, Leonardo Rodrigues

2011-01-01

Full Text Available Ao longo dos anos diversos métodos foram propostos para avaliar a empatia, sendo que os mais utilizados são escalas autoavaliativas. Dentre estas, destaca-se o Interpersonal Reactivity Index (IRI de Davis (1983, que avalia componentes cognitivos e afetivos da empatia. Os principais objetivos do presente trabalho foram: traduzir e adaptar o IRI para uso no Brasil, verificando suas propriedades psicométricas; e avaliar a dimensionalidade do construto empatia por meio da aplicação de análises fatoriais exploratória e confirmatória. Os resultados demonstraram que a versão traduzida e adaptada é adequada para ser aplicada no Brasil, que a dimensão de Fantasia tem importância fundamental para a empatia e que um modelo tetrafatorial é mais adequado do que os modelos unifatorial e bifatorial para explicação dos dados, o que corrobora a tese de Davis e Hoffman de que a empatia deve ser compreendida a partir de uma perspectiva multidimensional

Algorithms for Some Euler-Type Identities for Multiple Zeta Values

Directory of Open Access Journals (Sweden)

Shifeng Ding

2013-01-01

Full Text Available Multiple zeta values are the numbers defined by the convergent series ζ(s1,s2,…,sk=∑n1>n2>⋯>nk>0(1/n1s1 n2s2⋯nksk, where s1, s2, …, sk are positive integers with s1>1. For k≤n, let E(2n,k be the sum of all multiple zeta values with even arguments whose weight is 2n and whose depth is k. The well-known result E(2n,2=3ζ(2n/4 was extended to E(2n,3 and E(2n,4 by Z. Shen and T. Cai. Applying the theory of symmetric functions, Hoffman gave an explicit generating function for the numbers E(2n,k and then gave a direct formula for E(2n,k for arbitrary k≤n. In this paper we apply a technique introduced by Granville to present an algorithm to calculate E(2n,k and prove that the direct formula can also be deduced from Eisenstein's double product.

A Cation-containing Polymer Anion Exchange Membrane based on Poly(norbornene)

Science.gov (United States)

Beyer, Frederick; Price, Samuel; Ren, Xiaoming; Savage, Alice

Cation-containing polymers are being studied widely for use as anion exchange membranes (AEMs) in alkaline fuel cells (AFCs) because AEMs offer a number of potential benefits including allowing a solid state device and elimination of the carbonate poisoning problem. The successful AEM will combine high performance from several orthogonal properties, having robust mechanical strength even when wet, high hydroxide conductivity, and the high chemical stability required for long device lifetimes. In this study, we have synthesized a model cationic polymer that combines three of the key advantages of Nafion. The polymer backbone based on semicrystalline atactic poly(norbornene) offers good mechanical properties. A flexible, ether-based tether between the backbone and fixed cation charged species (quaternary ammonium) should provide the low-Tg, hydrophilic environment required to facilitate OH- transport. Finally, methyl groups have been added at the beta position relative to the quaternary ammonium cation to prevent Hoffman elimination, one mechanism by which AEMs are neutralized in a high pH environment. In this poster, we will present our findings on mechanical properties, morphology, charge transport, and chemical stability of this material.

Aspirin: 120 years of innovation. A report from the 2017 Scientific Conference of the International Aspirin Foundation, 14 September 2017, Charité, Berlin.

Science.gov (United States)

Walker, Jaqui; Hutchison, Pippa; Ge, Junbo; Zhao, Dong; Wang, Yongjun; Rothwell, Peter M; Gaziano, J Michael; Chan, Andrew; Burn, John; Chia, John; Langley, Ruth; O'Donnell, Valerie; Rocca, Bianca; Hawkey, Chris

2018-01-01

Acetylsalicylic acid was first synthesised by Dr FeIix Hoffman on 10th August 1897 and Aspirin was born. It quickly became the best-known pain killer in the world and in the 120 years since this event, aspirin has continued to attract interest, innovation and excitement. Set within the walls of the preserved ruins of Rudolf Virchow's lecture hall at Charité, within Berlin's Museum of Medical History, the International Aspirin Foundation's 28th Scientific Conference served to facilitate international, multi-disease, multidisciplinary discussion about the current understanding of aspirin's mechanisms of action and its utility in modern medicine as well as ideas for future research into its multifaceted applications to enhance global health. In addition to the delegates in Berlin, 300 medical doctors at the 19th Annual Scientific Congress of the Chinese Society of Cardiology were able to join the cardiology sessions from Taiyuan, Shangxi province via a live streaming link to and from China. This led to useful discussion and allowed a truly international perspective to the meeting.

Understanding Middle School Students' Perceptions of Physics Using Girl-Friendly and Integrated STEM Strategies: A Gender Study

Science.gov (United States)

Dare, Emily Anna

According to the American Physical Society, women accounted for only 20% of bachelor's degrees in the fields of physics and engineering in 2010. This low percentage is likely related to young girls' K-12 education experiences, particularly their experiences prior to high school, during which time young women's perceptions of Science, Technology, Engineering, and Math (STEM) and STEM careers are formed (Catsambis, 1995; Maltese & Tai, 2011; National Research Council, 2012; Sadler, Sonnert, Hazari, & Tai, 2012; Tai, Liu, Maltese, & Fan, 2006; Scantlebury, 2014; Sikora & Pokropek, 2012). There are no significant gender differences in academic achievement in middle school, yet young women have less positive attitudes towards careers in science than their male peers (Catsambis, 1995; Scantlebury, 2014). This suggests that the low female representation in certain STEM fields is a result of not their abilities, but their perceptions; for fields like physics where negative perceptions persist (Haussler & Hoffman, 2002; Labudde, Herzog, Neuenschander, Violi, & Gerber, 2000), it is clear that middle school is a critical time to intervene. This study examines the perceptions of 6th grade middle school students regarding physics and physics-related careers. A theoretical framework based on the literature of girl-friendly and integrated STEM strategies (Baker & Leary, 1995; Halpern et al., 2007; Haussler & Hoffman, 2000, 2002; Labudde et al., 2000; Moore et al., 2014b; Newbill & Cennamo, 2008; Rosser, 2000; Yanowitz, 2004) guided this work to understand how these instructional strategies may influence student's perceptions of physics for both girls and boys. The overarching goal of this work was to understand similarities and differences between girls' and boys' perceptions about physics and physics-related careers. This convergent parallel mixed-methods study uses a series of student surveys and focus group interviews to identify and understand these similarities and

Annual review of energy and the environment. Volume 23

Energy Technology Data Exchange (ETDEWEB)

Socolow, R.H. [ed.] [Princeton Univ., NJ (United States); Anderson, D. [ed.] [Imperial College of Science, Technology, and Medicine, London (United Kingdom); Harte, J. [ed.] [Univ. of California, Berkeley, CA (United States)

1998-12-31

Thirteen papers are included in this volume. The titles and authors are: From Physics to Development Strategies by Jose Goldemberg; Rewards and Penalties of Monitoring the Earth by Charles D. Keeling; Science and Nonscience Concerning Human-Caused Climate Warming by J. D. Mahlman; Consumption of Materials in the United States, 1990--1995 by Grecia Matos and Lorie Wagner; Future Technologies for Energy-Efficient Iron and Steel Making by Jeroen de Beer, Ernst Worrell, and Kornelis Blok; The O{sub 2} Balance of the Atmosphere: A Tool for Studying the Fate of Fossil Fuel CO{sub 2} by Michael L. Bender, Mark Battle, and Ralph F. Keeling; Mexican Electric End-Use Efficiency: Experiences to Date by Rafael Friedmann and Claudia Sheinbaum; Drinking Water in Developing Countries by Ashok Gadgil; Engineering-Economic Studies of Energy Technologies to Reduce Greenhouse Gas Emissions: Opportunities and Challenges by Marilyn A. Brown, Mark D. Levine, Joseph P. Romm, Arthur H. Rosenfeld, and Jonathan G. Koomey; Climate Change Mitigation in the Energy and Forestry Sectors of Developing Countries by Jayant A. Sathaye and N. H. Ravindranath; Toward a Productive Divorce: Separating DOE Cleanups from Transition Assistance by M. Russell; Recycling Metals for the Environment by Iddo K. Wernick and Nickolas J. Themelis; and Environmentally Conscious Chemical Process Design by J. A. Cano-Ruiz and G. J. McRae.

Review of sarcocystosis in Malaysia.

Science.gov (United States)

Kan, S P; Pathmanathan, R

1991-12-01

Sarcocystis is a tissue coccidian with an obligatory two-host life cycle. The sexual generations of gametogony and sporogony occur in the lamina propria of the small intestine of definitive hosts which shed infective sporocysts in their stools and present with intestinal sarcocystosis. Asexual multiplication occurs in the skeletal and cardiac muscles of intermediate hosts which harbor Sarcocystis cysts in their muscles and present with muscular sarcocystosis. In Malaysia, Sarcocystis cysts have been reported from many domestic and wild animals, including domestic and field rats, moonrats, bandicoots, slow loris, buffalo, and monkey, and man. The known definitive hosts for some species of Sarcocystis are the domestic cat, dog and the reticulated python. Human muscular sarcocystosis in Malaysia is a zoonotic infection acquired by contamination of food or drink with sporocysts shed by definitive hosts. The cysts reported in human muscle resembled those seen in the moonrat, Echinosorex gymnurus, and the long-tailed monkey, Macaca fascicularis. While human intestinal sarcocystosis has not been reported in Malaysia so far, it can be assumed that such cases may not be infrequent in view of the occurrence of Sarcocystis cysts in meat animals, such as buffalo. The overall seroprevalence of 19.8% reported among the main racial groups in Malaysia indicates that sarcocystosis (both the intestinal and muscular forms) may be emerging as a significant food-borne zoonotic infection in the country.

Improving medical graduates' training in palliative care: advancing education and practice

Directory of Open Access Journals (Sweden)

Head BA

2016-02-01

Full Text Available Barbara A Head,1 Tara J Schapmire,1 Lori Earnshaw,1 John Chenault,2 Mark Pfeifer,1 Susan Sawning,3 Monica A Shaw,3 1Division of General Internal Medicine, Palliative Care and Medical Education, University of Louisville School of Medicine, 2Kornhouser Health Sciences Library, University of Louisville, 3Undergraduate Medical Education Office, University of Louisville School of Medicine, Louisville, KY, USA Abstract: The needs of an aging population and advancements in the treatment of both chronic and life-threatening diseases have resulted in increased demand for quality palliative care. The doctors of the future will need to be well prepared to provide expert symptom management and address the holistic needs (physical, psychosocial, and spiritual of patients dealing with serious illness and the end of life. Such preparation begins with general medical education. It has been recommended that teaching and clinical experiences in palliative care be integrated throughout the medical school curriculum, yet such education has not become the norm in medical schools across the world. This article explores the current status of undergraduate medical education in palliative care as published in the English literature and makes recommendations for educational improvements which will prepare doctors to address the needs of seriously ill and dying patients. Keywords: medical education, palliative care, end-of-life care

Histopathological survey of protozoa, helminths and acarids of imported and local psittacine and passerine birds in Japan.

Science.gov (United States)

Tsai, S S; Hirai, K; Itakura, C

1992-12-01

A total of 534 psittacine and passerine birds consisting of 241 imported and 293 local birds were examined histologically. As a result, the following parasites were found: Giardia (86 cases), Knemido-coptes (26 cases), coccidia (10 cases), Ascaridia (6 cases), Cryptosporidium (5 cases), Sarcocystis (5 cases), tapeworm (4 cases), microfilaria (2 cases), Hexamita (1 case), and Spiroptera (1 case). High incidences of giardiasis and knemido-coptic infestation were detected in the local birds, but rarely in the imported birds. Giardial trophozoites were observed mainly in the duodenum of budgerigars (Melopsittacus undulatus). Knemidocoptic mites burrowed into the epidermis producing proliferative dermatitis in 25 budgerigars and 1 African Grey Parrot (Psittacus erithacus erithacus). This ectoparasite often infested the skin around the cloaca. Coccidiosis was seen only in the small intestines of the finch (Poephila gouldiae gouldiae), African Grey Parrot, Rainbow lory (Trichoglossus haematodus), Indian Ring-necked parakeet (Psittacula krameri manillensis) and peach-faced lovebird (Agapornis roseicollis). Two parrots (Amazona aestiva aestiva and Psittacus erithacus erithacus) and two budgerigars had intestinal cryptosporidiosis. Conjunctivitis associated with cryptosporidial infection was seen in a lovebird. Sarcocystis cysts containing crescent-shaped bradyzoites were found not only in the thigh and breast but also in the heart and cloacal muscles. Other organisms such as Ascaridia, tapeworm, microfilaria, Hexamita, and Spiroptera were clinically less significant. However, infections such as Giardia and Cryptosporidim might have zoonotic implications.

Hiding from the moonlight: luminosity and temperature affect activity of Asian nocturnal primates in a highly seasonal forest.

Directory of Open Access Journals (Sweden)

Carly Starr

Full Text Available The effect of moonlight and temperature on activity of slow lorises was previously little known and this knowledge might be useful for understanding many aspects of their behavioural ecology, and developing strategies to monitor and protect populations. In this study we aimed to determine if the activity of the pygmy loris (Nycticebus pygmaeus is affected by ambient temperature and/or moonlight in a mixed deciduous forest. We radio-collared five females and five males in the Seima Protection Forest, Cambodia, in February to May, 2008 and January to March, 2009 and recorded their behaviour at 5 minutes intervals, totalling 2736 observations. We classified each observation as either inactive (sleeping or alert or active behaviour (travel, feeding, grooming, or others. Moon luminosity (bright/dark and ambient temperature were recorded for each observation. The response variable, activity, was binary (active or inactive, and a logit link function was used. Ambient temperature alone did not significantly affect mean activity. Although mean activity was significantly affected by moonlight, the interaction between moonlight and temperature was also significant: on bright nights, studied animals were increasingly more active with higher temperature; and on dark nights they were consistently active regardless of temperature. The most plausible explanation is that on bright cold nights the combined risk of being seen and attacked by predators and heat loss outweigh the benefit of active behaviours.

Parasitoses intestinais se associam a menores índices de peso e estatura em escolares de baixo estrato socioeconômico Parasitosis intestinales se asocian con menores índices de peso y estatura en niños de bajo nivel económico Intestinal parasitoses are associated with lower values of weight and height in school-aged children from low socioeconomic level

Directory of Open Access Journals (Sweden)

Humberto B. Araujo Filho

2011-12-01

Full Text Available OBJETIVO: Avaliar a prevalência de parasitoses intestinais, correlacionando-as com os fatores socioeconômicos e ambientais, peso, estatura e hemoglobina, em crianças de dois estratos socioeconômicos, no município de Osasco (SP. MÉTODOS: Estudo transversal, comparando 84 crianças de seis a dez anos, residentes em área sem saneamento básico e moradia precária, com 35 crianças de escola particular no mesmo município, que possuíam boas condições socioeconômicas e de moradia. Excluíram-se aquelas com diarreia há menos de 30 dias ou doença grave. Utilizou-se questionário padronizado para avaliar as condições socioambientais. A avaliação nutricional foi realizada mediante escores Z de peso para idade, estatura para idade e índice de massa corpórea. A determinação da hemoglobina em amostra de sangue capilar foi realizada pelo método Hemocue® e a pesquisa de parasitas intestinais, pelos métodos de Hoffman, Ritchie, Kinyoun e swab anal. RESULTADOS: Parasitose intestinal ocorreu em 60,7% das crianças da favela e em 5,9% das crianças da escola particular (pOBJETIVO: Evaluar la prevalencia de parasitosis intestinales correlacionándolas con los factores socioeconómicos y ambientales, peso, estatura y hemoglobina, en niños de dos niveles socioeconómicos en el municipio de Osasco, São Paulo (Brasil. MÉTODOS: Se realizó un estudio transversal, comparando 84 niños entre 6 y 10 años, residentes en área sin saneamiento ambiental y vivienda precaria, con 35 niños de escuela privada en el mismo municipio, que poseían buenas condiciones socioeconómicas y de vivienda. Se excluyeron aquellas con diarrea hace menos de 30 días o enfermedad grave. Se utilizó cuestionario estandarizado para evaluar las condiciones socioambientales. La evaluación nutricional fue realizada mediante escores Z de peso para la edad, estatura para la edad e índice de masa corporal. La determinación de la hemoglobina en muestra de sangre capilar

Enhanced Accident Tolerant LWR Fuels National Metrics Workshop Report

Energy Technology Data Exchange (ETDEWEB)

Lori Braase

2013-01-01

Commercialization. The activities performed during the feasibility assessment phase include laboratory scale experiments; fuel performance code updates; and analytical assessment of economic, operational, safety, fuel cycle, and environmental impacts of the new concepts. The development and qualification stage will consist of fuel fabrication and large scale irradiation and safety basis testing, leading to qualification and ultimate NRC licensing of the new fuel. The commercialization phase initiates technology transfer to industry for implementation. Attributes for fuels with enhanced accident tolerance include improved reaction kinetics with steam and slower hydrogen generation rate, while maintaining acceptable cladding thermo-mechanical properties; fuel thermo-mechanical properties; fuel-clad interactions; and fission-product behavior. These attributes provide a qualitative guidance for parameters that must be considered in the development of fuels and cladding with enhanced accident tolerance. However, quantitative metrics must be developed for these attributes. To initiate the quantitative metrics development, a Light Water Reactor Enhanced Accident Tolerant Fuels Metrics Development Workshop was held October 10-11, 2012, in Germantown, Maryland. This document summarizes the structure and outcome of the two-day workshop. Questions regarding the content can be directed to Lori Braase, 208-526-7763, lori.braase@inl.gov.

Observations of Multi-band Structures in Double Star TC-1 PEACE Electron and HIA Ion Data

Science.gov (United States)

Mohan Narasimhan, K.; Fazakerley, A. N.; Grimald, S.; Dandouras, I. S.; Mihaljcic, B.; Kistler, L. M.; Owen, C. J.

2015-12-01

Several authors have reported inner magnetosphere observations of proton distributions confined to narrow energy bands in the range 1 - 25 keV (Smith and Hoffman (1974), etc). These structures have been described as "nose structures", with reference to their appearance in energy-time spectrograms and are also known as "bands" if they occur for extended periods of time. Multi-nose structures have been observed if 2 or more noses appear at the same time (Vallat et al., 2007). Gaps between "noses" (or "bands") have been explained in terms of the competing corotation, convection and magnetic gradient drifts. Charge exchange losses in slow drift paths for steady state scenarios and the role of substorm injections have also been considered (Li et al., 2000; Ebihara et al., 2004). We analyse observations of electron and ion multi-band structures frequently seen in Double-Star TC1 PEACE and HIA data. We present results from statistical surveys conducted using data from the duration of the mission. Furthermore, using a combination of both statistics and simulations, we test previous theories as to possible formation mechanisms and explore other possible explanations.

Motion correction of PET brain images through deconvolution: II. Practical implementation and algorithm optimization

Science.gov (United States)

Raghunath, N.; Faber, T. L.; Suryanarayanan, S.; Votaw, J. R.

2009-02-01

Image quality is significantly degraded even by small amounts of patient motion in very high-resolution PET scanners. When patient motion is known, deconvolution methods can be used to correct the reconstructed image and reduce motion blur. This paper describes the implementation and optimization of an iterative deconvolution method that uses an ordered subset approach to make it practical and clinically viable. We performed ten separate FDG PET scans using the Hoffman brain phantom and simultaneously measured its motion using the Polaris Vicra tracking system (Northern Digital Inc., Ontario, Canada). The feasibility and effectiveness of the technique was studied by performing scans with different motion and deconvolution parameters. Deconvolution resulted in visually better images and significant improvement as quantified by the Universal Quality Index (UQI) and contrast measures. Finally, the technique was applied to human studies to demonstrate marked improvement. Thus, the deconvolution technique presented here appears promising as a valid alternative to existing motion correction methods for PET. It has the potential for deblurring an image from any modality if the causative motion is known and its effect can be represented in a system matrix.

Motion correction of PET brain images through deconvolution: II. Practical implementation and algorithm optimization

International Nuclear Information System (INIS)

Raghunath, N; Faber, T L; Suryanarayanan, S; Votaw, J R

2009-01-01

Image quality is significantly degraded even by small amounts of patient motion in very high-resolution PET scanners. When patient motion is known, deconvolution methods can be used to correct the reconstructed image and reduce motion blur. This paper describes the implementation and optimization of an iterative deconvolution method that uses an ordered subset approach to make it practical and clinically viable. We performed ten separate FDG PET scans using the Hoffman brain phantom and simultaneously measured its motion using the Polaris Vicra tracking system (Northern Digital Inc., Ontario, Canada). The feasibility and effectiveness of the technique was studied by performing scans with different motion and deconvolution parameters. Deconvolution resulted in visually better images and significant improvement as quantified by the Universal Quality Index (UQI) and contrast measures. Finally, the technique was applied to human studies to demonstrate marked improvement. Thus, the deconvolution technique presented here appears promising as a valid alternative to existing motion correction methods for PET. It has the potential for deblurring an image from any modality if the causative motion is known and its effect can be represented in a system matrix.

Motion correction of PET brain images through deconvolution: II. Practical implementation and algorithm optimization

Energy Technology Data Exchange (ETDEWEB)

Raghunath, N; Faber, T L; Suryanarayanan, S; Votaw, J R [Department of Radiology, Emory University Hospital, 1364 Clifton Road, N.E. Atlanta, GA 30322 (United States)], E-mail: John.Votaw@Emory.edu

2009-02-07

Image quality is significantly degraded even by small amounts of patient motion in very high-resolution PET scanners. When patient motion is known, deconvolution methods can be used to correct the reconstructed image and reduce motion blur. This paper describes the implementation and optimization of an iterative deconvolution method that uses an ordered subset approach to make it practical and clinically viable. We performed ten separate FDG PET scans using the Hoffman brain phantom and simultaneously measured its motion using the Polaris Vicra tracking system (Northern Digital Inc., Ontario, Canada). The feasibility and effectiveness of the technique was studied by performing scans with different motion and deconvolution parameters. Deconvolution resulted in visually better images and significant improvement as quantified by the Universal Quality Index (UQI) and contrast measures. Finally, the technique was applied to human studies to demonstrate marked improvement. Thus, the deconvolution technique presented here appears promising as a valid alternative to existing motion correction methods for PET. It has the potential for deblurring an image from any modality if the causative motion is known and its effect can be represented in a system matrix.

Impact of PET/CT system, reconstruction protocol, data analysis method, and repositioning on PET/CT precision: An experimental evaluation using an oncology and brain phantom.

Science.gov (United States)

Mansor, Syahir; Pfaehler, Elisabeth; Heijtel, Dennis; Lodge, Martin A; Boellaard, Ronald; Yaqub, Maqsood

2017-12-01

In longitudinal oncological and brain PET/CT studies, it is important to understand the repeatability of quantitative PET metrics in order to assess change in tracer uptake. The present studies were performed in order to assess precision as function of PET/CT system, reconstruction protocol, analysis method, scan duration (or image noise), and repositioning in the field of view. Multiple (repeated) scans have been performed using a NEMA image quality (IQ) phantom and a 3D Hoffman brain phantom filled with 18 F solutions on two systems. Studies were performed with and without randomly (PET/CT, especially in the case of smaller spheres (PET metrics depends on the combination of reconstruction protocol, data analysis methods and scan duration (scan statistics). Moreover, precision was also affected by phantom repositioning but its impact depended on the data analysis method in combination with the reconstructed voxel size (tissue fraction effect). This study suggests that for oncological PET studies the use of SUV peak may be preferred over SUV max because SUV peak is less sensitive to patient repositioning/tumor sampling. © 2017 The Authors. Medical Physics published by Wiley Periodicals, Inc. on behalf of American Association of Physicists in Medicine.

Effects of Different Relative Loads on Power Performance During the Ballistic Push-up.

Science.gov (United States)

Wang, Ran; Hoffman, Jay R; Sadres, Eliahu; Bartolomei, Sandro; Muddle, Tyler W D; Fukuda, David H; Stout, Jeffrey R

2017-12-01

Wang, R, Hoffman, JR, Sadres, E, Bartolomei, S, Muddle, TWD, Fukuda, DH, and Stout, JR. Effects of different relative loads on power performance during the ballistic push-up. J Strength Cond Res 31(12): 3411-3416, 2017-The purpose of this investigation was to examine the effect of load on force and power performance during a ballistic push-up. Sixty (24.5 ± 4.3 years, 1.75 ± 0.07 m, and 80.8 ± 13.5 kg) recreationally active men who participated in this investigation completed all testing and were included in the data analysis. All participants were required to perform a 1 repetition maximum bench press, and ballistic push-ups without external load (T1), with 10% (T2) and 20% (T3) of their body mass. Ballistic push-ups during T2 and T3 were performed using a weight loaded vest. Peak and mean force, power, as well as net impulse and flight time were determined for each ballistic push-up. Peak and mean force were both significantly greater (p ballistic push-up, regardless of the participants' level of strength.

A heuristic statistical stopping rule for iterative reconstruction in emission tomography

International Nuclear Information System (INIS)

Ben Bouallegue, F.; Mariano-Goulart, D.; Crouzet, J.F.

2013-01-01

We propose a statistical stopping criterion for iterative reconstruction in emission tomography based on a heuristic statistical description of the reconstruction process. The method was assessed for maximum likelihood expectation maximization (MLEM) reconstruction. Based on Monte-Carlo numerical simulations and using a perfectly modeled system matrix, our method was compared with classical iterative reconstruction followed by low-pass filtering in terms of Euclidian distance to the exact object, noise, and resolution. The stopping criterion was then evaluated with realistic PET data of a Hoffman brain phantom produced using the Geant4 application in emission tomography (GATE) platform for different count levels. The numerical experiments showed that compared with the classical method, our technique yielded significant improvement of the noise-resolution tradeoff for a wide range of counting statistics compatible with routine clinical settings. When working with realistic data, the stopping rule allowed a qualitatively and quantitatively efficient determination of the optimal image. Our method appears to give a reliable estimation of the optimal stopping point for iterative reconstruction. It should thus be of practical interest as it produces images with similar or better quality than classical post-filtered iterative reconstruction with a mastered computation time. (author)

Ain't necessarily so: review and critique of recent meta-analyses of behavioral medicine interventions in health psychology.

Science.gov (United States)

Coyne, James C; Thombs, Brett D; Hagedoorn, Mariet

2010-03-01

We examined four meta-analyses of behavioral interventions for adults (Dixon, Keefe, Scipio, Perri, & Abernethy, 2007; Hoffman, Papas, Chatkoff, & Kerns, 2007; Irwin, Cole, & Nicassio, 2006; and Jacobsen, Donovan, Vadaparampil, & Small, 2007) that have appeared in the Evidence Based Treatment Reviews section of Health Psychology. Narrative review. We applied the following criteria to each meta-analysis: (1) whether each meta-analysis was described accurately, adequately, and transparently in the article; (2) whether there was an adequate attempt to deal with methodological quality of the original trials; (3) the extent to which the meta-analysis depended on small, underpowered studies; and (4) the extent to which the meta-analysis provided valid and useful evidence-based recommendations. Across the four meta-analyses, we identified substantial problems with the transparency and completeness with which these meta-analyses were reported, as well as a dependence on small, underpowered trials of generally poor quality. Results of our exercise raise questions about the clinical validity and utility of the conclusions of these meta-analyses. Results should serve as a wake up call to prospective authors, reviewers, and end-users of meta-analyses now appearing in the literature. Copyright 2010 APA, all rights reserved.

Hypothyroid myopathy: A peculiar clinical presentation of thyroid failure. Review of the literature.

Science.gov (United States)

Sindoni, Alessandro; Rodolico, Carmelo; Pappalardo, Maria Angela; Portaro, Simona; Benvenga, Salvatore

2016-12-01

Abnormalities in thyroid function are common endocrine disorders that affect 5-10 % of the general population, with hypothyroidism occurring more frequently than hyperthyroidism. Clinical symptoms and signs are often nonspecific, particularly in hypothyroidism. Muscular symptoms (stiffness, myalgias, cramps, easy fatigability) are mentioned by the majority of patients with frank hypothyroidism. Often underestimated is the fact that muscle symptoms may represent the predominant or the only clinical manifestation of hypothyroidism, raising the issue of a differential diagnosis with other causes of myopathy, which sometimes can be difficult. Elevated serum creatine kinase, which not necessarily correlates with the severity of the myopathic symptoms, is certainly suggestive of muscle impairment, though it does not explain the cause. Rare muscular manifestations, associated with hypothyroidism, are rhabdomyolysis, acute compartment syndrome, Hoffman's syndrome and Kocher-Debré-Sémélaigne syndrome. Though the pathogenesis of hypothyroid myopathy is not entirely known, proposed mechanisms include altered glycogenolytic and oxidative metabolism, altered expression of contractile proteins, and neuro-mediated damage. Correlation studies of haplotype, muscle gene expression and protein characterization, could help understanding the pathophysiological mechanisms of this myopathic presentation of hypothyroidism.

FRAUD/SABOTAGE Killing Nuclear-Reactors Need Modeling!!!: ``Super'' alloys GENERIC ENDEMIC Wigner's-Disease/.../IN-stability: Ethics? SHMETHICS!!!

Science.gov (United States)

O'Grady, Joseph; Bument, Arlden; Siegel, Edward

2011-03-01

Carbides solid-state chemistry domination of old/new nuclear-reactors/spent-fuel-casks/refineries/jet/missile/rocket-engines is austenitic/FCC Ni/Fe-based (so miscalled)"super"alloys(182/82;Hastelloy-X,600,304/304L-SSs,...690!!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's-disease(WD) [J.Appl.Phys.17,857 (46)]/Ostwald-ripening/spinodal-decomposition/overageing-embrittlement/thermal-leading-to-mechanical(TLTM)-INstability: Mayo[Google: fLeaksCouldKill > ; - Siegel [ J . Mag . Mag . Mtls . 7 , 312 (78) = atflickr . comsearchonGiant - Magnotoresistance [Fert" [PRL(1988)]-"Gruenberg"[PRL(1989)] 2007-Nobel]necessitating NRC inspections on 40+25=65 Westin"KL"ouse PWRs(12/2006)]-Lai [Met.Trans.AIME, 9A,827(78)]-Sabol-Stickler[Phys.Stat.Sol.(70)]-Ashpahani[ Intl.Conf. Hydrogen in Metals, Paris(1977]-Russell [Prog.Mtls.Sci.(1983)]-Pollard [last UCS rept.(9/1995)]-Lofaro [BNL/DOE/NRC Repts.]-Pringle [ Nuclear-Power:From Physics to Politics(1979)]-Hoffman [animatedsoftware.com], what DOE/NRC MISlabels as "butt-welds" "stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embrittlement caused brittle-fracture cracking from early/ongoing AEC/DOE-n"u"tional-la"v"atories sabotage!!!

Dynamic facial expressions evoke distinct activation in the face perception network: a connectivity analysis study.

Science.gov (United States)

Foley, Elaine; Rippon, Gina; Thai, Ngoc Jade; Longe, Olivia; Senior, Carl

2012-02-01

Very little is known about the neural structures involved in the perception of realistic dynamic facial expressions. In the present study, a unique set of naturalistic dynamic facial emotional expressions was created. Through fMRI and connectivity analysis, a dynamic face perception network was identified, which is demonstrated to extend Haxby et al.'s [Haxby, J. V., Hoffman, E. A., & Gobbini, M. I. The distributed human neural system for face perception. Trends in Cognitive Science, 4, 223-233, 2000] distributed neural system for face perception. This network includes early visual regions, such as the inferior occipital gyrus, which is identified as insensitive to motion or affect but sensitive to the visual stimulus, the STS, identified as specifically sensitive to motion, and the amygdala, recruited to process affect. Measures of effective connectivity between these regions revealed that dynamic facial stimuli were associated with specific increases in connectivity between early visual regions, such as the inferior occipital gyrus and the STS, along with coupling between the STS and the amygdala, as well as the inferior frontal gyrus. These findings support the presence of a distributed network of cortical regions that mediate the perception of different dynamic facial expressions.

Breakout Session: International Treaties, Copyright Law, and the Future of the U.S.A. Presented by Kenneth D. Crews, attorney, Gipson Hoffman and Pancione.

Directory of Open Access Journals (Sweden)

Posie Aagaard

2018-02-01

Full Text Available Nearly every nation in the world enacts laws that explicitly govern domestic copyright, dictating rights reserved for authors and specifying other important legal terms. Both geographical borders and the less well-defined borders of the internet affect determinations of copyright. On a global scale, nations enact international copyright treaties to achieve harmonization of certain aspects of copyright law that would otherwise create challenges or conflicts in enforcement of policies between individual nations. However, member nations may need to adjust domestic laws to bring them into alignment with the terms of the international treaties. International law expert Dr. Kenneth Crews discussed the evolution of copyright law and described how precedents set by some nations historically influenced geographic and sociopolitical peers. He also discussed how existing international copyright treaties address issues that continue to reveal weaknesses or compelling needs that cannot easily be served through existing copyright law. Lastly, Dr. Crews provided an update on the landmark 2013 Marrakesh VIP Treaty, which establishes special copyright provisions to accommodate individuals with print disabilities, and reported on his work commissioned by WIPO to study the status of copyright law exceptions in nations around the world.

Avaliação da influência sazonal na incidência de ovos e larvas de parasitos intestinais em praças no município de Macapá-AP | Evaluation of seasonal influence on the incidence of eggs and larvae of intestinal parasites in squares in the city of Macapá-AP

Directory of Open Access Journals (Sweden)

Felipe Ferreira Rêgo

2017-05-01

Full Text Available Doenças relacionadas a parasitoses mostram-se um relevante problema de saúde pública devido às diferentes complicações que estas podem causar, e o fornecimento de dados epidemiológicos tem o objetivo de reverter esse quadro. O trabalho visou avaliar a frequência de ovos e larvas de helmintos no município de Macapá, assim como a influência da sazonalidade na incidência da contaminação das praças públicas nos períodos compreendidos como inverno e verão. Nesse estudo foi analisado uma amostra contendo três pontos estratégicos de solo de cada praça, totalizando 39 praças, divididas em diferentes bairros. A escolha foi feita de acordo com as zonas que dividem o município, totalizando 39 amostras em recipientes devidamente vedados. Os métodos utilizados foram: Hoffman, Direto, Willis e Baermann Moraes. Os resultados mostraram a alta carga parasitária nos locais públicos, principalmente na época do inverno, onde se notou a alta prevalência de ovos Toxocara spp. no período do verão e, no período do inverno, obteve-se a prevalência maior de ovos de Ancylostoma spp., o que justifica uma ação imediata do poder público em relação a presença desses agentes no meio ambiente, com controle de animais, saneamento básico, disponibilização de tratamento e manutenção periódica das praças públicas. ============================================ Diseases related to parasitosis are a relevant public health problem due to the different complications that these can cause, and the provision of epidemiological data is aimed at reversing this situation. The objective of this work was to evaluate the frequency of eggs and larvae of helminths in the county of Macapá, as well as the influence of seasonality on the incidence of contamination of public squares in seasons from winter to summer. In this study 1 sample containing 3 strategic points of soil of each square was analyzed, totaling 39 squares, divided in different

What I have changed my mind about and why

Directory of Open Access Journals (Sweden)

Rachel Yehuda

2016-11-01

Full Text Available This paper is based upon a panel discussion “What I Have Changed My Mind About and Why” held on 5 November in New Orleans, Louisiana (USA, as part of the ISTSS 2015 annual meeting “Back to Basics: Integrating Clinical and Scientific Knowledge to Advance the Field of Trauma.” The panel was chaired by Professor Dr. Rachel Yehuda of the Icahn School of Medicine at Mount Sinai and the James J. Peters Veterans Affairs, and included five clinician-scholars who exchanged thoughts about what they have changed their minds about over the years: Dr. David Spiegel, Dr. Steven Southwick, Dr. Lori Davis, Dr. Thomas Neylan, and Dr. John Krystal. This paper provides a summary of the salient points made by each expert and the questions and discussion that ensured. Major issues raised included the increasingly clear limitations to the fear-based model that has advanced the field. While treatments for PTSD have improved, there are some aspects of trauma exposure that cannot be entirely repaired. Research providing an evidence base to treatment has led to overly specific treatment guidelines that may obscure more general principles of effective treatment. Treatment might be viewed as a way to increase the plasticity of the brain in the context of processing social cues. A variety of novel and integrative therapies include comprehensive holistic care, exercise, returning to competitive work, logotherapy, mindfulness, enhancing well-being and resilience, and medications with novel mechanisms, such as ketamine.

2012 best practices for repositories collection, storage, retrieval, and distribution of biological materials for research international society for biological and environmental repositories.

Science.gov (United States)

2012-04-01

Third Edition [Formula: see text] [Box: see text] Printed with permission from the International Society for Biological and Environmental Repositories (ISBER) © 2011 ISBER All Rights Reserved Editor-in-Chief Lori D. Campbell, PhD Associate Editors Fay Betsou, PhD Debra Leiolani Garcia, MPA Judith G. Giri, PhD Karen E. Pitt, PhD Rebecca S. Pugh, MS Katherine C. Sexton, MBA Amy P.N. Skubitz, PhD Stella B. Somiari, PhD Individual Contributors to the Third Edition Jonas Astrin, Susan Baker, Thomas J. Barr, Erica Benson, Mark Cada, Lori Campbell, Antonio Hugo Jose Froes Marques Campos, David Carpentieri, Omoshile Clement, Domenico Coppola, Yvonne De Souza, Paul Fearn, Kelly Feil, Debra Garcia, Judith Giri, William E. Grizzle, Kathleen Groover, Keith Harding, Edward Kaercher, Joseph Kessler, Sarah Loud, Hannah Maynor, Kevin McCluskey, Kevin Meagher, Cheryl Michels, Lisa Miranda, Judy Muller-Cohn, Rolf Muller, James O'Sullivan, Karen Pitt, Rebecca Pugh, Rivka Ravid, Katherine Sexton, Ricardo Luis A. Silva, Frank Simione, Amy Skubitz, Stella Somiari, Frans van der Horst, Gavin Welch, Andy Zaayenga 2012 Best Practices for Repositories: Collection, Storage, Retrieval and Distribution of Biological Materials for Research INTERNATIONAL SOCIETY FOR BIOLOGICAL AND ENVIRONMENTAL REPOSITORIES (ISBER) INTRODUCTION T he availability of high quality biological and environmental specimens for research purposes requires the development of standardized methods for collection, long-term storage, retrieval and distribution of specimens that will enable their future use. Sharing successful strategies for accomplishing this goal is one of the driving forces for the International Society for Biological and Environmental Repositories (ISBER). For more information about ISBER see www.isber.org . ISBER's Best Practices for Repositories (Best Practices) reflect the collective experience of its members and has received broad input from other repository professionals. Throughout this document

Doubles everywhere: literary contributions to the study of the bodily self.

Science.gov (United States)

Dieguez, Sebastian

2013-01-01

The topic of the double is a hallmark of romantic, gothic, and fantastic literature. In the guise of the second self, the alter ego or the doppelgänger, fictional doubles have long fascinated critics, clinicians, and scientists. We review classical approaches to the theme and propose a broad clinical and neurocognitive framework from which to examine major instances of the motif in literature. Based on neurological disorders of the bodily self (including unilateral and whole body illusions and duplications), as well as related experimental approaches, we provide examples of literary depictions of bodily fragmentation and splitting; autoscopic hallucinations; the classical doppelgänger, second self, or heautoscopic double; the feeling of a presence; out-of-body experiences; and so-called near-death experiences. Examples include works from Guy de Maupassant, E.T.A. Hoffman, Edgar Allan Poe, Robert Louis Stevenson, Fyodor Dostoevsky, Rudyard Kipling, and others. We discuss these literary cases of doubles from a neurocognitive perspective, and suggest that common mechanisms of the bodily self are involved in the emergence of pathological illusory doubles, literary creations of the double, as well as widespread cultural and religious beliefs about the existence of doubles and the soul. Copyright © 2013 S. Karger AG, Basel.

Modeling Phytoremediation of Cadmium Contaminated Soil with Sunflower (Helianthus annus) Under Salinity Stress

International Nuclear Information System (INIS)

Motesharezadeh, B.; Navabzadeh, M.; Liyaghat, A. M.

2016-01-01

This study was carried out as a factorial experiment with 5 levels of cadmium (Cd) (o, 25, 50, 75, and 100 mg/kg), 5 levels of salinity (Control, 4, 5, 6, and 7 dS/m), and two soil textures (sandy loam and clay loam). The results showed that the amount of Cd in root and shoot of sunflower increased as soil salinity and Cd concentration increased. The best concentrations for Cd phytoremediation were 75 mg/kg in sandy loam and 100 mg/kg in clay loam. Mass-Hoffman model in simulating transpiration Cd stress as well as Homaee model in simulating salt stress indicated the best results in light soils. By multiplying the salinity stress model by Cd stress model, the simultaneous model for each soil was calculated. These models in light soil (r2=0.68) and heavy soil (r2=0.81) were compatible with measured values. In the heavy soil, absorbed Cd by plant along with increased salinity reflected low changes, but changes in Cd absorbed by plants in the heavy soil were more uniform than in the light soil. In conclusion, for estimating the Cd uptake, the model had a better performance in the heavy soil (under salt stress).

The Aomori Prefecture Brain Blood Flow SPECT Phantom Study (First information). Comparison between reference image and each facility to aim at grasp of the situation

International Nuclear Information System (INIS)

Ishikura, Makihito; Narita, Kazuo; Terayama, Yoshio; Kudou, Sukehiro

2008-01-01

As the single photon emission computed tomography (SPECT) image has rather big between-facility and -machine differences, a questionnaire was done to 18 SPECT facilities in Aomori Prefecture in May, 03, 15 of which answered, for the purpose of standardization of the brain blood flow images in the prefecture. The questionnaire concerned the condition of data collection, image display and reconstruction, and quantitative analysis, based on whose results the Phantom Study was then conducted to see the relationship between the average count and Butterworth filter (BWF) cut-off value by comparison of reference and facilities' images. The gamma camera PRISM 200XP, processor Odyssey Fx and low-energy high-resolution (LEHR) collimator were used for the reference image with collection matrix 128 x 128, 3.5 mm pixel size, Ramp reconstruction filter, Chang decay correction (coefficient μ=0.09) and null scattering correction. Used was the Hoffman phantom containing 30-37 MBq of 99m Tc or 8-18 MBq of 123 I. It was found that the fluctuation of cut-off values became small depending on the increase of count and the collection count was low for both nuclides in those facilities, and thus further study of the measure for increasing the collection count was thought necessary. (R.T.)

Motion correction of PET brain images through deconvolution: I. Theoretical development and analysis in software simulations

Science.gov (United States)

Faber, T. L.; Raghunath, N.; Tudorascu, D.; Votaw, J. R.

2009-02-01

Image quality is significantly degraded even by small amounts of patient motion in very high-resolution PET scanners. Existing correction methods that use known patient motion obtained from tracking devices either require multi-frame acquisitions, detailed knowledge of the scanner, or specialized reconstruction algorithms. A deconvolution algorithm has been developed that alleviates these drawbacks by using the reconstructed image to estimate the original non-blurred image using maximum likelihood estimation maximization (MLEM) techniques. A high-resolution digital phantom was created by shape-based interpolation of the digital Hoffman brain phantom. Three different sets of 20 movements were applied to the phantom. For each frame of the motion, sinograms with attenuation and three levels of noise were simulated and then reconstructed using filtered backprojection. The average of the 20 frames was considered the motion blurred image, which was restored with the deconvolution algorithm. After correction, contrast increased from a mean of 2.0, 1.8 and 1.4 in the motion blurred images, for the three increasing amounts of movement, to a mean of 2.5, 2.4 and 2.2. Mean error was reduced by an average of 55% with motion correction. In conclusion, deconvolution can be used for correction of motion blur when subject motion is known.

Motion correction of PET brain images through deconvolution: I. Theoretical development and analysis in software simulations

Energy Technology Data Exchange (ETDEWEB)

Faber, T L; Raghunath, N; Tudorascu, D; Votaw, J R [Department of Radiology, Emory University Hospital, 1364 Clifton Road, N.E. Atlanta, GA 30322 (United States)], E-mail: tfaber@emory.edu

2009-02-07

Image quality is significantly degraded even by small amounts of patient motion in very high-resolution PET scanners. Existing correction methods that use known patient motion obtained from tracking devices either require multi-frame acquisitions, detailed knowledge of the scanner, or specialized reconstruction algorithms. A deconvolution algorithm has been developed that alleviates these drawbacks by using the reconstructed image to estimate the original non-blurred image using maximum likelihood estimation maximization (MLEM) techniques. A high-resolution digital phantom was created by shape-based interpolation of the digital Hoffman brain phantom. Three different sets of 20 movements were applied to the phantom. For each frame of the motion, sinograms with attenuation and three levels of noise were simulated and then reconstructed using filtered backprojection. The average of the 20 frames was considered the motion blurred image, which was restored with the deconvolution algorithm. After correction, contrast increased from a mean of 2.0, 1.8 and 1.4 in the motion blurred images, for the three increasing amounts of movement, to a mean of 2.5, 2.4 and 2.2. Mean error was reduced by an average of 55% with motion correction. In conclusion, deconvolution can be used for correction of motion blur when subject motion is known.

Quantitative SPECT brain imaging: Effects of attenuation and detector response

International Nuclear Information System (INIS)

Gilland, D.R.; Jaszczak, R.J.; Bowsher, J.E.; Turkington, T.G.; Liang, Z.; Greer, K.L.; Coleman, R.E.

1993-01-01

Two physical factors that substantially degrade quantitative accuracy in SPECT imaging of the brain are attenuation and detector response. In addition to the physical factors, random noise in the reconstructed image can greatly affect the quantitative measurement. The purpose of this work was to implement two reconstruction methods that compensate for attenuation and detector response, a 3D maximum likelihood-EM method (ML) and a filtered backprojection method (FB) with Metz filter and Chang attenuation compensation, and compare the methods in terms of quantitative accuracy and image noise. The methods were tested on simulated data of the 3D Hoffman brain phantom. The simulation incorporated attenuation and distance-dependent detector response. Bias and standard deviation of reconstructed voxel intensities were measured in the gray and white matter regions. The results with ML showed that in both the gray and white matter regions as the number of iterations increased, bias decreased and standard deviation increased. Similar results were observed with FB as the Metz filter power increased. In both regions, ML had smaller standard deviation than FB for a given bias. Reconstruction times for the ML method have been greatly reduced through efficient coding, limited source support, and by computing attenuation factors only along rays perpendicular to the detector

C, Sr and Sr isotopic composition on probable vendian- tommotian carbonate sequences in Nw Argentina

International Nuclear Information System (INIS)

Sial, A. N.; Ferreira, V.P; Toselli, A.J.; Acenolaza, F.G; Pimentel, M.M; Parada, M.A; Alonso, R.N

2001-01-01

C-isotope stratigraphy is one of the most powerfool tools in Precambrian chronostratigraphy, especially when sediments lack recognizable animal fossils. The δ 13 C secular variation curves for marine carbonates in the Neoproterozoic-Cambrian interval show strong positive-negative excursions, several of them interpreted as the stratigraphic position of ancient ice ages (Hoffman et al. 1998). The Sr isotope composition of the seawater for this age interval is characterized by a continuous increase of 87 Sr/ 86 Sr that is interrupted, several times, by sharp rises, which represent important changes in the Earth history (Montanez et al. 2000). Only limited data on the behavior of C and Sr isotopes in carbonates are available in South America. We examine here carbonate sequences from the Argentine Precordillera, San Juan province, and from other carbonate sequences in NW Argentina that could be, potentially, proxies for the Precambrian-Cambrian transition. We have studied their δ 13 C and 87 Sr/ 86 Sr chemostratigraphy and compare it to global C and Sr isotope secular variation curves for this time span. This study aims to improve the relatively coarse stratigraphic resolution provided only by the study of the fossil record in some of the carbonate successions under consideration (au)

Model selection for semiparametric marginal mean regression accounting for within-cluster subsampling variability and informative cluster size.

Science.gov (United States)

Shen, Chung-Wei; Chen, Yi-Hau

2018-03-13

We propose a model selection criterion for semiparametric marginal mean regression based on generalized estimating equations. The work is motivated by a longitudinal study on the physical frailty outcome in the elderly, where the cluster size, that is, the number of the observed outcomes in each subject, is "informative" in the sense that it is related to the frailty outcome itself. The new proposal, called Resampling Cluster Information Criterion (RCIC), is based on the resampling idea utilized in the within-cluster resampling method (Hoffman, Sen, and Weinberg, 2001, Biometrika 88, 1121-1134) and accommodates informative cluster size. The implementation of RCIC, however, is free of performing actual resampling of the data and hence is computationally convenient. Compared with the existing model selection methods for marginal mean regression, the RCIC method incorporates an additional component accounting for variability of the model over within-cluster subsampling, and leads to remarkable improvements in selecting the correct model, regardless of whether the cluster size is informative or not. Applying the RCIC method to the longitudinal frailty study, we identify being female, old age, low income and life satisfaction, and chronic health conditions as significant risk factors for physical frailty in the elderly. © 2018, The International Biometric Society.

The study on acquisition mode and reconstruction parameters of brain FDG PET images

International Nuclear Information System (INIS)

Zuo Chuantao; Liu Yongchang; Guan Yihui; Zhao Jun; Lin Xiangtong

2001-01-01

Objective: To evaluate the effect of acquisition mode on the brain PET images. Methods: After changing conditions and parameters, the authors got brain PET images of different acquisition modes, different emission counts, different transmission times; and compared with the reference images the impacts of different acquisition modes, different acquisition conditions were assessed. Results: Compared with 2D mode, much higher background and noise were observed on the reconstruction images of 3D mode, and the bottoms of the brain structure were not well displayed. But the middle part of brain structure displayed well in 2D and 3D mode without difference; the gray/white radioactivity ratios were 2.108 +- 0.183 and 2.286 +- 0.232 under 2D and 3D mode, respectively. The gray/white radioactivity ratios with different emission counts were 2.108 +- 0.183, 2.215 +- 0.158, 2.161 +- 0.176, respectively, there was no evident difference among them. With transmission counts increasing, the segmented image outline of Hoffman phantom and brain structure became clear and integral. Conclusions: Different acquisition modes, different emission counts and different transmission times are of certain impacts on brain FDG PET images, and it should be paid more attention in clinical practice

Spinoff from high energy physics

International Nuclear Information System (INIS)

Hoffmann, Hans

1994-01-01

This year the CERN Courier is featuring the spinoff and technological benefits arising from research in fundamental physics. After initial illustrations in applied data processing sectors, this article by Hans Hoffman of CERN examines the rationale and underlying objectives of the 'new awareness' of the market value of basic science. He is the Chairman of a new panel on the subject set up recently by the International Committee for Future Accelerators (ICFA). The other members are: Oscar Barbalat of CERN, Hans Christian Dehne of DESY, Sin-ichi Kurakawa of KEK, Gennady Kulipanov of the Budker Institute (Novosibirsk), Anthony Montgomery, formerly of the SSC, A. H. Walenta of Siegen, Germany, and Zhongqiang Yu of IHEP Beijing. High energy physics - the quest to find and understand the structure of matter - is mainly seen as an essential part of human culture. However this basic science increasingly has to jostle for funding attention with other branches of science. Applied sciences aim for a rapid transformation of investment cash into viable market products. In times of economic difficulties this is attractive to funding agencies and governments, and economic usefulness and technological relevance also become criteria for a basic science like high energy physics.

Adopting adequate leaching requirement for practical response models of basil to salinity

Science.gov (United States)

Babazadeh, Hossein; Tabrizi, Mahdi Sarai; Darvishi, Hossein Hassanpour

2016-07-01

Several mathematical models are being used for assessing plant response to salinity of the root zone. Objectives of this study included quantifying the yield salinity threshold value of basil plants to irrigation water salinity and investigating the possibilities of using irrigation water salinity instead of saturated extract salinity in the available mathematical models for estimating yield. To achieve the above objectives, an extensive greenhouse experiment was conducted with 13 irrigation water salinity levels, namely 1.175 dS m-1 (control treatment) and 1.8 to 10 dS m-1. The result indicated that, among these models, the modified discount model (one of the most famous root water uptake model which is based on statistics) produced more accurate results in simulating the basil yield reduction function using irrigation water salinities. Overall the statistical model of Steppuhn et al. on the modified discount model and the math-empirical model of van Genuchten and Hoffman provided the best results. In general, all of the statistical models produced very similar results and their results were better than math-empirical models. It was also concluded that if enough leaching was present, there was no significant difference between the soil salinity saturated extract models and the models using irrigation water salinity.

Assessing Group Dynamics in a Mars Simulation

Science.gov (United States)

Bishop, S. L.

2007-10-01

International interest in psychosocial functioning generally and issues of group and inter-group function for space crews has increased as focus has shifted towards longer duration spaceflight and, particularly, the issues involved in sending a human crew to Mars (Kanas, et al., 2001; Dawson, 2002). Planning documents for a human mission to Mars such as the NASA Design Reference Mission (DRM 1.0) emphasize the need for adaptability of crewmembers and autonomy in the crew as a whole (Hoffman and Kaplan, 1997). Similarly a major study by the International Space University (ISU, 1991) emphasized the need for autonomy and initiative for a Mars crew given that many of the scenarios that will be encountered on Mars cannot be rehearsed on earth and given the lack of any realistic possibility for rescue of the crew. This research project was only one subset of data collected during the larger AustroMars Expedition at the Mars Desert Research Facility (MDRS) in 2006. The participating crew comprises part of a multi-year investigation on teams utilizing the MDRS facility. The program of research has included numerous researchers since 2002 with a progressive evolution of key foci addressing stress, personality, coping, adaptation, cognitive functioning, and group identity assessed across the duration period of the individual missions.

Effect of compatibilization and reprocessing on the isothermal crystallization kinetics of polypropylene/wood flour composites

Directory of Open Access Journals (Sweden)

Arieny Rodrigues

2013-01-01

Full Text Available Numerous studies have focused on polymer mixtures aimed at the potential applications of these materials. This work analyzed the effect of polymer reprocessing and the type and concentration of compatibilizer on the isothermal crystallization kinetics of polypropylene/wood flour composites. The composites, which were polypropylene grafted with acrylic acid (PP-g-AA and maleic anhydride (PP-g-MA, were processed in a twin screw extruder with and without compatibilizer. Reprocessed polypropylene reached complete crystallization in less time than the composites with virgin polypropylene. The addition of wood flour to the composites did not change the kinetics significantly compared to that of the pure polymers, but the compatibilizers did, particularly PP-g-AA. The nucleation exponent (n and crystallization rate (K were calculated from Avrami plots. The values of n ranged from 2 to 3, indicating instantaneous to sporadic nucleation. The crystallization half-time of reprocessed polypropylene was shorter than that of virgin polypropylene and of the compositions containing PP-g-AA compatibilizer. The activation energy of crystallization and the equilibrium melting temperature were calculated, respectively, from Arrhenius and Hoffman-Weeks plots. Both of these parameters showed lower values in the composites, particularly in the ones containing compatibilizers.

Encapsulamiento de lodos de plantas de tratamiento de aguas residuales de la industria automotriz en matrices de arcilla

Directory of Open Access Journals (Sweden)

César Augusto García Ubaque

2013-10-01

Full Text Available This article presents results of a pilot study, where metals leaching from ceramic pieces were made with different mixes of slugde and clay from the sewage treatment plant G.M. COLMOTORES in Bogota (Colombia. The slugde have been stabilized and solidified in clays and cook in a Hoffman Furnace oven for the fabrication of bricks. The proportions of mixture of clay and sludge for the fabrication of bricks used were: 99:1, 95:5, 90:10, 80:20 and 60:40. Then, the bricks were burned at temperatures between 50 to 1,100 ° C. Moreover, clays, sludge and bricks were tested by: X ray diffraction (XRD, X-ray Fluorescence X (XRF, Thermogravimetry (TG, Differential Thermal Analysis (DTA, Atomic Absorption Spectroscopy (AA and Scanning Electron Microscopy (SEM. Finally, other leaching tests were performed in the bricks (Toxicity Characteristic Reaching Procedure - TCLP for the determination of heavy metals. Results from this study showed that the clay had a high affinity with the sludge and the bricks showed low levels of leaching. Also, it was considered that 95:5 of clay and sludge was the best mixing ratio for all the metals. The metal with lowest removal percentage was selenium and the highest removal percentages were arsenic, nickel, chrome, zinc and cadmium.

Perspective taking and empathic concern in adolescence: gender differences in developmental changes.

Science.gov (United States)

Van der Graaff, Jolien; Branje, Susan; De Wied, Minet; Hawk, Skyler; Van Lier, Pol; Meeus, Wim

2014-03-01

Empathy is an important social skill and is believed to play an essential role in moral development (Hoffman, 2000). In the present longitudinal study, the authors investigated adolescents' development of perspective taking and empathic concern from age 13 to 18 years (mean age at Wave 1 = 13 years, SD = 0.46) and examined its association with pubertal status. Adolescents (283 boys, 214 girls) reported for 6 consecutive years on their dispositional perspective taking and empathic concern and for 4 consecutive years on pubertal status. Latent growth curve modeling revealed gender differences in levels and developmental trends. Gender differences in perspective taking emerged during adolescence, with girls' increases being steeper than those of the boys. Girls also showed higher levels of empathic concern than did boys. Whereas girls' empathic concern remained stable across adolescence, boys showed a decrease from early to middle adolescence with a rebound to the initial level thereafter. Boys who were physically more mature also reported lower empathic concern than did their less physically developed peers. The current study supports theoretical notions that perspective taking develops during adolescence as a result of cognitive development. Moreover, the results suggest that pubertal maturation plays a role in boys' development of empathic concern. PsycINFO Database Record (c) 2014 APA, all rights reserved.

PIC simulations of the trapped electron filamentation instability in finite-width electron plasma waves

Science.gov (United States)

Winjum, B. J.; Banks, J. W.; Berger, R. L.; Cohen, B. I.; Chapman, T.; Hittinger, J. A. F.; Rozmus, W.; Strozzi, D. J.; Brunner, S.

2012-10-01

We present results on the kinetic filamentation of finite-width nonlinear electron plasma waves (EPW). Using 2D simulations with the PIC code BEPS, we excite a traveling EPW with a Gaussian transverse profile and a wavenumber k0λDe= 1/3. The transverse wavenumber spectrum broadens during transverse EPW localization for small width (but sufficiently large amplitude) waves, while the spectrum narrows to a dominant k as the initial EPW width increases to the plane-wave limit. For large EPW widths, filaments can grow and destroy the wave coherence before transverse localization destroys the wave; the filaments in turn evolve individually as self-focusing EPWs. Additionally, a transverse electric field develops that affects trapped electrons, and a beam-like distribution of untrapped electrons develops between filaments and on the sides of a localizing EPW. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344 and funded by the Laboratory Research and Development Program at LLNL under project tracking code 12-ERD-061. Supported also under Grants DE-FG52-09NA29552 and NSF-Phy-0904039. Simulations were performed on UCLA's Hoffman2 and NERSC's Hopper.

Thermodynamic behavior of poly(3-alkyl thiophene) blends: Equilibrium cocrystal formation and phase segregation.

Science.gov (United States)

Pal, Susmita; Nandi, Arun K

2005-02-24

The equilibrium cocrystal formation of poly(3-alkyl thiophene) (P3AT) blends has been studied by isothermal cocrystallization in a differential scanning calorimeter (DSC-7). The equilibrium melting points (T(m)0) of the cocrystals are measured using the Hoffman-Weeks extrapolation procedure. The equilibrium phase diagrams are of three different types: (a) concave upward, (b) linear, and (c) linear with phase separation at higher content of lower melting component. The phase diagram nature depends on the regioregularity difference and also on the difference in the number of carbon atoms in the pendent alkyl group of the components. The origin of biphasic nature of type "c" phase diagram has been explored from the glass transition temperature (Tg) measurement using a dynamic mechanical analyzer. The biphasic compositions show two glass transition temperatures (Tg) as well as two beta transition temperatures (T beta). The T(g)s of phase-separated regions correspond to almost the component values but the T(beta)s correspond to that of a lower (T beta) component value, and the other is higher than that of the higher (T beta) component value. Possible reasons are discussed from the interchain lamella thickness in the P3AT blends and molecular modeling using molecular mechanics program.

Poly(butylene terephthalate)/montmorillonite nanocomposites: Effect of montmorillonite on the morphology, crystalline structure, isothermal crystallization kinetics and mechanical properties

International Nuclear Information System (INIS)

Kalkar, Arun K.; Deshpande, Vineeta D.; Vatsaraj, Bhakti S.

2013-01-01

Graphical abstract: - Highlights: • Effect of amount of clay content, its dispersion on crystalline structure of PBT. • Regime break temperature shifts to lower temperature for PCN4 up to 197 °C. • Tensile modulus enhanced up to 95% for PCN3 compared to PBT. - Abstract: Nanocomposites (PCNs), based on poly(butylene terephthalte) (PBT) and organoclay (Cloisite-15A) MMT were prepared by melt intercalation compounding process. The nanoscale dispersion and the microcrystal structure studied qualitatively using; X-ray diffraction (XRD) and electron microscopy (SEM, TEM and AFM). The XRD results indicated that the crystal size is highly dependent on the crystallization temperature. The isothermal crystallization kinetics of PBT in PCNs analysis indicated that the overall crystallization of PBT involved heterogeneous nucleated three-dimensional spherical primary crystallization growth process. The crystallization rate, however, is dependent on the PCN-composition, crystallization temperature and the dispersion state of clay in PCNs. Further analysis, based on Hoffman-Lauritzen theory revealed that the neat PBT and PBT in PCNs crystallization follow regime-II kinetics for temperature 195 °C–205 °C and enters the regime-III kinetics in lower T c range, 185 °C–195 °C. The improvement in mechanical properties is highly dependent on the level of clay exfoliation in PBT matrix

Fatores prognósticos associados ao tratamento cirúrgico da mielorradiculopatia espondilótica cervical Factores pronósticos asociados con el tratamiento quirúrgico de la mielorradiculopatía cervical espondilótica Prognostic factors associated with surgical treatment of cervical spondylotic myeloradiculopathy

Directory of Open Access Journals (Sweden)

Alexandre Meluzzi

2012-01-01

Full Text Available OBJETIVO: Identificar os fatores clínicos dos indivíduos, fatores sociais, ambientais e dos exames de imagem que se correlacionam ao resultado final de melhora neurológica em pacientes submetidos ao tratamento cirúrgico da mielopatia espondilótica cervical. MÉTODOS: A avaliação clínica foi quantificada pela escala deficitária da JOA. Analisamos 200 casos de mielorradiculopatia cervical, operados no HC-FMUSP, no período de janeiro de 1993 a janeiro de 2007. A média de segmento foi de 06 anos e 08 meses. A análise radiológica foi baseada nos critérios de instabilidade de White e scala de Kellgren. RESULTADOS: Em 80% houve melhora, 14% estabilização e em 6% piora do quadro neurológico. A piora neurológica não foi associada com nenhum fator clínico, ambiental ou de imagem. A melhora neurológica foi diretamente proporcional a menor idade na cirurgia, ausência de co-morbidade, sinal de Hoffman, atrofia muscular, hipersinal medular na RNM, menor período de evolução pré-operatório, melhor status neurológico pré-operatório e inversamente proporcional ao diâmetro AP do canal medular e multiplicidade de compressões. Identificou-se associação com o tabagismo. Mais de 70 anos, evolução superior a 24 meses, atrofia muscular, pontuação JOA igual ou inferior a sete pontos e diâmetro AP do canal inferior ou igual a seis mm não foram associado à melhora.OBJETIVO: Identificar los factores clínicos de los pacientes, factores sociales, ambientales y de exámenes de imagen que se correlacionan con el resultado final de mejoría neurológica en pacientes sometidos a tratamiento quirúrgico de la mielopatía cervical espondilótica. MÉTODOS: La evaluación clínica fue cuantificada por la escala de JOA. Se analizaron 200 casos de mielorradiculopatía cervical, operados en el HC-FMUSP, desde enero de 1993 a enero de 2007. El promedio del segmento fue de 06 años y 08 meses. El análisis radiológico se basó en los criterios

A Look Inside Hurricane Alma

Science.gov (United States)

2002-01-01

Hurricane season in the eastern Pacific started off with a whimper late last month as Alma, a Category 2 hurricane, slowly made its way up the coast of Baja California, packing sustained winds of 110 miles per hour and gusts of 135 miles per hour. The above image of the hurricane was acquired on May 29, 2002, and displays the rainfall rates occurring within the storm. Click the image above to see an animated data visualization (3.8 MB) of the interior of Hurricane Alma. The images of the clouds seen at the beginning of the movie were retrieved from the National Oceanic and Atmospheric Association's (NOAA's) Geostationary Orbiting Environmental Satellite (GOES) network. As the movie continues, the clouds are peeled away to reveal an image of rainfall levels in the hurricane. The rainfall data were obtained by the Precipitation Radar aboard NASA's Tropical Rainfall Measuring Mission (TRMM) satellite. The Precipitation Radar bounces radio waves off of clouds to retrieve a reading of the number of large, rain-sized droplets within the clouds. Using these data, scientists can tell how much precipitation is occurring within and beneath a hurricane. In the movie, yellow denotes areas where 0.5 inches of rain is falling per hour, green denotes 1 inch per hour, and red denotes over 2 inches per hour. (Please note that high resolution still images of Hurricane Alma are available in the NASA Visible Earth in TIFF format.) Image and animation courtesy Lori Perkins, NASA Goddard Space Flight Center Scientific Visualization Studio

Multi-label classifier based on histogram of gradients for predicting the anatomical therapeutic chemical class/classes of a given compound.

Science.gov (United States)

Nanni, Loris; Brahnam, Sheryl

2017-09-15

Given an unknown compound, is it possible to predict its Anatomical Therapeutic Chemical class/classes? This is a challenging yet important problem since such a prediction could be used to deduce not only a compound's possible active ingredients but also its therapeutic, pharmacological and chemical properties, thereby substantially expediting the pace of drug development. The problem is challenging because some drugs and compounds belong to two or more ATC classes, making machine learning extremely difficult. In this article a multi-label classifier system is proposed that incorporates information about a compound's chemical-chemical interaction and its structural and fingerprint similarities to other compounds belonging to the different ATC classes. The proposed system reshapes a 1D feature vector to obtain a 2D matrix representation of the compound. This matrix is then described by a histogram of gradients that is fed into a Multi-Label Learning with Label-Specific Features classifier. Rigorous cross-validations demonstrate the superior prediction quality of this method compared with other state-of-the-art approaches developed for this problem, a superiority that is reflected particularly in the absolute true rate, the most important and harshest metric for assessing multi-label systems. The MATLAB code for replicating the experiments presented in this article is available at https://www.dropbox.com/s/7v1mey48tl9bfgz/ToolPaperATC.rar?dl=0 . loris.nanni@unipd.it. Supplementary data are available at Bioinformatics online. © The Author (2017). Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com

The Effects of Long Duration Head Down Tilt Bed Rest on Neurocognitive Performance: The Effects of Exercise Interventions

Science.gov (United States)

Seidler, R. D.; Mulavara, A. P.; Koppelmans, V.; Erdeniz. B.; Kofman, I. S.; DeDios, Y. E.; Szecsy, D. L.; Riascos-Castaneda, R. F.; Wood, S. J.; Bloomberg, J. J.

2014-01-01

We are conducting ongoing experiments in which we are performing structural and functional magnetic resonance brain imaging to identify the relationships between changes in neurocognitive function and neural structural alterations following a six month International Space Station mission and following 70 days exposure to a spaceflight analog, head down tilt bedrest. Our central hypothesis is that measures of brain structure, function, and network integrity will change from pre to post intervention (spaceflight, bedrest). Moreover, we predict that these changes will correlate with indices of cognitive, sensory, and motor function in a neuroanatomically selective fashion. Our interdisciplinary approach utilizes cutting edge neuroimaging techniques and a broad ranging battery of sensory, motor, and cognitive assessments that will be conducted pre flight, during flight, and post flight to investigate potential neuroplastic and maladaptive brain changes in crewmembers following long-duration spaceflight. Success in this endeavor would 1) result in identification of the underlying neural mechanisms and operational risks of spaceflight-induced changes in behavior, and 2) identify whether a return to normative behavioral function following re-adaptation to Earth's gravitational environment is associated with a restitution of brain structure and function or instead is supported by substitution with compensatory brain processes. Our ongoing bed rest participants are also engaging in exercise studies directed by Dr. Lori Ploutz Snyder. In this presentation, I will briefly highlight the existing literature linking exercise and fitness to brain and behavioral functions. I will also overview the metrics from my study that could be investigated in relation to the exercise and control subgroups.

Impact of point-of-care ultrasound on quality of care in clinical practice

Directory of Open Access Journals (Sweden)

Adhikari S

2014-09-01

Full Text Available Srikar Adhikari,1 Richard Amini,1 Lori A Stolz,1 Michael Blaivas2 1Department of Emergency Medicine, University of Arizona Medical Center, Tucson, AZ, 2Department of Internal Medicine, University of South Carolina School of Medicine, Columbia, SC, USA Abstract: The use of point-of-care (POC ultrasonography has rapidly expanded in recent years, in both academic and community settings. It is one of the few diagnostic modalities that can be performed rapidly at the bedside by a physician and has significant impact on patient outcomes. It is portable, readily accessible, and cost-effective, and has no risk of ionizing radiation. There is an abundance of evidence that supports the use of POC ultrasound by physicians in different subspecialties. Multiple studies have documented the diagnostic accuracy of POC ultrasound and its ability to decrease the time to definitive treatment. As ultrasound technology has advanced, POC ultrasound applications have also evolved from being used solely in patients with blunt abdominal trauma to applications for nearly every clinical scenario imaginable. From performing procedures more safely to diagnosing pathology more quickly, POC ultrasound is radically changing clinical practice, patient outcomes, and the overall quality of patient care a clinician can provide. Recently, there has been a paradigm shift involving a symptom-based approach to POC ultrasound. This unique symptom-based ultrasound approach has led to improved quality of care in a variety of clinical settings. Keywords: point-of-care ultrasound, ultrasonography, bedside ultrasound, emergency physician, emergency department, quality, symptom-based

Computational modeling and experimental studies on NO{sub x} reduction under pulverized coal combustion conditions. Third quarterly technical progress report, July 1, 1995--September 30, 1995

Energy Technology Data Exchange (ETDEWEB)

Kumpaty, S.K.; Subramanian, K.

1995-12-31

An experimental plan outlining the first year`s activity was sent to Dr. Lori Gould, Project Officer/Contracting Officer`s Technical Representative on April 24, 1995. An approval was received with some questions on June 15, 1995. However, with some foresight of the director of the in-house combustion group of the PETC, Dr. Ekmann, a tentative hold-off on the purchase of the equipment was requested by the project officer on June 29, 1995. Enclosed with that request were some of Dr. Ekmann`s concerns. The research team spent the month of July in study of pertinent literature as well as in the preparation of the responses to Dr. Gould`s comments and Dr. Ekmann`s concerns. These responses included the choice of the reactor, reactor design, rate of gas heating, detailed test matrix and answers to host of other comments. Upon review of the above information submitted on July 24, 1995 by the Rust research team, the project officer called for a conference call on September 6, 1995 which involved the PI (Dr. Kumpaty), the research consultant (Mr. Subramanian), Dr. Gould and Dr. Ekmann. Dr. Ekmann insisted that further calculations be made on the rate of gas heating without taking radiation into account. Accordingly, calculations pertaining to the rate of gas heating based on convection were performed and submitted to Dr. Ekmann on September 13, 1995. This report contains the information emerged through the dialogue between the Rust College research team and the PETC represented by Dr. Gould and Dr. Ekmann during this quarter.

Ocorrência de enteroparasitas na população geronte de Nova Olinda do Norte Amazonas, Brasil Occurrence of enteroparasites in the elderly population of Nova Olinda do Norte, Amazonas, Brazil

Directory of Open Access Journals (Sweden)

Ana Felisa Hurtado-Guerrero

2005-12-01

Full Text Available Foi realizado um estudo para avaliar a prevalência de enteroparasitas em um grupo de idosos ribeirinhos, moradores do Município de Nova Olinda do Norte, Estado do Amazonas Brasil, no período de abril e agosto de 1999. Por meio de um estudo de corte transversal foram analisados 81 exames, através do método de Sedimentação Espontânea (Método de Hoffman et al., 1934. Foi constatada positividade em 72,8% dos idosos, predominando o monoparasitismo (43,2%. Os helmintos foram os mais freqüentes (70,4%, destacando-se: Ascaris lumbricoides (35,2%, Trichuris trichiura (16,0%, Ancylostoma duodenale (9,0% e Strongyloides stercoralis (9,0%. Dentre os protozoários (29,5%, a ocorrência de Entamoeba coli foi de 18,2%, Giárdia lamblia de 7,0% e Entamoeba histolytica 4,5%. Não houve associação estatisticamente significativa entre sexo e grau de parasitismo e entre faixas etárias e condição parasitária. Estes resultados evidenciam um quadro de alta prevalência de parasitas intestinais nesta população e discordam dos reportados por outros pesquisadores quando afirmam que a intensidade da infestação por parasitas diminui na idade avançada. Os achados anteriores exigem das autoridades governamentais medidas de controle e educação para melhorar a qualidade de vida desses idosos, considerando a grave repercussão que esses parasitas tem no estado nutricional dos gerontes de baixa renda.A study was carried out to determine the prevalence of enteroparasites attacking elderly people living in a riverside city of the Municipal district of Nova Olinda do Norte, Amazonas State Brazil. In this cross sectional study were examined the faecal material from 81 elderly people using the method of spontaneous sedimentation (Hoffman et al., 1934. It was found a positiveness in 72,8% of the elderly people examined, predominating the mono parasitism (43,2%. The helminths were more frequents (70,3%: Ascaris lumbricoides (35,2%, Trichuris trichiura (16

Comparative Study of the Accuracy of Different Techniques for the Laboratory Diagnosis of Schistosomiasis Mansoni in Areas of Low Endemicity in Barra Mansa City, Rio de Janeiro State, Brazil

Directory of Open Access Journals (Sweden)

Maria Cristina Carvalho Espírito-Santo

2015-01-01

Full Text Available Schistosomiasis constitutes a major public health problem, with an estimated 200 million people infected worldwide. Many areas of Brazil show low endemicity of schistosomiasis, and the current standard parasitological techniques are not sufficiently sensitive to detect the low-level helminth infections common in areas of low endemicity (ALEs. This study compared the Kato-Katz (KK; Hoffman, Pons, and Janer (HH; enzyme-linked immunosorbent assay- (ELISA- IgG and ELISA-IgM; indirect immunofluorescence technique (IFT-IgM; and qPCR techniques for schistosomiasis detection in serum and fecal samples, using the circumoval precipitin test (COPT as reference. An epidemiological survey was conducted in a randomized sample of residents from five neighborhoods of Barra Mansa, RJ, with 610 fecal and 612 serum samples. ELISA-IgM (21.4% showed the highest positivity and HH and KK techniques were the least sensitive (0.8%. All techniques except qPCR-serum showed high accuracy (82–95.5%, differed significantly from COPT in positivity P<0.05, and showed poor agreement with COPT. Medium agreement was seen with ELISA-IgG (Kappa = 0.377 and IFA (Kappa = 0.347. Parasitological techniques showed much lower positivity rates than those by other techniques. We suggest the possibility of using a combination of laboratory tools for the diagnosis of schistosomiasis in ALEs.

Tunable nano-wrinkling of chiral surfaces: Structure and diffraction optics

International Nuclear Information System (INIS)

Rofouie, P.; Rey, A. D.; Pasini, D.

2015-01-01

Periodic surface nano-wrinkling is found throughout biological liquid crystalline materials, such as collagen films, spider silk gland ducts, exoskeleton of beetles, and flower petals. These surface ultrastructures are responsible for structural colors observed in some beetles and plants that can dynamically respond to external conditions, such as humidity and temperature. In this paper, the formation of the surface undulations is investigated through the interaction of anisotropic interfacial tension, swelling through hydration, and capillarity at free surfaces. Focusing on the cellulosic cholesteric liquid crystal (CCLC) material model, the generalized shape equation for anisotropic interfaces using the Cahn-Hoffman capillarity vector and the Rapini-Papoular anchoring energy are applied to analyze periodic nano-wrinkling in plant-based plywood free surfaces with water-induced cholesteric pitch gradients. Scaling is used to derive the explicit relations between the undulations’ amplitude expressed as a function of the anchoring strength and the spatially varying pitch. The optical responses of the periodic nano-structured surfaces are studied through finite difference time domain simulations indicating that CCLC surfaces with spatially varying pitch reflect light in a wavelength higher than that of a CCLC’s surface with constant pitch. This structural color change is controlled by the pitch gradient through hydration. All these findings provide a foundation to understand structural color phenomena in nature and for the design of optical sensor devices

A Retrospective, Longitudinal, Claims-Based Comparison of Concomitant Diagnoses Between Individuals with and Without Down Syndrome.

Science.gov (United States)

Kong, Amanda M; Hurley, Dana; Evans, Kristin A; Brixner, Diana; Csoboth, Csilla; Visootsak, Jeannie

2017-07-01

Individuals with Down syndrome (DS) experience various comorbidities in excess of the prevalence seen among the non-DS population. However, the extent of the excess burden of comorbidities specifically within commercially and publicly insured DS populations aged Company, receives payment from Genentech to conduct research, including the research for this study. Truven Health Analytics also receives payment from other pharmaceutical companies to conduct research. Kong and Evans are employed by Truven Health Analytics. Csoboth is employed by Genentech. Brixner reports fees paid to the University of Utah by Truven Health Analytics on her behalf for work related to this study. Hurley reports fees from Genentech for work on this study and for work outside of this study. At the time of this study, Visootsak was employed by F. Hoffman-LaRoche Pharmaceuticals, parent company of Genentech. All authors, including those affiliated with the study sponsor, were involved in the design of the study, interpretation of the data, writing of the manuscript, and the decision to submit the manuscript for publication. Study concept and design were contributed by Kong, Hurley, and Brixner, along with Evans. Kong and Evans collected the data, and data interpretation was performed by Csoboth, Visootsak, Brixner, and Hurley, with assistance from Kong. The manuscript was written by Evans, Kong, Hurley, and Brixner and revised by Kong, Hurley, Evans, and Brixner, with assistance from Csoboth and Visootsak.

Tomographic and Geodynamic Constraints on Convection-Induced Mixing in Earth's Deep Mantle

Science.gov (United States)

Hafter, D. P.; Forte, A. M.; Bremner, P. M.; Glisovic, P.

2017-12-01

Seismological studies reveal two large low-shear-velocity provinces (LLSVPs) in the lowermost mantle (e.g., Su et al. 1994; Wang & Wen 2007; He & Wen 2012), which may represent accumulations of subducted slabs at the CMB (Tan & Gurnis 2005; Christensen & Hoffman 1994) or primordial material generated in the early differentiation of Earth (e.g. Li et al. 2014). The longevity or stability of these large-scale heterogeneities in the deep mantle depends on the vigor and spatial distribution of the convective circulation, which is in turn dependent on the distribution of mantle buoyancy and viscosity (e.g. Glisovic & Forte 2015). Here we explore the state of convective mixing in the mantle using the ASPECT convection code (Kronbichler et al. 2012). A series of experiments are conducted to consider the geochemical and dynamical contributions of LLSVPs to deep-mantle upwellings and corresponding plume-sourced volcanism. The principal feature of these experiments is the use of particle tracers to track geochemical changes in the LLSVPs and mantle plumes in addition to identifying those parts of the mantle that may remain unmixed. We employ 3-D mantle density anomalies derived from joint inversions of seismic, geodynamic and mineral physics constraints and geodynamically-constrained viscosity distributions (Glisovic et al. 2015) to ensure that the predicted flow fields yield a good match to key geophysical constraints (e.g. heat flow, global gravity anomalies and plate velocities).

Paleointensity determinations during the Akaroa polarity reversal, New Zealand: New input from the multispecimen parallel differential pTRM method

Science.gov (United States)

Camps, P.; Fanjat, G.; Poidras, T.; Hoffman, K. A.; Carvallo, C.; kennedy, B.

2011-12-01

We resampled two polarity reversals of late Miocene age (~ 9 Ma) recorded successively in the Akaroa volcano (Hoffman, 1986, Nature). Our main objective was to check old paleointensity determinations (Sherwood & Shaw, 1986, J. Geomag. Geoelec.) that yielded stronger values during the transitional period than during stable periods that preceded and followed the reversals. This observation is opposite to what is generally observed. An increase in intensity during the reversal would provide an extreme example of increasing secular variation. However, the experimental method used for determining the paleointensity, method of Shaw, is strongly questioned by the scientific community. A check of these data by the conventional Thellier method was required. Unfortunately, among the 72 sampled flows, only 4 yielded rock magnetic properties well suited for Thellier determinations. In most of the flows, the presence of large Multi-Domain grains of Ti-magnetite, which are frequently associated with Ti-maghemite, precludes any Thellier paleointensity determinations. We implement the domain-state independent paleointensity method (the multispecimen parallel differential pTRM, Dekkers & Bohnel, 2006, EPSL; Fabian & Leonhardt, 2010, EPSL) for 16 lava flows in which the MD Ti-magnetite are not oxidized. Thellier paleointensities obtained do not confirm the Sherwood results but show more scattered values of the intensity even during the stable periods of the field. To complete the data, multispecimen mesearements are being to be done.

A Modified Differential Coherent Bit Synchronization Algorithm for BeiDou Weak Signals with Large Frequency Deviation.

Science.gov (United States)

Han, Zhifeng; Liu, Jianye; Li, Rongbing; Zeng, Qinghua; Wang, Yi

2017-07-04

BeiDou system navigation messages are modulated with a secondary NH (Neumann-Hoffman) code of 1 kbps, where frequent bit transitions limit the coherent integration time to 1 millisecond. Therefore, a bit synchronization algorithm is necessary to obtain bit edges and NH code phases. In order to realize bit synchronization for BeiDou weak signals with large frequency deviation, a bit synchronization algorithm based on differential coherent and maximum likelihood is proposed. Firstly, a differential coherent approach is used to remove the effect of frequency deviation, and the differential delay time is set to be a multiple of bit cycle to remove the influence of NH code. Secondly, the maximum likelihood function detection is used to improve the detection probability of weak signals. Finally, Monte Carlo simulations are conducted to analyze the detection performance of the proposed algorithm compared with a traditional algorithm under the CN0s of 20~40 dB-Hz and different frequency deviations. The results show that the proposed algorithm outperforms the traditional method with a frequency deviation of 50 Hz. This algorithm can remove the effect of BeiDou NH code effectively and weaken the influence of frequency deviation. To confirm the feasibility of the proposed algorithm, real data tests are conducted. The proposed algorithm is suitable for BeiDou weak signal bit synchronization with large frequency deviation.

The ADVANCE project: Formal evaluation of the targeted deployment. Volume 3

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-01-01

ADVANCE [Advanced Driver and Vehicle Advisory Navigation ConcEpt] was a public/private partnership conceived and developed by four founding parties. The founding parties include the Federal Highway Administration (FHWA), the Illinois Department of Transportation (IDOT), the University of Illinois at Chicago and Northwestern University operating together under the auspices of the Illinois Universities Transportation Research Consortium (IUTRC), and Motorola, Inc. The major responsibilities of each party are fully described in the Project agreement. Subsequently, these four were joined on the Steering Committee by the American Automobile Association (AAA). This unique blending of public sector, private sector and university interests, augmented by more than two dozen other private sector participants, provided a strong set of resources for ADVANCE. The ADVANCE test area covered over 300 square miles including portions of the City of Chicago and 40 northwest suburban communities. The Project encompasses the high growth areas adjacent to O`Hare International Airport, the Schaumbura/Hoffman Estates office and retail complexes, and the Lake-Cook Road development corridor. It also includes major sports and entertainment complexes such as the Arlington International Racecourse and the Rosemont Horizon. The population in the area is more than 750,000. This volume provides a summary of the insights and achievements made as a result of this field test, and selected appendices containing more detailed information.

Iterative concurrent reconstruction algorithms for emission computed tomography

International Nuclear Information System (INIS)

Brown, J.K.; Hasegawa, B.H.; Lang, T.F.

1994-01-01

Direct reconstruction techniques, such as those based on filtered backprojection, are typically used for emission computed tomography (ECT), even though it has been argued that iterative reconstruction methods may produce better clinical images. The major disadvantage of iterative reconstruction algorithms, and a significant reason for their lack of clinical acceptance, is their computational burden. We outline a new class of ''concurrent'' iterative reconstruction techniques for ECT in which the reconstruction process is reorganized such that a significant fraction of the computational processing occurs concurrently with the acquisition of ECT projection data. These new algorithms use the 10-30 min required for acquisition of a typical SPECT scan to iteratively process the available projection data, significantly reducing the requirements for post-acquisition processing. These algorithms are tested on SPECT projection data from a Hoffman brain phantom acquired with a 2 x 10 5 counts in 64 views each having 64 projections. The SPECT images are reconstructed as 64 x 64 tomograms, starting with six angular views. Other angular views are added to the reconstruction process sequentially, in a manner that reflects their availability for a typical acquisition protocol. The results suggest that if T s of concurrent processing are used, the reconstruction processing time required after completion of the data acquisition can be reduced by at least 1/3 T s. (Author)

Feminist music therapy pedagogy: a survey of music therapy educators.

Science.gov (United States)

Hahna, Nicole D; Schwantes, Melody

2011-01-01

This study surveyed 188 music therapy educators regarding their views and use of feminist pedagogy and feminist music therapy. The purpose of this study was two-fold: (a) to determine how many music therapy educators used feminist pedagogy and (b) to determine if there was a relationship between the use of feminist pedagogy and academic rank of the participants. Seventy-two participants responded to this study, with 69 participants included for data analysis. Stake and Hoffman's (2000) feminist pedagogy survey was adapted for this study, examining four subscales of feminist pedagogy: (a) participatory learning, (b) validation of personal experience/development of confidence, (c) political/ social activism, and (d) critical thinking/open-mindedness. The results revealed that 46% (n=32) of participants identified as feminist music therapists and 67% (n=46) of participants identified as using feminist pedagogy. Results of a mixed analysis of variance revealed a statistically significant difference within the four survey subscales (p<.0001), no significant difference (p=.32) for academic rank, and no significant interaction (p=.08) of academic rank and the four survey subscales. Tukey's post hoc analysis of the data indicated that the survey subscale measuring political activism (p<.0001) was significantly lower than the other three survey subscales. In addition, a qualitative analysis on open-ended responses is also included. Discussion of the results, limitations, and areas for future research are addressed.

Protocol: An updated integrated methodology for analysis of metabolites and enzyme activities of ethylene biosynthesis

Directory of Open Access Journals (Sweden)

Geeraerd Annemie H

2011-06-01

Full Text Available Abstract Background The foundations for ethylene research were laid many years ago by researchers such as Lizada, Yang and Hoffman. Nowadays, most of the methods developed by them are still being used. Technological developments since then have led to small but significant improvements, contributing to a more efficient workflow. Despite this, many of these improvements have never been properly documented. Results This article provides an updated, integrated set of protocols suitable for the assembly of a complete picture of ethylene biosynthesis, including the measurement of ethylene itself. The original protocols for the metabolites 1-aminocyclopropane-1-carboxylic acid and 1-(malonylaminocyclopropane-1-carboxylic acid have been updated and downscaled, while protocols to determine in vitro activities of the key enzymes 1-aminocyclopropane-1-carboxylate synthase and 1-aminocyclopropane-1-carboxylate oxidase have been optimised for efficiency, repeatability and accuracy. All the protocols described were optimised for apple fruit, but have been proven to be suitable for the analysis of tomato fruit as well. Conclusions This work collates an integrated set of detailed protocols for the measurement of components of the ethylene biosynthetic pathway, starting from well-established methods. These protocols have been optimised for smaller sample volumes, increased efficiency, repeatability and accuracy. The detailed protocol allows other scientists to rapidly implement these methods in their own laboratories in a consistent and efficient way.

THE EGG – FUNCTIONAL FOOD.COMPARATIVE STUDY ON VARIOUS NUTRITIONAL SOLUTIONS TO ENRICH THE EGG POLYUNSATURATED FATTY ACIDS. II YOLK FATTY ACIDS PROFILE RESULTING FROM THE DIETARY USE OF SAFFLOWER OIL AND FLAX SEEDS

Directory of Open Access Journals (Sweden)

CRISTE RODICA. D.

2007-05-01

Full Text Available The paper presents the results obtained in a study on the comparative evaluation of the effect of a diet with safflower oil and flax seeds compared to a control soybean oil diet given to layers on the bioproductive effects, egg characteristics and yolk fatty acids profile. The trial involved 32 Lowman Brown layers during the age period 23- 28 weeks (1 week of accommodation and 4 experimental weeks. The layers, assigned to 2 groups (16 layers/group, 4 layers/cage received diets based on corn, wheat and soybean meal. The diets differed by the source of fatty acids: soybean oil for the control group (SO; safflower oil and flax seeds for SSO+FS. The diets were supplemented with 250 ppm vitamin E. Twelve eggs per group were collected randomly 10 and 30 days, respectively, after the beginning of the experiment. The paper presents comparative data on the: average egg weight, egg component (egg shell, yolk, egg white weight, intensity of yolk colour (Hoffman – La Roche colour range, yolk protein, fat yolk pH (measured one week after collection, the eggs being kept at 50C and yolk fatty acids. All data show that the profile of yolk unsaturated fatty acids can be handled quite easily by the nature of the dietary fats, their level of inclusion and their dietary ratio.

Tunable nano-wrinkling of chiral surfaces: Structure and diffraction optics

Energy Technology Data Exchange (ETDEWEB)

Rofouie, P.; Rey, A. D., E-mail: alejandro.rey@mail.mcgill.ca [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec H3A 2B2 (Canada); Pasini, D. [Department of Mechanical Engineering, McGill University, 817 Sherbrook West, Montreal, Quebec H3A 0C3 (Canada)

2015-09-21

Periodic surface nano-wrinkling is found throughout biological liquid crystalline materials, such as collagen films, spider silk gland ducts, exoskeleton of beetles, and flower petals. These surface ultrastructures are responsible for structural colors observed in some beetles and plants that can dynamically respond to external conditions, such as humidity and temperature. In this paper, the formation of the surface undulations is investigated through the interaction of anisotropic interfacial tension, swelling through hydration, and capillarity at free surfaces. Focusing on the cellulosic cholesteric liquid crystal (CCLC) material model, the generalized shape equation for anisotropic interfaces using the Cahn-Hoffman capillarity vector and the Rapini-Papoular anchoring energy are applied to analyze periodic nano-wrinkling in plant-based plywood free surfaces with water-induced cholesteric pitch gradients. Scaling is used to derive the explicit relations between the undulations’ amplitude expressed as a function of the anchoring strength and the spatially varying pitch. The optical responses of the periodic nano-structured surfaces are studied through finite difference time domain simulations indicating that CCLC surfaces with spatially varying pitch reflect light in a wavelength higher than that of a CCLC’s surface with constant pitch. This structural color change is controlled by the pitch gradient through hydration. All these findings provide a foundation to understand structural color phenomena in nature and for the design of optical sensor devices.

Examination of statistical noise in SPECT image and sampling pitch

International Nuclear Information System (INIS)

Takaki, Akihiro; Soma, Tsutomu; Murase, Kenya; Watanabe, Hiroyuki; Murakami, Tomonori; Kawakami, Kazunori; Teraoka, Satomi; Kojima, Akihiro; Matsumoto, Masanori

2008-01-01

Statistical noise in single photon emission computed tomography (SPECT) image was examined for its relation with total count and with sampling pitch by simulation and phantom experiment to obtain their projection data under defined conditions. The former SPECT simulation was performed on assumption of a virtual, homogeneous water column (20 cm diameter) as an absorbing mass. In the latter, used were 3D-Hoffman brain phantom (Data Spectrum Corp.) filled with 370 MBq of 99m Tc-pertechnetate solution and a facing 2-detector SPECT machine with a low-energy/high-resolution collimator, E-CAM (Siemens). Projected data by the two methods were reconstructed through the filtered back projection to make each transaxial image. The noise was evaluated by vision, by their root mean square uncertainty calculated from average count and standard deviation (SD) in the region of interest (ROI) defined in reconstructed images and by normalized mean squares calculated from the difference between the reference image obtained with common sampling pitch to and all of obtained slices of, the simulation and phantom. As a conclusion, the pitch was recommended to be set in the machine as to approximating the value calculated by the sampling theorem, though the projection counts per one angular direction were smaller with the same total time of data acquisition. (R.T.)

Ocorrência de Taenia sp. na população atendida no laboratório central do Instituto Adolfo Lutz, São Paulo, SP, Brasil (1960/1989 Occurrence of Taenia sp. in the population attended in the central laboratory of "Instituto Adolfo Lutz", São Paulo, SP, Brazil (1960/1989

Directory of Open Access Journals (Sweden)

Rosa Maria Donini Souza Dias

1991-04-01

Full Text Available Foram examinados retrospectivamente os relatórios mensais e anuais da Seção de Enteroparasitoses do Laboratório Central do Instituto Adolfo Lutz, São Paulo, SP, do período de 1960 a 1989, perfazendo uma série histórica de 30 anos, com 1.519.730 exames protoparasitológicos e 355 identificações de proglotes de Taenia. Pelo método da sedimentação espontânea foram diagnosticados 7.663 (0,5% casos de presença de ovos de Taenia sp. nas fezes. Das 355 proglotes enviadas para identificação, 311 (87,60% estavam em condições de serem especificadas, e dessas, 273 (87,80% eram proglotes de Taenia saginata e 38 (12,22% de T. solium.Monthly and yearly reports of the Seção de Enteroparasitoses of the Instituto Adolfo Lutz (São Paulo, SP, Brazil from 1960 to 1989 with 1,519,730 parasitological stool examinations were studied. There were also 355 identifications of Taenia sp. proglottids. Using HOFFMAN, PONS & JANER's method, 7,663 (0.5% cases of taeniasis were diagnosed, and 311 (87.60% of the 355 proglottids were on easy terms to be specified, 273 (87.80% of them were from Taenia saginata.

BrainBrowser: distributed, web-based neurological data visualization

Directory of Open Access Journals (Sweden)

Tarek eSherif

2015-01-01

Full Text Available Recent years have seen massive, distributed datasets become the norm in neuroimaging research, and the methodologies used analyze them have, in response, become more collaborative and exploratory. Tools and infrastructure are continuously being developed and deployed to facilitate research in this context: grid computation platforms to process the data, distributed data stores to house and share them, high-speed networks to move them around and collaborative, often web-based, platforms to provide access to and sometimes manage the entire system. BrainBrowser is a lightweight, high-performance JavaScript visualization library built to provide easy-to-use, powerful, on-demand visualization of remote datasets in this new research environment. BrainBrowser leverages modern Web technologies, such as WebGL, HTML5 and Web Workers, to visualize 3D surface and volumetric neuroimaging data in any modern web browser without requiring any browser plugins. It is thus trivial to integrate BrainBrowser into any web-based platform. BrainBrowser is simple enough to produce a basic web-based visualization in a few lines of code, while at the same time being robust enough to create full-featured visualization applications. BrainBrowser can dynamically load the data required for a given visualization, so no network bandwidth needs to be waisted on data that will not be used. BrainBrowser's integration into the standardized web platform also allows users to consider using 3D data visualization in novel ways, such as for data distribution, data sharing and dynamic online publications. BrainBrowser is already being used in two major online platforms, CBRAIN and LORIS, and has been used to make the 1TB MACACC dataset openly accessible.

Knowledge and critical thinking skills increase clinical reasoning ability in urogenital disorders: a Universitas Sriwijaya Medical Faculty experience

Directory of Open Access Journals (Sweden)

Irfannuddin Irfannuddin

2009-03-01

Full Text Available Aim Clinical reasoning is one of the essential competencies for medical practitioners, so that it must be exercised by medical students. Studies on quantitative evidence of factors influencing clinical reasoning abilicy of students are limited. The aim of this study was to determine the influence of knowledge and other factors on the clinical reasoning abiliry ofthe students, which can serve as reference to establish methods for learning ctinical reasoning.Methods This is a cross-sectional study on fourth semester students enrolled in the Competency-based Curriculum of the Medical Faculty, University of Sriwijaya. Data on clinical reasoning abilily and risk factors during urogenital blockwere collected inApril 2008, when the students have just completed the btock. Clinical reasoning abiliry was tested using the Script Concordance test and the risk factors were evaluated based on formative tests, block summative assessments, and student characteristics. Data were analyzed by Cox regression.Results The prevalence of low clinical reasoning ability of the 132 students was 38.6%. The group with low basic knowledge was found to have 63% risk ol low clinical reasoning abiliry when compared to those with high basic knowledge (adjusted RR = 1.63; 95% conidence intewal (Ct: 1.10 -2.42. When compared to students with high critical thinking skitls, those with lory critical thinking skills had 2.3 time to be low clinical reasoning abitity (adjusted RR : 2.30; 95% CI: 1.55 - 3.41.Conclusion Students with low critical thinking skills or with inadequate knowledge had a higher risk of low clinical reasoning ability. (Med J Indones 2009; 18: 53-9Keywords: clinical reasoning, basic knowledge, critical thinking, competency-based curriculum

Comparative studies on radiation induced chromosome aberrations in the peripheral blood lymphocytes in primates

International Nuclear Information System (INIS)

Tobari, Izuo; Hirai, Momoki; Takahashi, Eiichi; Nakai, Sayaka; Utugi, Toyoko

1978-01-01

In order to obtain the information regarding interspesific extrapolation of the production of chromosome aberrations, we have examined species difference in the yields of dicentrics induced by the acute or chronic irradiations of gamma-rays. After acute irradiation, there were no significant differences in the yields among four primate species, man, crab-eating monkey, squirrel monkey and slow loris, in spite of the difference in chromosome arm number. On the other hand, after chronic irradiation, a significant difference in the yields was observed between man and crab-eating monkey. Comparing the α and β values estimated by fitting the observed yields with linear-quadratic equation, the value of β was clearly different between acute and chronic irradiations for both man and monkey. Furthermore, at low dose rate the value of β for monkey was almost negligible, while it was somewhat measurable one for man. To clarify the mechanism(s) involved in the species difference in the yields of dicentrics induced by chronic irradiation, post-irradiation incubation experiment was carried out. The considerable reductions of both the yields of dicentrics and mitotic indices during post-irradiation incubation periods under unstimulated conditions may probably indicate that cells with dicentrics are partly eliminated in the course of chronic irradiation for both man and monkey. However, the elimination mechanism is not sufficient to explain the reduction of dicentric yields after chronic irradiation. Consequently, Go repair mechanism(s) may presumably be responsible for the dose-rate effects, and the different amount of reduction of dicentric yields between man and monkey may reflect the different ability of Go repair between them. (author)

Butterfly species richness and diversity in the Trishna Wildlife Sanctuary in South Asia.

Science.gov (United States)

Majumder, Joydeb; Lodh, Rahul; Agarwala, B K

2013-01-01

Several wildlife sanctuaries in the world are home to the surviving populations of many endemic species. Trishna wildlife sanctuary in northeast India is protected by law, and is home to the last surviving populations of Asian bison (Bos gorus Smith), spectacle monkey (Trachypithecus phayrie Blyth), capped langur (Trachypithecus pileatus Blyth), slow loris (Nycticebus coucang Boddaert), wild cat (Felis chaus Schreber), and wild boars (Sus scrofa L.), among many other animals and plants. The sanctuary was explored for species richness and diversity of butterflies. A six-month-long study revealed the occurrence of 59 butterfly species that included 21 unique species and 9 species listed in the threatened category. The mixed moist deciduous mature forest of the sanctuary harbored greater species richness and species diversity (39 species under 31 genera) than other parts of the sanctuary, which is comprised of regenerated secondary mixed deciduous forest (37 species under 32 genera), degraded forests (32 species under 28 genera), and open grassland with patches of plantations and artificial lakes (24 species under 17 genera). The majority of these species showed a distribution range throughout the Indo-Malayan region and Australasia tropics, and eight species were distributed in the eastern parts of South Asia, including one species, Labadea martha (F.), which is distributed in the eastern Himalayas alone. Estimator Chao 2 provided the best-predicted value of species richness. The steep slope of the species accumulation curve suggested the occurrence of a large number of rare species, and a prolonged gentle slope suggested a higher species richness at a higher sample abundance. The species composition of vegetation-rich habitats showed high similarity in comparison to vegetation-poor habitats.

The design and implementation of a motion correction scheme for neurological PET

International Nuclear Information System (INIS)

Bloomfield, Peter M; Spinks, Terry J; Reed, Johnny; Schnorr, Leonard; Westrip, Anthony M; Livieratos, Lefteris; Fulton, Roger; Jones, Terry

2003-01-01

increasing from 4.7 mm at the 0 mm position, to 4.8 mm, 20 mm offset, in the vertical direction. The results from the multi-line source phantom with ±5 deg. rotations showed a maximum degradation in FWHM, when compared with the stationary phantom, of 0.6 mm, in the horizontal direction, and 0.3 mm in the vertical direction. The corresponding values for the larger rotation, ±15 deg., were 0.7 mm and 1.1 mm, respectively. The performance of the method was confirmed with a Hoffman brain phantom moved continuously, and a clinical acquisition using [ 11 C]raclopride (normal volunteer). A visual comparison of both the motion and non-motion corrected images of the Hoffman brain phantom clearly demonstrated the efficacy of the method. A sample time-activity curve extracted from the clinical study showed irregularities prior to motion correction, which were removed after correction. A method has been developed to accurately monitor the motion of the head during a neurological PET acquisition, and correct for this motion prior to image reconstruction. The method has been demonstrated to be accurate and does not add significantly to either the acquisition or the subsequent data processing

Ação terapêutica do mebendazole (R 17635 em pacientes poliparasitados: resultados finais

Directory of Open Access Journals (Sweden)

Dirceu Wagner Carvalho de Souza

1973-08-01

Full Text Available O mebendazole (R 17635 foi testado no tratamento de pacientes, de ambos os sexos, portadores de helmintíases mistas; o grupo selecionado situava-se na faixa etária de 4 a 14 anos, constituindo-se de 140 pacientes necessariamente residentes em comunidades restritas. Cerca de 70% dos pacientes estavam infetados por pelo menos 3 helmintos (os demais pela associação de dois, dentre ancilostomídeos, Ascaris lumbricoides, Enterobius vermicularis, Taenia sp e Trichuris trichiura. O mebendazóle (R 17635 foi administrado em comprimidos de 100 mg, um 30 minutos antes do desjejum e outro 3 horas após o jantar, por 3 dias consecutivos, independentemente do peso corporal. Não foram observadas quaisquer evidências de reações indesejáveis imediatas ou tardias, que pudessem ser atribuídas à droga. O controle de cura foi efetuado mediante as técnicas de Willis e de Hoffman-Pons & Janer, em exames coprológicos realizados 7, 14 e 21 dias contados a partir do último dia do tratamento; nos portadores de teníase e oxiuríase procedeu-se, também, ao método do "anal-swab" durante 7 dias consecutivos, a partir do sétimo dia após o tratamento. Percentual de 100% de cura foi registrado para oxiuríase, tendo sido de 98% na ascaridíase e na triquiuríase e de 94.5% na ancilostomíase. De 9 pacientes com teníase, 8 apresentaram negativação dos exames; entretanto, os Autores insistem na necessidade de maiores estudos a este respeito, quanto aos aspectos técnico e estatístico. Não obstante, consideram demonstrada a real eficácia do mebendazole (R 17635 como droga anti-helmíntica polivalente.Mebendazole (R 17635 was tested in the treatment of mixed helminthiases in 140 male and female patients aged 4 to 14 years. These patients were necessarily treated by physicians visiting their restricted communities. Approximately 70% of the patients were infected by at least three, and the rest by only two, of the following helminths: hookworm, Ascaris

Renewal and Change (Editorial

Directory of Open Access Journals (Sweden)

Denise Koufogiannakis

2011-01-01

Full Text Available The end of yet another calendar year leads to a time of new beginnings and new challenges. For me, this is the end of my three year term as Editor-in-Chief of EBLIP, which has been a very rewarding challenge personally and professionally. I would like to thank each and every person who has contributed to the success of the journal. EBLIP relies on the talented and professional people who regularly give of their time and expertise. I particularly want to thank the Editorial Team who has worked so closely with me over the past three years: Alison Brettle, Lorie Kloda, Katrine Mallan, Jonathan Eldredge, Michelle Dunaway, and our former intern Andrea Baer. Thank you!In the past three years, EBLIP has continued to grow and thrive. We currently have more than 3400 registered readers, and an Editorial Advisory Board comprised of 70 people from 11 countries. Several of our papers have had more than 5000 pdf downloads, and the average number of downloads is 1308. I am also pleased to let you know that we have recently been accepted for inclusion in Scopus.In looking back and reflecting on the past three years, we have continued to build a strong open access journal that is relevant to LIS practitioners. We have increased the number of articles being published, and the overall number of submissions. Content is wide ranging, including multiple sectors within library and information studies. Our evidence summaries continue to be the heart of our journal, with more and more research from our field being critically appraised in this way. We have also added new sections such as Using Evidence in Practice, in which authors reflect on incorporating evidence into practice.And now it is time yet again for renewal and change. I am very pleased to welcome Alison Brettle of the University of Salford, as she begins her three year term as Editor-in-Chief. Alison has been the Associate Editor (Articles since the very early days of publication and brings extensive

Enteroparasitas presentes no Arroio do Engenho no município de Guarapuava, Paraná / Enteroparasites detected at Arroio do Engenho in the city of Guarapuava, Parana

Directory of Open Access Journals (Sweden)

Fábio Cesar Kaliberda

2008-09-01

Full Text Available O presente trabalho teve como objetivo avaliar a contaminação porenteroparasitos do Arroio do Engenho – mais especifi camente, no Parquedo Lago e no Arroio do Engenho na Vila Concórdia – e, a partir desse levantamento, caracterizar a qualidade de vida da população residente naregião. Em três diferentes períodos foram colhidas 67 amostras de água no local denominado Parque do Lago e no Arroio do Engenho na Vila Concórdia, Guarapuava, Paraná. O levantamento dos enteroparasitosfoi realizado através do método de sedimentação de Hoffman nosmeses de fevereiro a julho de 2006. Os dados mostraram que os ovos de ancilostomídeos foram as formas parasitárias mais freqüentemente encontradas (51,9%, seguidas de larvas rabditóide (25,9% e fi larióide (12,0%, respectivamente, sendo que as coletas realizadas no Parque do Lago, apresentaram maior número de parasitas quando comparadas às do Arroio do Engenho na Vila Concórdia. Os resultados demonstraram que o ambiente estudado era adequado para o embrionamento,desenvolvimento e sobrevivência das larvas, o que indica a existência de condições favoráveis à infecção humana e a precariedade dos serviços de saneamento básico comprometendo, assim, a salubridade do meio.

Nonisothermal melt-crystallization kinetics for in situ prepared poly(ethylene terephthalate)/monmorilonite (PET/OMMT)

International Nuclear Information System (INIS)

Antoniadis, G.; Paraskevopoulos, K.M.; Vassiliou, A.A.; Papageorgiou, G.Z.; Bikiaris, D.; Chrissafis, K.

2011-01-01

Highlights: → The melting temperature of the nanocomposites was shifted slightly to higher temperatures. → OMMT can act as nucleating agent. → The samples present lower activation energy compared to that of neat PET. → They crystallized by mechanisms with different activation energies. - Abstract: Poly(ethylene terephthalate) (PET) montmorillonite nanocomposites were prepared by in situ polymerization containing 0.5, 1, 2 and 5 wt% of organically modified montmorillonite (OMMT). In order to prepare exfoliated nanocomposites a new thermally stable modifier for montmorillonite nanoparticles like chlorohexadecane triphenylphosphine (CHDTPP) was synthesized. The preparation of nanocomposites was carried out using the two-stage melt polycondensation method. As verified by TEM micrographs, the dispersion of OMMT nanoparticles into the PET matrix was homogeneous while these were dispersed in the exfoliated form, proving the effectiveness of the modifier. The influence of OMMT nanomaterials on the thermal behaviour of PET and its non-isothermal crystallization was studied. Furthermore, the crystallization kinetics of PET and its nanocomposites were investigated by DSC. The activation energy was calculated using the Friedman's method. The Avrami exponent was calculated and analyzed. The effect of OMMT nanoparticles on spherulite growth rate of PET in all nanocomposites was also evaluated using the modified Lauritzen-Hoffman equation. From all these results it was found that OMMT nanoparticles can act as nucleating agents enhancing the crystallization rate of PET. The dispersion of OMMT nanoparticles in exfoliate form plays also an important role.

Quantitative validation of a new coregistration algorithm

International Nuclear Information System (INIS)

Pickar, R.D.; Esser, P.D.; Pozniakoff, T.A.; Van Heertum, R.L.; Stoddart, H.A. Jr.

1995-01-01

A new coregistration software package, Neuro9OO Image Coregistration software, has been developed specifically for nuclear medicine. With this algorithm, the correlation coefficient is maximized between volumes generated from sets of transaxial slices. No localization markers or segmented surfaces are needed. The coregistration program was evaluated for translational and rotational registration accuracy. A Tc-99m HM-PAO split-dose study (0.53 mCi low dose, L, and 1.01 mCi high dose, H) was simulated with a Hoffman Brain Phantom with five fiducial markers. Translation error was determined by a shift in image centroid, and rotation error was determined by a simplified two-axis approach. Changes in registration accuracy were measured with respect to: (1) slice spacing, using the four different combinations LL, LH, HL, HH, (2) translational and rotational misalignment before coregistration, (3) changes in the step size of the iterative parameters. In all the cases the algorithm converged with only small difference in translation offset, 0 and 0. At 6 nun slice spacing, translational efforts ranged from 0.9 to 2.8 mm (system resolution at 100 mm, 6.8 mm). The converged parameters showed little sensitivity to count density. In addition the correlation coefficient increased with decreasing iterative step size, as expected. From these experiments, the authors found that this algorithm based on the maximization of the correlation coefficient between studies was an accurate way to coregister SPECT brain images

The Tomato Hoffman’s Anthocyaninless Gene Encodes a bHLH Transcription Factor Involved in Anthocyanin Biosynthesis That Is Developmentally Regulated and Induced by Low Temperatures

Science.gov (United States)

Gao, Jianchang; Guo, Yanmei; Huang, Zejun; Du, Yongchen

2016-01-01

Anthocyanin pigments play many roles in plants, including providing protection against biotic and abiotic stresses. Many of the genes that mediate anthocyanin accumulation have been identified through studies of flowers and fruits; however, the mechanisms of genes involved in anthocyanin regulation in seedlings under low-temperature stimulus are less well understood. Genetic characterization of a tomato inbred line, FMTT271, which showed no anthocyanin pigmentation, revealed a mutation in a bHLH transcription factor (TF) gene, which corresponds to the ah (Hoffman's anthocyaninless) locus, and so the gene in FMTT271 at that locus was named ah. Overexpression of the wild type allele of AH in FMTT271 resulted in greater anthocyanin accumulation and increased expression of several genes in the anthocyanin biosynthetic pathway. The expression of AH and anthocyanin accumulation in seedlings was shown to be developmentally regulated and induced by low-temperature stress. Additionally, transcriptome analyses of hypocotyls and leaves from the near-isogenic lines seedlings revealed that AH not only influences the expression of anthocyanin biosynthetic genes, but also genes associated with responses to abiotic stress. Furthermore, the ah mutation was shown to cause accumulation of reactive oxidative species and the constitutive activation of defense responses under cold conditions. These results suggest that AH regulates anthocyanin biosynthesis, thereby playing a protective role, and that this function is particularly important in young seedlings that are particularly vulnerable to abiotic stresses. PMID:26943362

Motor learning in Sport. A short stroll into a (unfamiliar world. [Aprendizaje motor en el deporte: Un corto paseo por un mundo (desconocido].

Directory of Open Access Journals (Sweden)

Luis Miguel Ruiz

2015-01-01

Full Text Available It was in 1990 when Quest published an issue about “Usefulness of motor learning research for physical educators”. Several scholars tried to give an answer to this question, while motor learning researchers were in favour of this kind of scientific knowledge (Singer, 1990, Magill, 1990 pedagogues were more sceptical (Locke, 1990; Hoffman, 1990. Is it still a question that needs an answer? Does motor learning and expertise research useful for coaches and teachers? To quote J. von Uexkül “perhaps it would be a good idea to give a short stroll into the world of this (unfamiliar world”. Recently the philosophy of mind and philosophy of sport has begun to focus on sport expertise (Breivik, 2007; Moe, 2005. Today we are witnessing a change of the explanatory model of motor skill acquisition. Computational and computer metaphor is rejected and dynamic, sensorimotor, extended and enactive positions are the fashionable approaches (Araujo, 2013; Aviles et al., 2014; Clark and Chalmers, 2011; Davids, 2015; Froese and Di Paolo, 2011; Noë, 2010. In some cases these positions are coincidences but not in others. All of the researchers are agree upon the need to consider the mutuality of human beings and their surroundings. The computer metaphor, which at the time was the paradigm of any explanation, is now beginning to be seen as an overcome idea(Moe, 2005; Varela, Thompson and Rosch, 2005.

Semantic ambiguity effects on traditional Chinese character naming: A corpus-based approach.

Science.gov (United States)

Chang, Ya-Ning; Lee, Chia-Ying

2017-11-09

Words are considered semantically ambiguous if they have more than one meaning and can be used in multiple contexts. A number of recent studies have provided objective ambiguity measures by using a corpus-based approach and have demonstrated ambiguity advantages in both naming and lexical decision tasks. Although the predictive power of objective ambiguity measures has been examined in several alphabetic language systems, the effects in logographic languages remain unclear. Moreover, most ambiguity measures do not explicitly address how the various contexts associated with a given word relate to each other. To explore these issues, we computed the contextual diversity (Adelman, Brown, & Quesada, Psychological Science, 17; 814-823, 2006) and semantic ambiguity (Hoffman, Lambon Ralph, & Rogers, Behavior Research Methods, 45; 718-730, 2013) of traditional Chinese single-character words based on the Academia Sinica Balanced Corpus, where contextual diversity was used to evaluate the present semantic space. We then derived a novel ambiguity measure, namely semantic variability, by computing the distance properties of the distinct clusters grouped by the contexts that contained a given word. We demonstrated that semantic variability was superior to semantic diversity in accounting for the variance in naming response times, suggesting that considering the substructure of the various contexts associated with a given word can provide a relatively fine scale of ambiguity information for a word. All of the context and ambiguity measures for 2,418 Chinese single-character words are provided as supplementary materials.

Human H-reflexes are smaller in difficult beam walking than in normal treadmill walking.

Science.gov (United States)

Llewellyn, M; Yang, J F; Prochazka, A

1990-01-01

Hoffman (H) reflexes were elicited from the soleus (SOL) muscle while subjects walked on a treadmill and on a narrow beam (3.5 cm wide, raised 34 cm from the floor). The speed of walking on the treadmill was selected for each subject to match the background activation level of their SOL muscle during beam walking. The normal reciprocal activation pattern of the tibialis anterior and SOL muscles in treadmill walking was replaced by a pattern dominated by co-contraction on the beam. In addition, the step cycle duration was more variable and the time spent in the swing phase was reduced on the beam. The H-reflexes were highly modulated in both tasks, the amplitude being high in the stance phase and low in the swing phase. The H-reflex amplitude was on average 40% lower during beam walking than treadmill walking. The relationship between the H-reflex amplitude and the SOL EMG level was quantified by a regression line relating the two variables. The slope of this line was on average 41% lower in beam walking than treadmill walking. The lower H-reflex gain observed in this study and the high level of fusimotor drive observed in cats performing similar tasks suggest that the two mechanisms which control the excitability of this reflex pathway (i.e. fusimotor action and control of transmission at the muscle spindle to moto-neuron synapse) may be controlled independently.

The Suitability and the Bio-chemical Characteristics of Soils from the Northwest Region of Development from Romania, for Blueberry Crop

Directory of Open Access Journals (Sweden)

Amalia Ioana BOȚ

2017-11-01

Full Text Available We conducted several bio-chemical analyses on soil samples collected from eight blueberry plantations from Northwest Region of Development, using such as Kjeldahl method for total N, Perucci, Krawczyński, Hoffman and Teicher methodology for determine soil enzyme. The bio-chemical analyses conducted provide a better qualitative characterization of soils, providing significant information regarding their fertility degree and favourability for blueberries. For instance, the higher amount of total organic carbon found in four of the eight studied plantation, can be correlated with the same higher amount of enzyme present in soil which have an influence on them, xanthine oxidase and peroxidase activity. Taking into account the requirements needed for a blueberry plantation, we demonstrate that organic soils have also had the highest amount of bio-chemical compounds, such as cambisoil, met in Galații Bistriței, where were also found the highest amounts of different forms of nitrogen (1.755 g/kg total N; 0.0189 g/kg NH4 + and 0.0231g/kg NO3 in Galații Bistriței, comparing to 1.344 g/kg of total nitrogen; 0.0126 g/kg NH4+ and 0.0119 g/kg NO3- in Ulmeni, different forms of carbon and the enzymes that influence this compounds in soil, xanthine oxidase activity, peroxidase activity and nitrate reductase activity.

The ADVANCE project: Insights and achievments

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

ADVANCE [Advanced Driver and Vehicle Advisory Navigation ConcEpt] was a public/private partnership conceived and developed by four founding parties. The founding parties include the Federal Highway Administration (FHWA), the Illinois Department of Transportation (IDOT), the University of Illinois at Chicago and Northwestern University operating together under the auspices of the Illinois Universities Transportation Research Consortium (IUTRC), and Motorola, Inc. The major responsibilities of each party are fully described in the Project agreement. Subsequently, these four were joined on the Steering Committee by the American Automobile Association (AAA). This unique blending of public sector, private sector and university interests, augmented by more than two dozen other private sector participants, provided a strong set of resources for ADVANCE. The ADVANCE test area covered over 300 square miles including portions of the City of Chicago and 40 northwest suburban communities. The Project encompasses the high growth areas adjacent to O`Hare International Airport, the Schaumburg/Hoffman Estates office and retail complexes, and the Lake-Cook Road development corridor. It also includes major sports and entertainment complexes such as the Arlington International Racecourse and the Rosemont Horizon. The population in the area is more than 750,000. The Insights and Perspectives Compendium is intended to provide useful information to project managers, system developers, and system integrators of future similar ITS implementations. It is intended for those that are technically interested in the ADVANCE Project and have a basic understanding of the project.

Fermi surface investigation in the scanning tunneling microscopy of Bi2Sr2CaCu2O8

International Nuclear Information System (INIS)

Voo, K.K.; Wu, W.C.; Chen, H.Y.; Mou, C.Y.

2004-01-01

Within the ideal Fermi liquid picture, the impurity-induced spatial modulation of local density of states (LDOS) in the d-wave superconductor Bi 2 Sr 2 CaCu 2 O 8 is investigated at different superconducting (SC) gap sizes. These LDOS spectra are related to the finite-temperature dI/dV spectra in scanning tunneling microscopy (STM), when the Fermi distribution factor is deconvoluted away from dI/dV. We find stripe-like structures even in the zero gap case due to a local-nesting mechanism. This mechanism is different from the octet-scattering mechanism in the d-wave SC (dSC) state proposed by McElroy et al. [K. McElroy, R.W. Simmonds, J.E. Hoffman, D.H. Lee, J. Orenstein, H. Eisaki, S. Uchida, J.C. Davis, Nature 422 (2003) 592]. The zero gap LDOS is related to the normal state dI/dV. The zero gap spectra when Fourier-transformed into the reciprocal space, can reveal the information of the entire Fermi surface at a single measuring bias voltage, in contrast to the point-wise tracing out proposed by McElroy et al. This may serve as another way to check the reality of Landau quasiparticles in the normal state. We have also re-visited the octet-scattering mechanism in the dSC state and pointed out that, due to the Umklapp symmetry, there are additional peaks in the reciprocal space that experimentally yet to be found

Experimental study on reactivity measurement in thermal reactor by polarity correlation method

International Nuclear Information System (INIS)

Yasuda, Hideshi

1977-11-01

Experimental study on the polarity correlation method for measuring the reactivity of a thermal reactor, especially the one possessing long prompt neutron lifetime such as graphite on heavy water moderated core, is reported. The techniques of reactor kinetics experiment are briefly reviewed, which are classified in two groups, one characterized by artificial disturbance to a reactor and the other by natural fluctuation inherent in a reactor. The fluctuation phenomena of neutron count rate are explained using F. de Hoffman's stochastic method, and correlation functions for the neutron count rate fluctuation are shown. The experimental results by polarity correlation method applied to the β/l measurements in both graphite-moderated SHE core and light water-moderated JMTRC and JRR-4 cores, and also to the measurement of SHE shut down reactivity margin are presented. The measured values were in good agreement with those by a pulsed neutron method in the reactivity range from critical to -12 dollars. The conditional polarity correlation experiments in SHE at -20 cent and -100 cent are demonstrated. The prompt neutron decay constants agreed with those obtained by the polarity correlation experiments. The results of experiments measuring large negative reactivity of -52 dollars of SHE by pulsed neutron, rod drop and source multiplication methods are given. Also it is concluded that the polarity and conditional polarity correlation methods are sufficiently applicable to noise analysis of a low power thermal reactor with long prompt neutron lifetime. (Nakai, Y.)

SPM analysis of cerebrovascular reserve capacity after stimulation with acetazolamide measured by Tc-99m ECD SPECT in normal brain MRI patient

Energy Technology Data Exchange (ETDEWEB)

Lee, M. H.; Yoon, S. N.; Yoon, J. K.; Cho, C. W. [College of Medicine, Univ. of Ajou, Suwon (Korea, Republic of)

2003-07-01

This study was undertaken to evaluate normal response of acetazolamide in normal individuals, whose brain MRI is normal, using SPM99. In total, 10 Tc- 99m ECD brain SPECT were evaluated retrospectively. The half of the patients were male. Their mean age was 47.1 years old with a range of 33-61 years. They all visited our neurology department to evaluate stroke symptom. Their brain MRI was normal. Rest/acetazolamide brain SPECT was perfomed using Tc-99m ECD and the sequential injection and subtraction method. SPECT was acquired using fanbeam collimators and triple-head gamma camera (MultiSPECT III, Siemens medical systems, Inc. Hoffman Estates, III, USA). Chang's attenuation correction was applied their brain SPECT revealed normal rCBF pattern in visual analysis by two nuclear physician and they were diagnosed clinically normal. Using SPM method, we compared rest brain SPECT images with those of acetazolamide brain SPECT and measured the extent of the area with significant perfusion change (P<0.05) in predefined 34 cerebral regions. Acetazolamide brain SPECT showed no significant decreased region in comparison to rest brain SPECT. Only small portion of left mid temporal gyrus revealed increased rCBF on acetazolamide brain SPECT in comparison to rest brain SPECT. It apperas that there is no significant change in rCBF between rest and acetazolamide brain SPECT using Tc-99m ECD. The small number of this study is limitation of our study.

Epidemiological assessment of neglected diseases in children: lymphatic filariasis and soil-transmitted helminthiasis.

Science.gov (United States)

Aguiar-Santos, Ana M; Medeiros, Zulma; Bonfim, Cristine; Rocha, Abraham C; Brandão, Eduardo; Miranda, Tereza; Oliveira, Paula; Sarinho, Emanuel S C

2013-01-01

To report the prevalence of lymphatic filariasis and intestinal parasitic infections in school-aged children living in a filariasis endemic area and discuss about the therapeutic regimen adopted in Brazil for the large-scale treatment of filariasis. A cross-sectional study including 508 students aged 5-18 years old, enrolled in public schools within the city of Olinda, Pernambuco. The presence of intestinal parasites was analyzed using the Hoffman, Pons and Janer method on 3 stool samples. The diagnosis of filarial infection was performed using the rapid immunochromatographic technique (ICT) for the antigen, and the polycarbonate membrane filtration for the presence of microfilariae. Descriptive statistics of the data was performed using EpiInfo version 7. The prevalence of filariasis was 13.8% by ICT and 1.2% by microfilaraemia, while intestinal parasites were detected in 64.2% of cases. Concurrent diagnosis of filariasis and intestinal parasites was 9.4%, while 31.5% of students were parasite-free. Among individuals with intestinal parasites, 55% had one parasite and 45% had more than one parasite. Geohelminths occurred in 72.5% of the parasited individuals. In the group with filarial infection the prevalence of soil-transmitted helminthiasis was 54.5%. The simultaneous diagnosis of filariasis and intestinal parasites as well as the high frequency of geohelminths justify the need to reevaluate the treatment strategy used in the Brazilian filariasis large-scale treatment program. Copyright © 2013 Sociedade Brasileira de Pediatria. Published by Elsevier Editora Ltda. All rights reserved.

Frequency of heterozygous TET2 deletions in myeloproliferative neoplasms

Directory of Open Access Journals (Sweden)

Joseph Tripodi

2010-09-01

Full Text Available Joseph Tripodi1, Ronald Hoffman1, Vesna Najfeld2, Rona Weinberg31The Myeloproliferative Disorders Program, Tisch Cancer Institute, Department of Medicine and 2Department of Medicine and Pathology, Mount Sinai School of Medicine, 3The Myeloproliferative Disorders Program, Cellular Therapy Laboratory, The New York Blood Center, New York, NY, USAAbstract: The Philadelphia chromosome (Ph-negative myeloproliferative neoplasms (MPNs, including polycythemia vera, essential thrombocythemia, and primary myelofibrosis, are a group of clonal hematopoietic stem cell disorders with overlapping clinical and cytogenetic features and a variable tendency to evolve into acute leukemia. These diseases not only share overlapping chromosomal abnormalities but also a number of acquired somatic mutations. Recently, mutations in a putative tumor suppressor gene, ten-eleven translocation 2 (TET2 on chromosome 4q24 have been identified in 12% of patients with MPN. Additionally 4q24 chromosomal rearrangements in MPN, including TET2 deletions, have also been observed using conventional cytogenetics. The goal of this study was to investigate the frequency of genomic TET2 rearrangements in MPN using fluorescence in situ hybridization as a more sensitive method for screening and identifying genomic deletions. Among 146 MPN patients, we identified two patients (1.4% who showed a common 4q24 deletion, including TET2. Our observations also indicated that the frequency of TET2 deletion is increased in patients with an abnormal karyotype (5%.Keywords: TET2, myeloproliferative neoplasms, fluorescence in situ hybridization, cytogenetics

ROC [Receiver Operating Characteristics] study of maximum likelihood estimator human brain image reconstructions in PET [Positron Emission Tomography] clinical practice

International Nuclear Information System (INIS)

Llacer, J.; Veklerov, E.; Nolan, D.; Grafton, S.T.; Mazziotta, J.C.; Hawkins, R.A.; Hoh, C.K.; Hoffman, E.J.

1990-10-01

This paper will report on the progress to date in carrying out Receiver Operating Characteristics (ROC) studies comparing Maximum Likelihood Estimator (MLE) and Filtered Backprojection (FBP) reconstructions of normal and abnormal human brain PET data in a clinical setting. A previous statistical study of reconstructions of the Hoffman brain phantom with real data indicated that the pixel-to-pixel standard deviation in feasible MLE images is approximately proportional to the square root of the number of counts in a region, as opposed to a standard deviation which is high and largely independent of the number of counts in FBP. A preliminary ROC study carried out with 10 non-medical observers performing a relatively simple detectability task indicates that, for the majority of observers, lower standard deviation translates itself into a statistically significant detectability advantage in MLE reconstructions. The initial results of ongoing tests with four experienced neurologists/nuclear medicine physicians are presented. Normal cases of 18 F -- fluorodeoxyglucose (FDG) cerebral metabolism studies and abnormal cases in which a variety of lesions have been introduced into normal data sets have been evaluated. We report on the results of reading the reconstructions of 90 data sets, each corresponding to a single brain slice. It has become apparent that the design of the study based on reading single brain slices is too insensitive and we propose a variation based on reading three consecutive slices at a time, rating only the center slice. 9 refs., 2 figs., 1 tab

Grammar Clinical Marker Yields Substantial Heritability for Language Impairments in 16-Year-Old Twins.

Science.gov (United States)

Dale, Philip S; Rice, Mabel L; Rimfeld, Kaili; Hayiou-Thomas, Marianna E

2018-01-22

There is a need for well-defined language phenotypes suitable for adolescents in twin studies and other large-scale research projects. Rice, Hoffman, and Wexler (2009) have developed a grammatical judgment measure as a clinical marker of language impairment, which has an extended developmental range to adolescence. We conducted the first twin analysis, along with associated phenotypic analyses of validity, of an abridged, 20-item version of this grammatical judgment measure (GJ-20), based on telephone administration using prerecorded stimuli to 405 pairs of 16-year-olds (148 monozygotic and 257 dizygotic) drawn from the Twins Early Development Study (Haworth, Davis, & Plomin, 2012). The distribution of scores is markedly skewed negatively, as expected for a potential clinical marker. Low performance on GJ-20 is associated with lower maternal education, reported learning disability (age 7 years), and low scores on language tests administered via the Twins Early Development Study (age 16 years) as well as General Certificate of Secondary Education English and Math examination performance (age 16 years). Liability threshold estimates for the genetic influence on low performance on GJ-20 are substantial, ranging from 36% with a lowest 10% criterion to 74% for a lowest 5% criterion. The heritability of GJ-20 scores, especially at more extreme cutoffs, along with the score distribution and association with other indicators of language impairments, provides additional evidence for the potential value of this measure as a clinical marker of specific language impairment.

Relations between psychological separation and adaptation of adolescents

Directory of Open Access Journals (Sweden)

Vukelić Marija

2006-01-01

Full Text Available The object of this research is a problem of relations between psychological separation-individuation as well as adaptation to secondary and boarding school and differences in separation and adaptation. Explorative research was performed on the sample of 586 adolescents aged 14-16. The instruments used were: The Psychological Separation Inventory (PSI, Hoffman, 1984, and The Student Adaptation to College Questionnaire (SACQ, Baker & Siryk, 1984. The results showed that adolescents from boarding schools, comparing to those who are not separated from parents during secondary school, have significant higher level of separation of both parents, but discriminate analysis showed that adolescents from boarding schools express nostalgia for their parents and wants more contacts and support from them. Adolescent from boarding school showed general better adaptation, but lower emotional adaptation comparing to not separate adolescents. Discriminate analysis showed that adolescents from boarding schools express low satisfaction with life in boarding school. The results confirm hypothesis of connection between psychological separation from parents and adaptation in adolescence. Canonical correlation analysis showed two statistically significant canonical factors. First factor shows significant connection of lower independence and better adaptation, with 23% explained variance. Second factor indicates connection of lower functional, emotional and attitude independence and better adaptation, with 12% of explained variance. Results are argued in light of theory separation-individuation and importance of meaning of separation from their parents for adolescents for adaptation on request for adaptation on secondary school and boarding school.

Producción de cursos en-línea basados en objetos de aprendizaje: una propuesta metodológica orientada a estudiantes de carreras técnicas

Directory of Open Access Journals (Sweden)

Margarita Elizabeth Zambrano

2017-01-01

Full Text Available Introducción: Este estudio tiene como objetivo estimular la comprensión conceptual y procedural de estudiantes de carreras técnicas a través de una propuesta metodológica que se aplica durante el diseño e implementación de Cursos en-línea basados en objetos de aprendizaje (OA. Método: Se han aplicado de manera armonizada el método de diseño de hipermedia orientado a objetos (OOHDM y la metodología para la creación de OA (CROA para la producción de un curso de Seguridad de la Información, como prueba de concepto. El curso fue desarrollado bajo licencia académica Articulate Studio para contenidos y evaluaciones, y con Ardora para la elaboración de actividades de aprendizaje. Ambos fueron implantados dentro de Moodle como entorno virtual de E/A (EVEA. Para las instancias de auto evaluación y reflexión, se aplicó el aprendizaje basado en problemas (ABP, que además promueve experiencias colaborativas entre estudiantes y aprendientes. Para la evaluación de la usabilidad del curso, se aplicó la matriz para la evaluación de OA LORI. Resultados: Los resultados muestran, por un lado el procedimiento metodológico teórico y práctico validado, y por otro, muestran la satisfacción de los estudiantes con respecto a la organización, contenido y funcionalidad del curso. Conclusión: La aplicación conjunta de las metodologías OOHDM, CROA y ABP, permiten estructurar sistemáticamente y pedagógicamente los materiales educativos en base a OA de cursos en línea, para mejorar la comprensión conceptual y procedural de los estudiantes de carreras técnicas

The Mobile Phone Affinity Scale: Enhancement and Refinement.

Science.gov (United States)

Bock, Beth C; Lantini, Ryan; Thind, Herpreet; Walaska, Kristen; Rosen, Rochelle K; Fava, Joseph L; Barnett, Nancy P; Scott-Sheldon, Lori Aj

2016-12-15

Existing instruments that assess individuals' relationships with mobile phones tend to focus on negative constructs such as addiction or dependence, and appear to assume that high mobile phone use reflects pathology. Mobile phones can be beneficial for health behavior change, disease management, work productivity, and social connections, so there is a need for an instrument that provides a more balanced assessment of the various aspects of individuals' relationships with mobile phones. The purpose of this research was to develop, revise, and validate the Mobile Phone Affinity Scale, a multi-scale instrument designed to assess key factors associated with mobile phone use. Participants (N=1058, mean age 33) were recruited from Amazon Mechanical Turk between March and April of 2016 to complete a survey that assessed participants' mobile phone attitudes and use, anxious and depressive symptoms, and resilience. Confirmatory factor analysis supported a 6-factor model. The final measure consisted of 24 items, with 4 items on each of 6 factors: Connectedness, Productivity, Empowerment, Anxious Attachment, Addiction, and Continuous Use. The subscales demonstrated strong internal consistency (Cronbach alpha range=0.76-0.88, mean 0.83), and high item factor loadings (range=0.57-0.87, mean 0.75). Tests for validity further demonstrated support for the individual subscales. Mobile phone affinity may have an important impact in the development and effectiveness of mobile health interventions, and continued research is needed to assess its predictive ability in health behavior change interventions delivered via mobile phones. ©Beth C Bock, Ryan Lantini, Herpreet Thind, Kristen Walaska, Rochelle K Rosen, Joseph L Fava, Nancy P Barnett, Lori AJ Scott-Sheldon. Originally published in JMIR Mhealth and Uhealth (http://mhealth.jmir.org), 15.12.2016.

Evaluation and re-evaluation of genetic radiation hazards in man

International Nuclear Information System (INIS)

Sankaranarayanan, K.

1976-01-01

The arm number hypothesis proposed by Brewen and colleagues in 1973 has been examined in the light of information thus far available from mammalian studies. In experiments with peripheral blood lymphocytes (radiation in vitro), a linear relationship between dicentric yield and the effective chromosome arm number of the species was obtained in the mouse, Chinese hamster, goat, sheep, pig, wallaby and man. However, the data are not consistent with such a relationship in several primate species (marmoset, rhesus monkey, cynomolgus monkey, squirrel monkey and the slow loris), the cat and the dog. In the rabbit, the data are conflicting. In the mouse and the Chinese hamster the frequencies of reciprocal translocations recorded in spermatocytes descended from irradiated spermatogonia are in line with the expectation based on the arm number hypothesis, whereas in the golden hamster, rabbit and the rhesus they are not. In man and the marmoset, the limited data are not inconsistent with a 2-fold higher sensitivity of these species relative to the mouse although they do not rule out a difference as high as 4-fold. In the guinea-pig, the situation is unclear. New data on the transmission of reciprocal translocations in mice suggest that the frequency in the F 1 progeny may be close to one-quarter of that recorded in the spermatocytes of the irradiated fathers (spermatogonial irradiation) at an exposure level of 150 R, whereas at higher exposures, the reduction factor is about one-eighth, the latter being in line with the earlier finding. All these results taken together suggest that inter-specific extrapolation from the radiosensitivity of somatic cells (to dicentric induction) to that of germ cells (to translocation induction) is fraught with uncertainty at present. Certain aspects that need to be studied in more detail in the context of induced chromosome aberrations are discussed

Anatomical characterization of hoof growth pattern in six Iranian sheep breeds and its possible implication for trimming recommendations.

Science.gov (United States)

Azarpajouh, S; Marchewka, J; Segura Correa, J C; Calderón Díaz, J A

2018-03-11

The objective of this study was to compare hoof anatomy, hoof growth pattern, and hoof weight-bearing surface of six different Iranian sheep breeds to identify possible differences in the hoof anatomical features that could help to minimize adverse effects of hoof trimming methods. Front and hind hooves of 2-year-old, previously untrimmed, pastured dairy ewes of six Iranian breeds (Afshari, Moghani, Kurdi, Makoui, Chaleshtori, and Lori-Bakhtiari; n = 180 ewes; 30 ewes per breed) were collected after slaughter. Medial and lateral claws were incised sagittally and anatomical measurements such as toe length, heel height, toe height, sole thickness, sole length, and toe angle were recorded in each claw. Data were analyzed using mixed model equations including breed, claw (lateral or medial), hoof (front or hind) and their interactions as fixed effects, and ewe as random effect. Breed differences were observed for all hoof measurements (P < 0.05). Chaleshtori sheep had higher measurements for most of the traits studied while Afshari and Makoui sheep had lower measurements. All measurements, except for toe length and toe height to solar surface to heel height ratio, were significantly greater in the front hooves than in the hind hooves (P < 0.05). Soles were longer in the medial claws compared to the lateral claws of the front hooves (P < 0.05). Results suggest the observed breed differences could interfere with establishing a standard, uniform hoof trimming method for sheep. For instance, it might be possible that while Afshari and Makoui sheep could require more conservative trimming, Chaleshtori sheep could require to be trimmed more. In consequence, hoof trimming methods might need to be adjusted to specific breed characteristics to avoid possible tissue damage.

ESTIMACIÓN DE CALIDAD DE OBJETOS DE APRENDIZAJE EN REPOSITORIOS DE RECURSOS EDUCATIVOS ABIERTOS BASADA EN LAS INTERACCIONES DE LOS ESTUDIANTES

Directory of Open Access Journals (Sweden)

Aldo Gordillo Méndez

2018-01-01

Full Text Available Los recursos educativos abiertos se han erigido como uno de los pilares fundamentales de la educación abierta. Una de las principales barreras que está obstaculizando su uso y adopción es la carencia de mecanismos de control de calidad efectivos y sostenibles en los repositorios. Estrategias de evaluación como la revisión por pares no han resultado lo su®cientemente escalables para afrontar el ritmo de creación de materiales abiertos por parte de la comunidad. El presente estudio muestra una nueva estrategia basada en analíticas de aprendizaje para estimar la calidad de los objetos de aprendizaje en base a las interacciones que los estudiantes tienen con ellos en entornos abiertos. Se analizaron 146.291 sesiones de interacción de estudiantes con 256 objetos de aprendizaje distribuidos a través de un repositorio abierto. Un total de 11 interacciones estudiante-objeto de aprendizaje fueron consi- deradas en el estudio. La calidad de los recursos fue medida empleando el instrumento estándar de evaluación LORI (Learning Object Review Instru- ment. Para estudiar las relaciones entre las interacciones de los estudiantes con los objetos de aprendizaje y la calidad de los mismos y para construir una métrica de predicción se utilizaron análisis de regresión lineal. Los resulta- dos muestran que existe relación entre las interacciones y la calidad, y que es posible estimar con un error moderado la calidad de los objetos de apren- dizaje en base a las interacciones que los estudiantes tienen con ellos. Los resultados obtenidos señalan que la analítica de aprendizaje propuesta puede ser utilizada en repositorios de objetos de aprendizaje abiertos para detectar automáticamente recursos con ̄ictivos o de baja calidad.

Evaluation and re-evaluation of genetic radiation hazards in man. The arm number hypothesis and the induction of reciprocal translocations in man. II

Energy Technology Data Exchange (ETDEWEB)

Sankaranarayanan, K [Rijksuniversiteit Leiden (Netherlands). Lab. voor Stralengenetica en Chemische Mutagenese; Cohen (J.A.) Instituut voor Radiopathologie en Stralenbescherming, Leiden (Netherlands))

1976-06-01

The arm number hypothesis proposed by Brewen and colleagues in 1973 has been examined in the light of information thus far available from mammalian studies. In experiments with peripheral blood lymphocytes (radiation in vitro), a linear relationship between dicentric yield and the effective chromosome arm number of the species was obtained in the mouse, Chinese hamster, goat, sheep, pig, wallaby and man. However, the data are not consistent with such a relationship in several primate species (marmoset, rhesus monkey, cynomolgus monkey, squirrel monkey and the slow loris), the cat and the dog. In the rabbit, the data are conflicting. In the mouse and the Chinese hamster the frequencies of reciprocal translocations recorded in spermatocytes descended from irradiated spermatogonia are in line with the expectation based on the arm number hypothesis, whereas in the golden hamster, rabbit and the rhesus they are not. In man and the marmoset, the limited data are not inconsistent with a 2-fold higher sensitivity of these species relative to the mouse although they do not rule out a difference as high as 4-fold. In the guinea-pig, the situation is unclear. New data on the transmission of reciprocal translocations in mice suggest that the frequency in the F/sub 1/ progeny may be close to one-quarter of that recorded in the spermatocytes of the irradiated fathers (spermatogonial irradiation) at an exposure level of 150 R, whereas at higher exposures, the reduction factor is about one-eighth, the latter being in line with the earlier finding. All these results taken together suggest that inter-specific extrapolation from the radiosensitivity of somatic cells (to dicentric induction) to that of germ cells (to translocation induction) is fraught with uncertainty at present. Certain aspects that need to be studied in more detail in the context of induced chromosome aberrations are discussed.

Primate tarsal bones from Egerkingen, Switzerland, attributable to the middle Eocene adapiform Caenopithecus lemuroides.

Science.gov (United States)

Seiffert, Erik R; Costeur, Loïc; Boyer, Doug M

2015-01-01

The middle Eocene species Caenopithecus lemuroides, known solely from the Egerkingen fissure fillings in Switzerland, was the first Paleogene fossil primate to be correctly identified as such (by Ludwig Rütimeyer in 1862), but has long been represented only by fragmentary mandibular and maxillary remains. More recent discoveries of adapiform fossils in other parts of the world have revealed Caenopithecus to be a biogeographic enigma, as it is potentially more closely related to Eocene adapiforms from Africa, Asia, and North America than it is to any known European forms. More anatomical evidence is needed, however, to provide robust tests of such phylogenetic hypotheses. Here we describe and analyze the first postcranial remains that can be attributed to C. lemuroides-an astragalus and three calcanei held in the collections of the Naturhistorisches Museum Basel that were likely recovered from Egerkingen over a century ago. Qualitative and multivariate morphometric analyses of these elements suggest that C. lemuroides was even more loris-like than European adapines such as Adapis and Leptadapis, and was not simply an adapine with an aberrant dentition. The astragalus of Caenopithecus is similar to that of younger Afradapis from the late Eocene of Egypt, and parsimony and Bayesian phylogenetic analyses that include the new tarsal data strongly support the placement of Afradapis and Caenopithecus as sister taxa to the exclusion of all other known adapiforms, thus implying that dispersal between Europe and Africa occurred during the middle Eocene. The new tarsal evidence, combined with previously known craniodental fossils, allows us to reconstruct C. lemuroides as having been an arboreal and highly folivorous 1.5-2.5 kg primate that likely moved slowly and deliberately with little or no capacity for acrobatic leaping, presumably maintaining consistent powerful grasps on branches in both above-branch and inverted postures.

Point-of-care echocardiography in simulation-based education and assessment

Directory of Open Access Journals (Sweden)

Amini R

2016-05-01

Full Text Available Richard Amini, Lori A Stolz, Parisa P Javedani, Kevin Gaskin, Nicola Baker, Vivienne Ng, Srikar Adhikari Department of Emergency Medicine, University of Arizona Medical Center, Tucson, AZ, USA Background: Emergency medicine milestones released by the Accreditation Council for Graduate Medical Education require residents to demonstrate competency in bedside ultrasound (US. The acquisition of these skills necessitates a combination of exposure to clinical pathology, hands-on US training, and feedback. Objectives: We describe a novel simulation-based educational and assessment tool designed to evaluate emergency medicine residents’ competency in point-of-care echocardiography for evaluation of a hypotensive patient with chest pain using bedside US. Methods: This was a cross-sectional study conducted at an academic medical center. A simulation-based module was developed to teach and assess the use of point-of-care echocardiography in the evaluation of the hypotensive patient. The focus of this module was sonographic imaging of cardiac pathology, and this focus was incorporated in all components of the session: asynchronous learning, didactic lecture, case-based learning, and hands-on stations. Results: A total of 52 residents with varying US experience participated in this study. Questions focused on knowledge assessment demonstrated improvement across the postgraduate year (PGY of training. Objective standardized clinical examination evaluation demonstrated improvement between PGY I and PGY III; however, it was noted that there was a small dip in hands-on scanning skills during the PGY II. Clinical diagnosis and management skills also demonstrated incremental improvement across the PGY of training. Conclusion: The 1-day, simulation-based US workshop was an effective educational and assessment tool at our institution. Keywords: point-of care ultrasound, simulation education

Enteroparasitoses em manipuladores de alimentos de escolas públicas em Uberlândia (Minas Gerais, Brasil Enteroparasitoses in food handlers in public schools

Directory of Open Access Journals (Sweden)

Carlos Henrique A. de Rezende

1997-12-01

Full Text Available Procedeu-se ao controle das enteroparasitoses em manipuladores de alimentos de escolas públicas de primeiro grau de Uberlândia, Minas Gerais, a partir de estudo prospectivo baseado em inquérito parasitológico. Foram acompanhados 264 indivíduos de 57 escolas, com três coletas de fezes (C, sendo C1 em setembro de 1989, C2 em abril de 1990 e C3 em setembro de 1990. Entre os participantes 259 eram do sexo feminino e cinco do sexo masculino, com idades entre 20 e 66 anos. As 792 amostras de fezes foram conservadas em formol a 10% e analisadas pelo método de Hoffman, Pons e Janer. A ocorrência de parasitas intestinais foi de 17, 10 e 10% para C1, C2, e C3, respectivamente. Em C1 detectou-se: Giardia lamblia (8%, ancilostomídeos (6%, Ascaris lumbricoides (3%, Entamoeba histolytica, (2%, Strongyloides stercoralis, Hymenolepis nana, Taenia sp. e Trichuris trichiura (menos de 1% cada um deles. Em C2 detectou-se: ancilostomídeos (5%, G. lamblia (2%, A. lumbricoides (1%, S. stercoralis, H. nana, Taenia sp., Enterobius vermicularis (menos de 1% cada um deles. Em C3 observou-se: ancilostomídeos (5%, G. lamblia (3%, A. lumbricoides (2%, S. stercoralis e E. vermicularis (menos de 1% cada um deles. Os indivíduos infectados receberam tratamento específico após o diagnóstico em cada coleta. Recomendamos a implantação de vigilância epidemiológica através do exame parasitológico periódico, tratamento específico e treinamento sobre manejo higiênico de alimentos e higiene pessoal para todos os manipuladores de alimentos.A prospective study based on a parasitologic survey was carried out with a view toward controlling enteroparasitoses in food handlers who work in public primary schools in Uberlândia, Minas Gerais, Brazil. The study subjects were 264 individuals from 57 schools, from whom three fecal samples (C were collected: C1 in September 1989, C2 in April 1990, and C3 in September 1990. The participants were predominantly female (259 women

When Evidence Doesn’t Work (Editorial

Directory of Open Access Journals (Sweden)

Lindsay Glynn

2007-12-01

calmly work out the bugs, respond to our calls of frustration and panic, and she is solely responsible for the final look of the publication every 3 months. She has kept Denise, Alison and me on schedule and has caught more last minute typos and formatting issues than I could possibly count. Both Denise and Pam have led the journal to where it is today as a result oftheir commitment, expertise, enthusiasm, and sincere belief in what the board is trying to accomplish through this journal. On behalf of the Editorial Board, the Evidence Summary writers, the peer reviewers, the copyeditors, and the readers, I thank them both and wish them the best success in their future endeavors. Thankfully, their future endeavors include continued involvement with this journal. Denise will continue her work with Classics Evidence Summaries, which will be a semi‐regular feature, and both Denise and Pam have joined the Editorial Advisory team. On that note, I would like to welcome two new editorial board members. Lorie Kloda has joined the board as the Associate Editor, Evidence Summaries. Lorie has been contributing to the journal as an EvidenceSummaries author. She hails from McGill University where she is currently pursuing her PhD. Katrine Mallan is assuming the role of Production Editor. Katrine currently works at the University of Calgary as an instruction librarian. Please join me in welcoming both Lorie and Katrine. They may have big shoes to fill, but they have the skills, enthusiasm and expertise to do so seamlessly.This is our last issue for the year, and it’s a big one. Aside from 7 Evidence Summaries, we are featuring 5 summaries of classic articles. Many of you will, no doubt, be familiar with these seminal papers and will be interested to read how they fare today and the impact that they have had on our profession. Also in this issue are 3 original research articles and one article outlining how to create effective questions for surveys. There is much information here to

Detection of Dientamoeba fragilis in patients with HIV/AIDS by using a simplified iron hematoxylin technique

Directory of Open Access Journals (Sweden)

Juliana Alves Garcia

2012-04-01

Full Text Available INTRODUCTION: Studies strongly indicate Dientamoeba fragilis as one of the causes of diarrhea in human immunodeficiency virus (HIV patients. METHODS: The objective of the present study was to evaluate the prevalence of D. fragilis associated with the causes of diarrhea in 82 HIV/ AIDS patients hospitalized at the Instituto de Infectologia Emílio Ribas from September 2006 to November 2008. RESULTS: In total, 105 samples were collected from 82 patients. Unprotected sex was the most frequent cause of HIV infection (46.3%, followed by the use of injectable or non-injectable drugs (14.6%. Patients presented with viral loads of 49-750,000 copies/ mL (average: 73,849 ± 124,850 copies/mL and CD4 counts ranging of 2-1,306 cells/mm³ (average: 159 ± 250 cells/mm³. On an average, the odds of obtaining a positive result by using the other techniques (Hoffman, Pons and Janer or Lutz; Ritchie were 2.7 times higher than the chance of obtaining a positive result by using the simplified iron hematoxylin method. Significant differences were found between the methods (p = 0.003. CONCLUSIONS: The other techniques can detect a significantly greater amount of parasites than the simplified iron hematoxylin method, especially with respect to Isospora belli, Cryptosporidium sp., Schistosoma mansoni, and Strongyloides stercoralis, which were not detected using hematoxylin. Endolimax nana and D. fragilis were detected more frequently on using hematoxylin, and the only parasite not found by the other methods was D. fragilis.

Studies of N ~ 40 Ni isotopes via neutron-knockout (nKO) and deep-inelastic (DI) reactions

Science.gov (United States)

Chiara, C. J.; Recchia, F.; Gade, A.; Janssens, R. V. F.; Walters, W. B.

2013-10-01

V. BADER, T. BAUGHER, D. BAZIN, J.S. BERRYMAN, B.A. BROWN, C. LANGER, N. LARSON, S.N. LIDDICK, E. LUNDERBERG, S. NOJI, C. PROKOP, S.R. STROBERG, S. SUCHYTA, D. WEISSHAAR, S. WILLIAMS, NSCL/MSU, M. ALBERS, M. ALCORTA, P.F. BERTONE, M.P. CARPENTER, J. CHEN, C.R. HOFFMAN, F.G. KONDEV, T. LAURITSEN, A.M. ROGERS, D. SEWERYNIAK, S. ZHU, ANL, C.M. CAMPBELL, LBNL, H.M. DAVID, D.T. DOHERTY, U. of Edinburgh/ANL, A. KORICHI, CSNSM-IN2P3/ANL, C.J. LISTER, U. of Mass.-Lowell, K. WIMMER, Central Mich. U. -- Excited states in 68Ni were populated in 2nKO reactions at NSCL. Prompt γ rays were detected with the GRETINA array located in front of the S800 separator. A hodoscope at the S800 focal plane captured the 68Ni ions, where isomeric decays could be correlated with prompt γ rays. Decay of the first excited state, a 0+ isomer, was observed, confirming that its energy substantially differs from the literature value. Comparing the decay patterns of excited states with shell-model calculations provides insight into their underlying structure. Data from 70Zn + 208Pb DI reactions studied with Gammasphere provide results consistent with the 2nKO. Single-particle strengths are also under investigation in the odd- A Ni isotopes via 1nKO reactions. Supported in part by the DoE (DE-FG02-94ER40834, DE-AC02-06CH11357), NSF (PHY-1102511), and NNSA (DE-NA0000979).

Magnification bone scan of knees for knee pain evaluation

International Nuclear Information System (INIS)

Lee, Myoung Hoon; Park, Chan H.; Yoon, Seok Nam; Hwang, Kyung Hoon

2001-01-01

Knee pain is one of the common complaints of patients seen in our orthopedic clinic. Routine anterior and posterior views of whole body bone scan (WBBS) is often not sufficient in the evaluation of these patients. An ideal bone scan using pinhole collimator or single photon emission tomography (SPECT), however, is impractical and time consuming in busy nuclear medicine department with limited resources. Therefore, the aim of the study is to assess limited bone scan of knees with magnification (LNSKM) for knee pain evaluation. Technical aspect of LBSKM and diagnostic efficacy are discussed on this poster. Adult patients with knee pain were reffered for LBSKM from an orthopedic surgen specializing knees. Four hundred fifteen LBSKMs were performed since 1999. patients were given 740 MBq (20mCi) Tc-99m MDP intravenously and 3 hours later LBSKM was performed using a low energy high resolution parallel hole collimator and Siemens Orbitor camera. (Simens medical systems. Inc., Hoffman Estates, III., USA). Anterior view of the knees was taken for 5 min, without magnification and both lateral views of symptomatic knees were obtained with electronic magnification (1.25, upto 2.0) for 8 min each. Disease processes such as DJD, traumatic arthritis, P-F tendonitis, SONK, meniscus tear are detected and illustrated along with normal knee scan finding. We believe LBSKM may not be as good as SPECT or pinhole imaging of the knees in the evaluation of knee pain but superior to routine WBBS in the nuclear medicine department with limited resources of instrumentation and manpower

Adiabatic energy change of plasma electrons and the frame dependence of the cross-shock potential at collisionless magnetosonic shock waves

International Nuclear Information System (INIS)

Goodrich, C.C.; Scudder, J.D.

1984-01-01

In collisionless magnetosonic shock waves, ions are commonly thought to be decelerated by dc electrostatic cross-shock electric field along the shock normal n. In a frame where ions are normally incident to the shock the change in the potential energy [qphi/sup N/] in the quasi-perpendicular geommetry is of the order of the change of the energy of normal ion flow: [qphi/sup N/]roughly-equal[1/2m/sub i/(V/sub i//sup N/xn) 2 ], which is approximately 200-500 eV at the earth's bow shock. We show that the electron energy gain, typically 1/10 this number, is consistent with such a large potential jump in this geometry. Key facts are the different paths taken by electrons an ions through the shock wave and the frame dependence of the potential jump in the geometry. In the normal incidence frame, electrons lose energy by doing work against the solar wind motional electric field E/sub M//sup N/, which partially offsets the energy gain from the cross-shock electrostatic potential energy [ephi/sub asterisk//sup N/]. In the de Hoffman-Teller frame the motional electric field vanishes; the elctrons gain the full electrostatic potential energy jump e[phi/sub asterisk//sup H//sup T/] of that frame, which is not, however, equal to the electrostatic potential energy jump e[phi/sub asterisk//sup N/] of that frame, which is not, however, equal to the electrostatic potential energy jump e[phi/sub asterisk//sup N/] in the normal incidence frame

How States Carry Out Acts of Terror: Wars, Strategies and Tactics in Bosnia and Herzegovina and Kosovo

Directory of Open Access Journals (Sweden)

MA. Astrit Lleshi

2016-01-01

Full Text Available Terrorism is a notoriously difficult concept that defies single universal definition. Terrorists intentionally employ violence in order to instill fear in their victims and the wider public. Terrorist movements aim to achieve their political, social and/or religious goals through use of violent acts. (Hoffman, 1998: 43 In most cases terrorism is perpetrated by non-state actors and is "bottom up" challenge to the existing political order. However this article argues that the nature of the crime and not the perpetrator should determine whether some criminal act constitutes terrorism and acts of terror can also be committed by states and/or state actors. In this article, the author will examine the overall strategy and tactics used by the Milosevic and Karadzic regimes in BiH and Kosovo to fulfil their wartime ambitions of maintaining and consolidating control over Serb and Serb-occupied territory, relying primarily upon the indictments and judgments of the ICTY in which they and members of their armed forces acting under their authority have been charged and/or convicted of war crimes and terror, along with reports from international organizations such as the United Nations and other sources. Through an analysis of these tactics against leading definitions of terrorism, it will be demonstrated that rather than fighting against terrorists and insurgents, the Milosevic and Karadzic regimes carried out acts of terror during the wars in Kosovo and BiH, respectively, and furthermore Milosevic was sponsoring state-terrorism in BiH (Blakely, 2012: 3-4.

An arterio-venous bridge for gradual weaning from adult veno-arterial extracorporeal life support.

Science.gov (United States)

Babar, Z U D; Sharma, A S; Ganushchak, Y M; Delnoij, T S R; Donker, D W; Maessen, J G; Weerwind, P W

2015-11-01

Weaning from extracorporeal life support (ELS) is particularly challenging when cardiac recovery is slow, largely incomplete and hard to predict. Therefore, we describe an individualized gradual weaning strategy using an arterio-venous (AV) bridge incorporated into the circuit to facilitate weaning. Thirty adult patients weaned from veno-arterial ELS using an AV bridge were retrospectively analyzed. Serial echocardiography and hemodynamic monitoring were used to assess cardiac recovery and load responsiveness. Upon early signs of myocardial recovery, an AV bridge with an Hoffman clamp was added to the circuit and weaning was initiated. Support flow was reduced stepwise by 10-15% every 2 to 8 hours while the circuit flow was maintained at 3.5-4.5 L/min. The AV bridge facilitated gradual weaning in all 30 patients (median age: 66 [53-71] years; 21 males) over a median period of 25 [8-32] hours, with a median support duration of 96 [31-181] hours. During weaning, the median left ventricular ejection fraction was 25% [15-32] and the median velocity time integral of the aortic valve was 16 cm [10-23]. Through the weaning period, the mean arterial blood pressure was maintained at 70 mmHg and the activated partial thromboplastin time was 60 ± 10 seconds without additional systemic heparinization. Neither macroscopic thrombus formation in the ELS circuit during and after weaning nor clinically relevant thromboembolism was observed. Incorporation of an AV bridge for weaning from veno-arterial ELS is safe and feasible to gradually wean patients with functional cardiac recovery without compromising the circuit integrity. © The Author(s) 2015.

Quasi-solid polymer electrolytes using photo-cross-linked polymers. Lithium and divalent cation conductors and their applications

Science.gov (United States)

Ikeda, Shoichiro; Mori, Yoichi; Furuhashi, Yuri; Masuda, Hideki; Yamamoto, Osamu

In this report, we will present the results on the photo-cross-linked poly-(ethylene glycol) diacrylate (PEGDA) based quasi-solid, i.e. gel, polymer electrolyte systems with lithium, magnesium and zinc trifluoromethanesulfonates [triflate; M n(CF 3SO 3) n] and their preliminary applications to primary cells. The Celgard® membrane-impregnated electrolytes were prepared in the same manner as Abraham et al. [K.M. Abraham, M. Alamgir, D.K. Hoffman, J. Electrochem. Soc. 142 (1995) 683]. The precursor solutions were composed of metal triflates, ethylene carbonate, propylene carbonate, and tetraethylene glycol diacrylate. The Celgard® #3401 membrane was soaked overnight in the precursor solution, then clamped between two Pyrex glass plates and irradiated with UV light to form a gel electrolyte. The maxima of the conductivity obtained were 4.5×10 -4 S cm -1 at 12 mol% for LiCF 3SO 3, 1.7×10 -4 S cm -1 at 1 mol% for Mg(CF 3SO 3) 2, and 2.1×10 -4 S cm -1 at 4 mol% for Zn(CF 3SO 3) 2 system, respectively. The Arrhenius plots of the conductivities are almost linear between 268 and 338 K with 15-25 kJ/mol of activation energy for conduction. The cell, Li|LiCF 3SO 3-SPE+Celgard® #3401|(CH 3) 4NI 5+acetylene black, showed 2.86 V of OCV and could discharge up to 25% with respect to the cathode active material at a discharging current of 0.075 mA/cm 2.

The Comparison Flow of Four Impression Compounds (Green Stick with ADA Standard

Directory of Open Access Journals (Sweden)

S. Mir Mohammad Rezaei

2004-09-01

Full Text Available Statement of Problem: Low- fusing compound (type 1 is used for border molding and impressions. Flow and reproducibility of surface detail are two important characteristics of these materials. There are no valid data available comparing domestic and imported brands.Purpose: The Purpose of this study was to evaluate these two properties of four different products including Kerr (Kerr Manufacture MI 98174-2600, Harvard (Hoffman Harvard Dental GMb H Germany; Kymia (Kymia dental company 713 Iran; and Pishro (Pishro72534 Iran.Materials and Methods: All procedures were followed according to ADA and BSStandard.Total number of 48 samples were divided into 8 groups (6 in each group.Twenty disks were fabricated for impression tests. The specimen dimensions were 40 mm (diameter and 6mm (thickness. Standard test blocks were used to test the specimens.Results: The Willcoxon test showed significant difference in flow rate between materials tested with the best result for Kerr (P<0.05. Kerr flow was 85% and under 5% at 45°C and 37°C, respectively. There were great deviations from standards value at 45°C. For the rest of the samples at 37°C; except Kymia the flow rate for 3 materials (Kerr; Harvard Pishrowere almost acceptable. The impression test results revealed that only Kerr was able torecord the details at 45°C.Conclusion: Kerr flow is exactly what ADA standards specify. But the flow rate for three materials exhibit a great distance from these standards. In impression test only Kerr was able to record the details

Development of regularized expectation maximization algorithms for fan-beam SPECT data

International Nuclear Information System (INIS)

Kim, Soo Mee; Lee, Jae Sung; Lee, Dong Soo; Lee, Soo Jin; Kim, Kyeong Min

2005-01-01

SPECT using a fan-beam collimator improves spatial resolution and sensitivity. For the reconstruction from fan-beam projections, it is necessary to implement direct fan-beam reconstruction methods without transforming the data into the parallel geometry. In this study, various fan-beam reconstruction algorithms were implemented and their performances were compared. The projector for fan-beam SPECT was implemented using a ray-tracing method. The direct reconstruction algorithms implemented for fan-beam projection data were FBP (filtered backprojection), EM (expectation maximization), OS-EM (ordered subsets EM) and MAP-EM OSL (maximum a posteriori EM using the one-step late method) with membrane and thin-plate models as priors. For comparison, the fan-beam projection data were also rebinned into the parallel data using various interpolation methods, such as the nearest neighbor, bilinear and bicubic interpolations, and reconstructed using the conventional EM algorithm for parallel data. Noiseless and noisy projection data from the digital Hoffman brain and Shepp/Logan phantoms were reconstructed using the above algorithms. The reconstructed images were compared in terms of a percent error metric. For the fan-beam data with Poisson noise, the MAP-EM OSL algorithm with the thin-plate prior showed the best result in both percent error and stability. Bilinear interpolation was the most effective method for rebinning from the fan-beam to parallel geometry when the accuracy and computation load were considered. Direct fan-beam EM reconstructions were more accurate than the standard EM reconstructions obtained from rebinned parallel data. Direct fan-beam reconstruction algorithms were implemented, which provided significantly improved reconstructions

CONTAMINAÇÃO AMBIENTAL POR OVOS DE Ancylostoma spp. E Toxocara spp. EM ÁREAS DE SEIS PRAÇAS PÚBLICAS DO MUNICÍPIO DE VALENÇA, ESTADO DO RIO DE JANEIRO

Directory of Open Access Journals (Sweden)

Filipe Souza de Lima e CIRNE

2017-07-01

Full Text Available A contaminação de praças públicas por ovos de geohelmintos constitui um problema de saúde pública. Nesses locais, ovos ou larvas podem permanecer por muito tempo, até que a infecção ocorra. O objetivo deste trabalho foi verificar a contaminação ambiental por ovos de Ancylostoma spp. e Toxocara spp. em amostras de solos coletadas de praças públicas de Valença, Rio de Janeiro. O trabalho englobou seis praças próximas ao centro da cidade. Foram colhidos 50g de solo de cinco pontos diferentes de cada praça, totalizando-se 30 amostras. Utilizou-se as técnicas de centrífugo-flutuaçãoem solução saturada de açúcar e de Hoffman. A contaminação somente por ovos de Ancylostoma spp. foi de 66,6% (4/6, sendo encontrados ovos em 30% (9/30 das amostras de solo analisadas. A ocorrência de ovos de Ancylostoma spp. nas praças públicas de Valença enfatiza a importância da adoção de medidas restritivas rígidas que impeçam a entrada de animais em locais de recreação para crianças, pois não apenas este, mas outros parasitas são capazes de comprometer a saúde humana e atuar como forma de infecção no ambiente para outros animais. 

Anomalous bodily experiences and perceived social isolation in schizophrenia: An extension of the Social Deafferentation Hypothesis.

Science.gov (United States)

Michael, Jamie; Park, Sohee

2016-10-01

Disturbances of the bodily self are fundamental to the phenomenological experience of individuals with schizophrenia, a population at risk for social isolation. Both proprioception and exteroception contribute to a sense of consistent body boundary that contains the self across time and space, and this process is influenced by self-other (social) interactions. However, the relationship between social isolation, exteroception, and in-the-moment changes in body representation has not been elucidated. We investigated susceptibility to anomalous bodily experiences with a phantom nose induction procedure that elicits a sensation that one's nose is changing (Pinocchio Illusion: PI) in relation to exteroceptive awareness and social isolation. 25 individuals with schizophrenia (SZ) and 15 matched controls (CO) participated in a PI induction procedure to quantify susceptibility to bodily aberrations and a tactile discrimination task to assess exteroception. Clinical symptoms in SZ and schizotypy in CO were assessed, in addition to a self-report measure of perceived social isolation. Compared to CO, SZ showed increased PI and impaired tactile discriminability. SZ reported greater loneliness than CO. PI scores were correlated with increased loneliness and decreased tactile discriminability. Greater susceptibility to anomalous bodily experiences, together with reduced exteroceptive awareness and increased loneliness, is compatible with the framework of Hoffman's Social Deafferentation Hypothesis, which posits that a functional "amputation" from one's social environment could lead to a reorganization of the social brain network, resulting in hallucinations and delusions. These findings underscore the importance of the relationship between social isolation and self-disturbances in schizophrenia. Copyright © 2016 Elsevier B.V. All rights reserved.

APA efforts in promoting human rights and social justice.

Science.gov (United States)

Leong, Frederick T L; Pickren, Wade E; Vasquez, Melba J T

2017-11-01

This article reviews the American Psychological Association's (APA) efforts in promoting human rights and social justice. Beginning with a historical review of the conceptualizations of human rights and social justice, the social challenges that have faced the United States over time are discussed in relation to the APA's evolving mission and strategic initiatives enacted through its boards, committees, and directorates. From early efforts on the Board for Social and Ethical Responsibility in Psychology and the Board of Ethnic Minority Affairs to the establishment of the Public Interest Directorate, the APA's efforts to address these human rights and social justice challenges through its task force reports, guidelines, and policies are described. Specifically, issues related to diversity and underrepresentation of minority group members and perspective within the APA, as well as women's issues (prochoice, violence against women, sexualization of young girls, human trafficking) were central to these efforts. These minority groups included racial and ethnic minority groups; immigrants and refugees; lesbian, gay, bisexual, transgendered, and queer individuals; and those with disabilities. Later attention shifted to broader social justice challenges within a public health perspective, such as AIDS, obesity, and violence. Also included is a brief discussion of the Hoffman Report. The article ends with a discussion of future directions for the APA's efforts related to human rights and social justice related to health disparities, violent extremism, social inequality, migration, cultural and racial diversity, and an evidence-based approach to programming. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

Brain white matter demyelinating lesions and amyotrophic lateral sclerosis in a patient with C9orf72 hexanucleotide repeat expansion.

Science.gov (United States)

Oliveira Santos, Miguel; Caldeira, Inês; Gromicho, Marta; Pronto-Laborinho, Ana; de Carvalho, Mamede

2017-10-01

A hexanucleotide repeat expansion in the C9orf72 gene is associated with amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration. It has been described before four patients with multiple sclerosis (MS) and C9orf72-ALS. However, C9orf72 positivity is not associated with increased risk of MS. Inflammatory pathways related to NF-κB have been linked to ALS and MS, and appear to be important in C9orf72-ALS patients. A 42-year-old woman presented with progressive bulbar symptoms for 9 months. Neurological examination disclosed spastic dysarthria, atrophic tongue with fasciculations, brisk jaw and limb tendon reflexes, and bilateral Hoffman sign. Electrophysiological assessment confirmed ALS. Brain MRI revealed multiple and bilateral juxtacortical and periventricular inflammatory changes, some with gadolinium-enhancement, configuring a probable MS-like pattern. CSF evaluation was unremarkable, with no oligoclonal bands. Visual and somatosensory evoked potentials were normal. Follow-up brain MRI 6 months later showed two new lesions in two relatively characteristic locations of MS, with no gadolinium-enhancement. Genetic screening revealed a C9orf72 expansion. As patient had no clinical manifestation of MS, a diagnosis of radiologically isolated syndrome was considered. We speculate that these demyelinating lesions might facilitate expressivity of C9orf72 expansion, through NF-κB activation. This plausible association may lead to the identification of a therapeutic target in this subgroup of C9orf72-ALS patients. Copyright © 2017 Elsevier B.V. All rights reserved.

Ions upstream of the earth's bow shock: a theoretical comparison of alternative source populations

International Nuclear Information System (INIS)

Schwartz, S.J.; Thomsen, M.F.; Gosling, J.T.

1983-01-01

A theoretical framework is developed for studying trajectories of ions reflected or leaked upstream from the earth's bow shock and subject solely to the Lorentz force in a steady interplanetary magnetic field B and the V x B electric field. We include the effects of a sharp shock potential rise. Expressions are derived for the guiding center motion and gyromotion in a frame (the Hoffman-Teller frame) moving parallel to the shock surface with sufficient speed to transform the incident solar wind velocity into motion entirely along the interplanetary magnetic field: the appropriate equations are also provided to transform these motions back to the observer's frame. The utility of these expressions is illustrated by comparing the predicted upstream motions for four different source models for upstream ions: magnetic moment-conserving reflection of the solar wind ions, specular reflection of solar wind ions, magnetic moment-conserving leakage of magnetosheath ions, and leakage of magnetosheath ions parallel to the shock normal. This comparison reveals that, for identical geometries, the reflection models produce higher energies and/or gyromotion than do the leakage models. We further argue that in a single simple encounter with the shock, an ion should behave in an unmagnetized manner and hence should not conserve its magnetic moment. Conservation of magnetic moment, if it is to occur, would seem to require multiple encounters with the shock. We investigate the conditions under which such multiple encounters can occur and find that under most quasi-parallel geometries neither leaked nor reflected ions should probably conserve their magnetic moments

Neuromuscular function during drop jumps in young and elderly males.

Science.gov (United States)

Piirainen, Jarmo M; Linnamo, Vesa; Sippola, Niina; Avela, Janne

2012-12-01

The Hoffman reflex (H-reflex), indicating alpha-motoneuron pool activity, has been shown to be task - and in resting conditions - age dependent. How aging affects H-reflex activity during explosive movements is not clear at present. The purpose of this study was to examine the effects of aging on H-reflexes during drop jumps, and its possible role in drop jump performance. Ten young (26.8 ± 2.7 years) and twenty elderly (64.2 ± 2.7 years) subjects participated in the study. Maximal drop jump performance and soleus H-reflex response (H/M jump) 20 ms after ground contact were measured in a sledge ergometer. Maximal H-reflex, maximal M-wave, Hmax/Mmax-ratio and H-reflex excitability curves were measured during standing rest. Although in young the H-reflex response (Hmax/Mmax) was 6.5% higher during relaxed standing and 19.7% higher during drop jumps (H jump/M jump) than in the elderly group, these differences were not statistically significant. In drop jumps, the elderly subjects had lower jumping height (30.4%, p push-off force (18.0%, p push-off time (31.0% p push-off force (r = 0.833, p push-off time (r = -0.857, p < 0.01) in young but not in the elderly. Correlations between H-reflex response and jumping parameters in young may indicate different jumping and activation strategies in drop jumps. However, it does not fully explain age related differences in jumping performance, since age related differences in H-reflex activity were non-significant. Copyright © 2012 Elsevier Ltd. All rights reserved.

The fabulous legacy of a Nobel Prize Laureate

Science.gov (United States)

Zitvogel, Laurence; Merad, Miriam; Kroemer, Guido

2012-01-01

The Nobel Prize in Physiology or Medecine 2011 was awarded to Ralph M. Steinman, Jules A. Hoffman and Bruce A. Beutler for the discovery of essential elements of innate immunity, in particular dendritic cells (DCs) and toll-like receptors (TLRs). Antigens become immunogenic and capable of triggering an adaptive immune response involving antigen-specific, MHC- restricted effector T cells, only if they are captured and presented by “accessory” cells. In 1972, Ralph M. Steinman and Zanvil Cohn identified in lymphoid tissues, cells with treelike, arborescent morphology that they named “dendritic cells” (DC) (from the greek word “tree” for tree, δένδρον) with a superior ability to induce alloreactive T cell proliferation in vitro (1978) and to stimulate the rejection of kidney allotransplants in rodents (1982). Thirty years after their discovery, DCare now known to play a seminal role in bridging innate and adaptive immunity, In addition DC are being used in numerous clinical studies all over the world to increase immunity to infectious or tumor-associated antigens. This effort involved the contribution of an international network of basicand clinical scientists spearheaded by Ralph M. Steinman to defineappropriate culture conditions to generate ex vivo DC from circulating or bone marrow precursors, to definefunctionally distinct DC subsets, to identifytheir maturation pathways including those relying on the stimulation of TLRs, and finally to develop DC based-vaccines to immunize patients infected with HIV or affected by cancer. Here, we will detail the history of DC and outline the therapeutic implications of Ralph M. Steinman’s seminal discovery.

The history of cerebral PET scanning: from physiology to cutting-edge technology.

Science.gov (United States)

Portnow, Leah H; Vaillancourt, David E; Okun, Michael S

2013-03-05

To review the discoveries underpinning the introduction of cerebral PET scanning and highlight its modern applications. Important discoveries in neurophysiology, brain metabolism, and radiotracer development in the post-World War II period provided the necessary infrastructure for the first cerebral PET scan. A complete review of the literature was undertaken to search for primary and secondary sources on the history of PET imaging. Searches were performed in PubMed, Google Scholar, and select individual journal Web sites. Written autobiographies were obtained through the Society for Neuroscience Web site at www.sfn.org. A reference book on the history of radiology, Naked to the Bone, was reviewed to corroborate facts and to locate references. The references listed in all the articles and books obtained were reviewed. The neurophysiologic sciences required to build cerebral PET imaging date back to 1878. The last 60 years have produced an evolution of technological advancements in brain metabolism and radiotracer development. These advancements facilitated the development of modern cerebral PET imaging. Several key scientists were involved in critical discoveries and among them were Angelo Mosso, Charles Roy, Charles Sherrington, John Fulton, Seymour Kety, Louis Sokoloff, David E. Kuhl, Gordon L. Brownell, Michael Ter-Pogossian, Michael Phelps, and Edward Hoffman. Neurophysiology, metabolism, and radiotracer development in the postwar era synergized the development of the technology necessary for cerebral PET scanning. Continued use of PET in clinical trials and current developments in PET-CT/MRI hybrids has led to advancement in diagnosis, management, and treatment of neurologic disorders.

Interdependent mechanisms for processing gender and emotion:The special status of angry male faces

Directory of Open Access Journals (Sweden)

Daniel A Harris

2016-07-01

Full Text Available While some models of how various attributes of a face are processed have posited that face features, invariant physical cues such as gender or ethnicity as well as variant social cues such as emotion, may be processed independently (e.g., Bruce & Young, 1986, other models suggest a more distributed representation and interdependent processing (e.g., Haxby, Hoffman, & Gobbini, 2000. Here we use a contingent adaptation paradigm to investigate if mechanisms for processing the gender and emotion of a face are interdependent and symmetric across the happy-angry emotional continuum and regardless of the gender of the face. We simultaneously adapted participants to angry female faces and happy male faces (Experiment 1 or to happy female faces and angry male faces (Experiment 2. In Experiment 1 we found evidence for contingent adaptation, with simultaneous aftereffects in opposite directions: male faces were biased towards angry while female faces were biased towards happy. Interestingly, in the complementary Experiment 2 we did not find evidence for contingent adaptation, with both male and female faces biased towards angry. Our results highlight that evidence for contingent adaptation and the underlying interdependent face processing mechanisms that would allow for contingent adaptation may only be evident for certain combinations of face features. Such limits may be especially important in the case of social cues given how maladaptive it may be to stop responding to threatening information, with male angry faces considered to be the most threatening. The underlying neuronal mechanisms that could account for such asymmetric effects in contingent adaptation remain to be elucidated.

Fast Gaussian kernel learning for classification tasks based on specially structured global optimization.

Science.gov (United States)

Zhong, Shangping; Chen, Tianshun; He, Fengying; Niu, Yuzhen

2014-09-01

For a practical pattern classification task solved by kernel methods, the computing time is mainly spent on kernel learning (or training). However, the current kernel learning approaches are based on local optimization techniques, and hard to have good time performances, especially for large datasets. Thus the existing algorithms cannot be easily extended to large-scale tasks. In this paper, we present a fast Gaussian kernel learning method by solving a specially structured global optimization (SSGO) problem. We optimize the Gaussian kernel function by using the formulated kernel target alignment criterion, which is a difference of increasing (d.i.) functions. Through using a power-transformation based convexification method, the objective criterion can be represented as a difference of convex (d.c.) functions with a fixed power-transformation parameter. And the objective programming problem can then be converted to a SSGO problem: globally minimizing a concave function over a convex set. The SSGO problem is classical and has good solvability. Thus, to find the global optimal solution efficiently, we can adopt the improved Hoffman's outer approximation method, which need not repeat the searching procedure with different starting points to locate the best local minimum. Also, the proposed method can be proven to converge to the global solution for any classification task. We evaluate the proposed method on twenty benchmark datasets, and compare it with four other Gaussian kernel learning methods. Experimental results show that the proposed method stably achieves both good time-efficiency performance and good classification performance. Copyright © 2014 Elsevier Ltd. All rights reserved.

A rigid motion correction method for helical computed tomography (CT)

International Nuclear Information System (INIS)

Kim, J-H; Kyme, A; Fulton, R; Nuyts, J; Kuncic, Z

2015-01-01

We propose a method to compensate for six degree-of-freedom rigid motion in helical CT of the head. The method is demonstrated in simulations and in helical scans performed on a 16-slice CT scanner. Scans of a Hoffman brain phantom were acquired while an optical motion tracking system recorded the motion of the bed and the phantom. Motion correction was performed by restoring projection consistency using data from the motion tracking system, and reconstructing with an iterative fully 3D algorithm. Motion correction accuracy was evaluated by comparing reconstructed images with a stationary reference scan. We also investigated the effects on accuracy of tracker sampling rate, measurement jitter, interpolation of tracker measurements, and the synchronization of motion data and CT projections. After optimization of these aspects, motion corrected images corresponded remarkably closely to images of the stationary phantom with correlation and similarity coefficients both above 0.9. We performed a simulation study using volunteer head motion and found similarly that our method is capable of compensating effectively for realistic human head movements. To the best of our knowledge, this is the first practical demonstration of generalized rigid motion correction in helical CT. Its clinical value, which we have yet to explore, may be significant. For example it could reduce the necessity for repeat scans and resource-intensive anesthetic and sedation procedures in patient groups prone to motion, such as young children. It is not only applicable to dedicated CT imaging, but also to hybrid PET/CT and SPECT/CT, where it could also ensure an accurate CT image for lesion localization and attenuation correction of the functional image data. (paper)

Reversal of behavioral depression by infusion of an alpha-2 adrenergic agonist into the locus coeruleus.

Science.gov (United States)

Simson, P G; Weiss, J M; Hoffman, L J; Ambrose, M J

1986-04-01

This experiment demonstrated that behavioral depression produced by exposure of rats to strong uncontrollable shocks could be reversed by infusion of the alpha-2 adrenergic agonist clonidine into the region of the locus coeruleus (LC). A 20-min infusion, through bilateral cannulae, into the locus coeruleus of clonidine, piperoxane (alpha-2 antagonist) or inactive vehicle (0.85% saline), was given beginning 70 min after the animals were removed from the stress situation. The dose and volume of drug given in the infusion (0.16 microgram/microliter, 0.1 microliter/min) had been previously shown to produce effects specific to the locus coeruleus (Weiss, Simson, Hoffman, Ambrose, Cooper and Webster, 1986; Neuropharmacology 25: 367-384). At the conclusion of the infusion, active behavior of animals was measured in a 15-min swim test. Results showed that stressed animals infused with vehicle exhibited significantly less active behavior in the swim test than did non-stressed animals infused with vehicle, thereby showing the usual behavioral depression seen after exposure to an uncontrollable stress. Stressed animals infused with clonidine showed no difference in active behavior in comparison to non-stressed animals infused with vehicle and showed significantly more activity than did the stressed animals infused with vehicle. Stressed animals infused with piperoxane showed no significant difference in activity in comparison to the stressed animals infused with vehicle and were significantly less active than either the non-stressed animals infused with vehicle or the stressed animals infused with clonidine. Thus, infusion into the locus coeruleus of the alpha-2 agonist clonidine, but not the alpha-2 antagonist piperoxane, eliminated behavioral depression.(ABSTRACT TRUNCATED AT 250 WORDS)

Techniques for Achieving Zero Stress in Thin Films of Iridium, Chromium, and Nickel

Science.gov (United States)

Broadway, David M.; O'Dell, Stephen L.; Ramsey, Brian D.; Weimer, Jeffrey

2015-01-01

We examine techniques for achieving zero intrinsic stress in thin films of iridium, chromium, and nickel deposited by magnetron sputter deposition. The intrinsic stress is further correlated to the microstructural features and physical properties such as surface roughness and optical density at a scale appropriate to soft X-ray wavelengths. The examination of the stress in these materials is motivated by efforts to advance the optical performance of light-weight X-ray space telescopes into the regime of sub-arcsecond resolution through various deposition techniques that rely on control of the film stress to values within 10-100 MPa. A characteristic feature of the intrinsic stress behavior in chromium and nickel is their sensitivity to the magnitude and sign of the intrinsic stress with argon gas pressure and deposition rate, including the existence of a critical argon process pressure that results in zero film stress which scales linearly with the atomic mass of the sputtered species. While the effect of stress reversal with argon pressure has been previously reported by Hoffman and others for nickel and chromium, we report this effect for iridium. In addition to stress reversal, we identify zero stress in the optical functioning iridium layer shortly after island coalescence for low process pressures at a film thickness of approximately 35nm. The measurement of the low values of stress during deposition was achieved with the aid of a sensitive in-situ instrument capable of a minimum detectable level of stress, assuming a 35nm thick film, in the range of 0.40-6.0 MPa for oriented crystalline silicon substrate thicknesses of 70-280 microns, respectively.

Practical aspects of data-driven motion correction approach for brain SPECT

International Nuclear Information System (INIS)

Kyme, A.Z.; Hutton, B.F.; Hatton, R.L.; Skerrett, D.; Barnden, L.

2002-01-01

Full text: Patient motion can cause image artifacts in SPECT despite restraining measures. Data-driven detection and correction of motion can be achieved by comparison of acquired data with the forward-projections. By optimising the orientation of a partial reconstruction, parameters can be obtained for each misaligned projection and applied to update this volume using a 3D reconstruction algorithm. Phantom validation was performed to explore practical aspects of this approach. Noisy projection datasets simulating a patient undergoing at least one fully 3D movement during acquisition were compiled from various projections of the digital Hoffman brain phantom. Motion correction was then applied to the reconstructed studies. Correction success was assessed visually and quantitatively. Resilience with respect to subset order and missing data in the reconstruction and updating stages, detector geometry considerations, and the need for implementing an iterated correction were assessed in the process. Effective correction of the corrupted studies was achieved. Visually, artifactual regions in the reconstructed slices were suppressed and/or removed. Typically the ratio of mean square difference between the corrected and reference studies compared to that between the corrupted and reference studies was > 2. Although components of the motions are missed using a single-head implementation, improvement was still evident in the correction. The need for multiple iterations in the approach was small due to the bulk of misalignment errors being corrected in the first pass. Dispersion of subsets for reconstructing and updating the partial reconstruction appears to give optimal correction. Further validation is underway using triple-head physical phantom data. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc

Least-squares dual characterization for ROI assessment in emission tomography

International Nuclear Information System (INIS)

Ben Bouallègue, F; Mariano-Goulart, D; Crouzet, J F; Dubois, A; Buvat, I

2013-01-01

Our aim is to describe an original method for estimating the statistical properties of regions of interest (ROIs) in emission tomography. Drawn upon the works of Louis on the approximate inverse, we propose a dual formulation of the ROI estimation problem to derive the ROI activity and variance directly from the measured data without any image reconstruction. The method requires the definition of an ROI characteristic function that can be extracted from a co-registered morphological image. This characteristic function can be smoothed to optimize the resolution-variance tradeoff. An iterative procedure is detailed for the solution of the dual problem in the least-squares sense (least-squares dual (LSD) characterization), and a linear extrapolation scheme is described to compensate for sampling partial volume effect and reduce the estimation bias (LSD-ex). LSD and LSD-ex are compared with classical ROI estimation using pixel summation after image reconstruction and with Huesman's method. For this comparison, we used Monte Carlo simulations (GATE simulation tool) of 2D PET data of a Hoffman brain phantom containing three small uniform high-contrast ROIs and a large non-uniform low-contrast ROI. Our results show that the performances of LSD characterization are at least as good as those of the classical methods in terms of root mean square (RMS) error. For the three small tumor regions, LSD-ex allows a reduction in the estimation bias by up to 14%, resulting in a reduction in the RMS error of up to 8.5%, compared with the optimal classical estimation. For the large non-specific region, LSD using appropriate smoothing could intuitively and efficiently handle the resolution-variance tradeoff. (paper)

Least-squares dual characterization for ROI assessment in emission tomography

Science.gov (United States)

Ben Bouallègue, F.; Crouzet, J. F.; Dubois, A.; Buvat, I.; Mariano-Goulart, D.

2013-06-01

Our aim is to describe an original method for estimating the statistical properties of regions of interest (ROIs) in emission tomography. Drawn upon the works of Louis on the approximate inverse, we propose a dual formulation of the ROI estimation problem to derive the ROI activity and variance directly from the measured data without any image reconstruction. The method requires the definition of an ROI characteristic function that can be extracted from a co-registered morphological image. This characteristic function can be smoothed to optimize the resolution-variance tradeoff. An iterative procedure is detailed for the solution of the dual problem in the least-squares sense (least-squares dual (LSD) characterization), and a linear extrapolation scheme is described to compensate for sampling partial volume effect and reduce the estimation bias (LSD-ex). LSD and LSD-ex are compared with classical ROI estimation using pixel summation after image reconstruction and with Huesman's method. For this comparison, we used Monte Carlo simulations (GATE simulation tool) of 2D PET data of a Hoffman brain phantom containing three small uniform high-contrast ROIs and a large non-uniform low-contrast ROI. Our results show that the performances of LSD characterization are at least as good as those of the classical methods in terms of root mean square (RMS) error. For the three small tumor regions, LSD-ex allows a reduction in the estimation bias by up to 14%, resulting in a reduction in the RMS error of up to 8.5%, compared with the optimal classical estimation. For the large non-specific region, LSD using appropriate smoothing could intuitively and efficiently handle the resolution-variance tradeoff.

Prevalência de enteroparasitos em crianças de uma unidade de educação infantil municipal de Rondonópolis – MT

Directory of Open Access Journals (Sweden)

Jéssica Teixeira Zamprone

2017-04-01

Full Text Available Objetivos: Este estudo teve como um de seus objetivos avaliar a presença de enteroparasitos em crianças que frequentavam um Centro de Educação Municipal Infantil (CMEI de Rondonópolis - MT. Métodos: Foram realizadas as coletas das amostras fecais no período de março a maio de 2016 e, posteriormente, analisadas pelo método de Hoffman, Pons e Janer (HPJ no laboratório de Ciências Básicas da Universidade Federal de Mato Grosso, Campus Universitário de Rondonópolis, finalizando com um questionário sócio demográfico de fatores de risco para a infecção. Resultados: Entre as 57 crianças pesquisadas, detectou-se positividade para enteroparasitoses em 10 (17,54% delas, o parasita mais prevalente foi a Giardia lamblia (70%. Em relação ao sexo, a maior positividade das amostras se deu entre crianças do sexo masculino. Conclusão: Os achados dessa pesquisa demonstram que, embora o Ministério da Saúde venha aplicando medidas de controle dos enteroparasitos como o Programa Saúde na Escola, mais medidas deverão ser tomadas, principalmente pelos profissionais de saúde da Atenção Primária. Uma medida simples e eficaz é a educação em saúde executada de forma específica para a conscientização dessas crianças e de seus responsáveis sobre cuidados e higienização para uma melhor qualidade de vida.

Can AIDS drugs be afforded?

Science.gov (United States)

1997-11-01

UNAIDS has launched an 'HIV Drug Access Initiative' in the Ivory Coast, Uganda, Chile, and Vietnam; the pilot project will attempt to improve access to HIV drugs. Public and private sector efforts will be coordinated. The Glaxo Wellcome, Hoffman-La Roche, and Virco pharmaceutical companies will participate. Each country will 1) adapt its present system with regard to HIV and 2) establish both an HIV drug advisory board and a non-profit company which will import the drugs. Health ministries within each country will be required to find sources of funding for the programs. Uganda will probably use funds from its sexually transmitted disease (STD) program, which is supported by the World Bank; the Ivory Coast will combine corporate contributions, new tariffs, and non-profit insurance system monies into a 'solidarity fund.' UNAIDS funds will be used for oversight and evaluation. UNAIDS also released a review of 68 studies which examined the impact of sex education on the sex behavior of young people; it indicated that, in 65 of the studies, sex education did not increase the sexual activity of youth. UNAIDS concluded that quality programs helped delay first intercourse and often reduced the number of sexual partners, resulting in reduced rates of STDs and unplanned pregnancy. UNAIDS further concluded that effective sex education should begin before the onset of sexual activity, and curriculums should be focused. Openness in communicating about sex should be encouraged, and social and media influences on behavior should be addressed. Young people should be taught negotiating skills (how to say 'no' to sex and how to insist on safer sex).

Correction of head motion artifacts in SPECT with fully 3-D OS-EM reconstruction

International Nuclear Information System (INIS)

Fulton, R.R.

1998-01-01

Full text: A method which relies on continuous monitoring of head position has been developed to correct for head motion in SPECT studies of the brain. Head position and orientation are monitored during data acquisition by an inexpensive head tracking system (ADL-1, Shooting Star Technology, Rosedale, British Colombia). Motion correction involves changing the projection geometry to compensate for motion (using data from the head tracker), and reconstructing with a fully 3-D OS-EM algorithm. The reconstruction algorithm can accommodate any number of movements and any projection geometry. A single iteration of 3-D OS-EM using all available projections provides a satisfactory 3-D reconstruction, essentially free of motion artifacts. The method has been validated in studies of the 3-D Hoffman brain phantom. Multiple 36- degree acquisitions, each with the phantom in a different position, were performed on a Trionix triple head camera. Movements were simulated by combining projections from the different acquisitions. Accuracy was assessed by comparison with a motion-free reconstruction, visually and by calculating mean squared error (MSE). Motion correction reduced distortion perceptibly and, depending on the motions applied, improved MSE by up to an order of magnitude. Three-dimensional reconstruction of the 128 x 128 x 128 data set took 2- minutes on a SUN Ultra 1 workstation. This motion correction technique can be retro-fitted to existing SPECT systems and could be incorporated in future SPECT camera designs. It appears to be applicable in PET as well as SPECT, to be able to correct for any head movements, and to have the potential to improve the accuracy of tomographic brain studies under clinical imaging conditions

Development and Assessment of Modules to Integrate Quantitative Skills in Introductory Biology Courses.

Science.gov (United States)

Hoffman, Kathleen; Leupen, Sarah; Dowell, Kathy; Kephart, Kerrie; Leips, Jeff

2016-01-01

Redesigning undergraduate biology courses to integrate quantitative reasoning and skill development is critical to prepare students for careers in modern medicine and scientific research. In this paper, we report on the development, implementation, and assessment of stand-alone modules that integrate quantitative reasoning into introductory biology courses. Modules are designed to improve skills in quantitative numeracy, interpreting data sets using visual tools, and making inferences about biological phenomena using mathematical/statistical models. We also examine demographic/background data that predict student improvement in these skills through exposure to these modules. We carried out pre/postassessment tests across four semesters and used student interviews in one semester to examine how students at different levels approached quantitative problems. We found that students improved in all skills in most semesters, although there was variation in the degree of improvement among skills from semester to semester. One demographic variable, transfer status, stood out as a major predictor of the degree to which students improved (transfer students achieved much lower gains every semester, despite the fact that pretest scores in each focus area were similar between transfer and nontransfer students). We propose that increased exposure to quantitative skill development in biology courses is effective at building competency in quantitative reasoning. © 2016 K. Hoffman, S. Leupen, et al. CBE—Life Sciences Education © 2016 The American Society for Cell Biology. This article is distributed by The American Society for Cell Biology under license from the author(s). It is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

Integrable, oblique travelling waves in quasi-charge-neutral two-fluid plasmas

Directory of Open Access Journals (Sweden)

G. M. Webb

2008-02-01

Full Text Available A Hamiltonian description of oblique travelling waves in a two-fluid, charge-neutral, electron-proton plasma reveals that the transverse momentum equations for the electron and proton fluids are exactly integrable in cases where the total transverse momentum flux integrals, P_y^(d and P_z^(d, are both zero in the de Hoffman Teller (dHT frame. In this frame, the transverse electric fields are zero, which simplifies the transverse momentum equations for the two fluids. The integrable travelling waves for the case P_y^(d=P_z^(d=0, are investigated based on the Hamiltonian trajectories in phase space, and also on the longitudinal structure equation for the common longitudinal fluid velocity component u_x of the electron and proton fluids. Numerical examples of a variety of travelling waves in a cold plasma, including oscillitons, are used to illustrate the physics. The transverse, electron and proton velocity components u_jy and u_jz (j=e, p of the waves exhibit complex, rosette type patterns over several periods for u_x. The role of separatrices in the phase space, the rotational integral and the longitudinal structure equation on the different wave forms are discussed.

X-linked lethal infantile spinal muscular atrophy: From clinical description to molecular mapping

Energy Technology Data Exchange (ETDEWEB)

Baumbach, L.; Schiavi, A. [Univ. of Miami, FL (United States)] [and others

1994-09-01

The proximal spinal muscular atrophies (PSMA), one of the most common forms of lower motor neuron disease in children, are characterized by progressive muscle weakness due to loss of anterior horn cells. All three autosomal recessive forms have been mapped to chromosome 5q11.2-11.3, implying an allelic association between these disorders. Recent evidence from our laboratories, as well as others, suggests that a distinct form of lethal neonatal spinal muscular atrophy, associated with early onset contractures, is determined by a gene on the X chromosome. We report our efforts in mapping this disease locus. Our original studies have focused on two unrelated multigenerational families with similar clinical presentations of severe hypotonia, muscle weakness, and a disease course similar to Werdnig Hoffman except for the additional finding of congenital or early onset contractures. Muscle biopsy and/or autopsy were indicative of anterior horn cell loss in affected males. Disease occurrence in each of the families was consistent with an X-linked recessive mode of inheritance. Subsequently, two additional families have been identified, as well as several sporadic male cases. Linkage analysis has been completed in one of these families using highly polymorphic repeats dispersed 10 cM on the X chromosome. Interpretation of results was achieved using an automated data acquisition program. Analysis of over 300 haplotypes generated using PCR-based DNA markers have identified two 16 cM regions on Xp with complete concordance to the disease phenotype. Our currents efforts are focused on the region surrounding the Kallman gene, in attempts to better define a candidate region, as well as analyze possible candidate genes within this region.

Tc-99m ECD brain SPET in the evaluation of dementia for institutionalized elderly patients

International Nuclear Information System (INIS)

Lee, Myoung Hoon; Park, Chan H.; Yoon, Seok Na.; Hwang, Kyung Hoon

2001-01-01

Dementia is one of the clinically recognized indications of regional cerebral blood flow (rCBF) measurement by Tc-99m ECD brain SPET (Single Photon Emission Tomography). There is only limited number of institutions for elderly demented patients who are institutionalized in Korea and SPET is nor available at these institutions. The aim of the study is to evaluate rCBF SPET findings of the patients from such an institution. Thirty-one patients were reffered for rCBF SPET from Yongin Hyoja Hospital, Yongin. They were screened using NINCDS-ADRDA criteria for probable Alzheimers disease (AD) and dementia severity was assumed by the Mini-Mental State examination. In a quite, dim light room, patients were injected with 740 mBq (20mCi) Tc-99m ethyl cysteinate dimmer (ECD), Neurolite R, Dupont Pharmaceuticals, Billerica, MA, USA). SPET was acquired using fanbeam collimators and triple-head gamma camera (MultiSPECT III, Siemens medical systems. Inc. Hoffman Estates, III.USA). SPET was done one hour after the tracer injection and most of the patients needed sedation 30 minutes before the scan. SPET was evaluated visually by 2 nuclear medicine physicians blinded to clinical information. The SPET scans of 31 patients revealed 3 typical AD, 9 atypical AD patterns. Other dementia patterns were 4 cases of frontotemporal lobe dementia, 5 cases of frontal lobe dementia and 2 multifocal infarctions. Only cerebral atrophy is depicted in 8 patients and normal SPECT findings was noted in one patient. Patients who are institutionalized for dementia have varying SPET patterns as expected and SPET findings are useful in the management of these patients with more clearer clinical insight

Cortical Contribution to Linear, Non-linear and Frequency Components of Motor Variability Control during Standing.

Science.gov (United States)

König Ignasiak, Niklas; Habermacher, Lars; Taylor, William R; Singh, Navrag B

2017-01-01

Motor variability is an inherent feature of all human movements and reflects the quality of functional task performance. Depending on the requirements of the motor task, the human sensory-motor system is thought to be able to flexibly govern the appropriate level of variability. However, it remains unclear which neurophysiological structures are responsible for the control of motor variability. In this study, we tested the contribution of cortical cognitive resources on the control of motor variability (in this case postural sway) using a dual-task paradigm and furthermore observed potential changes in control strategy by evaluating Ia-afferent integration (H-reflex). Twenty healthy subjects were instructed to stand relaxed on a force plate with eyes open and closed, as well as while trying to minimize sway magnitude and performing a "subtracting-sevens" cognitive task. In total 25 linear and non-linear parameters were used to evaluate postural sway, which were combined using a Principal Components procedure. Neurophysiological response of Ia-afferent reflex loop was quantified using the Hoffman reflex. In order to assess the contribution of the H-reflex on the sway outcome in the different standing conditions multiple mixed-model ANCOVAs were performed. The results suggest that subjects were unable to further minimize their sway, despite actively focusing to do so. The dual-task had a destabilizing effect on PS, which could partly (by 4%) be counter-balanced by increasing reliance on Ia-afferent information. The effect of the dual-task was larger than the protective mechanism of increasing Ia-afferent information. We, therefore, conclude that cortical structures, as compared to peripheral reflex loops, play a dominant role in the control of motor variability.

The conceptual design of a hybrid life support system based on the evaluation and comparison of terrestrial testbeds

Science.gov (United States)

Czupalla, M.; Horneck, G.; Blome, H. J.

This report summarizes a trade study of different options of a bioregenerative Life Support System (LSS) and a subsequent conceptual design of a hybrid LSS. The evaluation was based mainly on the terrestrial testbed projects MELISSA (ESA) and BIOS (Russia). In addition, some methods suggested by the Advanced Life Support Project (NASA) were considered. Computer models, including mass flows were established for each of the systems with the goal of closing system loops to the extent possible. In order to cope with the differences in the supported crew size and provided nutrition, all systems were scaled for supporting a crew of six for a 780 day Mars mission (180 days transport to Mars; 600 days surface period) as given in the NASA Design Reference Mission Scenario [Hoffman, S.J., Kaplan, D.L. Human exploration of Mars: the Reference Mission of the NASA Mars Exploratory Study, 1997]. All models were scaled to provide the same daily allowances, as of calories, to the crew. Equivalent System Mass (ESM) analysis was used to compare the investigated system models against each other. Following the comparison of the terrestrial systems, the system specific subsystem options for Food Supply, Solid Waste Processing, Water Management and Atmosphere Revitalization were evaluated in a separate trade study. The best subsystem technologies from the trade study were integrated into an overall design solution based on mass flow relationships. The optimized LSS is mainly a bioregenerative system, complemented by a few physico-chemical elements, with a total ESM of 18,088 kg, which is about 4 times higher than that of a pure physico-chemical LSS, as designed in an earlier study.

Retrospective chart review of a referenced EEG database in assisting medication selection for treatment of depression in patients with eating disorders

Directory of Open Access Journals (Sweden)

Greenblatt JM

2011-09-01

Full Text Available James M Greenblatt1, Craig Sussman1, Mariko Jameson1, Lee Yuan1, Daniel A Hoffman2, Dan V Iosifescu31Comprehensive Psychiatric Resources, Waltham, MA, USA; 2Neuro-Therapy Clinic Inc, Denver, CO, USA; 3Mood and Anxiety Disorders Program, Mount Sinai School of Medicine, New York, NY, USABackground: A retrospective chart review was undertaken in a private clinic to examine the clinical outcomes for patients with an eating disorder comorbid with depression or bipolar illness who underwent a referenced electroencephalographic (EEG database analysis to help guide medication selection.Method: We examined 33 charts for patients with the primary psychiatric diagnosis of an eating disorder and comorbid major depressive disorder or bipolar disorder who underwent a quantitative EEG database assessment to provide additional information for choices of medication. The current analysis includes data from 22 subjects who accepted treatments based on information from the referenced-EEG medication database. Hamilton Depression Rating Scale, Clinical Global Impression-Severity, Clinical Global Impression-Improvement, and hospitalization data were examined for these patients.Results: Patients whose EEG data was used for clinical treatment reported significant decreases in associated depressive symptoms (HDRS scores, overall severity of illness (Clinical Global Impression-Severity, and overall clinical global improvement (Clinical Global Impression-Improvement. This cohort also reported fewer inpatient, residential, and partial hospitalization program days following referenced-EEG compared with the two-year period prior to treatment.Conclusion: These findings are consistent with previously reported data for patients with eating disorders and suggest the need for future studies using EEG data correlated with those from other patients with similar quantitative EEG features.Keywords: eating disorders, anorexia, bulimia, depression, referenced-EEG, chart review

Progressive muscular dystrophy: Duchenne type. Controversies of the kinesitherapy treatment

Directory of Open Access Journals (Sweden)

Ana Valéria de Araujo Leitão

Full Text Available The authors carried out a study of children with progressive muscular dystrophy of Duchenne type (DMD, giving special attention to physiatrical follow-up, having in mind that the practice of exercises has been debated very much in the specialized literature. The goal of this study is to try to settle the limits for the utilization of kinesitherapy which should be applied only in specific situations, such as: after skeletal muscular trauma or when the respiratory system is at risk. In this situation the physiatrical procedure would be to restrict physical activity, with early use of wheelchairs and the exclusion of the use of orthoses for orthostatism. DMD, at present, has been considered a result of duplication (60%, deletion (5 to 6% or point mutations at gen Xp21 (Zatz, 1994, that codifies a protein called Dystrophin ( Hoffman et al., 1987. Dystrophin is a cytoskeletal sarcolemmic protein that constitutes about .002% of the total protein of the muscle, present in skeletal fibers concentrated in muscle tendinous joints, which supplies mechanical reinforcement to the surface of the membrane during stretching and shortening physical activity. This protein is absent in DMD cases, wherefore, the sarcolemma undergoes a segmentary necrosis losing its contractile property during eccentric and concentric physical activity. The importance of physiatrical follow-up for DMD patients is to avoid deformities and tendon shortening, to ameliorate the patient's quality of life, to provide respiratory assistance and general couseling to members of the patient's family. The objective of this study is to try to clarify the risks and possibilities of kinesitherapy applied to DMD cases.

New host record and molecular characterization of Dicauda atherinoidi Hoffman & Walker (Bivalvulida: Myxobolidae): a parasite of the emerald shiner Notropis atherinoides Rafinesque, 1818 and mimic shiner Notropis vollucellus Cope, 1865.

Science.gov (United States)

Loch, T P; Rosser, T G; Baumgartner, W A; Boontai, T; Faisal, M; Griffin, M J

2017-10-01

Updated morphological and histopathological descriptions for Dicauda atherinoidi (Bivalvulida:Myxobolidae) and an expanded host range are supplemented with the first molecular data and phylogenetic analyses of the genus. Plasmodia were located on the head, ventrum/body and fins of infected emerald shiner Notropis atherinoides Rafinesque, 1818 and mimic shiner Notropis vollucellus Cope, 1865, a new host species. Myxospores were spherical, ranging 9.3-11.4 μm (10.5 ± 0.4) in length, 9.0-11.0 μm (9.7 ± 0.4) in width and 6.6-7.0 μm (6.8 ± 0.2) thick in sutural view, and possessed 2-3 caudal processes (5.3-68.3 μm, 31.1 ± 13.6) connected to the spore body at the sutural groove, all of which are consistent with the genus Dicauda. In the absence of available Dicauda sequence data, the 18S rDNA sequences from Michigan isolates were most similar to Myxobolus spp. Phylogenetic analyses clustered these isolates with myxobolid species from cyprinid fish, suggesting these parasites may represent an underpopulated group of cyprinid-infecting myxozoans. Histopathology revealed thin-walled plasmodial pseudocysts in the dermis and associated connective tissue, where granulomatous inflammation and focal scale atrophy were also present. Further sampling/sequencing of myxobolids from Notropis spp. should expand these underrepresented myxozoans and offer further insight into Myxobolidae host family tropisms. © 2017 John Wiley & Sons Ltd.

Pin Wire Coating Trip Report

International Nuclear Information System (INIS)

Spellman, G P

2004-01-01

A meeting to discuss the current pin wire coating problems was held at the Reynolds plant in Los Angeles on 2MAR04. The attendance list for Reynolds personnel is attached. there was an initial presentation which gave a brief history and the current status of pin wire coating at Reynolds. There was a presentation by Lori Primus on the requirements and issues for the coating. There was a presentation by Jim Smith of LANL on the chemistry and to some extent process development done to date. There was a long session covering what steps should be taken in the short term and, to a lesser extent, the long term. The coating currently being used is a blend of two polymers, polyethersulfone and polyparabanic acid (PPA) and some TiO2 filler. This system was accepted and put into production when the pin wire coating was outsourced to another company in 1974. When that company no longer was interested, the wire coating was brought in-house to Reynolds. At that time polyparabanic acid was actually a commercial product available from Exxon under the trade name Tradlon. However, it appears that the material used at Reynolds was synthesized locally. Also, it appears that a single large batch was synthesized in that time period and used up to 1997 when the supply ran out. The reason for the inclusion of TiO2 is not known although it does act as a rheological thickener. However, a more controlled thickening can be obtained with materials such as fumed silica. This material would have less likelihood of causing point imperfections in the coatings. Also, the mixing technique being used for all stages of the process is a relatively low shear ball mill process and the author recommends a high shear process such as a three roll paint mill, at least for the final mixing. Since solvent is added to the powder at Reynolds, it may be that they need to have the paint mill there

Implementation of innovative pulsed xenon ultraviolet (PX-UV environmental cleaning in an acute care hospital

Directory of Open Access Journals (Sweden)

Fornwalt L

2014-01-01

Full Text Available Lori Fornwalt,1 Brad Riddell1,2 1Departments of Infection Prevention and Environmental Services, Trinity Medical Centre, Birmingham, AL, 2Environmental Services, Medical University of South Carolina, Charleston, SC, USA Abstract: It is widely acknowledged that the hospital environment is an important reservoir for many of the pathogenic microbes associated with health care-associated infections (HAIs. Environmental cleaning plays an important role in the prevention and containment of HAIs, in patient safety, and the overall experience of health care facilities. New technologies, such as pulsed xenon ultraviolet (PX-UV light systems are an innovative development for enhanced cleaning and decontamination of hospital environments. A portable PX-UV disinfection device delivers pulsed UV light to destroy microbial pathogens and spores, and can be used in conjunction with manual environmental cleaning. In addition, this technology facilitates thorough disinfection of hospital rooms in 10–15 minutes. The current study was conducted to evaluate whether the introduction of the PX-UV device had a positive impact on patient satisfaction. Satisfaction was measured using the Hospital Consumer Assessment of Healthcare Providers and Systems (HCAHPS survey. In 2011, prior to the introduction of the PX-UV system, patient HCAHPS scores for cleanliness averaged 75.75%. In the first full quarter after enhanced cleaning of the facility was introduced, this improved to 83%. Overall scores for the hospital rose from 76% (first quarter, 2011 to 87.6% (fourth quarter, 2012. As a result of this improvement, the hospital received 1% of at-risk reimbursement from the inpatient prospective payment system as well as additional funding. Cleanliness of the hospital environment is one of the questions included in the HCAHPS survey and one measure of patient satisfaction. After the introduction of the PX-UV system, the score for cleanliness and the overall rating of the

Ocular oxyspirurosis of primates in zoos: intermediate host, worm morphology, and probable origin of the infection in the Moscow zoo

Directory of Open Access Journals (Sweden)

Ivanova E.

2007-12-01

Full Text Available Over the last century, only two cases of ocular oxyspirurosis were recorded in primates, both in zoos, and two species were described: in Berlin, Germany, Oxyspirura (O. conjunctivalis from the lemurid Microcebus murinus, later also found in the lorisid Loris gracilis; in Jacksonville, Florida, O. (O. youngi from the cercopithecid monkey Erythrocebus patas. In the present case from the Moscow zoo, oxyspirurosis was recorded in several species of Old World lemuriforms and lorisiforms, and some South American monkeys. i The intermediate host was discovered to be a cockroach, as for O. (O. mansoni, a parasite of poultry. The complete sequence identity between ITS-1 rDNA from adult nematodes of the primate and that of the larval worms from the vector, Nauphoete cinerea, confirmed their conspecificity. ii Parasites from Moscow zoo recovered from Nycticebus c. coucang were compared morphologically to those from other zoos. The length and shape of the gubernaculum, used previously as a distinct character, were found to be variable. However, the vulvar bosses arrangement, the distal extremity of left spicule and the position of papillae of the first postcloacal pair showed that the worms in the different samples were not exactly identical and that each set seemed characteristic of a particular zoo. iii The presence of longitudinal cuticular crests in the infective stage as well as in adult worms was recorded. Together with several other morphological and biological characters (long tail and oesophagus, cockroach vector, this confirmed that Oxyspirura is not closely related to Thelazia, another ocular parasite genus. iv The disease in the Moscow zoo is thought to have started with Nycticebus pygmaeus imported fromVietnam, thus the suggestion was that Asiatic lorisids were at the origin of the Moscow set of cases. The natural host(s for the Berlin and Jacksonville cases remain unknown but they are unlikely to be the species found infected in zoos

Use of an interdisciplinary, participatory design approach to develop a usable patient self-assessment tool in atrial fibrillation

Directory of Open Access Journals (Sweden)

MacCallum L

2013-11-01

Full Text Available Lori MacCallum,1,2 Heather McGaw,1 Nazanin Meshkat,3 Alissia Valentinis,4 Leslie Beard Ashley,5 Rajan Sacha Bhatia,3,6,7 Kaye Benson,7 Noah Ivers,6,8 Kori Leblanc,2,7 Dante Morra3,5,7 1Li Ka Shing Knowledge Institute, St Michael's Hospital, Toronto, 2Leslie Dan Faculty of Pharmacy, University of Toronto, 3Department of Medicine, University of Toronto, Toronto, 4Taddle Creek Family Health Team, Toronto, 5Trillium Health Partners, Mississauga, 6Women's College Hospital, Toronto, 7Centre for Innovation in Complex Care, University Health Network, Toronto, 8Department of Family and Community Medicine, University of Toronto, Toronto, ON, Canada Abstract: After identifying that significant care gaps exist within the management of atrial fibrillation (AF, a patient-focused tool was developed to help patients better assess and manage their AF. This tool aims to provide education and awareness regarding the management of symptoms and stroke risk associated with AF, while engaging patients to identify if their condition is optimally managed and to become involved in their own care. An interdisciplinary group of health care providers and designers worked together in a participatory design approach to develop the tool with input from patients. Usability testing was completed with 22 patients of varying demographics to represent the characteristics of the patient population. The findings from usability testing interviews were used to further improve and develop the tool to improve ease of use. A physician-facing tool was also developed to help to explain the tool and provide a brief summary of the 2012 Canadian Cardiovascular Society atrial fibrillation guidelines. By incorporating patient input and human-centered design with the knowledge, experience, and medical expertise of health care providers, we have used an approach in developing the tool that tries to more effectively meet patients' needs. Keywords: patient education, atrial fibrillation, care gaps

Factors that Influence the Price of Al, Cd, Co, Cu, Fe, Ni, Pb, Rare Earth Elements, and Zn

Science.gov (United States)

Papp, John F.; Bray, E. Lee; Edelstein, Daniel L.; Fenton, Michael D.; Guberman, David E.; Hedrick, James B.; Jorgenson, John D.; Kuck, Peter H.; Shedd, Kim B.; Tolcin, Amy C.

2008-01-01

This report is based on a presentation delivered at The 12th International Battery Materials Recycling Seminar, March 17-20, 2008, Fort Lauderdale, Fla., about the factors that influence prices for aluminum, cadmium, cobalt, copper, iron, lead, nickel, rare earth elements, and zinc. These are a diverse group of metals that are of interest to the battery recycling industry. Because the U.S. Geological Survey (USGS) closely monitors, yet neither buys nor sells, metal commodities, it is an unbiased source of metal price information and analysis. The authors used information about these and other metals collected and published by the USGS (U.S. production, trade, stocks, and prices and world production) and internationally (consumption and stocks by country) from industry organizations, because metal markets are influenced by activities and events over the entire globe. Long-term prices in this report, represented by unit values, were adjusted to 1998 constant dollars to remove the effects of inflation. A previous USGS study in this subject area was 'Economic Drivers of Mineral Supply' by Lorie A. Wagner, Daniel E. Sullivan, and John L. Sznopek (USGS Open File Report 02-335). By seeking a common cause for common behavior of prices among the various metal commodities, the authors found that major factors that influence prices of metal commodities were international events such as wars and recessions, and national events such as the dissolution of the Soviet Union in 1991 and economic growth in China, which started its open door policy in the 1970s but did not have significant market impact until the 1990s. Metal commodity prices also responded to commodity-specific events such as tariff or usage changes or mine strikes. It is shown that the prices of aluminum, cadmium, copper, iron, lead, nickel, and zinc are at historic highs, that world stocks are at (or near) historic lows, and that China's consumption of these metals had increased substantially, making it the world

The Impact of Discovering Life beyond Earth

Science.gov (United States)

Dick, Steven J.

2016-01-01

Introduction: astrobiology and society Steven J. Dick; Part I. Motivations and Approaches. How Do We Frame the Problems of Discovery and Impact?: Introduction; 1. Current approaches to finding life beyond earth, and what happens if we do Seth Shostak; 2. The philosophy of astrobiology: the Copernican and Darwinian presuppositions Iris Fry; 3. History, discovery, analogy: three approaches to the impact of discovering life beyond earth Steven J. Dick; 4. Silent impact: why the discovery of extraterrestrial life should be silent Clément Vidal; Part II. Transcending Anthropocentrism. How Do We Move beyond our Own Preconceptions of Life, Intelligence and Culture?: Introduction; 5. The landscape of life Dirk Schulze-Makuch; 6. The landscape of intelligence Lori Marino; 7. Universal biology: assessing universality from a single example Carlos Mariscal; 8. Equating culture, civilization, and moral development in imagining extraterrestrial intelligence: anthropocentric assumptions? John Traphagan; 9. Communicating with the other: infinity, geometry, and universal math and science Douglas Vakoch; Part III. Philosophical, Theological, and Moral Impact. How Do We Comprehend the Cultural Challenges Raised by Discovery?: Introduction; 10. Life, intelligence and the pursuit of value in cosmic evolution Mark Lupisella; 11. 'Klaatu barada nikto' - or, do they really think like us? Michael Ruse; 12. Alien minds Susan Schneider; 13. The moral subject of astrobiology: guideposts for exploring our ethical and political responsibilities towards extraterrestrial life Elspeth Wilson and Carol Cleland; 14. Astrobiology and theology Robin Lovin; 15. Would you baptize an extraterrestrial? Guy Consolmagno, SJ; Part IV. Practical Considerations: How Should Society Prepare for Discovery - and Non-Discovery?: Introduction; 16. Is there anything new about astrobiology and society? Jane Maienschein; 17. Evaluating preparedness for the discovery of extraterrestrial life: considering potential

Simulating Durum Wheat (Triticum turgidum L. Response to Root Zone Salinity based on Statistics and Macroscopic Models

Directory of Open Access Journals (Sweden)

Vahid Reza Jalali

2017-10-01

Full Text Available Introduction Salinity as an abiotic stress can cause excessive disturbance for seed germination and plant sustainable production. Salinity with three different mechanisms of osmotic potential reduction, ionic toxicity and disturbance of plant nutritional balance, can reduce performance of the final product. Planning for optimal use of available water and saline water with poor quality in agricultural activities is of great importance. Wheat is one of the eight main food sources including rice, corn, sugar beet, cattle, sorghum, millet and cassava which provide 70-90% of all calories and 66-90% of the protein consumed in developing countries. Durum wheat (Triticum turgidum L. is an important crop grows in some arid and semi-arid areas of the world such as Middle East and North Africa. In these regions, in addition to soil salinity, sharp decline in rainfall and a sharp drop in groundwater levels in recent years has emphasized on the efficient use of limited soil and water resources. Consequently, in order to use brackish water for agricultural productions, it is required to analyze its quantitative response to salinity stress by simulation models in those regions. The objective of this study is to assess the capability of statistics and macro-simulation models of yield in saline conditions. Materials and methods In this study, two general approach of simulation includes process-physical models and statistical-experimental models were investigated. For this purpose, in order to quantify the salinity effect on seed relative yield of durum wheat (Behrang Variety at different levels of soil salinity, process-physical models of Maas & Hoffman, van Genuchten & Hoffman, Dirksen et al. and Homaee et al. models were used. Also, statistical-experimental models of Modified Gompertz Function, Bi-Exponential Function and Modified Weibull Function were used too. In order to get closer to real conditions of growth circumstances in saline soils, a natural saline

Avaliação terapêutica do praziquantel (Embay 8440 na infecção humana pelo S. mansoni Therapeutical investigation of praziquantel in human infection due to Schistosoma mansoni

Directory of Open Access Journals (Sweden)

Silvino Alves de Carvalho

1984-02-01

Full Text Available Foram tratados com praziquantel, dose oral única de 40 ou 50 mg/kg, 200 indivíduos portadores de esquistossomose mansoni, matriculados na Clínica de Doenças Infecciosas e Parasitárias do Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo. As idades dos pacientes variavam de seis a 63 anos, sendo que 33 (16,5% eram menores de 15 anos. Os principais efeitos colaterais consistiram em tontura 27,5%; sonolência 21,0%; eólica 17,5%; náusea 16,0%; diarréia 9,0%; cefaléia 7,5%; vômito 4,0%; febre 2,0%; disenteria 1,0%; tremor 1,0%; exantema 1,0% e urticaria 0,5%. A toxicidade do medicamento foi investigada mediante a realização, pré e pós-tratamento, de exames hematimétricos, bem como de função renal (uréia e creatinina, hepática (enzimas de liberação hépato-canalicular e bilirrubinas, cardíaca (ECG e neuropsiquiátrica (EEG. Não foram encontradas nesses controles alterações relevantes que repercutissem clinicamente. O controle de cura verificou-se em 115 indivíduos, através de oito coproscopias, no período de seis meses, subseqüente ao tratamento, utilizando-se duas técnicas (HOFFMAN e KATO/KATZ para cada amostra de fezes. Dos 82 indivíduos que tiveram as oito coproscopias negativadas, 62 realizaram biópsia retal. Essa mostrou-se positiva em duas oportunidades, indicando um percentual de 3,2% de achados falsos negativos com relação às coproscopias. Os índices de cura variaram de 65,2%, nos pacientes menores de 15 anos, a 75% nos acima dessa idade. Para todas as faixas etárias a eficácia foi de 71,3%. Os resultados obtidos demonstram ter o praziquantel, nas doses empregadas, relativa eficácia no tratamento da esquistossomose mansoni, bem como ser determinante de baixos efeitos tóxico-colaterais.Two hundred patients with schistosomiasis mansoni, registered in the Infectious and Parasitic Disease Ward, Hospital das Clínicas, Faculdade de Medicina, Universidade de São Paulo, were

Large-scale retrospective evaluation of regulated liquid chromatography-mass spectrometry bioanalysis projects using different total error approaches.

Science.gov (United States)

Tan, Aimin; Saffaj, Taoufiq; Musuku, Adrien; Awaiye, Kayode; Ihssane, Bouchaib; Jhilal, Fayçal; Sosse, Saad Alaoui; Trabelsi, Fethi

2015-03-01

The current approach in regulated LC-MS bioanalysis, which evaluates the precision and trueness of an assay separately, has long been criticized for inadequate balancing of lab-customer risks. Accordingly, different total error approaches have been proposed. The aims of this research were to evaluate the aforementioned risks in reality and the difference among four common total error approaches (β-expectation, β-content, uncertainty, and risk profile) through retrospective analysis of regulated LC-MS projects. Twenty-eight projects (14 validations and 14 productions) were randomly selected from two GLP bioanalytical laboratories, which represent a wide variety of assays. The results show that the risk of accepting unacceptable batches did exist with the current approach (9% and 4% of the evaluated QC levels failed for validation and production, respectively). The fact that the risk was not wide-spread was only because the precision and bias of modern LC-MS assays are usually much better than the minimum regulatory requirements. Despite minor differences in magnitude, very similar accuracy profiles and/or conclusions were obtained from the four different total error approaches. High correlation was even observed in the width of bias intervals. For example, the mean width of SFSTP's β-expectation is 1.10-fold (CV=7.6%) of that of Saffaj-Ihssane's uncertainty approach, while the latter is 1.13-fold (CV=6.0%) of that of Hoffman-Kringle's β-content approach. To conclude, the risk of accepting unacceptable batches was real with the current approach, suggesting that total error approaches should be used instead. Moreover, any of the four total error approaches may be used because of their overall similarity. Lastly, the difficulties/obstacles associated with the application of total error approaches in routine analysis and their desirable future improvements are discussed. Copyright © 2015 Elsevier B.V. All rights reserved.

Outcomes and benefits of pediatric cochlear implantation in children with additional disabilities: a review and report of family influences on outcomes

Directory of Open Access Journals (Sweden)

Cejas I

2015-05-01

Full Text Available Ivette Cejas,1 Michael F Hoffman,2 Alexandra L Quittner21Department of Otolaryngology, University of Miami Miller School of Medicine, 2Department of Psychology, University of Miami, Miami, FL, USAAbstract: The number of children with hearing loss with additional disabilities receiving cochlear implantation has increased dramatically over the past decade. However, little is known about their auditory and speech and language development following implantation. The purpose of this review is to evaluate the effects of cochlear implantation on the most common genetic and developmental disorders in children with hearing loss. Benefits of cochlear implantation for children with autism spectrum disorder, developmental delay, CHARGE syndrome, cerebral palsy, learning disorders, Usher syndrome, Waardenburg syndrome, and attention deficit/hyperactivity disorder are reviewed. Our review indicates that children with hearing loss and additional disabilities benefit from cochlear implantation, especially when implanted early. Thus, early interventions seem as important for these children as for deaf children without additional disabilities. Comparisons of outcomes across these disabilities indicate that children with little to no cognitive impairment (eg, Waardenburg sydrome, attention deficit hyperactivity disorder have better outcomes than those with greater deficits in intellectual functioning (eg, autism, CHARGE syndrome. In addition, parents of children with hearing loss and additional disabilities report higher levels of parenting stress and greater child behavior problems than those without comorbid diagnoses. However, these parents are as sensitive when interacting with their children as parents with typically developing children using cochlear implantation. Given these results, it is critical to evaluate these children's developmental milestones to provide early implantation and intervention, appropriately counsel families regarding realistic

Enteroparasitoses em manipuladores de alimentos de escolas públicas em Uberlândia (Minas Gerais, Brasil

Directory of Open Access Journals (Sweden)

Carlos Henrique A. de Rezende

1997-12-01

Full Text Available Procedeu-se ao controle das enteroparasitoses em manipuladores de alimentos de escolas públicas de primeiro grau de Uberlândia, Minas Gerais, a partir de estudo prospectivo baseado em inquérito parasitológico. Foram acompanhados 264 indivíduos de 57 escolas, com três coletas de fezes (C, sendo C1 em setembro de 1989, C2 em abril de 1990 e C3 em setembro de 1990. Entre os participantes 259 eram do sexo feminino e cinco do sexo masculino, com idades entre 20 e 66 anos. As 792 amostras de fezes foram conservadas em formol a 10% e analisadas pelo método de Hoffman, Pons e Janer. A ocorrência de parasitas intestinais foi de 17, 10 e 10% para C1, C2, e C3, respectivamente. Em C1 detectou-se: Giardia lamblia (8%, ancilostomídeos (6%, Ascaris lumbricoides (3%, Entamoeba histolytica, (2%, Strongyloides stercoralis, Hymenolepis nana, Taenia sp. e Trichuris trichiura (menos de 1% cada um deles. Em C2 detectou-se: ancilostomídeos (5%, G. lamblia (2%, A. lumbricoides (1%, S. stercoralis, H. nana, Taenia sp., Enterobius vermicularis (menos de 1% cada um deles. Em C3 observou-se: ancilostomídeos (5%, G. lamblia (3%, A. lumbricoides (2%, S. stercoralis e E. vermicularis (menos de 1% cada um deles. Os indivíduos infectados receberam tratamento específico após o diagnóstico em cada coleta. Recomendamos a implantação de vigilância epidemiológica através do exame parasitológico periódico, tratamento específico e treinamento sobre manejo higiênico de alimentos e higiene pessoal para todos os manipuladores de alimentos.

Circle of Security–Parenting: A randomized controlled trial in Head Start

Science.gov (United States)

CASSIDY, JUDE; BRETT, BONNIE E.; GROSS, JACQUELYN T.; STERN, JESSICA A.; MARTIN, DAVID R.; MOHR, JONATHAN J.; WOODHOUSE, SUSAN S.

2017-01-01

Although evidence shows that attachment insecurity and disorganization increase risk for the development of psychopathology (Fearon, Bakermans-Kranenburg, van IJzendoorn, Lapsley, & Roisman, 2010; Groh, Roisman, van IJzendoorn, Bakermans-Kranenburg, & Fearon, 2012), implementation challenges have precluded dissemination of attachment interventions on the broad scale at which they are needed. The Circle of Security–Parenting Intervention (COS-P; Cooper, Hoffman, & Powell, 2009), designed with broad implementation in mind, addresses this gap by training community service providers to use a manualized, video-based program to help caregivers provide a secure base and a safe haven for their children. The present study is a randomized controlled trial of COS-P in a low-income sample of Head Start enrolled children and their mothers. Mothers (N = 141; 75 intervention, 66 waitlist control) completed a baseline assessment and returned with their children after the 10-week intervention for the outcome assessment, which included the Strange Situation. Intent to treat analyses revealed a main effect for maternal response to child distress, with mothers assigned to COS-P reporting fewer unsupportive (but not more supportive) responses to distress than control group mothers, and a main effect for one dimension of child executive functioning (inhibitory control but not cognitive flexibility when maternal age and marital status were controlled), with intervention group children showing greater control. There were, however, no main effects of intervention for child attachment or behavior problems. Exploratory follow-up analyses suggested intervention effects were moderated by maternal attachment style or depressive symptoms, with moderated intervention effects emerging for child attachment security and disorganization, but not avoidance; for inhibitory control but not cognitive flexibility; and for child internalizing but not externalizing behavior problems. This initial

Electrodes for the hydrogen through water electrolysis using BMI.BF{sub 4} as electrolyte; Eletrodos para a producao de hidrogenio via eletrolise da agua utilizando BMI.BF{sub 4} como eletrolito

Energy Technology Data Exchange (ETDEWEB)

Botton, Janine Padilha; Martini, Emilse M.A.; Souza, Michele Oberson de; Souza, Roberto Fernando de [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Inst. de Quimica. Lab. de Eletroquimica e Catalise]. E-mail: janine@iq.ufrgs.br; Loget, Gabriel [Universite de Rennes 1, Rennes (France). Lab. de Eletroquimica Molecular e Macromolecular. UMR CNRS 6510

2008-07-01

The hydrogen production by water electrolysis was tested with different electrocatalysts (nickel, iron alloys containing nickel, chromium and manganese, and molybdenum) in the ionic liquid electrolyte, 1-butyl-3-methylimidazolium tetrafluoroborate (BMI.BF{sub 4}), 10 vol.% in water. The hydrogen evolution reaction (HER) worked at room temperature with a platinum quasi-reference electrode (PtQRE) applying a -1.7 V potential. The experimental conditions used were determined in previous work and such parameters of operation were confirmed with the electrocatalysts employed in this work. A Hoffman cell apparatus was used to perform the water electrolysis. The current density values, j, obtained were between 3.0 mA cm{sup -2} and 77.5 mA cm{sup -2}. The system efficiency was very high for all electrocatalysts tested, between 97.0% and 99.2%. The molybdenum (Mo) electrode was better than others showing the highest current density value in HER. This behavior has been explained by the lower value of activation energy for the electrolysis reaction when Mo is employed comparing with Pt electrode. The energy activation of the HER using platinum (Pt) as electrocatalyst in an aqueous solution of BMI.BF{sub 4} 10 vol.% was 23.40 kJ mol{sup -1}, whereas with electrode of Mo in the same conditions , was 9.22 kJ mol{sup -1}. In an alkaline aqueous electrolyte (usual medium for such reaction), Mo is less efficient than Pt explaining the lack of published citation using pure Mo as cathode for the HER. The excellent results obtained with a Mo electrode employing ionic liquid as electrolyte show that the hydrogen production can be carried out with cheap electrode material at room temperature, which makes this method economically attractive. (author)

A practical head tracking system for motion correction in neurological SPECT and PET

International Nuclear Information System (INIS)

Fulton, R.R.; Eberl, S.; Meikle, S.; Hutton, B.F.; Braun, M.

1998-01-01

Full text: Patient motion during data acquisition can degrade the quality of SPECT and PET images. Techniques for motion correction in neurological studies in both modalities based on continuous monitoring of head position have been proposed. However difficulties in developing suitable head tracking systems have so far impeded clinical implementations. We have developed a head tracking system based on the mechanical ADL-1 tracker (Shooting Star Technology, Rosedale, Canada) on a Trionix triple-head SPECT camera A software driver running on a SUN Sparc host computer communicates with the tracker over a serial line providing up to 300 updates per second with angular and positional resolutions of 0.05 degrees and 0.2 mm respectively. The SUN Sparc workstation which acquires the SPECT study also communicates with the tracker, eliminating synchronisation problems. For motion correction, the motion parameters provided by the tracker within its own coordinate system must be converted to the camera's coordinate system. The conversion requires knowledge of the rotational relationships between the two coordinate systems and the displacement of their origins, both of which are determined from a calibration procedure. The tracker has been tested under clinical SPECT imaging conditions with a 3D Hoffman brain phantom. Multiple SPECT acquisitions were performed. After each acquisition the phantom was moved to a new position and orientation. Motion parameters reported by the tracker for each applied movement were compared with those obtained by applying an automated image registration program to the sequential reconstructed studies. Maximum differences were < 0.5 degrees and < 2mm, within the expected errors of the registration procedure. We conclude that this tracking system will be suitable for clinical evaluation of motion correction in SPECT and PET

Hydrogels and their medical applications

Science.gov (United States)

Rosiak, Janusz M.; Yoshii, Fumio

1999-05-01

Biomaterials play a key role in most approaches for engineering tissues as substitutes for functional replacement, for components of devices related to therapy and diagnosis, for drug delivery systems and supportive scaffolds for guided tissue growth. Modern biomaterials could be composed of various components, e.g. metals, ceramics, natural tissues, polymers. In this last group, the hydrogels, hydrophilic polymeric gels with requested biocompatibility and designed interaction with living surrounding seem to be one of the most promising group of biomaterials. Especially, if they are formed by means of ionizing radiation. In early 1950s, the pioneers of the radiation chemistry of polymers began some experiments with radiation crosslinking of hydrophilic polymers. However, hydrogels were analyzed mainly from the point of view of the phenomenon associated with radiation synthesis, with topology of network and relation between radiation parameters of the processes. Fundamental monographs on radiation polymer physics and chemistry written by A. Charlesby (Atomic Radition and polymers, Pergamon Press, Oxford, 1960) and A. Chapiro (Radiation Chemistry of Polymeric Systems, Interscience, New York, 1962) proceed from this time. The noticeable interest in the application of radiation techniques to obtain hydrogels for biomedical purposes began in the late sixties as a result of the papers and patents invented by Japanese and American scientists, headed by Kaetsu in Japan and Hoffman in USA. Immobilization of biologically active species in hydrogel matrices, their use as drug delivery systems and enzyme traps as well as the modification of material surfaces to improve biocompatibility and their ability to bond antigens and antibodies had been the main subjects of these investigations. In this article a brief summary of investigations on mechanism and kinetics of radiation formation of hydrogels as well as some examples of commercialized hydrogel biomaterials have been

Determinação da infecção por Entamoeba histolytica em residentes da área metropolitana de Belém, Pará, Brasil, utilizando ensaio imunoenzimático (ELISA para detecção de antígenos Determination of Entamoeba histolytica infection in patients from Greater Metropolitan Belém, Pará, Brazil, by enzyme-linked immunosorbent assay (ELISA for antigen detection

Directory of Open Access Journals (Sweden)

Mônica Cristina de Moraes Silva

2005-06-01

Full Text Available O status epidemiológico da amebíase está sendo reavaliado desde que a Entamoeba histolytica (patogênica foi considerada espécie distinta de Entamoeba dispar (não patogênica. Em nosso estudo, realizamos pesquisa de antígenos de E. histolytica em amostras fecais de pacientes residentes na cidade de Belém, Pará, Brasil, utilizando ensaio imunoenzimático (E. histolytica Test, TechLab Inc., Blacksburg, Estados Unidos disponível comercialmente. Foram analisadas 845 amostras, com positividade em 248 (29,35%. A infecção por E. histolytica foi maior no grupo etário acima de 14 anos (30,36% que no grupo de 0-14 anos (28,28%, porém sem significância estatística (p The epidemiological status of amebiasis has been reevaluated since Entamoeba histolytica (pathogenic was considered a distinct species from Entamoeba dispar (non-pathogenic. We investigated E. histolytica antigens in stool samples from residents of Belém, Pará State, Brazil, with commercially available enzyme-linked immunosorbent assay (E. histolytica Test, TechLab Inc., Blacksburg, USA. A total of 845 samples were analyzed, of which 248 were positive (29.35%. E. histolytica infection was more frequent in the over-14-year age group (30.36% than in the 0-14-year group (28.28%, but the difference was not statistically significant (p < 0.05. Of all the samples, 334 were also submitted to parasitological methods (direct, Hoffman, and Faust et al.. There were discordant results between ELISA and parasitological methods in 83 samples (24.85%, with more positive results using ELISA. Our results thus suggest that intestinal amebiasis is an important public health problem in Greater Metropolitan Belém.

Circle of Security-Parenting: A randomized controlled trial in Head Start.

Science.gov (United States)

Cassidy, Jude; Brett, Bonnie E; Gross, Jacquelyn T; Stern, Jessica A; Martin, David R; Mohr, Jonathan J; Woodhouse, Susan S

2017-05-01

Although evidence shows that attachment insecurity and disorganization increase risk for the development of psychopathology (Fearon, Bakermans-Kranenburg, van IJzendoorn, Lapsley, & Roisman, 2010; Groh, Roisman, van IJzendoorn, Bakermans-Kranenburg, & Fearon, 2012), implementation challenges have precluded dissemination of attachment interventions on the broad scale at which they are needed. The Circle of Security-Parenting Intervention (COS-P; Cooper, Hoffman, & Powell, 2009), designed with broad implementation in mind, addresses this gap by training community service providers to use a manualized, video-based program to help caregivers provide a secure base and a safe haven for their children. The present study is a randomized controlled trial of COS-P in a low-income sample of Head Start enrolled children and their mothers. Mothers (N = 141; 75 intervention, 66 waitlist control) completed a baseline assessment and returned with their children after the 10-week intervention for the outcome assessment, which included the Strange Situation. Intent to treat analyses revealed a main effect for maternal response to child distress, with mothers assigned to COS-P reporting fewer unsupportive (but not more supportive) responses to distress than control group mothers, and a main effect for one dimension of child executive functioning (inhibitory control but not cognitive flexibility when maternal age and marital status were controlled), with intervention group children showing greater control. There were, however, no main effects of intervention for child attachment or behavior problems. Exploratory follow-up analyses suggested intervention effects were moderated by maternal attachment style or depressive symptoms, with moderated intervention effects emerging for child attachment security and disorganization, but not avoidance; for inhibitory control but not cognitive flexibility; and for child internalizing but not externalizing behavior problems. This initial randomized

Integrating Statistical and Expert Knowledge to Develop Phenoregions for the Continental United States

Science.gov (United States)

Betancourt, J. L.; Biondi, F.; Bradford, J. B.; Foster, J. R.; Betancourt, J. L.; Foster, J. R.; Biondi, F.; Bradford, J. B.; Henebry, G. M.; Post, E.; Koenig, W.; Hoffman, F. M.; de Beurs, K.; Hoffman, F. M.; Kumar, J.; Hargrove, W. W.; Norman, S. P.; Brooks, B. G.

2016-12-01

Vegetated ecosystems exhibit unique phenological behavior over the course of a year, suggesting that remotely sensed land surface phenology may be useful for characterizing land cover and ecoregions. However, phenology is also strongly influenced by temperature and water stress; insect, fire, and weather disturbances; and climate change over seasonal, interannual, decadal and longer time scales. Normalized difference vegetation index (NDVI), a remotely sensed measure of greenness, provides a useful proxy for land surface phenology. We used NDVI for the conterminous United States (CONUS) derived from the Moderate Resolution Spectroradiometer (MODIS) every eight days at 250 m resolution for the period 2000-2015 to develop phenological signatures of emergent ecological regimes called phenoregions. We employed a "Big Data" classification approach on a supercomputer, specifically applying an unsupervised data mining technique, to this large collection of NDVI measurements to develop annual maps of phenoregions. This technique produces a prescribed number of prototypical phenological states to which every location belongs in any year. To reduce the impact of short-term disturbances, we derived a single map of the mode of annual phenological states for the CONUS, assigning each map cell to the state with the largest integrated NDVI in cases where multiple states tie for the highest frequency of occurrence. Since the data mining technique is unsupervised, individual phenoregions are not associated with an ecologically understandable label. To add automated supervision to the process, we applied the method of Mapcurves, developed by Hargrove and Hoffman, to associate individual phenoregions with labeled polygons in expert-derived maps of biomes, land cover, and ecoregions. We will present the phenoregions methodology and resulting maps for the CONUS, describe the "label-stealing" technique for ascribing biome characteristics to phenoregions, and introduce a new polar

Reactor-produced therapeutic radioisotopes

International Nuclear Information System (INIS)

Knapp, F.F. Jr.

2002-01-01

The significant worldwide increase in therapeutic radioisotope applications in nuclear medicine, oncology and interventional cardiology requires the dependable production of sufficient levels of radioisotopes for these applications (Reba, 2000; J. Nucl. Med., 1998; Nuclear News, 1999; Adelstein and Manning, 1994). The issues associated with both accelerator- and reactor-production of therapeutic radioisotopes is important. Clinical applications of therapeutic radioisotopes include the use of both sealed sources and unsealed radiopharmaceutical sources. Targeted radiopharmaceutical agents include those for cancer therapy and palliation of bone pain from metastatic disease, ablation of bone marrow prior to stem cell transplantation, treatment modalities for mono and oligo- and polyarthritis, for cancer therapy (including brachytherapy) and for the inhibition of the hyperplastic response following coronary angioplasty and other interventional procedures (For example, see Volkert and Hoffman, 1999). Sealed sources involve the use of radiolabeled devices for cancer therapy (brachytherapy) and also for the inhibition of the hyperplasia which is often encountered after angioplasty, especially with the exponential increase in the use of coronary stents and stents for the peripheral vasculature and other anatomical applications. Since neutron-rich radioisotopes often decay by beta decay or decay to beta-emitting daughter radioisotopes which serve as the basis for radionuclide generator systems, reactors are expected to play an increasingly important role for the production of a large variety of therapeutic radioisotopes required for these and other developing therapeutic applications. Because of the importance of the availability of reactor-produced radioisotopes for these applications, an understanding of the contribution of neutron spectra for radioisotope production and determination of those cross sections which have not yet been established is important. This

Positron Emission Tomography (PET) and breast cancer in clinical practice

International Nuclear Information System (INIS)

Lavayssiere, Robert; Cabee, Anne-Elizabeth; Filmont, Jean-Emmanuel

2009-01-01

The landscape of oncologic practice has changed deeply during the past few years and there is now a need, through a multidisciplinary approach, for imaging to provide accurate evaluation of morphology and function and to guide treatment (Image Guided Therapy). Increasing emphasis has been put on Position Emission Tomography (PET) role in various cancers among clinicians and patients despite a general context of healthcare expenditure limitation. Positron Emission Tomography has currently a limited role in breast cancer, but also general radiologists and specialists should be aware of these indications, especially when staging aggressive cancers and looking for recurrence. Currently, the hybrid systems associating PET and Computed Tomography (CT) and in the same device [Rohren EM, Turkington TG, Coleman RE. Clinical applications of PET in oncology. Radiology 2004;231:305-32; Blodgett TM, Meltzer CM, Townsend DW. PET/CT: form and function. Radiology 2007;242:360-85; von Schulthess GK, Steinert HC, Hany TF. Integrated PET/CT: current applications and futures directions. Radiology 2006;238(2):405-22], or PET-CT, are more commonly used and the two techniques are adding their potentialities. Other techniques, MRI in particular, may also compete with PET in some instance and as far as ionizing radiations dose limitation is considered, some breast cancers becoming some form of a chronic disease. Breast cancer is a very complex, non-uniform, disease and molecular imaging at large may contribute to a better knowledge and to new drugs development. Ongoing research, Positron Emission Mammography (PEM) and new tracers, are likely to bring improvements in patient care [Kelloff GJ, Hoffman JM, Johnson B, et al. Progress and promise of FDG-PET Imaging for cancer patient management and oncologic drug development. Clin Cancer Res 2005;1(April (8)): 2005

Positron Emission Tomography (PET) and breast cancer in clinical practice

Energy Technology Data Exchange (ETDEWEB)

Lavayssiere, Robert [Centre d' Imagerie Paris-Nord, 1, avenue Charles Peguy, 95200 Sarcelles (France); Institut du Sein Henri Hartmann (ISHH), 1, rue des Dames Augustines, 92200 Neuilly sur Seine (France)], E-mail: cab.lav@wanadoo.fr; Cabee, Anne-Elizabeth [Centre d' Imagerie Paris-Nord, 1, avenue Charles Peguy, 95200 Sarcelles (France); Institut du Sein Henri Hartmann (ISHH), 1, rue des Dames Augustines, 92200 Neuilly sur Seine (France); Centre RMX, 80, avenue Felix Faure, 75105 Paris (France); Filmont, Jean-Emmanuel [Institut du Sein Henri Hartmann (ISHH), 1, rue des Dames Augustines, 92200 Neuilly sur Seine (France); American Hospital of Paris, Nuclear Medicine, 63, boulevard Victor Hugo - BP 109, 92202 Neuilly sur Seine Cedex (France)

2009-01-15

The landscape of oncologic practice has changed deeply during the past few years and there is now a need, through a multidisciplinary approach, for imaging to provide accurate evaluation of morphology and function and to guide treatment (Image Guided Therapy). Increasing emphasis has been put on Position Emission Tomography (PET) role in various cancers among clinicians and patients despite a general context of healthcare expenditure limitation. Positron Emission Tomography has currently a limited role in breast cancer, but also general radiologists and specialists should be aware of these indications, especially when staging aggressive cancers and looking for recurrence. Currently, the hybrid systems associating PET and Computed Tomography (CT) and in the same device [Rohren EM, Turkington TG, Coleman RE. Clinical applications of PET in oncology. Radiology 2004;231:305-32; Blodgett TM, Meltzer CM, Townsend DW. PET/CT: form and function. Radiology 2007;242:360-85; von Schulthess GK, Steinert HC, Hany TF. Integrated PET/CT: current applications and futures directions. Radiology 2006;238(2):405-22], or PET-CT, are more commonly used and the two techniques are adding their potentialities. Other techniques, MRI in particular, may also compete with PET in some instance and as far as ionizing radiations dose limitation is considered, some breast cancers becoming some form of a chronic disease. Breast cancer is a very complex, non-uniform, disease and molecular imaging at large may contribute to a better knowledge and to new drugs development. Ongoing research, Positron Emission Mammography (PEM) and new tracers, are likely to bring improvements in patient care [Kelloff GJ, Hoffman JM, Johnson B, et al. Progress and promise of FDG-PET Imaging for cancer patient management and oncologic drug development. Clin Cancer Res 2005;1(April (8)): 2005].

Curcumin Modulates Pancreatic Adenocarcinoma Cell-Derived Exosomal Function

Science.gov (United States)

Osterman, Carlos J. Diaz; Lynch, James C.; Leaf, Patrick; Gonda, Amber; Ferguson Bennit, Heather R.; Griffiths, Duncan; Wall, Nathan R.

2015-01-01

Pancreatic cancer has the highest mortality rates of all cancer types. One potential explanation for the aggressiveness of this disease is that cancer cells have been found to communicate with one another using membrane-bound vesicles known as exosomes. These exosomes carry pro-survival molecules and increase the proliferation, survival, and metastatic potential of recipient cells, suggesting that tumor-derived exosomes are powerful drivers of tumor progression. Thus, to successfully address and eradicate pancreatic cancer, it is imperative to develop therapeutic strategies that neutralize cancer cells and exosomes simultaneously. Curcumin, a turmeric root derivative, has been shown to have potent anti-cancer and anti-inflammatory effects in vitro and in vivo. Recent studies have suggested that exosomal curcumin exerts anti-inflammatory properties on recipient cells. However, curcumin’s effects on exosomal pro-tumor function have yet to be determined. We hypothesize that curcumin will alter the pro-survival role of exosomes from pancreatic cancer cells toward a pro-death role, resulting in reduced cell viability of recipient pancreatic cancer cells. The main objective of this study was to determine the functional alterations of exosomes released by pancreatic cancer cells exposed to curcumin compared to exosomes from untreated pancreatic cancer cells. We demonstrate, using an in vitro cell culture model involving pancreatic adenocarcinoma cell lines PANC-1 and MIA PaCa-2, that curcumin is incorporated into exosomes isolated from curcumin-treated pancreatic cancer cells as observed by spectral studies and fluorescence microscopy. Furthermore, curcumin is delivered to recipient pancreatic cancer cells via exosomes, promoting cytotoxicity as demonstrated by Hoffman modulation contrast microscopy as well as AlamarBlue and Trypan blue exclusion assays. Collectively, these data suggest that the efficacy of curcumin may be enhanced in pancreatic cancer cells through

A geochemical modelling study of the evolution of the chemical composition of seawater linked to a "snowball" glaciation

Directory of Open Access Journals (Sweden)

G. Le Hir

2008-02-01

Full Text Available The Snowball Earth theory initially proposed by Kirschvink (1992 to explain the Neoproterozoic glacial episodes, suggested that the Earth was fully ice-covered at 720 Ma (Sturtian episode and 640 Ma (Marinoan episode. This succession of extreme climatic crises induced environmental perturbations which are considered as a strong selective pressure on the evolution of life (Hoffman et al., 1998. Using a numerical model of carbon-alkalinity global cycles, we quantify environmental stresses caused by a global glaciation. According to our results, we suggest that during global glaciations, the ocean becomes acidic (pH~6, and undersaturated with respect to carbonate minerals. Moreover the quick transition from ice-house to greenhouse conditions implies an abrupt and large shift of the oceanic surface temperature which causes an extended hypoxia. The intense continental weathering, in the aftermath of the glaciation, deeply affects the seawater composition inducing rapid changes in terms of pH and alkalinity. We also propose a new timing for post glacial perturbations and for the cap carbonates deposition, ~2 Myr instead of 200 kyr as suggested in a previous modelling study. In terms of Precambrian life sustainability, seawater pH modifications appear drastic all along the glaciation, but we suggest that the buffering action of the oceanic crust dissolution avoids a total collapse of biological productivity. But short-lived and large post-glacial perturbations are more critical and may have played the role of an environmental filter proposed in the classic snowball Earth theory. Although the link between environmental changes and life sustainability cannot be modelled accurately, we suggest that only a permissive life (Knoll, 2003 may explain the relative continuity in microfossils diversity observed before, during and after Neoproterozoic glaciation events.

Quality of brain perfusion single-photon emission tomography images: multicentre evaluation using an anatomically accurate three-dimensional phantom

International Nuclear Information System (INIS)

Heikkinen, J.; Kuikka, J.T.; Ahonen, A.; Rautio, P.

1998-01-01

The aim of the study was to evaluate the quality of routine brain perfusion single-photon emission tomography (SPET) images in Finnish nuclear medicine laboratories. Twelve laboratories participated in the study. A three-dimensional high resolution brain phantom (Data Spectrum's 3D Hoffman Brain Phantom) was filled with a well-mixed solution of technetium-99m (110 MBq), water and detergent. Acquisition, reconstruction and printing were performed according to the clinical routine in each centre. Three nuclear medicine specialists blindly evaluated all image sets. The results were ranked from 1 to 5 (poor quality-high quality). Also a SPET performance phantom (Nuclear Associates' PET/SPECT Performance Phantom PS 101) was filled with the same radioactivity concentration as the brain phantom. The parameters for the acquisition, the reconstruction and the printing were exactly the same as with the brain phantom. The number of detected ''hot'' (from 0 to 8) and ''cold'' lesions (from 0 to 7) was visually evaluated from hard copies. Resolution and contrast were quantified from digital images. Average score for brain phantom images was 2.7±0.8 (range 1.5-4.5). The average diameter of the ''hot'' cylinders detected was 16 mm (range 9.2-20.0 mm) and that of the ''cold'' cylinders detected, 11 mm (5.9-14.3 mm) according to visual evaluation. Quantification of digital images showed that the hard copy was one reason for low-quality images. The quality of the hard copies was good only in four laboratories and was amazingly low in the others when comparing it with the actual structure of the brain phantom. The described quantification method is suitable for optimizing resolution and contrast detectability of hard copies. This study revealed the urgent need for external quality assurance of clinical brain perfusion SPET images. (orig.)

Noncoplanar magnetic fields at collisionless shocks: A test of a new approach

International Nuclear Information System (INIS)

Gosling, J.T.; Winske, D.; Thomsen, M.F.

1988-01-01

Within the foot and ramp of a fast mode collisionless shock the magnetic field rotates out of the plane of coplanarity defined by the upstream magnetic field and the shock normal. As previously noted (Goodrich and Scudder, 1984), the sense of this rotation is such as to reduce the cross-shock potential drop when measured in the deHoffman-Teller frame relative to that measured in the normal incidence frame. From a consideration of the requirement that there be zero current in the coplanarity plane downstream of the shock, Jones and Ellison (1987) have argued that the field rotation and potential drop difference are a consequence of unequal ion and electron masses, and have derived an expression for the spatial integral of the noncoplanar field component in terms of the electron current within the shock layer. Moreover, by assuming that the ion current within the shock layer is negligible compared to the electron current, they derive equations which predict the magnitude of both the field rotation and the potential drop difference in terms of upstream quantities and the field jump at the shock. We have tested their equations with ISEE 1 and 2 plasma and field measurements at the Earth's bow shock and by means of numerical simulations. We find substantial support for their suggestion that the field rotation and thus also the frame dependence of the potential drop are fundamentally a consequence of unequal ion and electron masses. Further, for subcritical shocks (low Mach number) one can neglect the ion current to predict both the sign and the magnitude of the field rotation and potential drop difference. However, at supercritical shocks (high Mach numbers) the ion current associated with reflected, gyrating ions cannot be neglected, and the final equations of Jones and Ellison seriously underestimate the magnitude of the field rotation and the potential drop difference at these shocks

Automated movement correction for dynamic PET/CT images: evaluation with phantom and patient data.

Science.gov (United States)

Ye, Hu; Wong, Koon-Pong; Wardak, Mirwais; Dahlbom, Magnus; Kepe, Vladimir; Barrio, Jorge R; Nelson, Linda D; Small, Gary W; Huang, Sung-Cheng

2014-01-01

Head movement during a dynamic brain PET/CT imaging results in mismatch between CT and dynamic PET images. It can cause artifacts in CT-based attenuation corrected PET images, thus affecting both the qualitative and quantitative aspects of the dynamic PET images and the derived parametric images. In this study, we developed an automated retrospective image-based movement correction (MC) procedure. The MC method first registered the CT image to each dynamic PET frames, then re-reconstructed the PET frames with CT-based attenuation correction, and finally re-aligned all the PET frames to the same position. We evaluated the MC method's performance on the Hoffman phantom and dynamic FDDNP and FDG PET/CT images of patients with neurodegenerative disease or with poor compliance. Dynamic FDDNP PET/CT images (65 min) were obtained from 12 patients and dynamic FDG PET/CT images (60 min) were obtained from 6 patients. Logan analysis with cerebellum as the reference region was used to generate regional distribution volume ratio (DVR) for FDDNP scan before and after MC. For FDG studies, the image derived input function was used to generate parametric image of FDG uptake constant (Ki) before and after MC. Phantom study showed high accuracy of registration between PET and CT and improved PET images after MC. In patient study, head movement was observed in all subjects, especially in late PET frames with an average displacement of 6.92 mm. The z-direction translation (average maximum = 5.32 mm) and x-axis rotation (average maximum = 5.19 degrees) occurred most frequently. Image artifacts were significantly diminished after MC. There were significant differences (Pdynamic brain FDDNP and FDG PET/CT scans could improve the qualitative and quantitative aspects of images of both tracers.

Performance evaluation of neuro-PET using silicon photomultipliers

Energy Technology Data Exchange (ETDEWEB)

Jung, Jiwoong; Choi, Yong, E-mail: ychoi@sogang.ac.kr; Jung, Jin Ho, E-mail: jinho1115@gmail.com; Kim, Sangsu; Im, Ki Chun

2016-05-21

Recently, we have developed the second prototype Silicon photomultiplier (SiPM) based positron emission tomography (PET) scanner for human brain imaging. The PET system was comprised of detector block which consisted of 4×4 SiPMs and 4×4 Lutetium Yttrium Orthosilicate arrays, charge signal transmission method, high density position decoder circuit and FPGA-embedded ADC boards. The purpose of this study was to evaluate the performance of the newly developed neuro-PET system. The energy resolution, timing resolution, spatial resolution, sensitivity, stability of the photo-peak position and count rate performance were measured. Tomographic image of 3D Hoffman brain phantom was also acquired to evaluate imaging capability of the neuro-PET. The average energy and timing resolutions measured for 511 keV gamma rays were 17±0.1% and 3±0.3 ns, respectively. Spatial resolution and sensitivity at the center of field of view (FOV) were 3.1 mm and 0.8%, respectively. The average scatter fraction was 0.4 with an energy window of 350–650 keV. The maximum true count rate and maximum NECR were measured as 43.3 kcps and 6.5 kcps at an activity concentration of 16.7 kBq/ml and 5.5 kBq/ml, respectively. Long-term stability results show that there was no significant change in the photo-peak position, energy resolution and count rate for 60 days. Phantom imaging studies were performed and they demonstrated the feasibility for high quality brain imaging. The performance tests and imaging results indicate that the newly developed PET is useful for brain imaging studies, if the axial FOV is extended to improve the system sensitivity.

Hydrogels and their medical applications

International Nuclear Information System (INIS)

Rosiak, Janusz M.; Yoshii, Fumio

1999-01-01

Biomaterials play a key role in most approaches for engineering tissues as substitutes for functional replacement, for components of devices related to therapy and diagnosis, for drug delivery systems and supportive scaffolds for guided tissue growth. Modern biomaterials could be composed of various components, e.g. metals, ceramics, natural tissues, polymers. In this last group, the hydrogels, hydrophilic polymeric gels with requested biocompatibility and designed interaction with living surrounding seem to be one of the most promising group of biomaterials. Especially, if they are formed by means of ionizing radiation. In early 1950s, the pioneers of the radiation chemistry of polymers began some experiments with radiation crosslinking of hydrophilic polymers. However, hydrogels were analyzed mainly from the point of view of the phenomenon associated with radiation synthesis, with topology of network and relation between radiation parameters of the processes. Fundamental monographs on radiation polymer physics and chemistry written by A. Charlesby (Atomic Radition and polymers, Pergamon Press, Oxford, 1960) and A. Chapiro (Radiation Chemistry of Polymeric Systems, Interscience, New York, 1962) proceed from this time. The noticeable interest in the application of radiation techniques to obtain hydrogels for biomedical purposes began in the late sixties as a result of the papers and patents invented by Japanese and American scientists, headed by Kaetsu in Japan and Hoffman in USA. Immobilization of biologically active species in hydrogel matrices, their use as drug delivery systems and enzyme traps as well as the modification of material surfaces to improve biocompatibility and their ability to bond antigens and antibodies had been the main subjects of these investigations. In this article a brief summary of investigations on mechanism and kinetics of radiation formation of hydrogels as well as some examples of commercialized hydrogel biomaterials have been

Stockholm Shines (Editorial

Directory of Open Access Journals (Sweden)

Denise Koufogiannakis

2009-09-01

Full Text Available I didn’t sleep much in Stockholm. The eight hour time difference and the jet lag completely messed me up, not to mention the 19 hours of daylight! But during the day when I was so tired, the content being presented at the conference and the people I met kept me buzzing and wide awake! It is always nice to find a group of people who are interested in the same things as you are, and to do so in a beautiful setting with great food and a friendly environment is all the better. In my opinion, the 5th EBLIP conference was the best yet! I returned to Canada inspired and intellectually stimulated.The EBLIP conference is one of the few times that those of us who work on the EBLIP journal have a chance to get together and talk in person. Our journal editors are situated in the U.K., Canada, and the United States, so our work is done primarily via e‐mail and the occasional conference call. Three of us made it to Stockholm (Alison, Lorie and myself, so it was great to touch base in person and have a drink or two together! We also got to see several members of the Editorial Advisory board, as well as those who write evidence summaries for us, or are involved in some other way. Meeting some of these people in person for the first time after a lengthy e‐mail relationship is quite a treat! The Editors took the opportunity at the conference to hold a user group meeting, inviting anyone who was interested to attend and provide us with feedback about the journal. To start we provided an update, which included the fact that the journal has over 2000 registered readers. Did you know that in just one month (May 25 – June 24, 2009 we had 4649 site visits; 3,678 of them unique? Most visits to the journal are from the United States, followed by Canada, Australia, and the U.K. But we have people accessing the journal from all over world, and now that we are tracking site traffic via Google Analytics, it is easy to see on a map where our readers reside. There was

Changes in the primate trade in indonesian wildlife markets over a 25-year period: Fewer apes and langurs, more macaques, and slow lorises.

Science.gov (United States)

Nijman, Vincent; Spaan, Denise; Rode-Margono, Eva Johanna; Wirdateti; Nekaris, K A I

2017-11-01

Indonesia has amongst the highest primate species richness, and many species are included on the country's protected species list, partially to prevent over-exploitation. Nevertheless traders continue to sell primates in open wildlife markets especially on the islands of Java and Bali. We surveyed 13 wildlife markets in 2012-2014 and combined our results with previous surveys from 1990-2009 into a 122-survey dataset with 2,424 records of 17 species. These data showed that the diversity of species in trade decreased over time, shifting from rare rainforest-dwelling primates traded alongside more widespread species that are not confined to forest to the latter type only. In the 1990s and early 2000s orangutans, gibbons and langurs were commonly traded alongside macaques and slow lorises but in the last decade macaques and slow lorises comprised the bulk of the trade. In 2012-2014 we monitored six wildlife markets in Jakarta, Bandung and Garut (all on Java), and Denpasar (Bali). During 51 surveys we recorded 1,272 primates of eight species. Traders offered long-tailed macaque (total 1,007 individuals) and three species of slow loris (228 individuals) in five of the six markets, whereas they traded ebony langurs (18 individuals), and pig-tailed macaques (14 individuals) mostly in Jakarta. Pramuka and Jatinegara markets, both in Jakarta, stood out as important hubs for the primate trade, with a clear shift in importance over time from the former to the latter. Slow lorises, orangutans, gibbons and some langurs are protected under Indonesian law, which prohibits all trade in them; of these protected species, only the slow lorises remained common in trade throughout the 25-year period. Trade in non-protected macaques and langurs is subject to strict regulations-which market traders did not follow-making all the market trade in primates that we observed illegal. Trade poses a substantial threat to Indonesian primates, and without enforcement, the sheer volume of trade may

Cyberinfrastructure for Open Science at the Montreal Neurological Institute.

Science.gov (United States)

Das, Samir; Glatard, Tristan; Rogers, Christine; Saigle, John; Paiva, Santiago; MacIntyre, Leigh; Safi-Harab, Mouna; Rousseau, Marc-Etienne; Stirling, Jordan; Khalili-Mahani, Najmeh; MacFarlane, David; Kostopoulos, Penelope; Rioux, Pierre; Madjar, Cecile; Lecours-Boucher, Xavier; Vanamala, Sandeep; Adalat, Reza; Mohaddes, Zia; Fonov, Vladimir S; Milot, Sylvain; Leppert, Ilana; Degroot, Clotilde; Durcan, Thomas M; Campbell, Tara; Moreau, Jeremy; Dagher, Alain; Collins, D Louis; Karamchandani, Jason; Bar-Or, Amit; Fon, Edward A; Hoge, Rick; Baillet, Sylvain; Rouleau, Guy; Evans, Alan C

2016-01-01

Data sharing is becoming more of a requirement as technologies mature and as global research and communications diversify. As a result, researchers are looking for practical solutions, not only to enhance scientific collaborations, but also to acquire larger amounts of data, and to access specialized datasets. In many cases, the realities of data acquisition present a significant burden, therefore gaining access to public datasets allows for more robust analyses and broadly enriched data exploration. To answer this demand, the Montreal Neurological Institute has announced its commitment to Open Science, harnessing the power of making both clinical and research data available to the world (Owens, 2016a,b). As such, the LORIS and CBRAIN (Das et al., 2016) platforms have been tasked with the technical challenges specific to the institutional-level implementation of open data sharing, including: Comprehensive linking of multimodal data (phenotypic, clinical, neuroimaging, biobanking, and genomics, etc.)Secure database encryption, specifically designed for institutional and multi-project data sharing, ensuring subject confidentiality (using multi-tiered identifiers).Querying capabilities with multiple levels of single study and institutional permissions, allowing public data sharing for all consented and de-identified subject data.Configurable pipelines and flags to facilitate acquisition and analysis, as well as access to High Performance Computing clusters for rapid data processing and sharing of software tools.Robust Workflows and Quality Control mechanisms ensuring transparency and consistency in best practices.Long term storage (and web access) of data, reducing loss of institutional data assets.Enhanced web-based visualization of imaging, genomic, and phenotypic data, allowing for real-time viewing and manipulation of data from anywhere in the world.Numerous modules for data filtering, summary statistics, and personalized and configurable dashboards. Implementing

Psychometric evaluation of the Sheehan Disability Scale in adult patients with attention-deficit/hyperactivity disorder

Directory of Open Access Journals (Sweden)

Coles T

2014-05-01

Full Text Available Theresa Coles,1 Cheryl Coon,1 Carla DeMuro,1 Lori McLeod,1 Ari Gnanasakthy21Patient-Reported Outcomes, RTI Health Solutions, Research Triangle Park, NC, 2Novartis Pharmaceuticals, East Hanover, NJ, USAAbstract: Inattention and impulsivity symptoms are common among adults with attention-deficit/hyperactivity disorder (ADHD, which can lead to difficulty concentrating, restlessness, difficulty completing tasks, disorganization, impatience, and impulsiveness. Many adults with ADHD find it difficult to focus and prioritize. Resulting outcomes, such as missed deadlines and forgotten engagements, may ultimately impact the ability to function at work, school, home, or in a social environment. The European Medicines Agency guidelines for evaluating medicinal products for ADHD recommend inclusion of both functional outcomes, such as school, social, or work functioning, and outcomes related to symptoms of ADHD in clinical studies of novel medication primary efficacy endpoints. Due to its performance in other disease areas and the relevance of its items as evidenced by content validity analyses, the Sheehan Disability Scale (SDS was chosen to assess functional impairment in ADHD. The aim of this study was to investigate the psychometric properties of the SDS, used as a brief measure of functional impairment in a number of psychiatric disorders, in adult patients with ADHD. To the authors' knowledge, this is the first study to evaluate the reliability of the SDS (based on Cronbach's coefficient alpha and test-retest reliability, its validity (construct and known-groups validity, and its ability to detect change in this patient population. This study also established a preliminary responder definition for the SDS in this study population to determine when change can be considered clinically beneficial in a clinical trial setting. The psychometric results support the use of the SDS subscales (items 1–3 and total score (sum of items 1–3 in an ADHD

Comparison of fluorine-18 and bromine-76 imaging in positron emission tomography

International Nuclear Information System (INIS)

Ribeiro, M.J.; Ferreira, N.; Almeida, P.; Strul, D.; Loc'h, C.; Brulon, V.; Trebossen, R.; Maziere, B.; Bendriem, B.

1999-01-01

State of the art positron emission tomography (PET) systems allow for scatter and attenuation correction. However, the size of the structure being studied and the region of interest (ROI) chosen also influence the accuracy of measurements of radioactive concentration. Furthermore, the limited spatial resolution of PET tomographs, which depends, among other factors, on the range of positrons in matter, can also contribute to a loss in quantitation accuracy. In this paper we address the influence of positron range, structure size and ROI size on the quantitation of radioactive concentration using PET. ECAT EXACT HR+ (HR+) and ECAT 953B/31 (ECAT 953B) PET systems were used in phantom acquisitions performed with two radioisotopes with different positron ranges. The 3D Hoffman phantom was scanned on both scanners with both radioisotopes, to visually analyse the image quality. A resolution phantom having six spheres of different diameters in a Plexiglas cylinder was used to calculate the values of the contrast recovery coefficient or hot spot recovery coefficient and of the spill-over or cold spot recovery coefficient under different imaging conditions used in clinical routine at our institution. Activity ratios were varied between 2 and 30 or between 0.4 and 200 by filling the spheres with fluorine-18 or bromine-76 respectively and the cylinder with 11 C. Dynamic scans were performed on each scanner. Data were reconstructed using the same parameters as are used in clinical protocols. The variations in sphere and cylinder activities with time were fitted using the function M(t)=k 1 .A(t)+k 2 .B(t), where M(t) is the radioactivity concentration measured in an ROI placed on each sphere and A(t) and B(t) represent the true radioactivity concentrations present at time t in the spheres and in the cylinder respectively. k 1 and k 2 are factors representing the contrast recovery coefficient and the spill-over from surrounding activity on measurements respectively. The visual

Estudo seccional sobre esquistossomose mansônica no Município de Riachuelo, Estado de Sergipe

Directory of Open Access Journals (Sweden)

Antonio Paulo de Menezes

1980-12-01

Full Text Available Os autores fizeram um estudo clínico e epidemioiógico, visando estudar a morbidade da esquistossomose mansônica, na cidade de fíiachuelo, Sergipe, área considerada de alta endemicidade. Foi selecionada de maneira sistemática uma amostra da população local, constituída por 850 pessoas. Destas pessoas, foram realizados 835 exames de fezes, pelos métodos de Lutz (Hoffman, Pons e Janner e/ou Kato. Fez-se também 393 reações intradérmicas com antígeno de verme adulto. Da mesma maneira, realizou-se o exame clínico das pessoas da amostra, visando a determinar a gravidade da doença. Foram localizados os focos onde existiam caramujos transmissores da esquistossomose e deles coletados exemplares nos quais se verificou o índice de infecção. A prevalência global obtida através do exame de fezes foi igual a 50,54%. O estudo da prevalência através da coproscopia mostrou não haver diferença entre os sexos, porém entre as raças ocorreu predominância dos resultados obtidos entre os não brancos sobre os brancos. Quanto i idade, a prevalência foi baixa até os 5 anos de vida, subindo após os 11 anos a níveis elevados, caindo após os 50 anos. O estudo feito através da reação intradérmica permitiu tirar conclusões semelhantes ao feito por coproscopia, exceto na faixa etária que compreendia os maiores de 50 anos, onde quase todo o grupo apresentou reações positivas. Das 850 pessoas da amostra, 422 eram portadores de ovos de S. mansoni nas fezes. Destes, 410 foram examinados clinicamente, sendo 73,17% classificados como tipo I, 24,39% como tipo II e 2,43% como tipo III. Segundo esta classificação clínica não se demonstrou diferença estatisticamente significativa entre os sexos ou entre os grupos raciais, porém a maioria dos portadores de hepatoesplenomegalia (tipo III tinha mais de 40 anos de idade. Do levantamento malacológico, determinou-se os focos de infecção de onde se coletou 1.208 exemplares de caramujos vetores

Tentativa de controle de Hymenolepis nana através de tratamentos clínicos repetidos, com praziquantel, em uma comunidade fechada The use of repeated praziquantel treatments in an attempt to control Hymenolepis nana in an orphanage

Directory of Open Access Journals (Sweden)

R. S. Rocha

1981-08-01

Full Text Available Foi feita tentativa de controle do Hymenolepis nana em uma comunidade fechada utilizando-se o praziquantel em repetidos tratamentos. Concomitantemente, foram estudados os prováveis mecanismos de transmissão da parasitose. A comunidade trabalhada possuia inicialmente 161 pessoas, sendo 109 crianças internas, com idade variando de dias e/ou meses a 8 anos, e de 52 adultos, funcionários da instituição. O diagnóstico parasitológico foi realizado aproximadamente de 2 em 2 meses em toda a população, pelo método de Hoffman, Pons e Janer, e o controle de cura, pelo mesmo método, entre o 7.º e o 14.º dia. Quinzenalmente foram realizadas pesquisas para ovos de H. nana no leito ungueal das crianças, em insetos, no lixo doméstico, nas maçanetas das portas e geladeiras, nos botões e cordões de descarga. Posteriormente examinou-se água recolhida dos urinóis e do chão do "box" do chuveiro. Todos os pacientes eliminando ovos de H. nana nas fezes foram tratados com praziquantel, após exame clínico, na dose única oral de 25mg/kg, após o almoço. Em 4 tratamentos realizados (66 pacientes, não foram observadas reações colterais importantes, e o controle de cura foi sempre de 100%. No 5.º e último tratamento, grupos de pacientes positivos e negativos para H. nana foram divididos em subgrupos e tratados com uma dose da droga (25mg/kg ou duas doses espaçadas de 4 dias (total: 50mg/kg. No levantamento realizado dois meses após o tratamento, foram encontrados apenas 6 indivíduos eliminando ovos do parasita. Estes pertenciam ao subgrupo de crianças com himenolepíase tratado com uma única dose da droga. Ovos e larvas de helmintos e cistos de protozoários foram encontrados no lixo doméstico, insetos (baratas e maçanetas de portas, enquanto ovos de H. nana só foram achados em água aspirada do "box" do chuveiro e da lavagem dos urinóis. Apesar da elevada percentagem de cura e dos vários tratamentos realizados, não se conseguiu o

Comparisons in the Recovery Response From Resistance Exercise Between Young and Middle-Aged Men.

Science.gov (United States)

Gordon, Joseph A; Hoffman, Jay R; Arroyo, Eliott; Varanoske, Alyssa N; Coker, Nicholas A; Gepner, Yftach; Wells, Adam J; Stout, Jeffrey R; Fukuda, David H

2017-12-01

Gordon, JA III, Hoffman, JR, Arroyo, E, Varanoske, AN, Coker, NA, Gepner, Y, Wells, AJ, Stout, JR, and Fukuda, DH. Comparisons in the recovery response from resistance exercise between young and middle-aged men. J Strength Cond Res 31(12): 3454-3462, 2017-The purpose of this study was to compare the effects of a bout of high-volume isokinetic resistance exercise protocol (HVP) on lower-body strength and markers of inflammation and muscle damage during recovery between young and middle-aged adult men. Nineteen recreationally trained men were classified as either a young adult (YA: 21.8 ± 2.0 years; 90.7 ± 11.6 kg) or a middle-aged adult (MA: 47.0 ± 4.4 years; 96.0 ± 21.5 kg) group. The HVP consisted of 8 sets of 10 repetitions, with 1 minute of rest between each set, performed on an isokinetic dynamometer at 60°·s. Maximal voluntary isometric contractions and isokinetic peak torque (PKT) and average torque (AVGT) (measured at 240° and 60°·s, respectively) were assessed at baseline (BL), immediately post (IP), 120 minutes, 24, and 48 hours after HVP. Blood was obtained at BL, IP, 30, 60, 120 minute, 24, and 48 hours after HVP to assess muscle damage and inflammation. All performance data were analyzed using repeated measures analysis of covariance, whereas all inflammatory and muscle damage markers were analyzed using a 2-way (time × group) repeated measures analysis of variance. Results revealed no between-group differences for PKT, AVGT, or rate of torque development at 200 ms (RTD200). No between-group differences in myoglobin, creatine kinase, C-reactive protein, or interleukin-6 were observed. Although BL differences in muscle performance were observed between YA and MA, no between-group differences were noted in performance recovery measures from high-volume isokinetic exercise in recreationally trained men. These results also indicate that the inflammatory and muscle damage response from high-volume isokinetic exercise is similar between

Relationship between pre-reconstruction filter and accuracy of registration software based on mutual-information maximization. A study of SPECT-MR brain phantom images

International Nuclear Information System (INIS)

Mito, Suzuko; Magota, Keiichi; Arai, Hiroshi; Omote, Hidehiko; Katsuura, Hidenori; Suzuki, Kotaro; Kubo Naoki

2005-01-01

Image registration technique is becoming an increasingly important tool in SPECT. Recently, software based on mutual-information maximization has been developed for automatic multimodality image registration. The accuracy of the software is important for its application to image registration. During SPECT reconstruction, the projection data are pre-filtered in order to reduce Poisson noise, commonly using a Butterworth filter. We have investigated the dependence of the absolute accuracy of MRI-SPECT registration on the cut-off frequencies of a range of Butterworth filters. This study used a 3D Hoffman phantom (Model No. 9000, Data-spectrum Co.). For the reference volume, an magnetization prepared rapid gradient echo (MPRage) sequence was performed on a Vision MRI (Siemence, 1.5 T). For the floating volumes, SPECT data of a phantom including 99m Tc 85 kBq/mL were acquired by a GCA-9300 (Toshiba Medical Systems Co.). During SPECT, the orbito-meatal (OM) line of the phantom was tilted by 5 deg and 15 deg to mimic the incline of a patient's head. The projection data were pre-filtered with Butterworth filters (cut-off frequency varying between 0.24 to 0.94 cycles/cm in 0.02 steps, order 8). The automated registrations were performed using iNRT β version software (Nihon Medi. Co.) and the rotation angles of SPECT for registration were noted. In this study, the registrations of all SPECT data were successful. Graphs of registration rotation angles against cut-off frequencies were scattered and showed no correlation between the two. The registration rotation angles ranged with changing cut-off frequency from -0.4 deg to +3.8 deg at a 5 deg tilt and from +12.7 deg to +19.6 deg at a 15 deg tilt. The registration rotation angles showed variation even for slight differences in cut-off frequencies. The absolute errors were a few degrees for any cut-off frequency. Regardless of the cut-off frequency, automatic registration using this software provides similar results. (author)

Integrating Statistical and Expert Knowledge to Develop Phenoregions for the Continental United States

Science.gov (United States)

Hoffman, F. M.; Kumar, J.; Hargrove, W. W.

2013-12-01

Vegetated ecosystems typically exhibit unique phenological behavior over the course of a year, suggesting that remotely sensed land surface phenology may be useful for characterizing land cover and ecoregions. However, phenology is also strongly influenced by temperature and water stress; insect, fire, and storm disturbances; and climate change over seasonal, interannual, decadal and longer time scales. Normalized difference vegetation index (NDVI), a remotely sensed measure of greenness, provides a useful proxy for land surface phenology. We used NDVI for the conterminous United States (CONUS) derived from the Moderate Resolution Spectroradiometer (MODIS) at 250 m resolution to develop phenological signatures of emergent ecological regimes called phenoregions. By applying a unsupervised, quantitative data mining technique to NDVI measurements for every eight days over the entire MODIS record, annual maps of phenoregions were developed. This technique produces a prescribed number of prototypical phenological states to which every location belongs in any year. To reduce the impact of short-term disturbances, we derived a single map of the mode of annual phenological states for the CONUS, assigning each map cell to the state with the largest integrated NDVI in cases where multiple states tie for the highest frequency. Since the data mining technique is unsupervised, individual phenoregions are not associated with an ecologically understandable label. To add automated supervision to the process, we applied the method of Mapcurves, developed by Hargrove and Hoffman, to associate individual phenoregions with labeled polygons in expert-derived maps of biomes, land cover, and ecoregions. Utilizing spatial overlays with multiple expert-derived maps, this "label-stealing"' technique exploits the knowledge contained in a collection of maps to identify biome characteristics of our statistically derived phenoregions. Generalized land cover maps were produced by combining

MO-G-17A-05: PET Image Deblurring Using Adaptive Dictionary Learning

International Nuclear Information System (INIS)

Valiollahzadeh, S; Clark, J; Mawlawi, O

2014-01-01

Purpose: The aim of this work is to deblur PET images while suppressing Poisson noise effects using adaptive dictionary learning (DL) techniques. Methods: The model that relates a blurred and noisy PET image to the desired image is described as a linear transform y=Hm+n where m is the desired image, H is a blur kernel, n is Poisson noise and y is the blurred image. The approach we follow to recover m involves the sparse representation of y over a learned dictionary, since the image has lots of repeated patterns, edges, textures and smooth regions. The recovery is based on an optimization of a cost function having four major terms: adaptive dictionary learning term, sparsity term, regularization term, and MLEM Poisson noise estimation term. The optimization is solved by a variable splitting method that introduces additional variables. We simulated a 128×128 Hoffman brain PET image (baseline) with varying kernel types and sizes (Gaussian 9×9, σ=5.4mm; Uniform 5×5, σ=2.9mm) with additive Poisson noise (Blurred). Image recovery was performed once when the kernel type was included in the model optimization and once with the model blinded to kernel type. The recovered image was compared to the baseline as well as another recovery algorithm PIDSPLIT+ (Setzer et. al.) by calculating PSNR (Peak SNR) and normalized average differences in pixel intensities (NADPI) of line profiles across the images. Results: For known kernel types, the PSNR of the Gaussian (Uniform) was 28.73 (25.1) and 25.18 (23.4) for DL and PIDSPLIT+ respectively. For blinded deblurring the PSNRs were 25.32 and 22.86 for DL and PIDSPLIT+ respectively. NADPI between baseline and DL, and baseline and blurred for the Gaussian kernel was 2.5 and 10.8 respectively. Conclusion: PET image deblurring using dictionary learning seems to be a good approach to restore image resolution in presence of Poisson noise. GE Health Care

Motion correction in neurological fan beam SPECT using motion tracking and fully 3D reconstruction

International Nuclear Information System (INIS)

Fulton, R.R.; Hutton, B.; Eberl, S.; Meikle, S.; Braun, M.; Westmead Hospital, Westmead, NSW; University of Technology, Sydney, NSW

1998-01-01

Full text: We have previously proposed the use of fully three-dimensional (3D) reconstruction and continuous monitoring of head position to correct for motion artifacts in neurological SPECT and PET. Knowledge of the motion during acquisition provided by a head tracking system can be used to reposition the projection data in space in such a way as to negate motion effects during reconstruction. The reconstruction algorithm must deal with variations in the projection geometry resulting from differences in the timing and nature of motion between patients. Rotational movements about any axis other than the camera's axis of rotation give rise to projection geometries which necessitate the use of a fully 3D reconstruction algorithm. Our previous work with computer simulations assuming parallel hole collimation demonstrated the feasibility of correcting for motion. We have now refined our iterative 3D reconstruction algorithm to support fan beam data and attenuation correction, and developed a practical head tracking system for use on a Trionix Triad SPECT system. The correction technique has been tested in fan beam SPECT studies of the 3D Hoffman brain phantom. Arbitrary movements were applied to the phantom during acquisition and recorded by the head tracker which monitored the position and orientation of the phantom throughout the study. 3D reconstruction was then performed using the motion data provided by the tracker. The accuracy of correction was assessed by comparing the corrected images with a motion free study acquired immediately beforehand, visually and by calculating mean squared error (MSE). Motion correction reduced distortion perceptibly and, depending on the motions applied, improved MSE by up to an order of magnitude. 3D reconstruction of the 128x128x128 data set took 20 minutes on a SUN Ultra 1 workstation. The results of these phantom experiments suggest that the technique can effectively compensate for head motion under clinical SPECT imaging

Measuring severe adverse events and medication selection using a “PEER Report” for nonpsychotic patients: a retrospective chart review

Directory of Open Access Journals (Sweden)

Hoffman DA

2012-06-01

Full Text Available Daniel A Hoffman,1 Charles DeBattista,2 Rob J Valuck,3 Dan V Iosifescu41Neuro-Therapy Clinic, Inc, Denver, CO, USA; 2Stanford University School of Medicine, Palo Alto, CA, USA; 3University of Colorado, SKAGES School of Pharmacy and Pharmaceutical Sciences, Aurora, CO, USA; 4Mood and Anxiety Disorders Program, Mount Sinai School of Medicine, New York, NY, USAAbstract: We previously reported on an objective new tool that uses quantitative electroencephalography (QEEG normative- and referenced-electroencephalography sampling databases (currently called Psychiatric EEG Evaluation Registry [PEER], which may assist physicians in determining medication selection for optimal efficacy to overcome trial-and-error prescribing. The PEER test compares drug-free QEEG features for individual patients to a database of patients with similar EEG patterns and known outcomes after pharmacological interventions. Based on specific EEG data elements and historical outcomes, the PEER Report may also serve as a marker of future severe adverse events (eg, agitation, hostility, aggressiveness, suicidality, homicidality, mania, hypomania with specific medications. We used a retrospective chart review to investigate the clinical utility of such a registry in a naturalistic environment.Results: This chart review demonstrated significant improvement on the global assessment scales Clinical Global Impression – Improvement and Quality of Life Enjoyment and Satisfaction – Short Form as well as time to maximum medical improvement and decreased suicidality occurrences. The review also showed that 54.5% of previous medications causing a severe adverse event would have been raised as a caution had the PEER Report been available at the time the drug was prescribed. Finally, due to the significant amount of off-label prescribing of psychotropic medications, additional, objective, evidence-based data aided the prescriber toward better choices.Conclusion: The PEER Report may be

The concept of instability: a French perspective on the concept of ADHD.

Science.gov (United States)

Bader, Michel; Hadjikhani, Nouchine

2014-03-01

Historical references to the emergence of the current concept of ADHD typically cite descriptions from medical textbooks by Weikard (1775) and Crichton (An inquiry into the nature and origin of mental derangement: Comprehending a concise system of the physiology and pathology of the human mind and a history of the passion and their affects. Cardell Jr and Davies, Londres, 1798) on attention disorders, poems of Hoffman on hyperactive and impulsive behaviors (Der Struwwelpeter. Frankfurt am Main, Literarische Anstalt, 1843), as well as the work of Still (Lancet 1:1008-1012, 1077-1082, 1163-1168, 1902a, Lancet 159(4102):1008-1013, 1902b, Lancet 159(4103):1077-1082, 1902c, Lancet 159(4104):1163-1168, 1902d) on impulsive behaviors and defective moral regulation of behavior. The notion of "instability" developed by French physicians between 1887 and 1910 is rarely mentioned and often ignored. Writings from this period show that in France, the emergence of the concept of ADHD according to modern terminology comes from the notion of "mental instability" introduced in the 1890s under the leadership of Désiré-Magloire Bourneville at the Hospital Bicêtre in Paris, based on his observations of children and adolescents who had been labeled "abnormal" and placed in medical and educational institutions. In the early twentieth century, elaborating on the observations of Bourneville, Jean Phillipe and Georges Paul-Boncour showed the presence of a subgroup of "unstable" children who suffered from a disease entity in its own right within the population of "abnormal" schoolchildren (the terminology of the time). This new pathological entity included symptoms of hyperactivity, impulsivity and inattention, corresponding to today's classic triad of ADHD symptoms. While noting the lack of behavioral inhibition, clinical descriptions of Bourneville, Philip and Paul-Boncour also considered the notion of "moral disorder" which at that time played an important role in psychopathology. This

MO-G-17A-05: PET Image Deblurring Using Adaptive Dictionary Learning

Energy Technology Data Exchange (ETDEWEB)

Valiollahzadeh, S [RICE University, Houston, Tx (United States); Clark, J [MD Anderson Cancer Ctr., Houston, TX (United States); Mawlawi, O

2014-06-15

Purpose: The aim of this work is to deblur PET images while suppressing Poisson noise effects using adaptive dictionary learning (DL) techniques. Methods: The model that relates a blurred and noisy PET image to the desired image is described as a linear transform y=Hm+n where m is the desired image, H is a blur kernel, n is Poisson noise and y is the blurred image. The approach we follow to recover m involves the sparse representation of y over a learned dictionary, since the image has lots of repeated patterns, edges, textures and smooth regions. The recovery is based on an optimization of a cost function having four major terms: adaptive dictionary learning term, sparsity term, regularization term, and MLEM Poisson noise estimation term. The optimization is solved by a variable splitting method that introduces additional variables. We simulated a 128×128 Hoffman brain PET image (baseline) with varying kernel types and sizes (Gaussian 9×9, σ=5.4mm; Uniform 5×5, σ=2.9mm) with additive Poisson noise (Blurred). Image recovery was performed once when the kernel type was included in the model optimization and once with the model blinded to kernel type. The recovered image was compared to the baseline as well as another recovery algorithm PIDSPLIT+ (Setzer et. al.) by calculating PSNR (Peak SNR) and normalized average differences in pixel intensities (NADPI) of line profiles across the images. Results: For known kernel types, the PSNR of the Gaussian (Uniform) was 28.73 (25.1) and 25.18 (23.4) for DL and PIDSPLIT+ respectively. For blinded deblurring the PSNRs were 25.32 and 22.86 for DL and PIDSPLIT+ respectively. NADPI between baseline and DL, and baseline and blurred for the Gaussian kernel was 2.5 and 10.8 respectively. Conclusion: PET image deblurring using dictionary learning seems to be a good approach to restore image resolution in presence of Poisson noise. GE Health Care.

A new approach for quantitative evaluation of reconstruction algorithms in SPECT

International Nuclear Information System (INIS)

Raeisi, E.; Rajabi, H.; Aghamiri, S. M. R.

2006-01-01

In nuclear medicine, phantoms are mainly used to evaluate the overall performance of the imaging systems, and practically there is no phantom exclusively designed for the evaluation of the software performance. In this study the Hoffman brain phantom was used for quantitative evaluation of reconstruction techniques. The phantom is modified to acquire tomographic and planar image of the same structure. The planar image may be used as the reference image to evaluate the quality of reconstructed slices, using the companion software developed in MATLAB. Materials and Methods: The designed phantom was composed of 4 independent 2D slices that could have been placed juxtapose to the 3D phantom. Each slice was composed of objects of different size and shape (for example: circle, triangle, and rectangle). Each 2D slice was imaged at distances ranging from 0 to 15 cm from the collimator surface. The phantom in 3D configuration was imaged acquiring 128 views of 128*128 matrix size. Reconstruction was performed using different filtering condition and the reconstructed images were compared to the corresponding planar images. The modulation transfer function, scatter fraction and attenuation map were calculated for each reconstructed image. Results: Since all the parameters of the acquisition were identical for the 2D and the 3D imaging, it was assumed that the difference in the quality of the images has exclusively been due to the reconstruction condition. The planar images were assumed to be the most perfect images which could be obtained with the system. The comparison of the reconstructed slices with the corresponding planar images yielded the optimum reconstruction condition. The results clearly showed that Wiener filter yields superior quality image among the entire tested filters. The extent of the improvement has been quantified in terms of universal image quality index. Conclusion : The phantom and the accompanying software were evaluated and found to be quite useful in

Multi-unit inertial fusion plants based on HYLIFE-II, with shared heavy-ion RIA driver and target factory, producing electricity and hydrogen fuel

Energy Technology Data Exchange (ETDEWEB)

Logan, G.; Moir, R. [Lawrence Livermore National Lab., CA (United States); Hoffman, M. [Univ. of California, Davis, CA (United States)

1994-05-05

Following is a modification of the IFEFUEL systems code, called IFEFUEL2, to treat specifically the HYLIFE-II target chamber concept. The same improved Recirculating Induction Accelerator (RIA) energy scaling model developed recently by Bieri is used in this survey of the economics of multi-unit IFE plants producing both electricity and hydrogen fuel. Reference cases will assume conventional HI-indirect target gains for a 2 mm spot, and improved HYLIFE-II BoP models as per Hoffman. Credits for improved plant availability and lower operating costs due to HYLIFE-II`s 30-yr target chamber lifetime are included, as well as unit cost reductions suggested by Delene to credit greater {open_quotes}learning curve{close_quotes} benefits for the duplicated portions of a multi-unit plant. To illustrate the potential impact of more advanced assumptions, additional {open_quotes}advanced{close_quotes} cases will consider the possible benefits of an MHD + Steam BoP, where direct MHD conversion of plasma from baseball-size LiH target blanket shells is assumed to be possible in a new (as yet undesigned) liquid Flibe-walled target chamber, together and separately, with advanced, higher-gain heavy-ion targets with Fast Ignitors. These runs may help decide the course of a possible future {open_quotes}HYLIFE-III{close_quotes} IFE study. Beam switchyard and final focusing system costs per target chamber are assumed to be consistent with single-sided illumination, for either {open_quotes}conventional{close_quotes} or {open_quotes}advanced{close_quotes} indirect target gain assumptions. Target costs are scaled according to the model by Woodworth. In all cases, the driver energy and rep rate for each chosen number of target chambers and total plant output will be optimized to minimize the cost of electricity (CoE) and the associated cost of hydrogen (CoH), using a relationship between CoE and CoH to be presented in the next section.

Isometric Mid-Thigh Pull Correlates With Strength, Sprint, and Agility Performance in Collegiate Rugby Union Players.

Science.gov (United States)

Wang, Ran; Hoffman, Jay R; Tanigawa, Satoru; Miramonti, Amelia A; La Monica, Michael B; Beyer, Kyle S; Church, David D; Fukuda, David H; Stout, Jeffrey R

2016-11-01

Wang, R, Hoffman, JR, Tanigawa, S, Miramonti, AA, La Monica, MB, Beyer, KS, Church, DD, Fukuda, DH, and Stout, JR. Isometric mid-thigh pull correlates with strength, sprint, and agility performance in collegiate rugby union players. J Strength Cond Res 30(11): 3051-3056, 2016-The purpose of this investigation was to examine the relationships between isometric mid-thigh pull (IMTP) force and strength, sprint, and agility performance in collegiate rugby union players. Fifteen members of a champion-level university's club rugby union team (mean ± SD: 20.67 ± 1.23 years, 1.78 ± 0.06 m, and 86.51 ± 14.18 kg) participated in this investigation. One repetition maximum (1RM) squat, IMTP, speed (40 m sprint), and agility (proagility test and T-test) were performed during 3 separate testing sessions. Rate of force development (RFD) and force output at 30, 50, 90, 100, 150, 200, and 250 milliseconds of IMTP, as well as the peak value were determined. Pearson product-moment correlation analysis was used to examine the relationships between these measures. Performance in the 1RM squat was significantly correlated to the RFD between 90 and 250 milliseconds from the start of contraction (r's ranging from 0.595 to 0.748), and peak force (r = 0.866, p ≤ 0.05). One repetition maximum squat was also correlated to force outputs between 90 and 250 milliseconds (r's ranging from 0.757 to 0.816, p ≤ 0.05). Sprint time over the first 5 m in the 40 m sprint was significantly (p ≤ 0.05) correlated with peak RFD (r = -0.539) and RFD between 30 and 50 milliseconds (r's = -0.570 and -0.527, respectively). Time for the proagility test was correlated with peak RFD (r = -0.523, p ≤ 0.05) and RFD between 30 and 100 milliseconds (r's ranging from -0.518 to -0.528, p's strength, agility, and sprint performance. Future studies should examine IMTP as a potential tool to monitor athletic performance during the daily training of rugby union players.

Electroacupuncture improves gait locomotion, H-reflex and ventral root potentials of spinal compression injured rats.

Science.gov (United States)

Escobar-Corona, Carlos; Torres-Castillo, Sergio; Rodríguez-Torres, Erika Elizabeth; Segura-Alegría, Bertha; Jiménez-Estrada, Ismael; Quiroz-González, Salvador

2017-05-01

This study explored the effect of electroacupuncture stimulation (EA) on alterations in the Hoffman reflex (H-reflex) response and gait locomotion provoked by spinal cord injury (SCI) in the rat. A compression lesion of the spinal cord was evoked by insufflating a Fogarty balloon located in the epidural space at the T8-9 spinal level of adult Wistar male rats (200-250 gr; n=60). In different groups of SCI rats, EA (frequencies: 2, 50 and 100Hz) was applied simultaneously to Huantiao (GB30), Yinmen (BL37), Jizhong (GV6) and Zhiyang (GV9) acupoints from the third post-injury day until the experimental session. At 1, 2, 3 and 4 post-injury weeks, the BBB scores of the SCI group of rats treated with EA at 50Hz showed a gradual but greater enhancement of locomotor activity than the other groups of rats. Unrestrained gait kinematic analysis of SCI rats treated with EA-50Hz stimulation showed a significant improvement in stride duration, length and speed (p<0.05), whereas a discrete recovery of gait locomotion was observed in the other groups of animals. After four post-injury weeks, the H-reflex amplitude and H-reflex/M wave amplitude ratio obtained in SCI rats had a noticeable enhancement (217%) compared to sham rats (n=10). Meanwhile, SCI rats treated with EA at 50Hz manifested a decreased facilitation of the H-reflex amplitude and H/M amplitude ratio (154%) and a reduced frequency-dependent amplitude depression of the H-reflex (66%). In addition, 50 Hz-EA treatment induced a recovery of the presynaptic depression of the Gs-VRP evoked by PBSt conditioning stimulation in the SCI rat (63.2±8.1%; n=9). In concordance with the latter, it could be suggested that 50 Hz-EA stimulation reduced the hyper-excitability of motoneurons and provokes a partial improvement of the locomotive performance and H reflex responses by a possible recovery of presynaptic mechanisms in the spinal cord of experimentally injured rats. Copyright © 2017 Elsevier Inc. All rights reserved.

Sonography and hypotension: a change to critical problem solving in undergraduate medical education

Directory of Open Access Journals (Sweden)

Amini R

2016-01-01

Full Text Available Richard Amini, Lori A Stolz, Nicholas C Hernandez, Kevin Gaskin, Nicola Baker, Arthur Barry Sanders, Srikar AdhikariDepartment of Emergency Medicine, University of Arizona Medical Center, College of Medicine, University of Arizona, Tucson, AZ, USAStudy objectives: Multiple curricula have been designed to teach medical students the basics of ultrasound; however, few focus on critical problem-solving. The objective of this study is to determine whether a theme-based ultrasound teaching session, dedicated to the use of ultrasound in the management of the hypotensive patient, can impact medical students’ ultrasound education and provide critical problem-solving exercises.Methods: This was a cross-sectional study using an innovative approach to train 3rd year medical students during a 1-day ultrasound training session. The students received a 1-hour didactic session on basic ultrasound physics and knobology and were also provided with YouTube hyperlinks, and links to smart phone educational applications, which demonstrated a variety of bedside ultrasound techniques. In small group sessions, students learned how to evaluate patients for pathology associated with hypotension. A knowledge assessment questionnaire was administered at the end of the session and again 3 months later. Student knowledge was also assessed using different clinical scenarios with multiple-choice questions.Results: One hundred and three 3rd year medical students participated in this study. Appropriate type of ultrasound was selected and accurate diagnosis was made in different hypotension clinical scenarios: pulmonary embolism, 81% (95% CI, 73%–89%; abdominal aortic aneurysm, 100%; and pneumothorax, 89% (95% CI, 82%–95%. The average confidence level in performing ultrasound-guided central line placement was 7/10, focused assessment with sonography for trauma was 8/10, inferior vena cava assessment was 8/10, evaluation for abdominal aortic aneurysm was 8/10, assessment for

UbuLab, or pataphysics at the university: Searching for the threshold of articulability

Directory of Open Access Journals (Sweden)

Piotr Marecki

2017-10-01

in running institutions outside the university (I also lead a third sector institution called Ha!art [www.ha.art.pl], which, apart from the publishing house, also runs mini-festivals and a portal that produces new works and knowledge, including published academic books, lectures, conferences, research projects, reports. My essay/report contributes to a current research trend on laboratories in the field of the humanities conducted, among others, by Lori Emerson and Jussi Parikka.

MARATHON DESPITE UNILATERAL VOCAL FOLD PARALYSIS

Directory of Open Access Journals (Sweden)

Matthias Echternach

2008-06-01

physical analysis conspicuous results were shown concerning hoarseness, shimmer or jitter. The maximum-phonation-time was slightly restricted at 11 seconds. Both vocal dynamics and frequency spectrum showed normal ratings.Neck CT and thorax region MRT were performed, showing no pathology in the area of the recurrent nerve or the vagus.The patient was re-examined at the Clinic for Sports Medicine on the basis of the laryngological results. Neither in the internal sports medical examination nor in the physical analysis were conspicuous results shown. The flow characteristics registered breath-by-breath during the ergometry (bicycle- ergometry up to 125 W were completely unaffected up to maximal ventilation (Figure 2. The blood gases after exertion and the performance attained showed norm ratings.Two months after the examination the patient ran her first marathon. No respiratory complaints were experienced any more. Although there is one description of dyspnea due to a unilateral vocal fold paralysis published (Laccourreye et al., 2003, there are still no data regarding either the form of stress that goes together with laryngeally caused dyspnea or what machanism induces it. Both restriction of the breath cross-section and excessively high consumption of air during phonation may produce a subjective sensation of unspecific respiratory complaints. It was shown that, in vocal fold paralysis, inspirational flow is in fact reduced - in contrast to exspiratory flow (Beaty and Hoffman, 1999; Cantarella et al., 2003. However, neither the position of the fixed vocal fold nor the degree of breathiness had an influence on the breathing parameters (Cantarella et al., 2005. Beaty and Hoffman, 1999 found lower inspiratory flow rates after medialization thyreoplasty. No modification of the breathing parameters was shown after fat injection in the vocal fold (Cantarella et al., 2006. We are here describing an extraordinary achievement in an endurance form of athletics with a unilateral

Clinical evidence for cervical myelopathy due to Chiari malformation and spinal stenosis in a non-randomized group of patients with the diagnosis of fibromyalgia.

Science.gov (United States)

Heffez, Dan S; Ross, Ruth E; Shade-Zeldow, Yvonne; Kostas, Konstantinos; Shah, Sagar; Gottschalk, Robert; Elias, Dean A; Shepard, Alan; Leurgans, Sue E; Moore, Charity G

2004-10-01

While patients with fibromyalgia report symptoms consistent with cervical myelopathy, a detailed neurological evaluation is not routine. We sought to determine if patients with fibromyalgia manifest objective neurological signs of cervical myelopathy. Two hundred and seventy patients, 18 years and older, who carried the diagnosis of fibromyalgia but who had no previously recognized neurological disease underwent detailed clinical neurological and neuroradiological evaluation for the prevalence of objective evidence of cervical myelopathy and radiological evidence of cerebellar tonsillar herniation (Chiari 1 malformation) or cervical spinal canal stenosis. Patients were primarily women (87%), of mean age 44 years, who had been symptomatic for 8 years (standard deviation, 6.3 years). The predominant complaints were neck/back pain (95%), fatigue (95%), exertional fatigue (96%), cognitive impairment (92%), instability of gait (85%), grip weakness (83%), paresthesiae (80%), dizziness (71%) and numbness (69%). Eighty-eight percent of patients reported worsening symptoms with neck extension. The neurological examination was consistent with cervical myelopathy: upper thoracic spinothalamic sensory level (83%), hyperreflexia (64%), inversion of the radial periosteal reflex (57%), positive Romberg sign (28%), ankle clonus (25%), positive Hoffman sign (26%), impaired tandem walk (23%), dysmetria (15%) and dysdiadochokinesia (13%). MRI and contrast-enhanced CT imaging of the cervical spine revealed stenosis. The mean antero-posterior (AP) spinal canal diameter at C2/3, C3/4, C4/5, C5/6, C6/7 and C7/T1 was 13.5 mm, 11.8 mm, 11.5 mm, 10.4 mm, 11.3 mm and 14.5 mm respectively, (CT images). In 46% of patients, the AP spinal diameter at C5/6 measured 10 mm, or less, with the neck positioned in mild extension, i.e., clinically significant spinal canal stenosis. MRI of the brain revealed tonsillar ectopia >5 mm in 20% of patients (mean=7.1+/-1.8 mm), i.e., Chiari 1 malformation

SU-C-9A-06: The Impact of CT Image Used for Attenuation Correction in 4D-PET

International Nuclear Information System (INIS)

Cui, Y; Bowsher, J; Yan, S; Cai, J; Das, S; Yin, F

2014-01-01

Purpose: To evaluate the appropriateness of using 3D non-gated CT image for attenuation correction (AC) in a 4D-PET (gated PET) imaging protocol used in radiotherapy treatment planning simulation. Methods: The 4D-PET imaging protocol in a Siemens PET/CT simulator (Biograph mCT, Siemens Medical Solutions, Hoffman Estates, IL) was evaluated. CIRS Dynamic Thorax Phantom (CIRS Inc., Norfolk, VA) with a moving glass sphere (8 mL) in the middle of its thorax portion was used in the experiments. The glass was filled with 18 F-FDG and was in a longitudinal motion derived from a real patient breathing pattern. Varian RPM system (Varian Medical Systems, Palo Alto, CA) was used for respiratory gating. Both phase-gating and amplitude-gating methods were tested. The clinical imaging protocol was modified to use three different CT images for AC in 4D-PET reconstruction: first is to use a single-phase CT image to mimic actual clinical protocol (single-CT-PET); second is to use the average intensity projection CT (AveIP-CT) derived from 4D-CT scanning (AveIP-CT-PET); third is to use 4D-CT image to do the phase-matched AC (phase-matching- PET). Maximum SUV (SUVmax) and volume of the moving target (glass sphere) with threshold of 40% SUVmax were calculated for comparison between 4D-PET images derived with different AC methods. Results: The SUVmax varied 7.3%±6.9% over the breathing cycle in single-CT-PET, compared to 2.5%±2.8% in AveIP-CT-PET and 1.3%±1.2% in phasematching PET. The SUVmax in single-CT-PET differed by up to 15% from those in phase-matching-PET. The target volumes measured from single- CT-PET images also presented variations up to 10% among different phases of 4D PET in both phase-gating and amplitude-gating experiments. Conclusion: Attenuation correction using non-gated CT in 4D-PET imaging is not optimal process for quantitative analysis. Clinical 4D-PET imaging protocols should consider phase-matched 4D-CT image if available to achieve better accuracy

How Cells Can Control Their Size by Pumping Ions

Directory of Open Access Journals (Sweden)

Alan R. Kay

2017-05-01

Full Text Available The ability of all cells to set and regulate their size is a fundamental aspect of cellular physiology. It has been known for sometime but not widely so, that size stability in animal cells is dependent upon the operation of the sodium pump, through the so-called pump-leak mechanism (Tosteson and Hoffman, 1960. Impermeant molecules in cells establish an unstable osmotic condition, the Donnan effect, which is counteracted by the operation of the sodium pump, creating an asymmetry in the distribution of Na+ and K+ staving off water inundation. In this paper, which is in part a tutorial, I show how to model quantitatively the ion and water fluxes in a cell that determine the cell volume and membrane potential. The movement of water and ions is constrained by both osmotic and charge balance, and is driven by ion and voltage gradients and active ion transport. Transforming these constraints and forces into a set of coupled differential equations allows us to model how the ion distributions, volume and voltage change with time. I introduce an analytical solution to these equations that clarifies the influence of ion conductances, pump rates and water permeability in this multidimensional system. I show that the number of impermeant ions (x and their average charge have a powerful influence on the distribution of ions and voltage in a cell. Moreover, I demonstrate that in a cell where the operation of active ion transport eliminates an osmotic gradient, the size of the cell is directly proportional to x. In addition, I use graphics to reveal how the physico-chemical constraints and chemical forces interact with one another in apportioning ions inside the cell. The form of model used here is applicable to all membrane systems, including mitochondria and bacteria, and I show how pumps other than the sodium pump can be used to stabilize cells. Cell biologists may think of electrophysiology as the exclusive domain of neuroscience, however the electrical

Dark sides of the proposed Framework Convention on Global Health's many virtues: A systematic review and critical analysis.

Science.gov (United States)

Hoffman, Steven J; Røttingen, John-Arne

2013-06-14

that completely bypasses WHO; or 4) narrowing the scope of sought changes to one particular governance issue such as financing for global health needs. Copyright © 2013 Hoffman and Rottingen. This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/), which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original author and source are credited.

Comparison of accelerated ion populations observed upstream of the bow shocks at Venus and Mars

Directory of Open Access Journals (Sweden)

M. Yamauchi

2011-03-01

Full Text Available Foreshock ions are compared between Venus and Mars at energies of 0.6~20 keV using the same ion instrument, the Ion Mass Analyser, on board both Venus Express and Mars Express. Venus Express often observes accelerated protons (2~6 times the solar wind energy that travel away from the Venus bow shock when the spacecraft location is magnetically connected to the bow shock. The observed ions have a large field-aligned velocity compared to the perpendicular velocity in the solar wind frame, and are similar to the field-aligned beams and intermediate gyrating component of the foreshock ions in the terrestrial upstream region. Mars Express does not observe similar foreshock ions as does Venus Express, indicating that the Martian foreshock does not possess the intermediate gyrating component in the upstream region on the dayside of the planet. Instead, two types of gyrating protons in the solar wind frame are observed very close to the Martian quasi-perpendicular bow shock within a proton gyroradius distance. The first type is observed only within the region which is about 400 km from the bow shock and flows tailward nearly along the bow shock with a similar velocity as the solar wind. The second type is observed up to about 700 km from the bow shock and has a bundled structure in the energy domain. A traversal on 12 July 2005, in which the energy-bunching came from bundling in the magnetic field direction, is further examined. The observed velocities of the latter population are consistent with multiple specular reflections of the solar wind at the bow shock, and the ions after the second reflection have a field-aligned velocity larger than that of the de Hoffman-Teller velocity frame, i.e., their guiding center has moved toward interplanetary space out from the bow shock. To account for the observed peculiarity of the Martian upstream region, finite gyroradius effects of the solar wind protons compared to the radius of the bow shock curvature and

Predicting PTSD using the New York Risk Score with genotype data: potential clinical and research opportunities

Directory of Open Access Journals (Sweden)

Boscarino JA

2013-04-01

Full Text Available Joseph A Boscarino,1,2 H Lester Kirchner,3,4 Stuart N Hoffman,5 Porat M Erlich1,4 1Center for Health Research, Geisinger Clinic, Danville, 2Department of Psychiatry, Temple University School of Medicine, Philadelphia, 3Division of Medicine, Geisinger Clinic, Danville, 4Department of Medicine, Temple University School of Medicine, Philadelphia, 5Department of Neurology, Geisinger Clinic, Danville, PA, USA Background: We previously developed a post-traumatic stress disorder (PTSD screening instrument, ie, the New York PTSD Risk Score (NYPRS, that was effective in predicting PTSD. In the present study, we assessed a version of this risk score that also included genetic information. Methods: Utilizing diagnostic testing methods, we hierarchically examined different prediction variables identified in previous NYPRS research, including genetic risk-allele information, to assess lifetime and current PTSD status among a population of trauma-exposed adults. Results: We found that, in predicting lifetime PTSD, the area under the receiver operating characteristic curve (AUC for the Primary Care PTSD Screen alone was 0.865. When we added psychosocial predictors from the original NYPRS to the model, including depression, sleep disturbance, and a measure of health care access, the AUC increased to 0.902, which was a significant improvement (P = 0.0021. When genetic information was added in the form of a count of PTSD risk alleles located within FKBP, COMT, CHRNA5, and CRHR1 genetic loci (coded 0–6, the AUC increased to 0.920, which was also a significant improvement (P = 0.0178. The results for current PTSD were similar. In the final model for current PTSD with the psychosocial risk factors included, genotype resulted in a prediction weight of 17 for each risk allele present, indicating that a person with six risk alleles or more would receive a PTSD risk score of 17 × 6 = 102, the highest risk score for any of the predictors studied. Conclusion: Genetic

TH-AB-207A-09: Tailoring TCM Schemes to a Task: Evaluating the Impact of Customized TCM Profiles On Detection of Lung Nodules in Simulated CT Lung Cancer Screening

Energy Technology Data Exchange (ETDEWEB)

Hoffman, J; McNitt-Gray, M [Departments of Biomedical Physics and Radiology, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Noo, F [University of Utah, Salt Lake City, UT (United States); Young, S [Department of Radiology, UCLA, Los Angeles, CA (United States)

2016-06-15

detection. J. Hoffman: Part-time intern, Toshiba Medical Research Institute; M. McNitt-Gray: Institutional research agreement, Siemens Healthcare; Past recipient, research grant support, Siemens Healthcare; Consultant, Toshiba America Medical Systems; Consultant, Samsung Electronics; F. Noo: Institutional research agreement, Siemens Healthcare; Receives research funding from Siemens Healthcare.

TH-AB-207A-09: Tailoring TCM Schemes to a Task: Evaluating the Impact of Customized TCM Profiles On Detection of Lung Nodules in Simulated CT Lung Cancer Screening

International Nuclear Information System (INIS)

Hoffman, J; McNitt-Gray, M; Noo, F; Young, S

2016-01-01

detection. J. Hoffman: Part-time intern, Toshiba Medical Research Institute; M. McNitt-Gray: Institutional research agreement, Siemens Healthcare; Past recipient, research grant support, Siemens Healthcare; Consultant, Toshiba America Medical Systems; Consultant, Samsung Electronics; F. Noo: Institutional research agreement, Siemens Healthcare; Receives research funding from Siemens Healthcare

Relationship between the Neoproterozoic snowball Earth and Cambrian explosion

Science.gov (United States)

Maruyama, S.; Yoshihara, A.; Isozaki, Y.

2007-12-01

Origin of snowball Earth has been debated in terms of greenhouse gas (e.g., Hoffman and Schrag), obliqueness of Earth's rotation axis (Williams, 1975), true polar wander (Evans, 2003), Galactic cosmic ray radiation (Shaviv and Veizer, 2003; Svensmark, 2006), or weakened geomagnetism (Maruyama and Yoshihara, 2003). A major difficulty for the greenhouse gas hypothesis is the on-off switch causing decrease and increase of appropriate amounts of CO2 by plume- and plate tectonics, and also in available amount of CO2 in atmosphere to be consistent with the observations. In contrast, the cosmic ray radiation models due to the star burst peaked at 2.5- 2.1 Ga and 1.4-0.8 Ga can explain on-off switch more easily than the greenhouse gas model. Cosmic ray radiations, however, must be modified by the geomagnetic intensity, fluctuating 150"% to cause the snowball Earth. Time difference between the Neoproterozoic snowball Earth and Cambrian explosion is as large as 250 millions years, and this refuses their direct close-relationship. Role of frequent mass extinctions, i.e., 8 times during 100 m.y. from 585 Ma to 488 Ma, during the Ediacaran and Cambrian, has been proposed (Zhu et al., 2007). This frequency is one order of magnitude higher compared to that in the post-Ordovician time. Yet, the Cambrian explosion cannot be explained by mass extinction which replaced the vacant niches shortly after the mass extinction and never created a new animal with a new body plan. A new model proposed herein is derived from weakened geomagnetism and resultant extensive cosmic radiation to alter gene and genome for a long period over advancement of low magnetic intensity and cosmic radiations (Svensmark, 2006) from 1.2-0.8Ga. As to the new body plans of animals, it took an appreciably long time to prepare all 34 genometypes before the apparent Cambrian explosion. Geochemically extreme conditions and widened shallow marine environment on continental shelf by the return-flow of sweater into

SU-C-9A-06: The Impact of CT Image Used for Attenuation Correction in 4D-PET

Energy Technology Data Exchange (ETDEWEB)

Cui, Y; Bowsher, J; Yan, S; Cai, J; Das, S; Yin, F [Duke University Medical Center, Durham, NC (United States)

2014-06-01

Purpose: To evaluate the appropriateness of using 3D non-gated CT image for attenuation correction (AC) in a 4D-PET (gated PET) imaging protocol used in radiotherapy treatment planning simulation. Methods: The 4D-PET imaging protocol in a Siemens PET/CT simulator (Biograph mCT, Siemens Medical Solutions, Hoffman Estates, IL) was evaluated. CIRS Dynamic Thorax Phantom (CIRS Inc., Norfolk, VA) with a moving glass sphere (8 mL) in the middle of its thorax portion was used in the experiments. The glass was filled with {sup 18}F-FDG and was in a longitudinal motion derived from a real patient breathing pattern. Varian RPM system (Varian Medical Systems, Palo Alto, CA) was used for respiratory gating. Both phase-gating and amplitude-gating methods were tested. The clinical imaging protocol was modified to use three different CT images for AC in 4D-PET reconstruction: first is to use a single-phase CT image to mimic actual clinical protocol (single-CT-PET); second is to use the average intensity projection CT (AveIP-CT) derived from 4D-CT scanning (AveIP-CT-PET); third is to use 4D-CT image to do the phase-matched AC (phase-matching- PET). Maximum SUV (SUVmax) and volume of the moving target (glass sphere) with threshold of 40% SUVmax were calculated for comparison between 4D-PET images derived with different AC methods. Results: The SUVmax varied 7.3%±6.9% over the breathing cycle in single-CT-PET, compared to 2.5%±2.8% in AveIP-CT-PET and 1.3%±1.2% in phasematching PET. The SUVmax in single-CT-PET differed by up to 15% from those in phase-matching-PET. The target volumes measured from single- CT-PET images also presented variations up to 10% among different phases of 4D PET in both phase-gating and amplitude-gating experiments. Conclusion: Attenuation correction using non-gated CT in 4D-PET imaging is not optimal process for quantitative analysis. Clinical 4D-PET imaging protocols should consider phase-matched 4D-CT image if available to achieve better accuracy.

What product might a renewal of Heavy Ion Fusion development offer that competes with methane microbes and hydrogen HTGRs

International Nuclear Information System (INIS)

Logan, Grant; Lee, Ed; Yu, Simon; Briggs, Dick; Barnard, John; Friedman, Alex; Qin, Hong; Waldron, Will; Leitner, Mattaheus; Kwan, Joe; Henestroza, Enrique; Caporaso, George; Meier, Wayne; Tabak, Max; Callahan, Debbie; Moir, Ralph; Peterson, Per

2006-01-01

In 1994 a Fusion Technology journal publication by Logan, Moir and Hoffman described how exploiting unusually-strong economy-of-scale for large (8 GWe-scale) multi-unit HIF plants sharing a driver and target factory among several low cost molten salt fusion chambers (at) 100MWe net power DEMO. This scoping study, at a very preliminary conceptual level, attempts to identify how we might meet the last two great challenges taking advantage of several recent ideas and advances which motivate reconsideration of modular HIF drivers: >60X longitudinal compression of neutralized ion beams using a variable waveform induction module in NDCX down to 2 nanosecond bunches, the proof-of-principle demonstration of fast optical-gated solid state SiC switches by George Caporaso's group at LLNL (see George's RPIA06 paper), and recent work by Ed Lee, John Barnard and Hong Qin on methods for time-dependent correction of chromatic focusing errors in neutralized beams with up to 10 % Δv/v velocity tilt, allowing 5 or more bunches, and shorter bunches, and possibly 40 that would need higher peak beam intensities in order to reduce total driver energy below 1 MJ. In principle, both PLIA and induction accelerators might benefit from multiple short bunches (see June 24, 2005 talk by Logan on multi-pulsing in PLIA accelerators for IFE), although the PLIA approach, because of fixed circuit wave velocities at any z, requires imaginative work-arounds to handle the different bunch velocities required. George's RPIA06 paper also describes a different type of radial line induction linac that might be considered, but its unclear how the required pulse-to-pulse variable waveforms can be obtained with such pulselines. This initial MathCad analysis explores multi-pulsing in modular solenoid induction linacs (concept shown in Figure 1) considering high-q ECR sources, basic induction acceleration limits assuming affordable agile waveforms, transverse and longitudinal bunch confinement constraints

Enteroparasite and vivax malaria co-infection on the Brazil-French Guiana border: Epidemiological, haematological and immunological aspects.

Directory of Open Access Journals (Sweden)

Rubens Alex de Oliveira Menezes

Full Text Available Malaria-enteroparasitic co-infections are known for their endemicity. Although they are prevalent, little is known about their epidemiology and effect on the immune response. This study evaluated the effect of enteroparasite co-infections with malaria caused by Plasmodium vivax in a border area between Brazil and French Guiana. The cross sectional study took place in Oiapoque, a municipality of Amapá, on the Amazon border. Malaria was diagnosed using thick blood smears, haemoglobin dosage by an automated method and coproparasitology by the Hoffman and Faust methods. The anti-PvMSP-119 IgG antibodies in the plasma were evaluated using ELISA and Th1 (IFN-γ, TNF-α and IL-2, and Th2 (IL-4, IL-5 and IL-10 cytokine counts were performed by flow cytometry. The participants were grouped into those that were monoinfected with vivax malaria (M, vivax malaria-enteroparasite co-infected (CI, monoinfected with enteroparasite (E and endemic controls (EC, who were negative for both diseases. 441 individuals were included and grouped according to their infection status: [M 6.9% (30/441], [Cl 26.5% (117/441], [E 32.4% (143/441] and [EC 34.2% (151/441]. Males prevailed among the (M 77% (23/30 and (CI 60% (70/117 groups. There was a difference in haemoglobin levels among the different groups under study for [EC-E], [EC-Cl], [E-M] and [Cl-M], with (p < 0.01. Anaemia was expressed as a percentage between individuals [CI-EC (p < 0.05]. In terms of parasitaemia, there were differences for the groups [CI-M (p < 0.05]. Anti-PvMSP-119 antibodies were detected in 51.2% (226/441 of the population. The level of cytokines evaluation revealed a large variation in TNF-α and IL-10 concentrations in the co-infected group. In this study we did not observe any influence of coinfection on the acquisition of IgG antibodies against PvMSP119, as well as on the profile of the cytokines that characterize the Th1 and Th2 patterns. However, co-infection increased TNF-α and IL-10

Evaluating Upper-Body Strength and Power From a Single Test: The Ballistic Push-up.

Science.gov (United States)

Wang, Ran; Hoffman, Jay R; Sadres, Eliahu; Bartolomei, Sandro; Muddle, Tyler W D; Fukuda, David H; Stout, Jeffrey R

2017-05-01

Wang, R, Hoffman, JR, Sadres, E, Bartolomei, S, Muddle, TWD, Fukuda, DH, and Stout, JR. Evaluating upper-body strength and power from a single test: the ballistic push-up. J Strength Cond Res 31(5): 1338-1345, 2017-The purpose of this study was to examine the reliability of the ballistic push-up (BPU) exercise and to develop a prediction model for both maximal strength (1 repetition maximum [1RM]) in the bench press exercise and upper-body power. Sixty recreationally active men completed a 1RM bench press and 2 BPU assessments in 3 separate testing sessions. Peak and mean force, peak and mean rate of force development, net impulse, peak velocity, flight time, and peak and mean power were determined. Intraclass correlation coefficients were used to examine the reliability of the BPU. Stepwise linear regression was used to develop 1RM bench press and power prediction equations. Intraclass correlation coefficient's ranged from 0.849 to 0.971 for the BPU measurements. Multiple regression analysis provided the following 1RM bench press prediction equation: 1RM = 0.31 × Mean Force - 1.64 × Body Mass + 0.70 (R = 0.837, standard error of the estimate [SEE] = 11 kg); time-based power prediction equation: Peak Power = 11.0 × Body Mass + 2012.3 × Flight Time - 338.0 (R = 0.658, SEE = 150 W), Mean Power = 6.7 × Body Mass + 1004.4 × Flight Time - 224.6 (R = 0.664, SEE = 82 W); and velocity-based power prediction equation: Peak Power = 8.1 × Body Mass + 818.6 × Peak Velocity - 762.0 (R = 0.797, SEE = 115 W); Mean Power = 5.2 × Body Mass + 435.9 × Peak Velocity - 467.7 (R = 0.838, SEE = 57 W). The BPU is a reliable test for both upper-body strength and power. Results indicate that the mean force generated from the BPU can be used to predict 1RM bench press, whereas peak velocity and flight time measured during the BPU can be used to predict upper-body power. These findings support the potential use of the BPU as a valid method to evaluate upper-body strength and power.

More Than Meets the Eye: The Merging of Perceptual and Conceptual Knowledge in the Anterior Temporal Face Area.

Directory of Open Access Journals (Sweden)

Jessica A. Collins

2016-05-01

Full Text Available An emerging body of research has supported the existence of a small face sensitive region in the ventral anterior temporal lobe (ATL, referred to here as the anterior temporal face area. The contribution of this region in the greater face-processing network remains poorly understood. The goal of the present study was to test the relative sensitivity of this region to perceptual as well as conceptual information about people and objects. We contrasted the sensitivity of this region to that of two highly-studied face-sensitive regions, the fusiform face area and the occipital face area, as well as a control region in early visual cortex. Our findings revealed that multivoxel activity patterns in the anterior temporal face area contain information about facial identity, as well as conceptual attributes such as one’s occupation. The sensitivity of this region to the conceptual attributes of people was greater than that of posterior face processing regions. In addition, the anterior temporal face area overlaps with voxels that contain information about the conceptual attributes of concrete objects, supporting a generalized role of the ventral ATLs in the identification and conceptual processing of multiple stimulus classes.1IntroductionOver a decade of neuroimaging work has characterized the neural basis of face perception and identified several nodes that preferentially respond to faces relative to other objects (Haxby, Hoffman, & Gobbini, 2000; Nancy Kanwisher & Yovel, 2006. Most of this work has focused on the fusiform face area (FFA and the occipital face area (OFA (Kanwisher, McDermott, & Chun, 1997; Kanwisher & Yovel, 2006; Pitcher, Walsh, Yovel, & Duchaine, 2007, however an emerging literature has implicated an anterior temporal face area, on the ventral surface of the right anterior temporal lobes (vATLs in or near perirhinal cortex, in facial processing (Avidan et al., 2013; Pinsk et al., 2009; Rajimehr, Young, & Tootell, 2009; Tsao

The search for Ar in the lunar atmosphere using the Lunar Reconnaissance Orbiter's LAMP instrument.

Science.gov (United States)

Cook, J. C.; Stern, S. A.; Feldman, P. D.; Gladstone, R.; Retherford, K. D.; Greathouse, T. K.; Grava, C.

2014-12-01

The Apollo 17 mass spectrometer, LACE, first measured mass 40 particles in the lunar atmosphere, and over a nine-month period, detected variations correlated with the lunar day (Hoffman et al., 1973, LPSC, 4, 2865). LACE detected a high particle density at dusk (0.6-1.0x104 cm-3), decreasing through the lunar night to a few hundred cm-3, then increasing rapidly before dawn to levels 2-4 times greater than at dusk. No daytime measurements were made due to instrument saturation. Given the LACE measurements' periodic nature, and the Ar abundance in lunar regolith samples (Kaiser, 1972, EPSL, 13, 387), it was concluded that mass 40 was likely due to Ar. Benna et al. (2014, LPSC, 45, 1535) recently reported that the Neutral Mass Spectrometer (NMS) aboard LADEE also detected Ar (mass 40) with similar diurnal profiles. We report on UV spectra of the lunar atmosphere as obtained by the Lunar Reconnaissance Orbiter (LRO). Aboard LRO is the UV-spectrograph, LAMP (Lyman Alpha Mapping Project), spanning the spectral range 575 to 1965 Å. LAMP is typically oriented toward the surface and has been mapping the Moon since September 2009. LAMP also observes the tenuous lunar atmosphere when the surface is in darkness, but the atmospheric column below LRO is illuminated. We have previously used nadir oriented twilight observations to examine the sparse lunar atmosphere (Feldman et al., 2012, Icarus, 221, 854; Cook et al., 2013, Icarus, 225, 681; Stern et al., 2013, Icarus, 226, 1210; Cook & Stern 2014, Icarus, 236, 48). In Cook et al., 2013, we reported an upper limit for Ar of 2.3x104 cm-3. Since then, we have collected additional data and refined our search method by focusing on the regions (near equator) and local times (dawn and dusk) where Ar has been reported previously. We have carefully considered effective area calibration and g-factor accuracies and find these to be unlikely explanations for the order of magnitude differences. We will report new results, which provide much

News & Announcements

Science.gov (United States)

1999-08-01

; materials that augment laboratory experiments are a good example. ·Supplementary videos, such as the videos, still images, and excerpts from interviews with nuclear chemists that give fuller meaning to the Viewpoints article "Chemistry of the Heaviest Elements- One Atom at a Time" referred to below. ·Internet feature columns are more effective in a dynamic medium. Two that are in place are Mathcad in the Chemistry Curriculum (edited by Theresa Zielinski) and Conceptual Questions and Challenge Problems (edited by William Robinson and Susan Nurrenbern). ·Buyers Guides have their content updated often and link to other useful sites. There is one for books and software and another for supplies and equipment. Elements Added to Periodic Table Two new transuranic elements have been added to the list in the Viewpoints article "Chemistry of the Heaviest ElementsOne Atom at a Time" by Darleane C. Hoffman and Diana M. Lee (JCE, 1999, 76, 331). The new elements have atomic numbers 118 and 116. The path to the discovery of these elements was predicted by Robert Smolanczuk, a young Polish theorist whose calculations led him to conclude that a lead-krypton collision technique could produce element 118, which then decays to element 116. Others questioned his results, but Hoffman invited him to join the team at the Lawrence Berkeley National Laboratory and a decision was made to try out his ideas. The result was almost complete verification of Smolanczuk's calculations. The experimental team was headed by Kenneth E. Gregorich; Darleane Hoffman is one of 15 codiscoverers of element 118. Awards Willard Gibbs Medal Lawrence F. Dahl of the University of Wisconsin-Madison is the recipient of 1999 Willard Gibbs Medal, the highest award of the Chicago Section of the American Chemical Society. It is awarded annually to a world-renowned scientist selected by a jury of panelists composed of eminent chemists elected by the Board of Directors of the Chicago Section. The award was presented at the

How to fully exploit frequency-dependent S-wave travel times for refining the Earth's mantle imaging?

Science.gov (United States)

Zaroli, C.; Nolet, G.; Charlety, J.; Debayle, E.; Sambridge, M.

2011-12-01

-band tomographic inversion (using period bands centred at 10, 15, 22, 34 s) against a single-band inversion (22 s centre period) using various degrees of damping. This leads to a limited choice of damping values allowing us to fully exploit multi-band data. Our results indicate a need for very fine model parameterization and more sophisticated regularization technique (e.g. Loris et al., 2010), if we wish to fully exploit the spatial structure of FF kernels. This is particularly essential for small-scale features of the mantle (e.g. plumes, slabs) that are small enough to give rise to body wave travel time dispersion.

Comparative effectiveness trial of family-supported smoking cessation intervention versus standard telephone counseling for chronically ill veterans using proactive recruitment

Directory of Open Access Journals (Sweden)

Bastian LA

2012-09-01

Full Text Available Lori A Bastian,1–3 Laura J Fish,4 Jennifer, M Gierisch,3,5 Lesley D Rohrer,3 Karen M Stechuchak,3 Steven C Grambow3,61Veterans Affairs Connecticut, West Haven, CT, USA; 2Department of Medicine, University of Connecticut Health Center, Farmington, CT, USA; 3Center for Health Services Research in Primary Care, Durham Veterans Affairs Medical Center, Durham, NC, USA; 4Duke Comprehensive Cancer Center, 5Department of Medicine, 6Department of Biostatistics and Bioinformatics, Duke University Medical Center, Durham, NC, USAObjectives: Smoking cessation among patients with chronic medical illnesses substantially decreases morbidity and mortality. Chronically ill veteran smokers may benefit from interventions that assist them in harnessing social support from family and friends.Methods: We proactively recruited veteran smokers who had cancer, cardiovascular disease, or other chronic illnesses (diabetes, chronic obstructive pulmonary disease, hypertension and randomized them to either standard telephone counseling or family-supported telephone counseling focused on increasing support for smoking cessation from family and friends. Participants each received a letter from a Veterans Affairs physician encouraging them to quit smoking, a self-help cessation kit, five telephone counseling sessions, and nicotine replacement therapy, if not contraindicated. The main outcome was 7-day point prevalent abstinence at 5 months.Results: We enrolled 471 participants with mean age of 59.2 (standard deviation [SD] = 7.9 years. 53.0% were white, 8.5% were female, and 55.4% were married/living as married. Overall, 42.9% had cardiovascular disease, 34.2% had cancer, and 22.9% had other chronic illnesses. At baseline, participants were moderately dependent on cigarettes as measured by the Heaviness of Smoking Index (mean = 2.8, SD = 1.6, expressed significant depressive symptoms as measured by the Center for Epidemiological Studies Depression scale (54.8% > 10, and