Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.
Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R
2012-10-01
The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.
Jwa, Seung Chik; Fujiwara, Takeo; Hata, Akira; Arata, Naoko; Sago, Haruhiko; Ohya, Yukihiro
2013-04-25
Research investigating the association between socioeconomic status (SES) and blood pressure (BP) during pregnancy is limited and its underlying pathway is unknown. The aim of this study was to investigate the mediators of the association between educational level as an indicator of the SES and BP in early and mid-pregnancy among Japanese women. Nine hundred and twenty-three pregnant women in whom BP was measured before 16 weeks and at 20 weeks of gestation were enrolled in this study. Maternal educational levels were categorized into three groups: high (university or higher), mid (junior college), and low (junior high school, high school, or vocational training school). The low educational group had higher systolic (low vs. high, difference = 2.39 mmHg, 95% confidence interval [CI]: 0.59 to 4.19) and diastolic BP levels (low vs. high, difference = 0.74 mmHg, 95% CI: -0.52 to 1.99) in early pregnancy. However, the same associations were not found after adjustment for pre-pregnancy body mass index (BMI). BP reduction was observed in mid-pregnancy in all three educational groups and there was no association between educational level and pregnancy-induced hypertension. In Japanese women, the low educational group showed higher BP during pregnancy than the mid or high educational groups. Pre-pregnancy BMI mediates the association between educational level and BP.
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
International Nuclear Information System (INIS)
Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.
2015-01-01
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
Energy Technology Data Exchange (ETDEWEB)
Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)
2015-04-15
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.
Elevated levels of circulating IL-18BP and perturbed regulation of IL-18 in schizophrenia
Directory of Open Access Journals (Sweden)
Palladino Ilaria
2012-08-01
Full Text Available Abstract Background The pleiotropic pro-inflammatory cytokine Interleukin (IL-18 has been proposed to play a role in schizophrenia, since elevated circulating levels of its protein and altered frequencies of genetic variants in its molecular system are reported in schizophrenic patients. Methods We analyzed 77 patients with schizophrenia diagnosis (SCZ and 77 healthy control subjects (HC for serum concentration of both IL-18 and its natural inhibitor, the IL-18 binding protein (IL-18BP. Results We confirmed that serum levels of total IL-18 are significantly increased in SCZ, as compared to HC. However, due to a highly significant increase in levels of circulating IL-18BP in SCZ, as compared to HC, the levels of free, bioactive IL-18 are not significantly different between the two groups. In addition, the relationships between the levels of IL-18 and its inhibitor, as well as between the two molecules and age appear dissimilar for SCZ and HC. In particular, the elevated levels of IL-18BP, likely a consequence of the body’s attempt to counteract the early prominent inflammation which characterizes schizophrenia, are maintained in earlier and later stages of the disease. However, the IL-18BP elevation appears ineffective to balance the IL-18 system in younger SCZ patients, while in older patients the levels of circulating bioactive IL-18 are comparable to those of HC, if not lower. Conclusions In conclusion, these findings indicate that the IL-18 system is perturbed in schizophrenia, supporting the idea that this pro-inflammatory cytokine might be part of a pathway of genetic and environmental components for vulnerability to the disease.
4E-BP1 regulates the differentiation of white adipose tissue.
Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori
2013-07-01
4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.
Wang, Hongjie; Dey, Debleena; Carrera, Ivan; Minond, Dmitriy; Bianchi, Elisabetta; Xu, Shaohua; Lakshmana, Madepalli K
2013-09-13
Increased processing of amyloid precursor protein (APP) and accumulation of neurotoxic amyloid β peptide (Aβ) in the brain is central to the pathogenesis of Alzheimer's disease (AD). Therefore, the identification of molecules that regulate Aβ generation is crucial for future therapeutic approaches for AD. We demonstrated previously that RanBP9 regulates Aβ generation in a number of cell lines and primary neuronal cultures by forming tripartite protein complexes with APP, low-density lipoprotein-related protein, and BACE1, consequently leading to increased amyloid plaque burden in the brain. RanBP9 is a scaffold protein that exists and functions in multiprotein complexes. To identify other proteins that may bind RanBP9 and regulate Aβ levels, we used a two-hybrid analysis against a human brain cDNA library and identified COPS5 as a novel RanBP9-interacting protein. This interaction was confirmed by coimmunoprecipitation experiments in both neuronal and non-neuronal cells and mouse brain. Colocalization of COPS5 and RanBP9 in the same subcellular compartments further supported the interaction of both proteins. Furthermore, like RanBP9, COPS5 robustly increased Aβ generation, followed by increased soluble APP-β (sAPP-β) and decreased soluble-APP-α (sAPP-α) levels. Most importantly, down-regulation of COPS5 by siRNAs reduced Aβ generation, implying that endogenous COPS5 regulates Aβ generation. Finally, COPS5 levels were increased significantly in AD brains and APΔE9 transgenic mice, and overexpression of COPS5 strongly increased RanBP9 protein levels by increasing its half-life. Taken together, these results suggest that COPS5 increases Aβ generation by increasing RanBP9 levels. Thus, COPS5 is a novel RanBP9-binding protein that increases APP processing and Aβ generation by stabilizing RanBP9 protein levels.
Sedimentary Evidence for a Rapid Sea Level Rise at 7,600 cal yr BP from North-Central Cuba
Peros, M. C.; Agosta G'meiner, A. M.; Collins, S.
2016-12-01
A lack of high-resolution relative sea level (RSL) proxy data has meant that the pattern of early Holocene RSL change in the Caribbean is poorly understood. A RSL curve published by Toscano and Macintyre (2003) using inter-tidal mangrove peats and submerged corals suggests RSL underwent a relatively fast and `smooth' curvilinear increase during the Holocene. However, others, such as Blanchon and Shaw (1995), suggest that RSL increased rapidly at around 7600 cal yr BP, in response to the final stages of the melting of the Laurentide Ice Sheet (melt water pulse 1C or catastrophic rise event 3). We investigated this question using multi-proxy data from a flooded sinkhole (Cenote Jennifer) on the north coast of central Cuba. Cenote Jennifer is located 7 m above mean sea level and 2 km from the Bahamas Channel and appears to have a high degree of connectivity with the ocean through a network of underground caverns. The water depth is 13 m and the bottommost 5 m is anoxic. A sediment core collected from Cenote Jennifer was studied using loss-on-ignition, pollen analysis, high-resolution XRF core-scanning, and grain size analysis. An age-depth model was generated for the core by AMS dating. The results show that the bottommost stratigraphic unit ( 9000 to 7600 cal yr BP) is a fine-grained carbonate-rich mud (i.e., marl). This unit abruptly transitions into finely laminated organic-rich sediment from 7600 cal yr BP to the present. The pollen analysis shows that the sinkhole supported a cattail (Typha) community until 7600 cal yr BP, indicating low water levels ( 1 m). At 7600 cal yr BP, the cattail community disappeared and the vegetation of the surrounding bedrock became dominated by a thorny coastal scrubland. In addition, a 3 cm thick fining-upward siliciclastic unit is present immediately above the marl-organic contact, suggesting: 1) a marine sediment source given the limestone-dominated nature of the region, and 2) the presence of a short-duration, high
John, Alin; Weir, Matthew R.; Smith, Stephen R.; Hunsicker, Lawrence; Kasiske, Bertram L.; Kusek, John W.; Bostom, Andrew; Ivanova, Anastasia; Levey, Andrew S.; Solomon, Scott; Pesavento, Todd; Weiner, Daniel E.
2014-01-01
The optimal BP level in kidney transplant recipients remains uncertain. This post hoc analysis of the Folic Acid for Vascular Outcome Reduction in Transplantation (FAVORIT) trial cohort assessed associations of BP with a pooled cardiovascular disease (CVD) outcome and with all-cause mortality. In 3474 prevalent kidney transplant patients, mean age was 52±9 years, 63% were men, 76% were white, 20% had a history of CVD, 40% had a history of diabetes mellitus, and the median time since transplant was 4.1 years (25th to 75th percentiles, 1.7–7.4); mean systolic BP was 136±20 mmHg and mean diastolic BP was 79±12 mmHg. There were 497 CVD events and 406 deaths. After adjustment for demographic and transplant characteristics and CVD risk factors, each 20-mmHg increase in baseline systolic BP associated with a 32% increase in subsequent CVD risk (hazard ratio [HR], 1.32; 95% confidence interval [95% CI], 1.19 to 1.46) and a 13% increase in mortality risk (HR, 1.13; 95% CI, 1.01 to 1.27). Similarly, after adjustment, at diastolic BP levels70 mmHg, there was no significant relationship between diastolic BP and outcomes. Higher systolic BP strongly and independently associated with increased risk of CVD and all-cause mortality, without evidence of a J shape, whereas only lower levels of diastolic BP associated with increased risk of CVD and death in this trial. PMID:24627349
Tunneling in BP-MoS2 heterostructure
Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong
Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).
Burkholderia sp. KCTC 11096BP modulates pepper growth and resistance against Phytophthora capsici
International Nuclear Information System (INIS)
Kang, S.M.; Hamayun, M.; Shinwari, Z.K.
2016-01-01
Biological control of crop diseases is desirable for sustainable agriculture as it minimizes chemical inputs in the agricultural system and promotes eco-friendly environment. We analyzed the favorable role of Burkholderia sp. KCTC 11096BP against the pathogen Phytophthora capsici in pepper. We screen thirty rhizobateria for their anti-pathogen activity, and found that Burkholderia sp. KCTC 11096BP exhibits maximum growth inhibition of the pathogen P. capsici. The bacterium inoculation to pepper plants significantly enhanced growth attributes of pepper in infected and control treatments. The total proteins (10.9%), and the amino acids viz. glycine (4.08 ug/g), leucine (3.3 ug/g), and alanine (3.26 ug/g) were preset in considerably higher quantities in Burkholderia sp. applied treatments as compare to control. The systemic acquired resistance (SAR) of the host plant was up-regulated by Burkholderia sp. KCTC, as endogenous salicylic acid (235.5 ng/g) and jasmonic acid (22.8 ng/g) levels were found higher in such treatments. It was concluded that Burkholderia sp. KCTC 11096BP mitigates the adverse effects of P. capsici on pepper crop and can improve crop productivity at the field level. (author)
BP fusion model for the detection of oil spills on the sea by remote sensing
Chen, Weiwei; An, Jubai; Zhang, Hande; Lin, Bin
2003-06-01
Oil spills are very serious marine pollution in many countries. In order to detect and identify the oil-spilled on the sea by remote sensor, scientists have to conduct a research work on the remote sensing image. As to the detection of oil spills on the sea, edge detection is an important technology in image processing. There are many algorithms of edge detection developed for image processing. These edge detection algorithms always have their own advantages and disadvantages in the image processing. Based on the primary requirements of edge detection of the oil spills" image on the sea, computation time and detection accuracy, we developed a fusion model. The model employed a BP neural net to fuse the detection results of simple operators. The reason we selected BP neural net as the fusion technology is that the relation between simple operators" result of edge gray level and the image"s true edge gray level is nonlinear, while BP neural net is good at solving the nonlinear identification problem. Therefore in this paper we trained a BP neural net by some oil spill images, then applied the BP fusion model on the edge detection of other oil spill images and obtained a good result. In this paper the detection result of some gradient operators and Laplacian operator are also compared with the result of BP fusion model to analysis the fusion effect. At last the paper pointed out that the fusion model has higher accuracy and higher speed in the processing oil spill image"s edge detection.
Directory of Open Access Journals (Sweden)
Alessandra Teixeira Neto Zucatti
2017-01-01
Full Text Available The aim of this study is to evaluate the association between usual physical activity and 24 h blood pressure (BP profile in people with type 2 diabetes mellitus (DM. This is a cross-sectional study of 151 participants with type 2 DM. Usual physical activity was assessed by step counting and self-reported questionnaire. BP was measured in office and by 24 h ambulatory BP monitoring (ABPM; 24 h, daytime and nighttime. Mean participant age was 61.1 ± 8.4 years, 64% was women, and mean duration of diabetes was 14.3 ± 8.5 years. Ninety-two percent of participants had hypertension, and office BP was 138 ± 18/78 ± 10 mmHg. Inverse correlations were observed between step count and 24 h BP (systolic, r=−0.186; p=0.022, daytime BP (systolic, r=−0.198; p=0.015, and nighttime BP (pulse pressure, r=−0.190; p=0.019. People were categorized into tertiles of daily step count, and the 1st tertile had higher 24 h systolic BP, daytime systolic BP, daytime mean BP, and daytime systolic BP load than those in the other tertiles, even after adjusting for age and HbA1c. Participants with type 2 DM and low levels of physical activity exhibit higher 24 h and daytime systolic ambulatory BP values as compared with those who performed more steps per day, even after adjustments for confounding factors.
Relative Sea-Level Stability in Natuna Island, Indonesia, since 6400 yr BP
Wan, J. X. W.; Meltzner, A. J.; Switzer, A.; Horton, B.; Ke, L.; Wang, X.; Bradley, S.; Natawidjaja, D.; Suwargadi, B. W.
2017-12-01
In order to understand the regional variability of relative sea level (RSL) due to glacio-isostatic adjustment (GIA) and other natural influences, high-precision records of Holocene RSL on the Sunda Shelf are required. Accurate estimates of past RSL at a variety of locations allow us to validate geophysical and climate models, and provide context for understanding modern RSL change in the face of global climate change. For the aforementioned purposes, we surveyed and dated coral microatoll colonies, which are precise RSL proxy archives, from Natuna Island in Indonesia. Our analysis of 11 coral microatoll elevations from a total of four sites on Natuna Island is constrained in time by a minimum of one radiocarbon date and one U-Th age on each microatoll. The distribution of ages and elevations indicates that RSL was relatively stable from 6400 to 1400 yr BP at 0.3-0.6 m higher than present, before a more recent fall to current levels. The radiocarbon and U-Th ages are consistent with one another, with preliminary estimates of ΔR ≈ 0 for our entire data set. Our data are roughly compatible with predictions of a recently developed GIA model for the Southeast Asia region (Bradley et al., 2016, Quat. Sci. Rev.). This new dataset is part of larger project with more than 25 sites in Malaysia and Indonesia. Our new constraints on past RSL on the Sunda Shelf will allow for validation and calibration of GIA models in the tropics, where RSL data are presently insufficient.
[Clinical significance of NS1-BP expression in esophageal squamous cell carcinoma].
Ren, K; Qian, D; Wang, Y W; Pang, Q S; Zhang, W C; Yuan, Z Y; Wang, P
2018-01-23
Objective: To investigate the clinical significance of NS1-BP expression in patients with esophageal squamous cell carcinoma (ESCC), and to study the roles of NS1-BP in proliferation and apoptosis of ESCC cells. Methods: A total of 98 tumor tissues and 30 adjacent normal tissues from 98 ESCC patients were used as study group and control group, and these samples were collected in Sun Yat-Sen University Cancer Center between 2002 and 2008. In addition, 46 ESCC tissues which were collected in Cancer Institute and Hospital of Tianjin Medical University were used as validation group. Expression of mucosal NS1-BP was detected by immunohistochemistry. Kaplan-Meier curve and log-rank test were used to analyze the survival rate. Multivariate Cox proportional hazard model was used to analyze the prognostic factors. Furthermore, NS1-BP was over expressed or knocked down in ESCC cells by transient transfection. Protein levels of c-Myc were detected by western blot. Cell viability and apoptosis was analyzed by MTT assay and flow cytometry. Results: Among all of tested samples, NS1-BP were down-regulated in 9 out of 30 non-tumorous normal esophageal tissues (30.0%) and 85 out of 144 ESCC tissues (59.0%), respectively, showing a statistically significant difference ( P =0.012). In the study group, three-year disease-free survival rate of NS1-BP high expression group (53.2%) was significantly higher than that of NS1-BP low expression group (27.6%; P =0.009). In the validation group, the three-year disease-free survival rates were 57.8% and 25.5% in NS1-BP high and low levels groups, respectively, showing a similar results ( P =0.016). Importantly, multivariate analyses showed that low expression of NS1-BP was an independent predictor for chemoradiotherapy sensitivity and shorter disease-free survival time in ESCC patients( P <0.05 for all). Furthermore, overexpressed NS1-BP in TE-1 cells repressed c-Myc expression, inhibited cell proliferation and promoted apoptosis. In contrast
Directory of Open Access Journals (Sweden)
de Groot S
2017-06-01
Full Text Available Stefanie de Groot,1 Hans Gelderblom,1 Marta Fiocco,2,3 Judith VMG Bovée,4 Jacobus JM van der Hoeven,1 Hanno Pijl,5 Judith R Kroep1 1Department of Medical Oncology, 2Department of Medical Statistics and Bioinformatics, Leiden University Medical Center, 3Mathematical Department, Leiden University, 4Department of Pathology, 5Department of Endocrinology, Leiden University Medical Center, Leiden, the Netherlands Background: Activation of the insulin-like growth factor 1 (IGF-1 pathway is involved in cell growth and proliferation and is associated with tumorigenesis, tumor progression, and therapy resistance in solid tumors. We examined whether variability in serum levels of IGF-1, IGF-2, and IGF-binding protein 3 (IGF-BP3 can predict event-free survival (EFS and overall survival (OS in Ewing sarcoma patients treated with chemotherapy.Patients and methods: Serum levels of IGF-1, IGF-2, and IGF-BP3 of 22 patients with localized or metastasized Ewing sarcoma treated with six cycles of vincristine/ifosfamide/doxorubicin/etoposide (VIDE chemotherapy were recorded. Baseline levels were compared with presixth cycle levels using paired t-tests and were tested for associations with EFS and OS. Continuous variables were dichotomized according to the Contal and O’Quigley procedure. Survival analyses were performed using Cox regression analysis.Results: High baseline IGF-1 and IGF-BP3 serum levels were associated with EFS (hazard ratio [HR] 0.075, 95% confidence interval [CI] 0.009–0.602 and HR 0.090, 95% CI 0.011–0.712, respectively in univariate and multivariate analyses (HR 0.063, 95% CI 0.007–0.590 and HR 0.057, 95% CI 0.005–0.585, respectively. OS was improved, but this was not statistically significant. IGF-BP3 and IGF-2 serum levels increased during treatment with VIDE chemotherapy (P=0.055 and P=0.023, respectively.Conclusion: High circulating serum levels of IGF-1 and IGF-BP3 and the molar ratio of IGF-1:IGF-BP3 serum levels were associated
Alpert, Bruce S
2011-04-01
We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.
BP180 dysfunction triggers spontaneous skin inflammation in mice.
Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi
2018-06-04
BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.
Directory of Open Access Journals (Sweden)
Azamat Aslanukov
2006-10-01
Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A
2006-10-01
The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
International Nuclear Information System (INIS)
Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao
2003-01-01
A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)
Hsp70 cochaperones HspBP1 and BAG-1M differentially regulate steroid hormone receptor function.
Directory of Open Access Journals (Sweden)
Regina T Knapp
Full Text Available Hsp70 binding protein 1 (HspBP1 and Bcl2-associated athanogene 1 (BAG-1, the functional orthologous nucleotide exchange factors of the heat shock protein 70 kilodalton (Hsc70/Hsp70 chaperones, catalyze the release of ADP from Hsp70 while inducing different conformational changes of the ATPase domain of Hsp70. An appropriate exchange rate of ADP/ATP is crucial for chaperone-dependent protein folding processes. Among Hsp70 client proteins are steroid receptors such as the glucocorticoid receptor (GR, the mineralocorticoid receptor (MR, and the androgen receptor (AR. BAG-1 diversely affects steroid receptor activity, while to date the influence of HspBP1 on steroid receptor function is mostly unknown. Here, we compared the influence of HspBP1 and BAG-1M on Hsp70-mediated steroid receptor folding complexes and steroid receptor activity. Coimmunoprecipitation studies indicated preferential binding of Hsp40 and the steroid receptors to BAG-1M as compared to HspBP1. Furthermore, Hsp70 binding to the ligand-binding domain of GR was reduced in the presence of HspBP1 but not in the presence of BAG-1M as shown by pull-down assays. Reporter gene experiments revealed an inhibitory effect on GR, MR, and AR at a wide range of HspBP1 protein levels and at hormone concentrations at or approaching saturation. BAG-1M exhibited a transition from stimulatory effects at low BAG-1M levels to inhibitory effects at higher BAG-1M levels. Overall, BAG-1M and HspBP1 had differential impacts on the dynamic composition of steroid receptor folding complexes and on receptor function with important implications for steroid receptor physiology.
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
International Nuclear Information System (INIS)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola
2015-01-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
Energy Technology Data Exchange (ETDEWEB)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola, E-mail: Ola.Hermanson@ki.se
2015-03-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs.
International Nuclear Information System (INIS)
Chan, J.G.
2000-01-01
Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc
Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?
Directory of Open Access Journals (Sweden)
K. M. Usrey
2014-01-01
Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.
An Inventory Controlled Supply Chain Model Based on Improved BP Neural Network
Directory of Open Access Journals (Sweden)
Wei He
2013-01-01
Full Text Available Inventory control is a key factor for reducing supply chain cost and increasing customer satisfaction. However, prediction of inventory level is a challenging task for managers. As one of the widely used techniques for inventory control, standard BP neural network has such problems as low convergence rate and poor prediction accuracy. Aiming at these problems, a new fast convergent BP neural network model for predicting inventory level is developed in this paper. By adding an error offset, this paper deduces the new chain propagation rule and the new weight formula. This paper also applies the improved BP neural network model to predict the inventory level of an automotive parts company. The results show that the improved algorithm not only significantly exceeds the standard algorithm but also outperforms some other improved BP algorithms both on convergence rate and prediction accuracy.
International Nuclear Information System (INIS)
Victor, David G.; House, Joshua C.
2006-01-01
Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate
RanBP3 influences interactions between CRM1 and its nuclear protein export substrates
Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike
2001-01-01
We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...
Assembly of human C-terminal binding protein (CtBP) into tetramers.
Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E
2018-06-08
C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.
CacyBP/SIP promotes the proliferation of colon cancer cells.
Directory of Open Access Journals (Sweden)
Huihong Zhai
Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.
Lee, Peisan; Liu, Ju-Chi; Hsieh, Ming-Hsiung; Hao, Wen-Rui; Tseng, Yuan-Teng; Liu, Shuen-Hsin; Lin, Yung-Kuo; Sung, Li-Chin; Huang, Jen-Hung; Yang, Hung-Yu; Ye, Jong-Shiuan; Zheng, He-Shun; Hsu, Min-Huei; Syed-Abdul, Shabbir; Lu, Richard; Nguyen, Phung-Anh; Iqbal, Usman; Huang, Chih-Wei; Jian, Wen-Shan; Li, Yu-Chuan Jack
2016-08-01
Less than 50% of patients with hypertensive disease manage to maintain their blood pressure (BP) within normal levels. The aim of this study is to evaluate whether cloud BP system integrated with computerized physician order entry (CPOE) can improve BP management as compared with traditional care. A randomized controlled trial done on a random sample of 382 adults recruited from 786 patients who had been diagnosed with hypertension and receiving treatment for hypertension in two district hospitals in the north of Taiwan. Physicians had access to cloud BP data from CPOE. Neither patients nor physicians were blinded to group assignment. The study was conducted over a period of seven months. At baseline, the enrollees were 50% male with a mean (SD) age of 58.18 (10.83) years. The mean sitting BP of both arms was no different. The proportion of patients with BP control at two, four and six months was significantly greater in the intervention group than in the control group. The average capture rates of blood pressure in the intervention group were also significantly higher than the control group in all three check-points. Cloud-based BP system integrated with CPOE at the point of care achieved better BP control compared to traditional care. This system does not require any technical skills and is therefore suitable for every age group. The praise and assurance to the patients from the physicians after reviewing the Cloud BP records positively reinforced both BP measuring and medication adherence behaviors. Copyright © 2016. Published by Elsevier Ireland Ltd.
Lifescience Database Archive (English)
Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap
2018-01-01
Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.
Lifescience Database Archive (English)
Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000
DEFF Research Database (Denmark)
Bandaru, Sunith; Tutum, Cem Celal; Deb, Kalyanmoy
2011-01-01
we introduce the higher-level innovization task through an application of a manufacturing process simulation for the Friction Stir Welding (FSW) process where commonalities among two different Pareto-optimal fronts are analyzed. Multiple design rules are simultaneously deciphered from each front...
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001
Lifescience Database Archive (English)
Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:
Lifescience Database Archive (English)
Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433
Lifescience Database Archive (English)
Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene
Lifescience Database Archive (English)
Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca
Lifescience Database Archive (English)
Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26
Lifescience Database Archive (English)
Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52
Lifescience Database Archive (English)
Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1
Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): a multiproxy study
Lewis, Jonathan P.; Ryves, David B.; Rasmussen, Peter; Knudsen, Karen L.; Petersen, Kaj S.; Olsen, Jesper; Leng, Melanie J.; Kristensen, Peter; McGowan, Suzanne; Philippsen, Bente
2013-10-01
The Limfjord region of northern Jutland, Denmark, supports a rich archaeological record dating back to the Mesolithic, which documents long-term change in human practices and utilisation of marine resources since approximately 7500 BP. The presence and availability of marine resources in the Limfjord is sensitively regulated by environmental parameters such as salinity, sedimentary regime, nutrient status and primary productivity, but long-term changes in these parameters are currently poorly understood. In this study a multiproxy approach (including sedimentary parameters, diatoms, molluscs, foraminifera, sedimentary pigments, C and O stable isotopes and plant macrofossils) has been adopted to assess environmental change over the period ca 7500-1500 cal yrs BP at Kilen, a coastal fjord (before AD 1856) situated in the Western Limfjord. A diatom-based salinity transfer function based on a pan-Baltic training set has been applied to the fossil diatom dataset for quantitative assessment of salinity change over the study period. This study demonstrates that large-scale shifts in salinity are a common feature of the Limfjord's long-term history and are driven by the level of connection with the North Sea and the Skagerrak respectively, which in turn is likely driven by the complex interplay between climate, sea-level change, current velocity and rates of erosion/sedimentary accretion. Three shifts in state at Kilen are identified over the study period: a deep, periodically stratified fjord with medium-high salinity (and high productivity) between ca 7500-5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400 BP, and lastly, within this shallow phase, an abrupt shift to brackish conditions around 2000 BP. Environmental-societal interactions are discussed on the
Li, Hui; McCullough, Lauren E.; Qi, Ya-na; Li, Jia-yuan; Zhang, Jing; Miller, Erline; Yang, Chun-xia; Smith, Jennifer S.
2014-01-01
Background Higher insulin-like growth factor (IGF)-1 and lower IGF binding protein (BP)-3 levels have been associated with higher commoncancer risk, including breast cancer. Dietary factors, genetic polymorphisms, and the combination of both may influence circulating IGF-1 and IGFBP-3 serum concentrations. Methods From September 2011 to July 2012, we collected demographic, reproductive and dietary data on 143 women (≥40 years). We genotyped IGF-1 rs1520220 and IGFBP-3 rs2854744 and measured circulating IGF-1 and IGFBP-3 levels in serum. Covariance analyses were used to estimate the associations of serum levels of IGF-1 and IGFBP-3, and the molar ratio of IGF-1to IGFBP-3 with IGF-1 rs1520220 and IGFBP-3 rs2854744 genotypes. We subsequently assessed the combined influence of genetics and diet (daily intake of protein, fat and soy isoflavones) on IGF-1 and IGFBP-3 levels. Results Among women aged less than 50 years, circulating IGF-1 serum levels were significantly lower for those with CC genotype for IGF-1 rs1520220 than levels for those with the GC or GG genotypes (in recessive model: P = 0.007).In gene-diet analyses among these women, we found carrying CC genotype for IGF-1 rs1520220 and high soy isoflavone intake tend to be associated with lower circulating IGF-1 levels synthetically (P = 0.002). Women with GG or GC genotypes for IGF-1 rs1520220 and with low intake of soy isoflavones had the highest levels of circulating IGF-1 (geometric mean [95% CI]: 195 [37, 1021] µg/L). Comparatively, women with both the CC genotype and high soy intake had the lowest levels of circulating IGF-1 (geometric mean [95% CI]: 120 [38,378] µg/L). Conclusions IGF-1 serum levels are significantly lower among women with the CC genotype for IGF-1-rs1520220. High soy isoflavone intake may interact with carrying CC genotype for IGF-1-rs1520220 to lower women's serum IGF-1 levels more. PMID:25285521
Radioactivity nuclide identification based on BP and LM algorithm neural network
International Nuclear Information System (INIS)
Wang Jihong; Sun Jian; Wang Lianghou
2012-01-01
The paper provides the method which can identify radioactive nuclide based on the BP and LM algorithm neural network. Then, this paper compares the above-mentioned method with FR algorithm. Through the result of the Matlab simulation, the method of radioactivity nuclide identification based on the BP and LM algorithm neural network is superior to the FR algorithm. With the better effect and the higher accuracy, it will be the best choice. (authors)
Lifescience Database Archive (English)
Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406
Lifescience Database Archive (English)
Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,
Lifescience Database Archive (English)
Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801
Lifescience Database Archive (English)
Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0
Lifescience Database Archive (English)
Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-
A 310-bp minimal promoter mediates smooth muscle cell-specific expression of telokin.
Smith, A F; Bigsby, R M; Word, R A; Herring, B P
1998-05-01
A cell-specific promoter located in an intron of the smooth muscle myosin light chain kinase gene directs transcription of telokin exclusively in smooth muscle cells. Transgenic mice were generated in which a 310-bp rabbit telokin promoter fragment, extending from -163 to +147, was used to drive expression of simian virus 40 large T antigen. Smooth muscle-specific expression of the T-antigen transgene paralleled that of the endogenous telokin gene in all smooth muscle tissues except uterus. The 310-bp promoter fragment resulted in very low levels of transgene expression in uterus; in contrast, a transgene driven by a 2.4-kb fragment (-2250 to +147) resulted in high levels of transgene expression in uterine smooth muscle. Telokin expression levels correlate with the estrogen status of human myometrial tissues, suggesting that deletion of an estrogen response element (ERE) may account for the low levels of transgene expression driven by the 310-bp rabbit telokin promoter in uterine smooth muscle. Experiments in A10 smooth muscle cells directly showed that reporter gene expression driven by the 2.4-kb, but not 310-bp, promoter fragment could be stimulated two- to threefold by estrogen. This stimulation was mediated through an ERE located between -1447 and -1474. Addition of the ERE to the 310-bp fragment restored estrogen responsiveness in A10 cells. These data demonstrate that in addition to a minimal 310-bp proximal promoter at least one distal cis-acting regulatory element is required for telokin expression in uterine smooth muscle. The distal element may include an ERE between -1447 and -1474.
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi
Lifescience Database Archive (English)
Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014
Lifescience Database Archive (English)
Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:
The MCM-associated protein MCM-BP is important for human nuclear morphology.
Jagannathan, Madhav; Sakwe, Amos M; Nguyen, Tin; Frappier, Lori
2012-01-01
Mini-chromosome maintenance complex-binding protein (MCM-BP) was discovered as a protein that is strongly associated with human MCM proteins, known to be crucial for DNA replication in providing DNA helicase activity. The Xenopus MCM-BP homologue appears to play a role in unloading MCM complexes from chromatin after DNA synthesis; however, the importance of MCM-BP and its functional contribution to human cells has been unclear. Here we show that depletion of MCM-BP by sustained expression of short hairpin RNA (shRNA) results in highly abnormal nuclear morphology and centrosome amplification. The abnormal nuclear morphology was not seen with depletion of other MCM proteins and was rescued with shRNA-resistant MCM-BP. MCM-BP depletion was also found to result in transient activation of the G2 checkpoint, slowed progression through G2 and increased replication protein A foci, indicative of replication stress. In addition, MCM-BP depletion led to increased cellular levels of MCM proteins throughout the cell cycle including soluble MCM pools. The results suggest that MCM-BP makes multiple contributions to human cells that are not limited to unloading of the MCM complex.
TopBP1 associates with NBS1 and is involved in homologous recombination repair
International Nuclear Information System (INIS)
Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya
2007-01-01
TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID
International Nuclear Information System (INIS)
Zhang Yipei
2009-01-01
Objective: To explore the feasibility of determining radiosensitivity of human tumor cell lines in vitro using the assay of mtDNA4977bp deletion. Methods: Three human tumor cell lines were selected in this study, HepG 2 , EC-9706 and MCF-7. The surviving fraction(SF), the ratio of mtDNA4977bp deletion and DNA damage were detected by MTT assay and nested PCR technique respectively. Results: MTT assay: The SF of HepG 2 and EC-9706 after irradiated by 2, 4and 8Gy was lower significantly than that of MCF-7, which showed that the radiosensitivity of HepG 2 and EC-9706 was higher than that of MCF-7. But there was no statistical difference of SF between HepG 2 and EC-9706. PCR method:The differences on mtDNA 4977bp deletion in mitochondrial DNA among HepG 2 , EC-9706 and MCF-7 were not significant after 1Gy and 4Gy γ-ray irradiation. The ratio of 4977bp deletion in mitochondrial DNA of HepG 2 and EC-9706 increased while that of MCF-7 decreased after 8Gy irradiation. The ratio of mtDNA 4977bp deletion of HepG 2 and EC-9706 was higher significantly than that of MCF-7, which implies that the radiosensitivity of HepG 2 and EC-9706 was higher than that of MCF -7. Conclusion: As a new biological marker, mtDNA4977bp deletion may be hopeful to evaluate the radiosensitivity of tumor cells more objectively and exactly. (authors)
Directory of Open Access Journals (Sweden)
Yang Du
2017-11-01
Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.
Correlations between plasma endothelin-1 levels and breakthrough pain in patients with cancer
Directory of Open Access Journals (Sweden)
Yan XB
2015-12-01
Full Text Available Xue-bin Yan, Tuo-chao Peng, Dong Huang Department of Anesthesiologist, The Third Xiangya Hospital of Central South University, Changsha, Hunan Province, People’s Republic of China Abstract: Endothelin-1 (ET-1 may be involved in driving pain in patients with advanced cancer. However, a few studies focus on the role of ET-1 in breakthrough pain (BP. The aim of this pivotal study was to explore the correlation between the plasma (ET-1 level and BP intensity. A total of 40 patients were enrolled in the study, and they were divided into two groups: BP group and non-BP group. Moreover, 20 healthy adults were used as the normal control group. Pain intensity was measured using visual analog scale (VAS scores of 1–10. Plasma ET-1 levels were detected by an ET radioimmunoassay kit. Subsequently, the correlation of ET-1 level with the VAS score and cancer types was analyzed by Pearson’s correlation coefficient. The plasma ET-1 level in the BP group (35.31±8.02 pg/mL was higher than that in the non-BP group (29.51±6.78 pg/mL and the normal control group (24.77±10.10 pg/mL, P<0.05. In addition, the VAS score in the BP group (7.45±0.82 was higher than that in the non-BP group (2.80±1.23, P<0.05. The plasma ET-1 level was positively correlated with the VAS score of the BP group (Pearson’s r=0.42. There was no significant correlation between the plasma ET-1 level and VAS score of the non-BP group (Pearson’s r=–0.22 or/and cancer types (P>0.05. The elevated plasma ET-1 levels were positively related to BP, and targeting ET-1 may provide a novel pain-reducing therapeutic treatment in BP. Keywords: visual analog scale, correlation, cancer types, background pain
Directory of Open Access Journals (Sweden)
D. Wong
2013-01-01
Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.
McMullan, Ciaran J; Borgi, Lea; Fisher, Naomi; Curhan, Gary; Forman, John
2017-05-08
Higher serum uric acid levels, even within the reference range, are strongly associated with increased activity of the renin-angiotensin system (RAS) and risk of incident hypertension. However, the effect of lowering serum uric acid on RAS activity in humans is unknown, although the data that lowering serum uric acid can reduce BP are conflicting. In a double-blind placebo-controlled trial conducted from 2011 to 2015, we randomly assigned 149 overweight or obese adults with serum uric acid ≥5.0 mg/dl to uric acid lowering with either probenecid or allopurinol, or to placebo. The primary endpoints were kidney-specific and systemic RAS activity. Secondary endpoints included mean 24-hour systolic BP, mean awake and asleep BP, and nocturnal dipping. Allopurinol and probenecid markedly lowered serum uric acid after 4 and 8 weeks compared with placebo (mean serum uric acid in allopurinol, probenecid, and placebo at 8 weeks was 2.9, 3.5, and 5.6 mg/dl, respectively). The change in kidney-specific RAS activity, measured as change in the median (interquartile range) renal plasma flow response to captopril (in ml/min per 1.73 m 2 ) from baseline to 8 weeks, was -4 (-25 to 32) in the probenecid group ( P =0.83), -4 (-16 to 9) in the allopurinol group ( P =0.32), and 1 (-21 to 17) in the placebo group ( P =0.96), with no significant treatment effect ( P =0.77). Similarly, plasma renin activity and plasma angiotensin II levels did not significantly change with treatment. The change in mean (±SD) 24-hour systolic BPs from baseline to 8 weeks was -1.6±10.1 with probenecid ( P =0.43), -0.4±6.1 with allopurinol ( P =0.76), and 0.5±6.0 with placebo ( P =0.65); there was no significant treatment effect ( P =0.58). Adverse events occurred in 9%, 12%, and 2% of those given probenecid, allopurinol, or placebo, respectively. In contrast to animal experiments and observational studies, this randomized, placebo-controlled trial found that uric acid lowering had no effect on kidney
Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): A multiproxy study
DEFF Research Database (Denmark)
Lewis, J. P.; Ryves, D.B.; Rasmussen, P.
2013-01-01
(and high productivity) between ca 7500–5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400...
Climate and sea level in isotope stage 5: an East Antarctic ice surge at approximately 95,000 BP
International Nuclear Information System (INIS)
Hollin, J.T.
1980-01-01
Six high-resolution records correlated with marine isotope stage 5 suggest that substage 5c was essentially interglacial, and was terminated by a catastrophic cooling. Over sixty 230 Th dates indicate that the sea level in substage 5c rose to at least -2 m. Amino acid rations, archaeology, pollen and lithostratigraphy suggest that the sea later jumped to about +16 m. The combination of the cooling and the large jump points to an East Antartic ice surge, at approximately 95 kyr BP. (author)
Lifescience Database Archive (English)
Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;
Lifescience Database Archive (English)
Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI
Lifescience Database Archive (English)
Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2
Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage
DEFF Research Database (Denmark)
Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon
2015-01-01
Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...
International Nuclear Information System (INIS)
Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia
2012-01-01
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.
Lifescience Database Archive (English)
Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa
Lifescience Database Archive (English)
Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot
Lifescience Database Archive (English)
Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett
Lifescience Database Archive (English)
Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI
International Nuclear Information System (INIS)
Rong Qinglin; Cao Yongzhen; Zhang Yaowen; Zhao Xinran; Wang Qin; Li Jin; Liu Qiang
2008-01-01
Objective: To evaluate the possibility of predicting the radiosensitivity of tumor cell lines using the assay of the mtDNA4977bp deletion. Methods: The mtDNA4977bp deletion of HepG 2 cells and PC-3 cells were detected by nested PCR after irradiated by various doses of x-ray. Results: The radiation-induced mtDNA4977bp deletion of the tumor cell lines of HepG 2 and PC-3 were detected after irradiated. There was a dose dependent in the mtDNA4977bp deletion of two tumor cell lines. The deletion rate of HepG 2 was higher significantly than that of PC-3 at each point of radiation dose (P 2 was higher than that of PC-3. Conclusion: The assay of the mtDNA4977bp deletion may be an approach to predict the radiosensitivity of tumor cells. (authors)
Lifescience Database Archive (English)
Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi
Lifescience Database Archive (English)
Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765
Effect of CPAP Withdrawal on BP in OSA: Data from Three Randomized Controlled Trials.
Schwarz, Esther I; Schlatzer, Christian; Rossi, Valentina A; Stradling, John R; Kohler, Malcolm
2016-12-01
Based on meta-analyses, the BP-lowering effect of CPAP therapy in patients with OSA is reported to be approximately 2 to 3 mm Hg. This figure is derived from heterogeneous trials, which are often limited by poor CPAP adherence, and thus the treatment effect may possibly be underestimated. We analyzed morning BP data from three randomized controlled CPAP withdrawal trials, which included only patients with optimal CPAP compliance. Within the three trials, 149 patients with OSA who were receiving CPAP were randomized to continue therapeutic CPAP (n = 65) or to withdraw CPAP (n = 84) for 2 weeks. Morning BP was measured at home before and after sleep studies in the hospital. CPAP withdrawal was associated with a return of OSA (apnea-hypopnea index [AHI] at a baseline of 2.8/h and at follow-up of 33.2/h). Office systolic BP (SBP) increased in the CPAP withdrawal group compared with the CPAP continuation group by +5.4 mm Hg (95% CI, 1.8-8.9 mm Hg; P = .003) and in the home SBP group by +9.0 mm Hg (95% CI, 5.7-12.3 mm Hg; P CPAP withdrawal results in a clinically relevant increase in BP, which is considerably higher than in conventional CPAP trials; it is also underestimated when office BP is used. Greater OSA severity is associated with a higher BP rise in response to CPAP withdrawal. ClinicalTrials.gov; No.: NCT01332175 and NCT01797653) URL: www.clinicaltrials.gov and ISRCTN registry (ISRCTN 93153804) URL: http://www.isrctn.com/. Copyright © 2016 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others
2012-06-15
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity
Let-7b Regulates Myoblast Proliferation by Inhibiting IGF2BP3 Expression in Dwarf and Normal Chicken
Lin, Shumao; Luo, Wen; Ye, Yaqiong; Bekele, Endashaw J.; Nie, Qinghua; Li, Yugu; Zhang, Xiquan
2017-01-01
The sex-linked dwarf chicken is caused by the mutation of growth hormone receptor (GHR) gene and characterized by shorter shanks, lower body weight, smaller muscle fiber diameter and fewer muscle fiber number. However, the precise regulatory pathways that lead to the inhibition of skeletal muscle growth in dwarf chickens still remain unclear. Here we found a let-7b mediated pathway might play important role in the regulation of dwarf chicken skeletal muscle growth. Let-7b has higher expression in the skeletal muscle of dwarf chicken than in normal chicken, and the expression of insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), which is a translational activator of IGF2, showed opposite expression trend to let-7b. In vitro cellular assays validated that let-7b directly inhibits IGF2BP3 expression through binding to its 3′UTR region, and the protein level but not mRNA level of IGF2 would be reduced in let-7b overexpressed chicken myoblast. Let-7b can inhibit cell proliferation and induce cell cycle arrest in chicken myoblast through let-7b-IGF2BP3-IGF2 signaling pathway. Additionally, let-7b can also regulate skeletal muscle growth through let-7b-GHR-GHR downstream genes pathway, but this pathway is non-existent in dwarf chicken because of the deletion mutation of GHR 3′UTR. Notably, as the loss binding site of GHR for let-7b, let-7b has enhanced its binding and inhibition on IGF2BP3 in dwarf myoblast, suggesting that the miRNA can balance its inhibiting effect through dynamic regulate its binding to target genes. Collectively, these results not only indicate that let-7b can inhibit skeletal muscle growth through let-7b-IGF2BP3-IGF2 signaling pathway, but also show that let-7b regulates myoblast proliferation by inhibiting IGF2BP3 expression in dwarf and normal chickens. PMID:28736533
Radiosensitivity in breast cancer assessed by the histone γ-H2AX and 53BP1 foci
International Nuclear Information System (INIS)
Djuzenova, Cholpon S; Elsner, Ines; Katzer, Astrid; Worschech, Eike; Distel, Luitpold V; Flentje, Michael; Polat, Bülent
2013-01-01
High expression of constitutive histone γ-H2AX, a sensitive marker of DNA damage, might be indicative of defective DNA repair pathway or genomic instability. 53BP1 (p53-binding protein 1) is a conserved checkpoint protein with properties of a DNA double-strand breaks sensor. This study explores the relationship between the clinical radiosensitivity of tumor patients and the expression/induction of γ-H2AX and 53BP1 in vitro. Using immunostaining, we assessed spontaneous and radiation-induced foci of γ-H2AX and 53 BP1 in peripheral blood mononuclear cells derived from unselected breast cancer (BC) patients (n=57) undergoing radiotherapy (RT). Cells from apparently healthy donors (n=12) served as references. Non-irradiated cells from controls and unselected BC patients exhibited similar baseline levels of DNA damage assessed by γ-H2AX and 53BP1 foci. At the same time, the γ-H2AX assay of in vitro irradiated cells revealed significant differences between the control group and the group of unselected BC patients with respect to the initial (0.5 Gy, 30 min) and residual (2 Gy, 24 h post-radiation) DNA damage. The numbers of 53BP1 foci analyzed in 35 BC patients were significantly higher than in controls only in case of residual DNA damage. A weak correlation was found between residual foci of both proteins tested. In addition, cells from cancer patients with an adverse acute skin reaction (grade 3) to RT showed significantly increased radiation-induced γ-H2AX foci and their protracted disappearance compared to the group of BC patients with normal skin reaction (grade 0–1). The mean number of γ-H2AX foci after 5 clinical fractions was significantly higher than that before RT, especially in clinically radiosensitive patients. The γ-H2AX assay may have potential for screening individual radiosensitivity of breast cancer patients.
Bidet, Katell; Dadlani, Dhivya; Garcia-Blanco, Mariano A
2014-07-01
Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV). We examined three conserved host RNA-binding proteins (RBPs) G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2) infection and found them to be novel regulators of the interferon (IFN) response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs), and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA), which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
Effect of turmeric and curcumin on BP-DNA adducts.
Mukundan, M A; Chacko, M C; Annapurna, V V; Krishnaswamy, K
1993-03-01
Many human cancers that are widely prevalent today can be prevented through modifications in life-styles, of which diet appears to be an important agent. Several dietary constituents modulate the process of carcinogenesis and prevent genotoxicity. Many plant constituents including turmeric appear to be potent antimutagens and antioxidants. Therefore the modulatory effects of turmeric and curcumin on the levels of benzo[a]pyrene induced DNA adducts in the livers of rats were studied by the newly developed 32P-postlabelling assay method. Turmeric when fed at 0.1, 0.5 and 3% and the active principle of turmeric (curcumin) when fed at a level of 0.03% in the diet for 4 weeks significantly reduced the level of BP-DNA adducts including the major adduct dG-N2-BP, formed within 24 h in response to a single i.p. injection of benzo[a]pyrene. The significance of these effects in terms of the potential anticarcinogenic effects of turmeric is discussed. Further, these results strengthen the various other biological effects of turmeric which have direct relevance to anticarcinogenesis and chemoprevention.
Higher levels of albuminuria within the normal range predict incident hypertension.
Forman, John P; Fisher, Naomi D L; Schopick, Emily L; Curhan, Gary C
2008-10-01
Higher levels of albumin excretion within the normal range are associated with cardiovascular disease in high-risk individuals. Whether incremental increases in urinary albumin excretion, even within the normal range, are associated with the development of hypertension in low-risk individuals is unknown. This study included 1065 postmenopausal women from the first Nurses' Health Study and 1114 premenopausal women from the second Nurses' Health Study who had an albumin/creatinine ratio who did not have diabetes or hypertension. Among the older women, 271 incident cases of hypertension occurred during 4 yr of follow-up, and among the younger women, 296 incident cases of hypertension occurred during 8 yr of follow-up. Cox proportional hazards regression was used to examine prospectively the association between the albumin/creatinine ratio and incident hypertension after adjustment for age, body mass index, estimated GFR, baseline BP, physical activity, smoking, and family history of hypertension. Participants who had an albumin/creatinine ratio in the highest quartile (4.34 to 24.17 mg/g for older women and 3.68 to 23.84 mg/g for younger women) were more likely to develop hypertension than those who had an albumin/creatinine ratio in the lowest quartile (hazard ratio 1.76 [95% confidence interval 1.21 to 2.56] and hazard ratio 1.35 [95% confidence interval 0.97 to 1.91] for older and younger women, respectively). Higher albumin/creatinine ratios, even within the normal range, are independently associated with increased risk for development of hypertension among women without diabetes. The definition of normal albumin excretion should be reevaluated.
Mallamaci, Francesca; Tripepi, Rocco; Leonardis, Daniela; Mafrica, Angela; Versace, Maria Carmela; Provenzano, Fabio; Tripepi, Giovanni; Zoccali, Carmine
2016-10-01
The clinical relevance of ambulatory blood pressure monitoring (ABPM) for risk stratification in renal transplant patients still remains poorly defined. We investigated the association between clinic and ABPM with an established biomarker of atherosclerosis (intima-media thickness [IMT] by echo-color Doppler) in a large, inclusive survey (n = 172) in renal transplant patients at a single institution. Forty-two patients (24%) were classified as hypertensive by ABPM criteria and 29 (17%) by clinic blood pressure (BP) criteria. Average daytime and nighttime BP was 126 ± 12/78 ± 9 mm Hg and 123 ± 13/74 ± 10 mm Hg, respectively. Forty-five patients (26%) were classified as hypertensive by the daytime criterion (>135/85 mm Hg) and a much higher proportion (n = 119, 69%) by the nighttime criterion (>120/70 mm Hg). Sixty-two patients (36%) had a night-day ratio of 1 or greater, indicating clear-cut nondipping. The average nighttime systolic BP (r = 0.24, P = 0.001) and the night-day systolic BP ratio (r = 0.23, P = 0.002) were directly related to IMT, and these associations were much more robust than the 24-hour systolic BP-IMT relationship (r = 0.16, P = 0.04). Average daytime BP and clinic B were unrelated to IMT. In a multiple regression analysis adjusting for confounders, the night-day systolic BP ratio maintained an independent association with IMT (β = 0.14, P = 0.04). In renal transplant patients, the prevalence of nocturnal hypertension by far exceeds the prevalence of hypertension as assessed by clinic, daytime, and 24-hour ABPM. Nighttime systolic BP and the night-day ratio but no other BP metrics are independently associated with IMT. Blood pressure during nighttime may provide unique information for the assessment of cardiovascular risk attributable to BP burden in renal transplant patients.
Milak, Matthew S; Pantazatos, Spiro; Rashid, Rain; Zanderigo, Francesca; DeLorenzo, Christine; Hesselgrave, Natalie; Ogden, R Todd; Oquendo, Maria A; Mulhern, Stephanie T; Miller, Jeffrey M; Burke, Ainsley K; Parsey, Ramin V; Mann, J John
2018-04-13
Higher serotonin-1A (5-HT 1A ) receptor binding potential (BP F ) has been found in major depressive disorder (MDD) during and between major depressive episodes. We investigated whether higher 5-HT 1A binding is a biologic trait transmitted to healthy high risk (HR) offspring of MDD probands. Data were collected contemporaneously from: nine HR, 30 depressed not-recently medicated (NRM) MDD, 18 remitted NRM MDD, 51 healthy volunteer (HV) subjects. Subjects underwent positron emission tomography (PET) using [ 11 C]WAY100635 to quantify 5-HT 1A BP F , estimated using metabolite, free fraction-corrected arterial input function and cerebellar white matter as reference region. Multivoxel pattern analyses (MVPA) of PET data evaluated group status classification of individuals. When tested across 13 regions of interest, an effect of diagnosis is found on BP F which remains significant after correction for sex, age, injected mass and dose: HR have higher BP F than HV (84.3% higher in midbrain raphe, 40.8% higher in hippocampus, mean BP F across all 13 brain regions is 49.9% ± 11.8% higher). Voxel-level BP F maps distinguish HR vs. HV. Elevated 5-HT 1A BP F appears to be a familially transmitted trait abnormality. Future studies are needed to replicate this finding in a larger cohort and demonstrate the link to the familial transmission of mood disorders. Copyright © 2018 Elsevier B.V. All rights reserved.
Molecular pathways associated with blood pressure and hexadecanedioate levels.
Directory of Open Access Journals (Sweden)
Cristina Menni
Full Text Available The dicarboxylic acid hexadecanedioate is associated with increased blood pressure (BP and mortality in humans and feeding it to rats raises BP. Here we aim to characterise the molecular pathways that influence levels of hexadecanedioate linked to BP regulation, using genetic and transcriptomic studies. The top associations for hexadecanedioate in a genome-wide association scan (GWAS conducted on 6447 individuals from the TwinsUK and KORA cohorts were tested for association with BP and hypertension in the International Consortium for BP and in a GWAS of BP extremes. Transcriptomic analyses correlating hexadecanedioate with gene expression levels in adipose tissue in 740 TwinsUK participants were further performed. GWAS showed 242 SNPs mapping to two independent loci achieving genome-wide significance. In rs414056 in the SCLO1B1 gene (Beta(SE = -0.088(0.006P = 1.65 x 10-51, P < 1 x 10-51, the allele previously associated with increased risk of statin associated myopathy is associated with higher hexadecanedioate levels. However this SNP did not show association with BP or hypertension. The top SNP in the second locus rs6663731 mapped to the intronic region of CYP4Z2P on chromosome 1 (0.045(0.007, P = 5.49x10-11. Hexadecanedioate levels also correlate with adipose tissue gene-expression of the 3 out of 4 CYP4 probes (P<0.05 and of alcohol dehydrogenase probes (Beta(SE = 0.12(0.02; P = 6.04x10-11. High circulating levels of hexadecanedioate determine a significant effect of alcohol intake on BP (SBP: 1.12(0.34, P = 0.001; DBP: 0.70(0.22, P = 0.002, while no effect is seen in the lower hexadecanedioate level group. In conclusion, levels in fat of ADH1A, ADH1B and CYP4 encoding enzymes in the omega oxidation pathway, are correlated with hexadecanedioate levels. Hexadecanedioate appears to regulate the effect of alcohol on BP.
Association Between Serum Levels of Uric Acid and Blood Pressure Tracking in Childhood.
Park, Bohyun; Lee, Hye Ah; Lee, Sung Hee; Park, Bo Mi; Park, Eun Ae; Kim, Hae Soon; Cho, Su Jin; Park, Hyesook
2017-07-01
Recent studies suggest that high levels of serum uric acid of very early life are a result of the in-utero environment and may lead to elevated blood pressure (BP) in adulthood. However, serum uric acid levels can change throughout life. We investigated the effect of serum uric acid levels in childhood on the BP tracking and analysed BP according to changes in serum uric acid levels in early life. A total of 449 children from the Ewha Birth and Growth Cohort study underwent at least 2 follow-up examinations. Data were collected across 3 check-up cycles. Serum uric acid levels, BP, and anthropometric characteristics were assessed at 3, 5, and 7 years of age. Children with a serum uric acid level higher than the median values had significantly increased systolic BP (SBP) and diastolic BP at 3 years of age. Baseline serum uric acid levels measured at 3 years of age, significantly affected subsequent BP in the sex and body mass index adjusted longitudinal data analysis (P uric acid over time, subjects with high uric acid levels at both 3 and 5 years of age had the highest SBP at 7 years of age. These findings suggest the importance of maintaining an adequate level of serum uric acids from the early life. Appropriate monitoring and intervention of uric acid levels in a high-risk group can reduce the risk of a future increased BP. © American Journal of Hypertension, Ltd 2017. All rights reserved. For Permissions, please email: journals.permissions@oup.com
Directory of Open Access Journals (Sweden)
Nadal Anna
2012-09-01
Full Text Available Abstract Background The Biopeptide BP100 is a synthetic and strongly cationic α-helical undecapeptide with high, specific antibacterial activity against economically important plant-pathogenic bacteria, and very low toxicity. It was selected from a library of synthetic peptides, along with other peptides with activities against relevant bacterial and fungal species. Expression of the BP100 series of peptides in plants is of major interest to establish disease-resistant plants and facilitate molecular farming. Specific challenges were the small length, peptide degradation by plant proteases and toxicity to the host plant. Here we approached the expression of the BP100 peptide series in plants using BP100 as a proof-of-concept. Results Our design considered up to three tandemly arranged BP100 units and peptide accumulation in the endoplasmic reticulum (ER, analyzing five BP100 derivatives. The ER retention sequence did not reduce the antimicrobial activity of chemically synthesized BP100 derivatives, making this strategy possible. Transformation with sequences encoding BP100 derivatives (bp100der was over ten-fold less efficient than that of the hygromycin phosphotransferase (hptII transgene. The BP100 direct tandems did not show higher antimicrobial activity than BP100, and genetically modified (GM plants constitutively expressing them were not viable. In contrast, inverted repeats of BP100, whether or not elongated with a portion of a natural antimicrobial peptide (AMP, had higher antimicrobial activity, and fertile GM rice lines constitutively expressing bp100der were produced. These GM lines had increased resistance to the pathogens Dickeya chrysanthemi and Fusarium verticillioides, and tolerance to oxidative stress, with agronomic performance comparable to untransformed lines. Conclusions Constitutive expression of transgenes encoding short cationic α-helical synthetic peptides can have a strong negative impact on rice fitness. However, GM
BP - bisnis põhjas? / Erik Aru
Aru, Erik
2010-01-01
Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris
Belkacemi, Louiza; Gariépy, Gilles; Mounier, Catherine; Simoneau, Lucie; Lafond, Julie
2004-01-01
During pregnancy, the calcium (Ca(2+)) transport machinery of the placenta is solely responsible for the nutrient supply to the developing fetus, where active Ca(2+) transport occurs from the mother to the fetus. As part of a larger study to determine the role of Ca(2+) in placental transport in vivo, we questioned whether calbindin-D9k (CaBP9k), which is mainly expressed in duodenum, uterus, and placenta of several mammals, is present in cytotrophoblast cells and syncytiotrophoblasts of human term placenta. We were interested in this protein because of its potential importance in serving as an indicator of Ca(2+) availability and utilization in the placenta. Here, we demonstrated that CaBP9k transcript is present in both cell types, with a lower expression in cytotrophoblast cells as compared to syncytiotrophoblasts. Moreover, we showed by immunochemistry that CaBP9k protein was present in cytotrophoblast and syncytiotrophoblast placental tissue sections as well as in cultured cells. The occurrence of CaBP9k protein in trophoblast cells was further confirmed by Western blot analysis. Thus, these results indicate for the first time that CaBP9k is unequivocally expressed by trophoblast cells from human term placenta.
Directory of Open Access Journals (Sweden)
Katell Bidet
2014-07-01
Full Text Available Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV. We examined three conserved host RNA-binding proteins (RBPs G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2 infection and found them to be novel regulators of the interferon (IFN response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs, and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA, which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer
International Nuclear Information System (INIS)
Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy
2003-01-01
BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event
Multivalent display of the antimicrobial peptides BP100 and BP143
Directory of Open Access Journals (Sweden)
Imma Güell
2012-12-01
Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.
Nambi-Kasozi, Justine; Sabiiti, Elly Nyambobo; Bareeba, Felix Budara; Sporndly, Eva; Kabi, Fred
2016-04-01
The effect of feeding varying banana peeling (BP) levels on rumen environment and feed degradation characteristics was evaluated using three rumen fistulated steers in four treatments. The steers were fed BP at 0, 20, 40, and 60% levels of the daily ration with basal elephant grass (EG) to constitute four diets. Maize bran, cotton seed cake, and Gliricidia sepium were offered to make the diets iso-nitrogenous. The nylon bag technique was used to measure BP and EG dry matter (DM), crude protein (CP), and neutral detergent fiber (NDF) degradabilities at 0, 6, 12, 24, 48, 72, 96, and 120 h. Rumen fluid samples were collected to determine pH and volatile fatty acid (VFA) concentrations. Effective DM, CP, and NDF degradabilities of BP ranged between 574 and 807, 629-802, and 527-689 g/kg, respectively, being lower at higher BP levels. Elephant grass degradability behaved similarly with relatively high effective CP degradability (548-569 g/kg) but low effective DM and NDF degradability (381-403 and 336-373 g/kg, respectively). Rumen pH and VFA reduced with increasing BP in the diets. Rumen pH dropped to 5.8 and 5.9 at the 40 and 60% BP feeding levels, respectively. Banana peelings were better degraded than EG but higher BP levels negatively affected feed degradability and rumen environment.
Nevid, Jeffrey S.; Ambrose, Michael A.; Pyun, Yea Seul
2017-01-01
Our study examined whether brief writing-to-learn assignments linked to lower and higher levels in Bloom's taxonomy affected performance differentially on examination performance in assessing these skill levels. Using a quasi-random design, 91 undergraduate students in an introductory psychology class completed eight lower level and eight higher…
International Nuclear Information System (INIS)
Zgheib, Omar; Huyen, Yentram; DiTullio, Richard A.; Snyder, Andrew; Venere, Monica; Stavridi, Elena S.; Halazonetis, Thanos D.
2005-01-01
The ATM (mutated in Ataxia-Telangiectasia) protein kinase is an important player in signaling the presence of DNA double strand breaks (DSBs) in higher eukaryotes. Recent studies suggest that ATM monitors the presence of DNA DSBs indirectly, through DNA DSB-induced changes in chromatin structure. One of the proteins that sense these chromatin structure changes is 53BP1, a DNA damage checkpoint protein conserved in all eukaryotes and the putative ortholog of the S. cerevisiae RAD9 protein. We review here the mechanisms by which ATM is activated in response to DNA DSBs, as well as key ATM substrates that control cell cycle progression, apoptosis and DNA repair
Directory of Open Access Journals (Sweden)
Tao Qin
Full Text Available Dendritic cells (DCs play a vital role in the regulation of immune-mediated inflammatory diseases. Thus, DCs have been regarded as a major target for the development of immunomodulators. However, oxidative stress could disturb inflammatory regulation in DCs. Here, we examined the effect of bursopentine (BP5, a novel pentapeptide isolated from chicken bursa of fabricius, on the protection of DCs against oxidative stress for immunosuppression. BP5 showed potent protective effects against the lipopolysaccharide (LPS-induced oxidative stress in DCs, including nitric oxide, reactive oxygen species and lipid peroxidation. Furthermore, BP5 elevated the level of cellular reductive status through increasing the reduced glutathione (GSH and the GSH/GSSG ratio. Concomitant with these, the activities of several antioxidative redox enzymes, including glutathione peroxidase (GPx, catalase (CAT and superoxide dismutase (SOD, were obviously enhanced. BP5 also suppressed submucosal DC maturation in the LPS-stimulated intestinal epithelial cells (ECs/DCs coculture system. Finally, we found that heme oxygenase 1 (HO-1 was remarkably upregulated by BP5 in the LPS-induced DCs, and played an important role in the suppression of oxidative stress and DC maturation. These results suggested that BP5 could protect the LPS-activated DCs against oxidative stress and have potential applications in DC-related inflammatory responses.
International Nuclear Information System (INIS)
Boee, Reidulv; Lepland, Aivo; Blikra, Lars Harald; Longva, Oddvar; Soenstegaard, Eivind
2002-01-01
The Ormen Lange Gas Field was discovered in the Norwegian Sea outside the Moere og Romsdal in 1997. The development of this field which is located in the area of the Storegga Slide, requires safety assessment. The project aims to collect and compile data on slides, avalanches and gravitational faults that may have resulted from large earthquakes or tsunamis in the north west of Western Norway. A major task in the present project has been to investigate the spatial extent and interpret the origin of a postulated mass movement event ca. 2000 years ago and to evaluate its causes, climate variations, a tsunami (possibly caused by an earthquake affecting the offshore area), and earthquake only affecting parts of Western Norway or a combination of an earthquake and a tsunami. Several other mass movements, including the Storegga Slide tsunami deposits and pre-Storegga Slide slide and debris flow deposits have been studied both in the fjord and the lake sediments. Five of the 16 investigated fjords (Dalsfjorden, Foerdefjorden, Syvdsfjorden, Voldafjorden, Oerstadfjorden) provide evidence for a 2000 - 2200 years BP (calendar years before present, i.e. 1950) event. Previous investigations show no indication of a large shelf edge slide in the Storegga area, that may have created a tsunami at that time, nor are any mass movement deposits found on land or in the investigated lakes. This suggests that the 2000 - 2200 BP debris flows and turbidites were most likely related to one or more earthquakes on land or close to the coast and not an offshore mega slide generated tsunami. The Storegga Slide (8200 BP) tsunami deposits are observed in cores over most of the investigated area, both in the deep fjords and in lakes. Striking similarity between major slide and debris flow deposits at the 2000 - 2200 BP and ca. 11000 - 11700 BP stratigraphic levels suggest a common triggering mechanism, probably earthquakes with epicentres in the Sunnfjord Sunnmoere region. A period of debris flows
BP report of the business year 1979
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.
KARAKTER FISIOLOGIS KLON KOPI ROBUSTA BP 358 PADA JENIS PENAUNG YANG BERBEDA
Directory of Open Access Journals (Sweden)
Ummi Sholikhah
2015-09-01
Full Text Available Shade plants for coffee plantation generally use dadap, lamtoro andothers. Today there many change the use of shade plant from lamtoro to sengon because economic value and increasing demand for sengon wood. Due to thechanging in different type of shade plant cause affect on coffee plantationmicroclimate. On the coffee plantation also use some coffee clones. The differences type of shade and coffee clones can affect the differences physiological and morphological characters of coffee plant that affect the production.The aim of this research is expected to give information about physiological characters of robusta coffee clones in different shade plant, factors that affect the robusta coffee photosynthesis process, the relationship of photosynthesis with the production and robusta coffee clones that have high production. This research was conducted in coffee plantation at Sidomulyo village, the district of Silo, Jember regency located at a 560 meters above sea level. This research was done on May up to June 2011. The area determination method was chosen based on the consideration that Sidomulyo village is one of the popular coffee producer in Jember. The experiment used field experiment with the quadrant method use to observation and collect the data of 12 years old BP 358. The support parameter observed were light intensity, temperature, humidity and assessed fruit production. The data from the observation wereproduction branch than photosynthesis activity. The result showed coffee clones BP 358 with sengon shade had higher photosynthesis activity than lamtoro shade. The photosynthesis activity was more affected by the stomatal conductivity and the light intensity. Keyword: Physiological Characters, Coffee Clones BP 358, Types of Shade
Face recognition based on improved BP neural network
Directory of Open Access Journals (Sweden)
Yue Gaili
2017-01-01
Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.
Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G
2011-10-01
The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.
Mohammadi, Nabiallah; Adib, Minoo; Alsahebfosoul, Fereshteh; Kazemi, Mohammad; Etemadifar, Masoud
2016-01-15
Human Leukocyte Antigen G (HLA-G) gene polymorphism and expression rate have recently been suggested to have a potential role in susceptibility to Multiple Sclerosis (MS), a chronic inflammatory demyelinating and neurodegenerative disease of the central nervous system with unknown etiology. The aim of this study was to investigate the association of the frequency of HLA-G gene 14 bp insertion/deletion polymorphism and its plasma level with MS susceptibility. In this study, the HLA-G gene from 212 patients and 210 healthy individuals was amplified using real time PCR and screened for the 14 bp insertion/deletion polymorphism. In addition, HLA-G plasma levels of the patients were measured and compared to normal controls by ELISA method. Our results revealed that 14 bp insertion in HLA-G could result in lower plasma HLA-G level of the subjects, regardless of their health status and vice versa. Additionally, significant correlation of HLA-G genotype and its plasma level with MS susceptibility was observed. In conclusion, not only HLA-G 14 bp insertion/deletion polymorphism could be associated with expression rate of the HLA-G gene and its plasma level, but also could be considered as a risk factor for susceptibility to MS in our study population. Copyright © 2015 Elsevier B.V. All rights reserved.
Yang, Lei; Lindblad, Rebecka; Gabrielsson, Erik; Boschloo, Gerrit; Rensmo, Håkan; Sun, Licheng; Hagfeldt, Anders; Edvinsson, Tomas; Johansson, Erik M J
2018-04-11
4- tert-Butylpyridine ( t-BP) is commonly used in solid state dye-sensitized solar cells (ssDSSCs) to increase the photovoltaic performance. In this report, the mechanism how t-BP functions as a favorable additive is investigated comprehensively. ssDSSCs were prepared with different concentrations of t-BP, and a clear increase in efficiency was observed up to a maximum concentration and for higher concentrations the efficiency thereafter decreases. The energy level alignment in the complete devices was measured using hard X-ray photoelectron spectroscopy (HAXPES). The results show that the energy levels of titanium dioxide are shifted further away from the energy levels of spiro-OMeTAD as the t-BP concentration is increased. This explains the higher photovoltage obtained in the devices with higher t-BP concentration. In addition, the electron lifetime was measured for the devices and the electron lifetime was increased when adding t-BP, which can be explained by the recombination blocking effect at the surface of TiO 2 . The results from the HAXPES measurements agree with those obtained from density functional theory calculations and give an understanding of the mechanism for the improvement, which is an important step for the future development of solar cells including t-BP.
Studies of the viral binding proteins of shrimp BP53, a receptor of white spot syndrome virus.
Li, Chen; Gao, Xiao-Xiao; Huang, Jie; Liang, Yan
2016-02-01
The specific binding between viral attachment proteins (VAPs) of a virus and its cellular receptors on host cells mediates virus entry into host cells, which triggers subsequent viral infections. Previous studies indicate that F1 ATP synthase β subunit (named BP53), is found on the surface of shrimp cells and involved in white spot syndrome virus (WSSV) infection by functioning as a potential viral receptor. Herein, in a far-western blotting assay, three WSSV proteins with molecular weights of 28 kDa, 37 kDa, and >50 kDa were found to interact with BP53. The 28 kDa and 37 kDa proteins were identified as the envelope protein VP28 and VP37 of WSSV respectively, which could be recognized by the polyclonal antibodies. Enzyme-linked immunosorbent binding assays revealed that VP37 contributed to almost 80% of the binding capability for BP53 compared with the same amount of total WSSV protein. The relationship between BP53 and its complementary interacting protein, VP37, was visualized using a co-localization assay. Bound VP37 on the cell surface co-localized with BP53 and shared a similar subcellular location on the outer surface of shrimp cells. Pearson's correlation coefficients reached to 0.67 ± 0.05 and the Mander's overlap coefficients reached 0.70 ± 0.05, which indicated a strong relationship between the localization of BP53 and bound rVP37. This provides evidence for an interaction between BP53 and VP37 obtained at the molecular and cellular levels, supporting the hypothesis that BP53 serves as a receptor for WSSV by binding to VP37. The identification of the viral binding proteins of shrimp BP53 is helpful for better understanding the pathogenic mechanisms of WSSV to infect shrimp at the cellular level. Copyright © 2016 Elsevier Inc. All rights reserved.
Khalesi, S; Sharma, S; Irwin, C; Sun, J
2016-10-01
This study examined the association between dietary patterns, nutrition knowledge and lifestyle with blood pressure (BP) in a sample of Australian adults. Adults with normal and high BP were included in a cross-sectional study. Dietary intake data was collected using a Food Frequency Questionnaire. Nutrition knowledge and lifestyle surveys were included in the questionnaire. Dietary patterns were extracted using factor analysis followed by cluster analysis. Associations were analysed using logistic regression. Four hundred and seven participants were included. Three dietary patterns were identified: Western; Snack and alcohol; and Balanced. Participants with high BP had a higher intake of Western and a lower intake of Balanced dietary pattern. A significant and higher frequency of discretionary foods and oils consumption, as well as lower nutrition knowledge score and activity frequency, were observed in the high BP group. Regression analysis indicated that the intake of Western and Snack and alcohol dietary patterns increases the likelihood of having high BP by 2.40 (95% confidence interval (CI): 1.28-4.49) and 2.76 (95% CI: 1.52-5.00), respectively, when nutrition knowledge and lifestyle were controlled for as moderator variables. The likelihood of high BP was not associated with nutrition knowledge, but increased with physical inactivity. This study indicates that poor dietary patterns and inactivity are associated with increases in the likelihood of high BP, and the association is not influenced by nutrition knowledge. These findings indicate the importance of developing public health strategies with an emphasis on improving the dietary patterns of individuals to prevent and control high BP in Australian adults.
The HLA-G genotype is associated with IL-10 levels in activated PBMCs
DEFF Research Database (Denmark)
Rizzo, Roberta; Hviid, Thomas Vauvert F; Stignani, Marina
2005-01-01
) in lipopolysaccharide (LPS)-activated peripheral blood mononuclear lymphocytes (PBMCs) in relation to the HLA-G 14 bp genotype. No HLA-G5/sHLA-G1 could be detected in the non-activated control PBMC culture media, and there were no significant differences among the three HLA-G 14 bp genotypes regarding IL-10...... concentrations. In LPS-activated PBMC cultures, no significant differences among the three HLA-G 14 bp genotypes regarding HLA-G5/sHLA-G1 concentrations were observed. However, this was in contrast to the IL-10 levels (P=0.0004, Kruskal-Wallis test). The +14/+14 bp PBMC samples expressed higher levels of IL-10...... when compared to the -14/+14 bp genotype and the -14/-14 bp genotype. Interestingly, the IL-10 G/G polymorphism at position -1082 was more frequent in the +14/+14 bp genotype (P=0.024, chi2 test). These results support an autocrine loop between HLA-G5/sHLA-G1 and IL-10 expression in activated PBMCs...
Obayashi, Kenji; Saeki, Keigo; Kurumatani, Norio
2016-05-06
and objectives Although previous studies suggested that nighttime BP is elevated in diabetes mellitus, the association between prediabetes and nighttime BP remains unclear. In addition, the relationship between diabetic status, renal function, and nighttime BP has not been evaluated in large populations. In this cross-sectional study, we assessed diabetic status, renal function, and ambulatory BP parameters among 1081 community-dwelling elderly individuals (mean age, 71.8±7.0 years). Participants were classified into six categories based on diabetic status (normoglycemia, prediabetes, or diabetes mellitus) and renal function (normal function or CKD). BP was measured at 30-minute intervals for 48 hours using a validated ambulatory recorder. The mean nighttime systolic BP (SBP) was 115.7±16.1 mmHg. The multivariable analysis, adjusted for age, sex, smoking status, and daytime SBP, revealed that, compared with participants with normoglycemia but without CKD (n=378), mean nighttime SBP was significantly higher in participants with both prediabetes and CKD (n=93) by 2.9 mmHg (95% confidence interval [95% CI], 0.2 to 5.6; P=0.03) and in patients with both diabetes mellitus and CKD (n=30) by 7.8 mmHg (95% CI, 3.5 to 12.2; Pprediabetes without CKD (n=374), or patients with diabetes mellitus without CKD (n=131). Notably, the multivariable analysis indicated that the interaction terms of diabetic status and renal function were significantly associated with nighttime SBP (P=0.03). Nighttime SBP was significantly higher in participants with prediabetes and CKD but not in participants with prediabetes without CKD, compared with participants with normoglycemia and without CKD. In addition, a significant interaction effect of diabetic status and renal function on nighttime SBP was detected in a general elderly population. Copyright © 2016 by the American Society of Nephrology.
Around and beyond 53BP1 Nuclear Bodies.
Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys
2017-12-05
Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
Around and beyond 53BP1 Nuclear Bodies
Directory of Open Access Journals (Sweden)
Anne Fernandez-Vidal
2017-12-01
Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
International Nuclear Information System (INIS)
Chu Liping; Liu Qiang; Wang Qin; Li Jin; Yue Jingyin; Mu Chuanjie; Fan Feiyue
2008-01-01
Objective: To explore the feasibility of determining radiosensitivity of human tumor cell lines in vitro using the assay of mtDNA 4977 bp deletion and comet assay. Methods: Three human tumor cell lines were selected in this study, HepG 2 , EC-9706 and MCF-7. The surviving fraction(SF), the ratio of mtDNA 4977 bp deletion and DNA damage were detected by MTY assay, nested PCR technique and comet assay, respectively. Results: The results of MTT assay showed that the radiosensitivity of HepG 2 and EC-9706 was higher than that of MCF-7. The ratio of mtDNA 4977 bp deletion of HepG 2 and EC-9706 was higher significantly than that of MCF-7 (P 2 and EC-9706 was higher than that of MCF-7. The difference of radiosensitivity among these three tumor cell lines was significant after 8 Gy γ-ray irradiation. Conclusions: Combination of many biological parameter is helpful to evaluate the radiosensitivity of tumor cells more accurately. (authors)
Luo, Dahu; Lou, Weihua
2017-07-01
Objective To study the expressions of RNA-binding Ras-GAP SH3 binding protein (G3BP) and tumor stem cell marker CD44v6 in laryngeal squamous cell carcinoma and their correlations with angiogenesis. Methods We collected the cancer tissues and corresponding paracancerous tissues from 56 patients with laryngeal squamous cell carcinoma. The expressions of G3BP and CD44v6 proteins were detected by Western blotting in cancer tissues and corresponding paracancerous tissues; the expressions of G3BP, CD44v6 and vascular endothelial growth factor A (VEGF-A) were tested by immunohistochemistry. Thereafter, we compared the positive expression rates of G3BP and CD44v6 between in cancer tissues and in normal tissues, analyzed the correlations between the expressions of G3BP, CD44v6 and the laryngeal squamous cell carcinoma features as well as their correlations with microvessel density (MVD) that was determined by FVIIIAg immunohistochemistry. Results Western blotting showed that the expressions of G3BP and CD44v6 proteins in the laryngeal squamous cell carcinoma were higher than those in the paracancerous tissues. Immunohistochemistry showed that compared with the paracancerous tissues, G3BP, CD44v6 and VEGF-A expressions (the positive rates are 58.9%, 53.6%, 46.4%, respectively) were higher in cancer tissues. The positive rates of G3BP and CD44v6 in cancer tissues were related with the clinical stage, recurrence or metastasis, and lymph node metastasis of laryngeal squamous cell carcinoma, but had nothing to do with patients' age and tumor size. Pearson correlation analysis showed the expressions of both G3BP and CD44v6 were positively correlated with VEGF-A (r=0.741, r=0.756). MVD values were significantly higher in the G3BP and CD44v6 positive cases than in paracancerous tissues, but there was no difference in MVD between those without G3BP and CD44v6 positive expressions and the paracancerous tissues. Conclusion The positive expression rates of G3BP and CD44v6 in laryngeal
Thomsen, Dana; Lee, Chow H.
2014-01-01
Studies on Coding Region Determinant-Binding Protein (CRD-BP) and its orthologs have confirmed their functional role in mRNA stability and localization. CRD-BP is present in extremely low levels in normal adult tissues, but it is over-expressed in many types of aggressive human cancers and in neonatal tissues. Although the exact role of CRD-BP in tumour progression is unclear, cumulative evidence suggests that its ability to physically associate with target mRNAs is an important criterion for its oncogenic role. CRD-BP has high affinity for the 3′UTR of the oncogenic CD44 mRNA and depletion of CRD-BP in cells led to destabilization of CD44 mRNA, decreased CD44 expression, reduced adhesion and disruption of invadopodia formation. Here, we further characterize the CRD-BP-CD44 RNA interaction and assess specific antisense oligonucleotides and small molecule antibiotics for their ability to inhibit the CRD-BP-CD44 RNA interaction. CRD-BP has a high affinity for binding to CD44 RNA nts 2862–3055 with a Kd of 645 nM. Out of ten antisense oligonucleotides spanning nts 2862–3055, only three antisense oligonucleotides (DD4, DD7 and DD10) were effective in competing with CRD-BP for binding to 32P-labeled CD44 RNA. The potency of DD4, DD7 and DD10 in inhibiting the CRD-BP-CD44 RNA interaction in vitro correlated with their ability to specifically reduce the steady-state level of CD44 mRNA in cells. The aminoglycoside antibiotics neomycin, paramomycin, kanamycin and streptomycin effectively inhibited the CRD-BP-CD44 RNA interaction in vitro. Assessing the potential inhibitory effect of aminoglycoside antibiotics including neomycin on the CRD-BP-CD44 mRNA interaction in cells proved difficult, likely due to their propensity to non-specifically bind nucleic acids. Our results have important implications for future studies in finding small molecules and nucleic acid-based inhibitors that interfere with protein-RNA interactions. PMID:24622399
Ihara, Makoto; Okajima, Toshihide; Yamashita, Atsuko; Oda, Takuma; Hirata, Koichi; Nishiwaki, Hisashi; Morimoto, Takako; Akamatsu, Miki; Ashikawa, Yuji; Kuroda, Shun'ichi; Mega, Ryosuke; Kuramitsu, Seiki; Sattelle, David B; Matsuda, Kazuhiko
2008-06-01
Neonicotinoid insecticides, which act on nicotinic acetylcholine receptors (nAChRs) in a variety of ways, have extremely low mammalian toxicity, yet the molecular basis of such actions is poorly understood. To elucidate the molecular basis for nAChR-neonicotinoid interactions, a surrogate protein, acetylcholine binding protein from Lymnaea stagnalis (Ls-AChBP) was crystallized in complex with neonicotinoid insecticides imidacloprid (IMI) or clothianidin (CTD). The crystal structures suggested that the guanidine moiety of IMI and CTD stacks with Tyr185, while the nitro group of IMI but not of CTD makes a hydrogen bond with Gln55. IMI showed higher binding affinity for Ls-AChBP than that of CTD, consistent with weaker CH-pi interactions in the Ls-AChBP-CTD complex than in the Ls-AChBP-IMI complex and the lack of the nitro group-Gln55 hydrogen bond in CTD. Yet, the NH at position 1 of CTD makes a hydrogen bond with the backbone carbonyl of Trp143, offering an explanation for the diverse actions of neonicotinoids on nAChRs.
Remedial investigation for the 200-BP-1 operable unit, Hanford Site, Richland, Washington
International Nuclear Information System (INIS)
Buckmaster, M.A.
1991-01-01
The Hanford Site, Richland, Washington, contains over 1500 identified waste sites that will be characterized and remediated over the next 30 years. In support of the ''Hanford Federal Facility Agreement and Consent Order,'' the US Department of Energy has initiated a remedial investigation/feasibility study (RI/FS) at the 200-BP-1 operable unit. The 200-BP-1 RI is the first Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) investigation on the Hanford Site that involves drilling into highly radioactive and chemically contaminated soils. The initial phase of the site characterization is oriented toward determining the nature and extent of any contamination present in the vicinity of the 200-BP-1 operable unit. The major focus of the Phase I RI is the drilling and sampling of 10 inactive waste disposal units which received low level radioactive liquid waste
Le Bacquer, Olivier; Petroulakis, Emmanuel; Paglialunga, Sabina; Poulin, Francis; Richard, Denis; Cianflone, Katherine; Sonenberg, Nahum
2007-02-01
The most common pathology associated with obesity is insulin resistance, which results in the onset of type 2 diabetes mellitus. Several studies have implicated the mammalian target of rapamycin (mTOR) signaling pathway in obesity. Eukaryotic translation initiation factor 4E-binding (eIF4E-binding) proteins (4E-BPs), which repress translation by binding to eIF4E, are downstream effectors of mTOR. We report that the combined disruption of 4E-BP1 and 4E-BP2 in mice increased their sensitivity to diet-induced obesity. Increased adiposity was explained at least in part by accelerated adipogenesis driven by increased expression of CCAAT/enhancer-binding protein delta (C/EBPdelta), C/EBPalpha, and PPARgamma coupled with reduced energy expenditure, reduced lipolysis, and greater fatty acid reesterification in the adipose tissue of 4E-BP1 and 4E-BP2 double KO mice. Increased insulin resistance in 4E-BP1 and 4E-BP2 double KO mice was associated with increased ribosomal protein S6 kinase (S6K) activity and impairment of Akt signaling in muscle, liver, and adipose tissue. These data clearly demonstrate the role of 4E-BPs as a metabolic brake in the development of obesity and reinforce the idea that deregulated mTOR signaling is associated with the development of the metabolic syndrome.
Air Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Waste Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Air Monitoring Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Sediment Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
BP Canada Energy Company energy efficiency and GHG reduction opportunities
Energy Technology Data Exchange (ETDEWEB)
Forsyth, B. [BP Canada Energy Company, Calgary, AB (Canada)
2004-07-01
This paper presented an outline of the BP Canada Energy Company's energy efficiency program, which uses an innovative approach that relies on front line operations staff to generate, evaluate and implement ideas for energy reduction projects. An outline of the organization team was presented, with details of the small central Calgary group responsible for coordination, technical support and tracking of data. Key objectives of the team were identified as: the promotion of energy efficiency; sharing of best practices; and coordination of efforts at operations at both the development and corporate level. An outline of BP upstream operations and emissions reduction strategies was provided along with a timeline of BP Canada greenhouse gas (GHG) emissions and sustainable reductions projects. A chart representing energy savings through conversion to natural gas was also presented, sorted by project type. Results included over 400 GHG or energy reduction projects completed, with an average pay out of 30 months as well as 300,000 tonnes equivalent of GHGs reduced at an estimated value of of $13,000,000. Areas of focus for future projects include: compression; fired equipment; flaring; venting; and fugitive emissions. Strategies to reduce emissions in all areas of future research were also provided. tabs, figs.
Rasputin, more promiscuous than ever: a review of G3BP.
Irvine, Katharine; Stirling, Renee; Hume, David; Kennedy, Derek
2004-12-01
In this review, we highlight what G3BP's domain structure initially suggested; that G3BPs are "scaffolding" proteins linking signal transduction to RNA metabolism. Whilst it is most attractive to hypothesise about G3BP's role in signalling to mRNA metabolism, it is not known whether all G3BP functions impinge on their RNA-binding activities, so any theories are naturally subject to this qualification. It is hypothesised that, in coordination with an array of other proteins, G3BP, in a phosphorylation-dependent manner, is involved in the post-transcriptional regulation of a subset of mRNAs, at least some of which are in common with those regulated by Hu proteins. These transcripts, partially controlled at the post-transcriptional level by G3BPs, code for proteins important in transcription (e.g. c-Myc) and cytoskeletal arrangement (e.g. Tau), amongst other as yet undetermined pathways. The subtle differences between G3BP family members could dictate binding to a variety of signalling proteins, so each of the G3BPs may participate in different, though possibly related mRNPs, which are assembled in response to different stimuli. The combinatorial nature of the mRNP complex offers a powerful means of regulating gene expression, beyond that provided by a simple mRNA sequence. The ways in which mRNP flexibility and specificity may be harnessed to coordinate gene expression of functionally or structurally related mRNAs are not yet fully appreciated. Characterising mRNP composition and the function/s of mRNP components, such as the G3BPs, will aid in the understanding of how post-transcriptional mechanisms contribute to the global regulation of gene expression.
Shukla, Mahendra; Ibrahim, Moustafa M A; Jain, Moon; Jaiswal, Swati; Sharma, Abhisheak; Hanif, Kashif; Lal, Jawahar
2017-11-15
Though numerous reports have demonstrated multiple mechanisms by which furosemide can exert its anti-hypertensive response. However, lack of studies describing PK-PD relationship for furosemide featuring its anti-hypertensive property has limited its usage as a blood pressure (BP) lowering agent. Serum concentrations and mean arterial BP were monitored following 40 and 80mgkg -1 multiple oral dose of furosemide in spontaneously hypertensive rats (SHR) and DOCA-salt induced hypertensive (DOCA-salt) rats. A simultaneous population PK-PD relationship using E max model with effect compartment was developed to compare the anti-hypertensive efficacy of furosemide in these rat models. A two-compartment PK model with Weibull-type absorption and first-order elimination best described the serum concentration-time profile of furosemide. In the present study, post dose serum concentrations of furosemide were found to be lower than the EC 50 . The EC 50 predicted in DOCA-salt rats was found to be lower (4.5-fold), whereas the tolerance development was higher than that in SHR model. The PK-PD parameter estimates, particularly lower values of EC 50 , K e and Q in DOCA-salt rats as compared to SHR, pinpointed the higher BP lowering efficacy of furosemide in volume overload induced hypertensive conditions. Insignificantly altered serum creatinine and electrolyte levels indicated a favorable side effect profile of furosemide. In conclusion, the final PK-PD model described the data well and provides detailed insights into the use of furosemide as an anti-hypertensive agent. Copyright © 2017. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
James A. Harley
2011-01-01
With correction for mood state, total harm avoidance (HA was higher than unaffected in both MDD and BP groups, but the mood disorder groups did not differ from each other. However, BP1 individuals had higher self-transcendence (ST than those with MDD and unaffected relatives. HA may reflect a trait marker of mood disorders whereas high ST may be specific to BP. As ST is heritable, genes that affect ST may be of relevance for vulnerability to BP.
76 FR 69712 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...
2011-01-01
Background Qualitative and quantitative changes in human mitochondrial DNA (mtDNA) have been implicated in various cancer types. A 4,977 bp deletion in the major arch of the mitochondrial genome is one of the most common mutations associated with a variety of human diseases and aging. Methods We conducted a comprehensive study on clinical features and mtDNA of 104 colorectal cancer patients in the Wenzhou area of China. In particular, using a quantitative real time PCR method, we analyzed the 4,977 bp deletion and mtDNA content in tumor tissues and paired non-tumor areas from these patients. Results We found that the 4,977 bp deletion was more likely to be present in patients of younger age (≤65 years, p = 0.027). In patients with the 4,977 bp deletion, the deletion level decreased as the cancer stage advanced (p = 0.031). Moreover, mtDNA copy number in tumor tissues of patients with this deletion increased, both compared with that in adjacent non-tumor tissues and with in tumors of patients without the deletion. Such mtDNA content increase correlated with the levels of the 4,977 bp deletion and with cancer stage (p deletion may play a role in the early stage of colorectal cancer, and it is also implicated in alteration of mtDNA content in cancer cells. PMID:21232124
BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer
Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.
2010-01-01
Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225
Energy Technology Data Exchange (ETDEWEB)
Tong, Yuxin; Li, Yan [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China); Gu, Hui [Department of Key Laboratory of Health Ministry for Congenital Malformation Shengjing Hospital, China Medical University, Shenyang, Liaoning 110004 (China); Wang, Chunyu [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China); Liu, Funan [Department of Surgical Oncology, The First Hospital of China Medical University, Shenyang, Liaoning 110001 (China); Shao, Yangguang; Li, Jiabin; Cao, Liu [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China); Li, Feng, E-mail: fli@mail.cmu.edu.cn [Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, and Key Laboratory of Medical Cell Biology, Ministry of Education, China Medical University, Shenyang, Liaoning 110122 (China)
2015-11-27
ArgBP2 is an adapter protein that plays an important role in actin-dependent processes such as cell adhesion and migration. However, its function and regulation mechanisms in gastric cancer have not yet been investigated. Here, we showed the low expression of ArgBP2 mRNA level in gastric tumor samples and its repressive function in the proliferation, migration, and invasion of gastric cancer cells. Then, we cloned and identified ArgBP2 promoter and verified that MORC2 bound to the promoter. Moreover, we demonstrated that MORC2 enhanced the recruitment of EZH2, which promoted the tri-methylation of H3K27, leading to the transcriptional repression of ArgBP2. Our results might thus contribute to understanding the molecular mechanisms of ArgBP2 regulation and suggesting ArgBP2 as a potential therapeutic target for gastric cancer. - Highlights: • ArgBP2 inhibits proliferation, migration, and invasion of gastric cancer cells. • Identification of ArgBP2 promoter and its transcription factor MORC2. • EZH2 is required in MORC2 down-regulating ArgBP2 via histone methylation.
International Nuclear Information System (INIS)
Tong, Yuxin; Li, Yan; Gu, Hui; Wang, Chunyu; Liu, Funan; Shao, Yangguang; Li, Jiabin; Cao, Liu; Li, Feng
2015-01-01
ArgBP2 is an adapter protein that plays an important role in actin-dependent processes such as cell adhesion and migration. However, its function and regulation mechanisms in gastric cancer have not yet been investigated. Here, we showed the low expression of ArgBP2 mRNA level in gastric tumor samples and its repressive function in the proliferation, migration, and invasion of gastric cancer cells. Then, we cloned and identified ArgBP2 promoter and verified that MORC2 bound to the promoter. Moreover, we demonstrated that MORC2 enhanced the recruitment of EZH2, which promoted the tri-methylation of H3K27, leading to the transcriptional repression of ArgBP2. Our results might thus contribute to understanding the molecular mechanisms of ArgBP2 regulation and suggesting ArgBP2 as a potential therapeutic target for gastric cancer. - Highlights: • ArgBP2 inhibits proliferation, migration, and invasion of gastric cancer cells. • Identification of ArgBP2 promoter and its transcription factor MORC2. • EZH2 is required in MORC2 down-regulating ArgBP2 via histone methylation.
BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer
Directory of Open Access Journals (Sweden)
Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu
2010-01-01
Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.
BP/Mobil. Joint-venture directions for use
International Nuclear Information System (INIS)
Anon.
1997-01-01
This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)
BP-Broker use-cases in the UncertWeb framework
Roncella, Roberto; Bigagli, Lorenzo; Schulz, Michael; Stasch, Christoph; Proß, Benjamin; Jones, Richard; Santoro, Mattia
2013-04-01
The UncertWeb framework is a distributed, Web-based Information and Communication Technology (ICT) system to support scientific data modeling in presence of uncertainty. We designed and prototyped a core component of the UncertWeb framework: the Business Process Broker. The BP-Broker implements several functionalities, such as: discovery of available processes/BPs, preprocessing of a BP into its executable form (EBP), publication of EBPs and their execution through a workflow-engine. According to the Composition-as-a-Service (CaaS) approach, the BP-Broker supports discovery and chaining of modeling resources (and processing resources in general), providing the necessary interoperability services for creating, validating, editing, storing, publishing, and executing scientific workflows. The UncertWeb project targeted several scenarios, which were used to evaluate and test the BP-Broker. The scenarios cover the following environmental application domains: biodiversity and habitat change, land use and policy modeling, local air quality forecasting, and individual activity in the environment. This work reports on the study of a number of use-cases, by means of the BP-Broker, namely: - eHabitat use-case: implements a Monte Carlo simulation performed on a deterministic ecological model; an extended use-case supports inter-comparison of model outputs; - FERA use-case: is composed of a set of models for predicting land-use and crop yield response to climatic and economic change; - NILU use-case: is composed of a Probabilistic Air Quality Forecasting model for predicting concentrations of air pollutants; - Albatross use-case: includes two model services for simulating activity-travel patterns of individuals in time and space; - Overlay use-case: integrates the NILU scenario with the Albatross scenario to calculate the exposure to air pollutants of individuals. Our aim was to prove the feasibility of describing composite modeling processes with a high-level, abstract
Directory of Open Access Journals (Sweden)
Shih-Yin Tsai
2016-08-01
Full Text Available Obesity is a major risk factor driving the global type II diabetes pandemic. However, the molecular factors linking obesity to disease remain to be elucidated. Gender differences are apparent in humans and are also observed in murine models. Here, we link these differences to expression of eukaryotic translation initiation factor 4E binding protein 1 (4E-BP1, which, upon HFD feeding, becomes significantly reduced in the skeletal muscle and adipose tissue of male but not female mice. Strikingly, restoring 4E-BP1 expression in male mice protects them against HFD-induced obesity and insulin resistance. Male 4E-BP1 transgenic mice also exhibit reduced white adipose tissue accumulation accompanied by decreased circulating levels of leptin and triglycerides. Importantly, transgenic 4E-BP1 male mice are also protected from aging-induced obesity and metabolic decline on a normal diet. These results demonstrate that 4E-BP1 is a gender-specific suppressor of obesity that regulates insulin sensitivity and energy metabolism.
Blood pressure levels and body mass index in Brazilian adults with Down syndrome
Directory of Open Access Journals (Sweden)
Felipe Pucci
Full Text Available ABSTRACT CONTEXT AND OBJECTIVE: Increased life expectancy among people with Down syndrome (DS has introduced new environmental factors that may affect blood pressure (BP and/or lead to obesity in this population. The aim here was to investigate BP levels and body mass index (BMI in adults with DS, correlating these data with the patients' sex and age. DESIGN AND SETTING: Analytical cross-sectional observational study conducted in special schools in Curitiba (PR, Brazil. METHODS: 97 adult patients were included. BP was measured in accordance with the established guidelines. BMI was calculated by dividing the weight by the height squared (kg/m2. RESULTS: Sex had no influence on BMI; nor did systolic BP (SBP or diastolic BP (DBP. The age range was from 18 to 56 years. No correlation was observed between increasing age and greater BMI or BP. Eighty-six individuals (88.7% presented normal BP, eleven (11.3% prehypertension and none hypertension. Twenty patients (20.4% presented BP lower than 90 × 60 mmHg. BMI ranged from 18 to 48 kg/m2 (mean of 28.8 ± 3.92 kg/m2: 21.9% had normal weight; 40.7% were overweight; and 25.3% had obesity class I, 9.9% class II and 2.2% class III. Higher BMI was associated with significantly greater SBP and DBP (P = 0.0175 and P = 0.0015. CONCLUSION: Sex and age did not influence SBP, DBP or BMI in Brazilian adults with DS. Higher BMI was associated with greater BP (both systolic and diastolic.
Feasibility study report for the 200-BP-1 operable unit
Energy Technology Data Exchange (ETDEWEB)
1993-06-01
This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.
Feasibility study report for the 200-BP-1 operable unit
International Nuclear Information System (INIS)
1993-06-01
This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5
Feasibility study report for the 200-BP-1 operable unit
International Nuclear Information System (INIS)
1994-01-01
This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5
AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity
Energy Technology Data Exchange (ETDEWEB)
Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)
2013-02-01
Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.
Surface Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Yan, Qun; Sun, Dongmei; Li, Xu; Chen, Guoliang; Zheng, Qinghu; Li, Lun; Gu, Chenhong; Feng, Bo
2016-07-13
There is a scarcity of epidemiological researches examining the relationship between blood pressure (BP) and glucose level among older adults. The objective of the current study was to investigate the association of high BP and glucose level in elderly Chinese. A cross-sectional study of a population of 2092 Chinese individuals aged over 65 years was conducted. Multiple logistic analysis was used to explore the association between hypertension and hyperglycemia. Independent risk factors for systolic and diastolic BP were analyzed using stepwise linear regression. Subjects in impaired fasting glucose group (IFG) (n = 144) and diabetes (n = 346), as compared with normal fasting glucose (NFG) (n = 1277), had a significant higher risk for hypertension, with odds ratios (ORs) of 1.81 (95 % CI, 1.39-2.35) (P = 0.000) and 1.40 (95 % CI, 1.09-1.80) (P = 0.009), respectively. Higher fasting plasma glucose (FPG) levels in the normal range were still significantly associated with a higher prevalence of hypertension in both genders, with ORs of 1.24 (95 % CI, 0.85-1.80), R (2) = 0.114, P = 0.023 in men and 1.61 (95 % CI, 1.12-2.30), R (2) = 0.082, P = 0.010 in women, respectively, when compared with lower FPG. Linear regression analysis revealed FPG was an independent factor of systolic and diastolic BP. Our findings suggest that hyperglycemia as well as higher FPG within the normal range is associated with a higher prevalence of hypertension independent of other cardiovascular risk factors in elderly Chinese. Further studies are needed to explore the relationship between hyperglycemia and hypertension in a longitudinal setting.
Energy Technology Data Exchange (ETDEWEB)
Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)
2006-07-01
This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.
InterProScan Result: BP184018 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP184018 BP184018_2_ORF2 4FEA411FDBEADEDD PANTHER PTHR21347 CLEFT LIP AND PALATE ASSOCIATED TRANSME...MBRANE PROTEIN-RELATED 6.1e-73 T IPR008429 Cleft lip and palate transmembrane 1 ...
Kim, Dong-Hyun; Kwon, Sanghoon; Byun, Sangwon; Xiao, Zhen; Park, Sean; Wu, Shwu-Yuan; Chiang, Cheng-Ming; Kemper, Byron; Kemper, Jongsook Kim
2016-01-01
Bile acids (BAs) are recently recognized signalling molecules that profoundly affect metabolism. Because of detergent-like toxicity, BA levels must be tightly regulated. An orphan nuclear receptor, Small Heterodimer Partner (SHP), plays a key role in this regulation, but how SHP senses the BA signal for feedback transcriptional responses is not clearly understood. We show an unexpected function of a nucleoporin, RanBP2, in maintaining BA homoeostasis through SUMOylation of SHP. Upon BA signalling, RanBP2 co-localizes with SHP at the nuclear envelope region and mediates SUMO2 modification at K68, which facilitates nuclear transport of SHP and its interaction with repressive histone modifiers to inhibit BA synthetic genes. Mice expressing a SUMO-defective K68R SHP mutant have increased liver BA levels, and upon BA- or drug-induced biliary insults, these mice exhibit exacerbated cholestatic pathologies. These results demonstrate a function of RanBP2-mediated SUMOylation of SHP in maintaining BA homoeostasis and protecting from the BA hepatotoxicity. PMID:27412403
4977-bp mitochondrial DNA deletion in infertile patients with varicocele.
Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T
2014-04-01
Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
76 FR 69713 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...
Study on polychlorobiphenyl serum levels in French consumers of freshwater fish
International Nuclear Information System (INIS)
Desvignes, Virginie; Volatier, Jean-Luc; Bels, Frédéric de; Zeghnoun, Abdelkrim; Favrot, Marie-Christine; Marchand, Philippe; Le Bizec, Bruno; Rivière, Gilles; Leblanc, Jean-Charles; Merlo, Mathilde
2015-01-01
Introduction: Polychlorobiphenyls (PCBs) are persistent pollutants that are widespread in the environment and in foodstuffs, particularly in freshwater fish, which frequently exceed the maximum levels set by European regulations. Objectives: First, we describe the consumption of freshwater fish and serum PCB levels in French anglers, a population expected to have the highest level of dietary PCB exposure. Second, we investigated whether there is a statistical relationship between serum PCB levels and the angler consumption of freshwater fish with high PCB bioaccumulation potential (PCB-BP + freshwater fish) in order to make recommendations with regard to safe consumption of freshwater fish. Methods: We conducted a survey of anglers from six sites with contrasting PCB contamination levels. The survey included a food consumption frequency questionnaire and blood samples were taken to assess serum PCB levels. We used a regression model to determine the main factors contributing to serum PCB levels. Results: Consumption of PCB-BP + freshwater fish was relatively infrequent. Serum PCB levels of the study population and of women of childbearing age were in the same range as those observed in the French population and in neighbouring European countries, but higher than in the North American population. The two factors with the highest positive association with serum PCB levels were age (R 2 = 61%) and the consumption of PCB-BP + freshwater fish (R 2 = 2%). Using the regression model, we calculated, for several scenarios depending on the age and gender of the population, the maximum annual frequencies for PCB-BP + freshwater fish consumption that do not exceed the critical body burden threshold. Conclusion: Following the results of this study, the French agency for food, environmental and occupational health and safety (ANSES) issued an opinion and recommended some specific maximum freshwater fish consumption frequencies to protect the French general population
Study on polychlorobiphenyl serum levels in French consumers of freshwater fish
Energy Technology Data Exchange (ETDEWEB)
Desvignes, Virginie, E-mail: virginie.desvignes@anses.fr [Risk Assessment Department, French Agency for Food, Environmental and Occupational Health and Safety (ANSES), 27–31, avenue du Général Leclerc, Maisons-Alfort, F-94701 (France); Volatier, Jean-Luc [Risk Assessment Department, French Agency for Food, Environmental and Occupational Health and Safety (ANSES), 27–31, avenue du Général Leclerc, Maisons-Alfort, F-94701 (France); Bels, Frédéric de [Division for Public Health and Care, French National Cancer Institute (INCa), 52, avenue André Morizet, Boulogne Billancourt Cedex, F-92513 (France); Zeghnoun, Abdelkrim [Department of Environmental Health, French Institute for Public Health Surveillance (InVS), 12, rue du Val d' Osne, Saint-Maurice, F-94415 (France); Favrot, Marie-Christine [Ministry of Health, 14, avenue Duquesne, Paris, F-75350 (France); Marchand, Philippe; Le Bizec, Bruno [LUNAM Université, Oniris, Laboratoire d' Etude des Résidus et Contaminants dans les Aliments (LABERCA), USC INRA 1329, Nantes, F-44307 (France); Rivière, Gilles; Leblanc, Jean-Charles; Merlo, Mathilde [Risk Assessment Department, French Agency for Food, Environmental and Occupational Health and Safety (ANSES), 27–31, avenue du Général Leclerc, Maisons-Alfort, F-94701 (France)
2015-02-01
Introduction: Polychlorobiphenyls (PCBs) are persistent pollutants that are widespread in the environment and in foodstuffs, particularly in freshwater fish, which frequently exceed the maximum levels set by European regulations. Objectives: First, we describe the consumption of freshwater fish and serum PCB levels in French anglers, a population expected to have the highest level of dietary PCB exposure. Second, we investigated whether there is a statistical relationship between serum PCB levels and the angler consumption of freshwater fish with high PCB bioaccumulation potential (PCB-BP{sup +} freshwater fish) in order to make recommendations with regard to safe consumption of freshwater fish. Methods: We conducted a survey of anglers from six sites with contrasting PCB contamination levels. The survey included a food consumption frequency questionnaire and blood samples were taken to assess serum PCB levels. We used a regression model to determine the main factors contributing to serum PCB levels. Results: Consumption of PCB-BP{sup +} freshwater fish was relatively infrequent. Serum PCB levels of the study population and of women of childbearing age were in the same range as those observed in the French population and in neighbouring European countries, but higher than in the North American population. The two factors with the highest positive association with serum PCB levels were age (R{sup 2} = 61%) and the consumption of PCB-BP{sup +} freshwater fish (R{sup 2} = 2%). Using the regression model, we calculated, for several scenarios depending on the age and gender of the population, the maximum annual frequencies for PCB-BP{sup +} freshwater fish consumption that do not exceed the critical body burden threshold. Conclusion: Following the results of this study, the French agency for food, environmental and occupational health and safety (ANSES) issued an opinion and recommended some specific maximum freshwater fish consumption frequencies to protect the French
Relationship of vitamin D levels to blood pressure in a biethnic population.
Sakamoto, R; Jaceldo-Siegl, K; Haddad, E; Oda, K; Fraser, G E; Tonstad, S
2013-08-01
Accumulating epidemiological and clinical studies have suggested that vitamin D insufficiency may be associated with hypertension. Blacks tend to have lower vitamin D levels than Whites, but it is unclear whether this difference explains the higher blood pressure (BP) observed in Blacks in a population with healthy lifestyle practices. We examined cross-sectional data in the Adventist Health Study-2 (AHS-2), a cohort of non-smoking, mostly non-drinking men and women following a range of diets from vegan to non-vegetarian. Each participant provided dietary, demographic, lifestyle and medical history data. Measurements of weight, height, waist circumference, percent body fat and blood pressure and fasting blood samples were obtained from a randomly selected non-diabetic sample of 284 Blacks and 284 Whites aged 30-95 years. Multiple regression analyses were used to assess independent relationships between blood pressure and 25(OH)D levels. Levels of 25(OH)D were inversely associated with systolic BP in Whites after control for age, gender, BMI, and use of BP-lowering medications (β-coefficient -0.23 [95% CI, -0.43, -0.03; p = 0.02]). This relationship was not seen in Blacks (β-coefficient 0.08 [95% CI, -0.14, 0.30; p = 0.4]). Results were similar when controlling for waist circumference or percentage body fat instead of BMI. No relationship between serum 25(OH)D and diastolic BP was seen. Systolic BP is inversely associated with 25(OH)D levels in Whites but not in Blacks. Vitamin D may not be a major contributor to the White-Black differential in BP. Copyright © 2012 Elsevier B.V. All rights reserved.
Expression of the Transcription Factor E4BP4 in Human Basophils
DEFF Research Database (Denmark)
Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard
2014-01-01
Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....
Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9
International Nuclear Information System (INIS)
Burgess, P.H.; Iles, W.J.
1979-08-01
The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)
Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.
Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W
2017-12-01
We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.
Zhang, Jianguo; Zhu, Junya; Yang, Lei; Guan, Chengqi; Ni, Runzhou; Wang, Yuchan; Ji, Lili; Tian, Ye
2015-09-01
CtBP2, as a transcriptional corepressor of epithelial-specific genes, has been reported to promote tumor due to upregulating epithelial-mesenchymal transition (EMT) in cancer cells. CtBP2 was also demonstrated to contribute to the proliferation of esophageal squamous cell carcinoma (ESCC) cells through a negative transcriptional regulation of p16(INK4A). In this study, for the first time, we reported that CtBP2 expression, along with CCNH/CDK7, was higher in ESCC tissues with lymph node metastases than in those without lymph node metastases. Moreover, both CtBP2 and CCNH/CDK7 were positively correlated with E-cadherin, tumor grade, and tumor metastasis. However, the concrete mechanism of CtBP2's role in enhancing ESCC migration remains incompletely understood. We confirmed that CCNH/CDK7 could directly interact with CtBP2 in ESCC cells in vivo and in vitro. Furthermore, our data demonstrate for the first time that CtBP2 enhanced the migration of ESCC cells in a CCNH/CDK7-dependent manner. Our results indicated that CCNH/CDK7-CtBP2 axis may augment ESCC cell migration, and targeting the interaction of both may provide a novel therapeutic target of ESCC.
Hattori, Tomomi; Munakata, Masanori
2015-01-01
Job strain is a risk factor for hypertension, but it is not fully understood if components of job strain, or job demand or job control per se could be related to blood pressure (BP), and if so, whether the relationship differs between normotension and mildly elevated BP. We examined resting BP, and job stress components in 113 Japanese male hospital clerks (38.1 ± 4.4 yr). Subjects were classified into normotensive (NT) (<130/85 mmHg, n=83) and mildly elevated BP (ME) (≥130/85 mmHg) groups. Diastolic BP (DBP) showed a significant interaction between group and job control level (p=0.013). Subjects with low job control demonstrated higher DBP than those with high job control (89.1 ± 2.1 vs. 82.3 ± 2.3 mmHg, p=0.042) in ME group even after adjustments for covariates while DBP did not differ between low and high job control subjects in NT group. Systolic BP (SBP) did not differ between high and low job control subjects in both groups. Neither SBP nor DBP differed between high and low demand groups in either group. Among job strain components, job control may be independently related to BP in Japanese male workers with mildly elevated BP.
Gear Fault Diagnosis Based on BP Neural Network
Huang, Yongsheng; Huang, Ruoshi
2018-03-01
Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.
Harley, James A; Wells, J Elisabeth; Frampton, Christopher M A; Joyce, Peter R
2011-01-01
Personality traits are potential endophenotypes for genetic studies of psychiatric disorders. One personality theory which demonstrates strong heritability is Cloninger's psychobiological model measured using the temperament and character inventory (TCI). 277 individuals who completed the TCI questionnaire as part of the South Island Bipolar Study were also interviewed to assess for lifetime psychiatric diagnoses. Four groups were compared, bipolar disorder (BP), type 1 and 2, MDD (major depressive disorder), and nonaffected relatives of a proband with BP. With correction for mood state, total harm avoidance (HA) was higher than unaffected in both MDD and BP groups, but the mood disorder groups did not differ from each other. However, BP1 individuals had higher self-transcendence (ST) than those with MDD and unaffected relatives. HA may reflect a trait marker of mood disorders whereas high ST may be specific to BP. As ST is heritable, genes that affect ST may be of relevance for vulnerability to BP.
A new BP Fourier algorithm and its application in English teaching evaluation
Pei, Xuehui; Pei, Guixin
2017-08-01
BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.
InterProScan Result: BP117067 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117067 BP117067_1_ORF2 D483359C05197373 PFAM PF00067 p450 6e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
Czech Academy of Sciences Publication Activity Database
Legartová, Soňa; Sehnalová, Petra; Malyšková, B.; Kuntziger, T.; Collas, P.; Cmarko, D.; Raška, I.; Sorokin, D.V.; Kozubek, Stanislav; Bártová, Eva
2016-01-01
Roč. 117, č. 11 (2016), s. 2583-2596 ISSN 0730-2312 R&D Projects: GA ČR GBP302/12/G157; GA ČR GA13-07822S; GA MŠk 7F14369 Institutional support: RVO:68081707 Keywords : DNA REPAIR * 53BP1 PROTEIN * PML BODIES Subject RIV: BO - Biophysics Impact factor: 3.085, year: 2016
InterProScan Result: BP124291 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
InterProScan Result: BP123442 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
The human element of right-sizing. BP experiences
International Nuclear Information System (INIS)
Hollis, J.W.
1994-01-01
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
The human element of right-sizing. BP experiences
Energy Technology Data Exchange (ETDEWEB)
Hollis, J W [BP Norge (Norway)
1994-12-31
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
International Nuclear Information System (INIS)
Switsur, Roy
1986-01-01
A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)
BP teatas harvast edusammust / Hendrik Vosman
Vosman, Hendrik
2010-01-01
Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud
International Nuclear Information System (INIS)
Iwabuchi, Kuniyoshi; Matsui, Tadashi; Hashimoto, Mitsumasa; Matsumoto, Yoshihisa; Kurihara, Takayuki; Date, Takayasu
2008-01-01
53BP1 plays important roles in checkpoint signaling and repair for DNA double-strand breaks. We found that a colon cancer cell line, SW48, expressed a splicing variant form of 53BP1, which lacks the residues corresponding to exons 10 and 11. Activation of ATM and phosphorylation of ATM and ATR targets occurred in SW48 cells in response to X-irradiation, and these X-ray-induced responses were not enhanced by expression of full-length 53BP1 in SW48 cells, indicating that this splicing variant fully activates the major checkpoint signaling in SW48 cells. In contrast, the expression of full-length 53BP1 in SW48 cells promoted the repair of X-ray-induced DNA damage, evidenced by faster disappearance of X-ray-induced γ-H2AX foci, a marker for DNA damage, and less residual chromosomal aberrations after X-irradiation. We conclude that the two major roles of 53BP1, the checkpoint signaling and repair for DNA damage, can be functionally separated
A heterozygous 21-bp deletion in CAPN3 causes dominantly inherited limb girdle muscular dystrophy
DEFF Research Database (Denmark)
Vissing, John; Barresi, Rita; Witting, Nanna
2016-01-01
screening. In this investigation, we report 37 individuals (age range: 21-85 years, 21 females and 16 males) from 10 families in whom only one mutation in CAPN3 could be identified; a 21-bp, in-frame deletion (c.643_663del21). This mutation co-segregated with evidence of muscle disease and autosomal...... not affect mRNA maturation. Calpain 3 expression in muscle, assessed by western blot, was below 15% of normal levels in the nine mutation carriers in whom this could be tested. Haplotype analysis in four families from three different countries suggests that the 21-bp deletion is a founder mutation...
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC
Directory of Open Access Journals (Sweden)
Hanane Ennajdaoui
2016-05-01
Full Text Available Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3 expression correlates with malignancy, but its role(s in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP revealed significant overlap of IGF2BP3 and microRNA (miRNA binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions.
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC.
Ennajdaoui, Hanane; Howard, Jonathan M; Sterne-Weiler, Timothy; Jahanbani, Fereshteh; Coyne, Doyle J; Uren, Philip J; Dargyte, Marija; Katzman, Sol; Draper, Jolene M; Wallace, Andrew; Cazarez, Oscar; Burns, Suzanne C; Qiao, Mei; Hinck, Lindsay; Smith, Andrew D; Toloue, Masoud M; Blencowe, Benjamin J; Penalva, Luiz O F; Sanford, Jeremy R
2016-05-31
Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3) expression correlates with malignancy, but its role(s) in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC) cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP) revealed significant overlap of IGF2BP3 and microRNA (miRNA) binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC) with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.
On-line dynamic monitoring automotive exhausts: using BP-ANN for distinguishing multi-components
Zhao, Yudi; Wei, Ruyi; Liu, Xuebin
2017-10-01
Remote sensing-Fourier Transform infrared spectroscopy (RS-FTIR) is one of the most important technologies in atmospheric pollutant monitoring. It is very appropriate for on-line dynamic remote sensing monitoring of air pollutants, especially for the automotive exhausts. However, their absorption spectra are often seriously overlapped in the atmospheric infrared window bands, i.e. MWIR (3 5μm). Artificial Neural Network (ANN) is an algorithm based on the theory of the biological neural network, which simplifies the partial differential equation with complex construction. For its preferable performance in nonlinear mapping and fitting, in this paper we utilize Back Propagation-Artificial Neural Network (BP-ANN) to quantitatively analyze the concentrations of four typical industrial automotive exhausts, including CO, NO, NO2 and SO2. We extracted the original data of these automotive exhausts from the HITRAN database, most of which virtually overlapped, and established a mixed multi-component simulation environment. Based on Beer-Lambert Law, concentrations can be retrieved from the absorbance of spectra. Parameters including learning rate, momentum factor, the number of hidden nodes and iterations were obtained when the BP network was trained with 80 groups of input data. By improving these parameters, the network can be optimized to produce necessarily higher precision for the retrieved concentrations. This BP-ANN method proves to be an effective and promising algorithm on dealing with multi-components analysis of automotive exhausts.
BP Canada Energy Company : climate change action plan update 1999-2000
International Nuclear Information System (INIS)
2001-10-01
An aggressive, world-wide target for a 10 per cent reduction of greenhouse gas emissions was set by BP p.l.c. and BP Canada Energy Company has supported this endeavour. Six major areas have been identified as offering potential solutions to the problem of climate change: the control of greenhouse gases, the conservation of energy, the introduction of new technologies, the promotion of flexible market instruments, the participation in the policy process, and an investment in research. This document reviewed the efforts expanded to date in those areas. It was noted that a deliberate shift was made by BP leadership from oil to natural gas production, releasing much less carbon dioxide in the atmosphere when burned. A brief overview of the operations of BP Canada Energy Company was provided in chapter 1, followed by the philosophy concerning greenhouse gases in chapter 2. In chapter 3, the topic of BP's global emissions trading system was discussed. The current and projected greenhouse gas emissions were looked at in chapter 4, while chapter 5 dealt with setting global targets, with specific emphasis on Canadian targets. In chapter 6 , the emphasis was placed on BP's emission reduction initiatives. In chapter 7, the question of raising awareness was examined. 7 tabs., 7 figs
International Nuclear Information System (INIS)
Minoshima, Kayo; Kawahata, Hodaka; Irino, Tomohisa; Ikehara, Ken; Aoki, Kaori; Uchida, Masao; Yoneda, Minoru; Shibata, Yasuyuki
2007-01-01
The difference between benthic and planktonic foraminifera radiocarbon (B-P 14 C) age differences in core PC6 (40 o 23.89' N, 143 o 29.87' E) retrieved from the northwestern North Pacific provide a clue to the reconstruction of deep water circulation during the last deglaciation and the early Holocene (15-5 cal. kyr B.P.). The observed B-P 14 C age differences ranged from 1030 to 1630 years, which are comparable to the present-day apparent ventilation age. It suggested that the ventilation generally remained similar during 15-5 cal. kyr B.P. However, B-P 14 C age difference slightly reduced at 14.6 cal. kyr B.P., indicating that the higher ventilation temporality could have occurred in the northwestern North Pacific (∼2200 m water depth)
Preliminary Geological Findings on the BP-1 Simulant
Stoeser, D. B.; Rickman, D. L.; Wilson, S.
2010-01-01
A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.
Mustanoja, Satu; Putaala, Jukka; Gordin, Daniel; Tulkki, Lauri; Aarnio, Karoliina; Pirinen, Jani; Surakka, Ida; Sinisalo, Juha; Lehto, Mika; Tatlisumak, Turgut
2016-06-01
High blood pressure (BP) in acute stroke has been associated with a poor outcome; however, this has not been evaluated in young adults. The relationship between BP and long-term outcome was assessed in 1004 consecutive young, first-ever ischemic stroke patients aged 15 to 49 years enrolled in the Helsinki Young Stroke Registry. BP parameters included systolic (SBP) and diastolic BP, pulse pressure, and mean arterial pressure at admission and 24 hours. The primary outcome measure was recurrent stroke in the long-term follow-up. Adjusted for demographics and preexisting comorbidities, Cox regression models were used to assess independent BP parameters associated with outcome. Of our patients (63% male), 393 patients (39%) had prestroke hypertension and 358 (36%) used antihypertensive treatment. The median follow-up period was 8.9 years (interquartile range 5.7-13.2). Patients with a recurrent stroke (n=142, 14%) had significantly higher admission SBP, diastolic BP, pulse pressure, and mean arterial pressure (Pstroke. Patients with SBP ≥160 mm Hg compared with those with SBP strokes (hazard ratio 3.3 [95% confidence interval, 2.05-4.55]; Pstroke, while the 24-hour BP levels were not. In young ischemic stroke patients, high acute phase BP levels are independently associated with a high risk of recurrent strokes. © 2016 American Heart Association, Inc.
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao
2016-10-13
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Fault Diagnosis of Power System Based on Improved Genetic Optimized BP-NN
Directory of Open Access Journals (Sweden)
Yuan Pu
2015-01-01
Full Text Available BP neural network (Back-Propagation Neural Network, BP-NN is one of the most widely neural network models and is applied to fault diagnosis of power system currently. BP neural network has good self-learning and adaptive ability and generalization ability, but the operation process is easy to fall into local minima. Genetic algorithm has global optimization features, and crossover is the most important operation of the Genetic Algorithm. In this paper, we can modify the crossover of traditional Genetic Algorithm, using improved genetic algorithm optimized BP neural network training initial weights and thresholds, to avoid the problem of BP neural network fall into local minima. The results of analysis by an example, the method can efficiently diagnose network fault location, and improve fault-tolerance and grid fault diagnosis effect.
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao; Zhang, Lu; Wu, Shaowen; Liu, Zhijun; Gao, Xin; Zhang, Xu; Liu, Maili; Liu, Jianwei; Huang, Xuhui; Wang, Wenning
2016-01-01
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Higher dimensional global monopole in Brans–Dicke theory
Indian Academy of Sciences (India)
Keywords. Global monopole; Brans–Dicke theory; higher dimension. PACS Nos 04.20.Jb; 98.80.Bp; 04.50.+h. 1. Introduction. The idea of higher dimensional theory was originated in super string and super gravity the- ories to unify gravity with other fundamental forces in nature. Solutions of Einstein field equations in higher ...
Directory of Open Access Journals (Sweden)
Lindkær-Jensen S
2015-03-01
Full Text Available Steen Lindkær-Jensen,1 Stig Larsen,2 Nina Habib-Lindkær-Jensen,1 Hans E Fagertun3 1Department of Surgery and Cancer, Hammersmith Hospital Campus, Imperial College, London, UK; 2Center of Epidemiology and Biostatistics, Faculty of Veterinary Medicine, University of Life Science, Oslo, Norway; 3Meddoc Research AS, Skjetten, Norway Abstract: A benzene-poly-carboxylic acid complex with cis-diammineplatinum(II dihydrocholride, BP-C1 is currently used in clinical trials in treating metastatic breast cancer. BP-C1 controls tumor growth with a few mild side-effects, improving quality of life.Methods: The data consisted of prospectively collected laboratory results from 47 patients in two controlled clinical trials of daily intramuscular injections of BP-C1 for 32 days. Study I was performed as an open, nonrandomized, Phase I dose–response, multicenter study with a three-level, between-patient, response surface pathway design. The second study was a randomized, double-blind, and placebo-controlled, multicenter study with a stratified semi-crossover design.Results: Hemoglobin (Hb and hematocrit (Hct increased significantly (P<0.01 during BP-C1 treatment, while red blood cell (RBC count increased but not significantly. The most pronounced increase in Hb, RBC, Hct, and white blood cell (WBC was in anemic patients (P≤0.01. WBC count and neutrophils increased significantly (P=0.01 in the overall data. WBCs and neutrophils (P<0.01, eosinophils (P=0.05 and monocytes (P<0.01 increased significantly and markedly in patients with lowest baseline levels. Additionally, low levels of thrombocytes significantly increased. No changes in liver parameters, amylase, glucose, creatinine, or albumin, were detected except for albumin in the subgroup with low baseline levels, where levels increased significantly (P=0.04. An increase in K+, Ca2+, and PO43- was most pronounced in patients with low baseline levels (P≤0.02. A similar pattern detected for Mg2+, prothrombin
Agarwal, Abhishek; Garg, Monika; Dixit, Nikhil; Godara, Rohini
2016-11-01
Stress had been associated with the development of central serous chorioretinopathy (CSC). The study was designed to evaluate the effect of stress on other risk factors of CSC such as serum cortisol levels, serum homocysteine levels, and blood pressure (BP) in CSC patients. To compare stress scores, serum cortisol and serum homocysteine levels, and BP of CSC patients with that of control population and to correlate stress scores of CSC patients with BP, serum cortisol levels, and serum homocysteine levels. Stress scores, serum morning and evening cortisol levels, serum homocysteine levels, systolic and diastolic BP of 54 CSC patients were measured and compared with that of 54 age- and sex-related controls using Student's t-test. Stress scores of CSC patients were correlated with systolic and diastolic BP, serum morning and evening cortisol levels and serum homocysteine levels and Pearson correlation coefficient (r) were calculated. Stress scores, serum homocysteine levels, serum morning and evening cortisol levels, and systolic and diastolic BP were all elevated in CSC patients as compared with age- and sex-related controls (P Stress scores of CSC patients were found to correlate strongly with serum homocysteine levels, serum morning and evening cortisol levels, and systolic and diastolic BP, with r values 0.82, 0.8, 0.8, 0.8, and 0.81, respectively (P Stress scores were elevated in CSC patients and were strongly correlated with serum homocysteine and cortisol levels and BP.
TopBP1-mediated DNA processing during mitosis.
Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H
2016-01-01
Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.
BP pääseb lekkest kuiva nahaga / Heiki Suurkask
Suurkask, Heiki, 1972-
2010-01-01
BP saab peagi valmis tagavara-naftapuuraugu, lekkinud puuraugule õnnestus peale valada betoonkiht. Autor märgib, et tegelikult ei saa USA võimud ühtegi edusammu naftalekke peatamisel selgelt oma nimele kirjutada ning ainsaks kaotajaks selles lekkes peale looduse ja kalurite paistab olevat ameti kaotav BP juht Tony Hatward
Verhoeven, H.A.; Griensven, van L.J.L.D.
2012-01-01
Two human leukemia cells K562 and THP-1, the breast cancer lines MCF-7 and ZR-75-1, and the melanoma line MDA-MB-435S were compared by flowcytometry for their behaviour at increasing levels of 3BP. K562 and THP-1 responded to 3BP by membrane depolarization and increased ROS; MCF-7 and ZR-75-1 showed
Plasma intact fibroblast growth factor 23 levels in women with anorexia nervosa
Directory of Open Access Journals (Sweden)
Otani Makoto
2008-04-01
Full Text Available Abstract Background Fibroblast growth factor (FGF23 is a novel phosphaturic factor associated with inorganic phosphate homeostasis. Previous human studies have shown that serum FGF23 levels increase in response to a high phosphate diet. For anorexia nervosa (AN patients, inorganic phosphate homeostasis is important in the clinical course, such as in refeeding syndrome. The purpose of this study was to determine plasma levels of intact FGF23 (iFGF23 in restricting-type AN (AN-R patients, binge-eating/purging-type AN (AN-BP patients, and healthy controls. Methods The subjects consisted of 6 female AN-R patients, 6 female AN-BP patients, and 11 healthy female controls; both inpatients and outpatients were included. Plasma iFGF23, 1,25-dihydroxyvitamin D (1,25-(OH2D, and 25-hydroxyvitamin D (25-OHD levels were measured. Data are presented as the median and the range. A two-tailed Mann-Whitney U-test with Bonferroni correction was used to assess differences among the three groups, and a value of p Results There were no differences between AN-R patients and controls in the iFGF23 and 1,25-(OH2D levels. In AN-BP patients, the iFGF23 level (41.3 pg/ml; range, 6.1–155.5 pg/ml was significantly higher than in controls (3.8 pg/ml; range, not detected-21.3 pg/ml; p = 0.001, and the 1,25-(OH2D was significantly lower in AN-BP patients (7.0 pg/ml; range, 4.2–33.7 pg/ml than in controls (39.7 pg/ml; range, 6.3–58.5 pg/ml; p = 0.015. No differences in plasma 25-OHD levels were observed among the groups. Conclusion This preliminary study is the first to show that plasma iFGF23 levels are increased in AN-BP patients, and that these elevated plasma FGF23 levels might be related to the decrease in plasma 1,25-(OH2D levels.
200-BP-5 operable unit Technical Baseline report
International Nuclear Information System (INIS)
Jacques, I.D.; Kent, S.K.
1991-10-01
This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted
Zhou, Yuhang; Huang, Tingting; Siu, Ho Lam; Wong, Chi Chun; Dong, Yujuan; Wu, Feng; Zhang, Bin; Wu, William K K; Cheng, Alfred S L; Yu, Jun; To, Ka Fai; Kang, Wei
2017-04-11
Gastric cancer (GC) is one of the frequent causes of cancer-related death in eastern Asian population. IGF2BP2 lists in the top rank up-regulated genes in GC, but its functional role is unclear. The expression of IGF2BP3 in GC cell lines and primary samples was examined by qRT-PCR and Western blot. The biological role of IGF2BP3 was revealed by a series of functional in vitro studies. Its regulation by microRNAs (miRNAs) was predicted by TargetScan and confirmed by luciferase assays and rescue experiments. IGF2BP3 ranked the No.1 of the up-regulated genes by expression microarray analysis in GC cell lines. The expression level of IGF2BP3 was observed in GC tissues comparing with non-tumorous gastric epitheliums. The up-regulated IGF2BP3 expression was associated with poor disease specific survival. IGF2BP3 knockdown significantly inhibited cell proliferation and invasion. Apart from copy number gain, IGF2BP3 has been confirmed to be negatively regulated by tumor-suppressive miRNA, namely miR-34a. The expression of miR-34a showed negative correlation with IGF2BP3 mRNA expression in primary GC samples and more importantly, re-overexpression of IGF2BP3 rescued the inhibitory effect of miR-34a. We compressively revealed the oncogenic role of IGF2BP3 in gastric tumorigenesis and confirmed its activation is partly due to the silence of miR-34a. Our findings identified useful prognostic biomarker and provided clinical translational potential.
Advertising as Insurance or Commitment? Evidence from the BP Oil Spill
Lint Barrage; Eric Chyn; Justine Hastings
2014-01-01
This paper explores how advertising impacts the consumer response to news about unobserved product quality. Specifically, we estimate how British Petroleum’s (BP) 2000-2008 “Beyond Petroleum” advertising campaign affected the impact of the 2010 BP oil spill. We find that BP station margins declined by 4.2 cents per gallon, and volumes declined by 3.6 percent after the spill. However, pre-spill advertising significantly dampened the price response in the short-run, and reduced the fraction of ...
Sharma, Shruti; Mora, G.; Johnston, J.W.; Thompson, T.A.
2005-01-01
Beach ridges along the coastline of Lake Superior provide a long-term and detailed record of lake level fluctuations for the past 4000 cal BP. Although climate change has been invoked to explain these fluctuations, its role is still in debate. Here, we reconstruct water balance by employing peat samples collected from swale deposits present between beach ridge sequences at two locations along the coastline of Lake Superior. Carbon isotope ratios for Sphagnum remains from these peat deposits are used as a proxy for water balance because the presence or absence of water films on Sphagnum controls the overall isotope discrimination effects. Consequently, increased average water content in Sphagnum produces elevated ??13C values. Two maxima of Sphagnum ??13C values interpreted to reflect wetter conditions prevailed from 3400 to 2400 cal BP and from about 1900 to 1400 cal BP. There are two relatively short drier periods as inferred from low Sphagnum ??13C values: one is centered at about 2300 cal BP, and one begins at 1400 cal BP. A good covariance was found between Sphagnum ??13C values and reconstructed lake-levels for Lake Michigan in which elevated carbon isotope values correlate well with higher lake levels. Based on this covariance, we conclude that climate exerts a strong influence on lake levels in Lake Superior for the past 4000 cal BP. ?? 2005 Elsevier Ltd. All rights reserved.
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Directory of Open Access Journals (Sweden)
Tin Nguyen
Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori
2012-01-01
MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.
Marriott, James; Muttitt, Greg
2006-01-01
An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.
An 8bp indel in exon 1 of Ghrelin gene associated with chicken growth.
Fang, Meixia; Nie, Qinghua; Luo, Chenglong; Zhang, Dexiang; Zhang, Xiquan
2007-04-01
Ghrelin, acts as the endogenous ligand for growth hormone secretagogues receptor (GHS-R), is a novel growth hormone (GH) releasing peptide with reported effects on food intake in chickens. In this study, an 8 bp indel polymorphism in exon 1 of the chicken Ghrelin (cGHRL) gene was genotyped in a F(2) designed full-sib population to analyze its associations with chicken growth and carcass traits. Later, mRNA level in the proventriculus was determined by real-time PCR to reveal the expression feature of cGHRL gene. Result showed that this 8 bp indel was significantly associated with body weight at the age of 28 days (BW28) and 56 days (BW56), eviscerated weight (EW) and leg muscle weight (LMW) (PGhrelin on chicken growth were indicated by this study.
200-BP-5 operable unit treatability test report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.
200-BP-5 operable unit treatability test report
International Nuclear Information System (INIS)
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites
Radio frequency plasma nitriding of aluminium at higher power levels
International Nuclear Information System (INIS)
Gredelj, Sabina; Kumar, Sunil; Gerson, Andrea R.; Cavallaro, Giuseppe P.
2006-01-01
Nitriding of aluminium 2011 using a radio frequency plasma at higher power levels (500 and 700 W) and lower substrate temperature (500 deg. C) resulted in higher AlN/Al 2 O 3 ratios than obtained at 100 W and 575 deg. C. AlN/Al 2 O 3 ratios derived from X-ray photoelectron spectroscopic analysis (and corroborated by heavy ion elastic recoil time of flight spectrometry) for treatments preformed at 100 (575 deg. C), 500 (500 deg. C) and 700 W (500 deg. C) were 1.0, 1.5 and 3.3, respectively. Scanning electron microscopy revealed that plasma nitrided surfaces obtained at higher power levels exhibited much finer nodular morphology than obtained at 100 W
Assessing the Need for Higher Levels of Care Among Problem Gambling Outpatients.
Ledgerwood, David M; Arfken, Cynthia L
2017-12-01
Most treatment for gambling disorder is provided on an outpatient basis. Only a small number of jurisdictions in North America provide higher levels of gambling treatment, such as residential or intensive outpatient (IOP) care, despite the potential need for these services. Further, there appear to be few guidelines for determining appropriate level of gambling treatment. The aim of the present study was to assess the appropriateness of higher levels of problem gambling care among clients receiving outpatient treatment. Problem gamblers and their therapists independently completed questionnaires that assessed the need and desire for residential and IOP treatment. About 42% of problem gambling outpatients noted that they would be "probably" or "definitely" willing to attend residential treatment, and about half indicated they would be equally likely to attend IOP. Therapists recommended about a third of their clients as appropriate for higher levels of care. For both client and therapist assessments, there was a significant association between desire or recommendation for level of treatment and severity of gambling and co-occurring problems. Further, therapist recommendations for level of care were significantly associated with client willingness to attend higher levels of treatment. Our data reveal the potential need for higher levels of care for problem gambling, as evaluated by clients and their therapists. Policy implications for the funding of residential and IOP treatment are discussed.
Study on MPGA-BP of Gravity Dam Deformation Prediction
Directory of Open Access Journals (Sweden)
Xiaoyu Wang
2017-01-01
Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.
BP Investment Exceeds $4 Bln in china
Institute of Scientific and Technical Information of China (English)
Wang Ping
2008-01-01
@@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.
Directory of Open Access Journals (Sweden)
Aikaterini Patsatsi
2012-01-01
Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.
Sleep-time BP: prognostic marker of type 2 diabetes and therapeutic target for prevention.
Hermida, Ramón C; Ayala, Diana E; Mojón, Artemio; Fernández, José R
2016-02-01
We investigated the prognostic value of clinic and ambulatory BP (ABP) to predict new-onset diabetes and whether risk reduction is related to the progressive decrease of clinic BP or awake or asleep ABP. We prospectively evaluated 2,656 individuals without diabetes, 1,292 men and 1,364 women, 50.6 ± 14.3 years of age, with baseline BP ranging from normotension to hypertension according to ABP criteria. At baseline and annually (more frequently if hypertension treatment was adjusted based on ABP) thereafter, ABP and physical activity (wrist actigraphy) were simultaneously monitored for 48 h to accurately derive the awake and asleep BP means. During a 5.9-year median follow-up, 190 participants developed type 2 diabetes. The asleep systolic ABP mean was the most significant predictor of new-onset diabetes in a Cox proportional-hazard model adjusted for age, waist circumference, glucose, chronic kidney disease (CKD) and hypertension treatment. Daytime clinic BP and awake or 48 h ABP mean had no predictive value when corrected by the asleep ABP mean. Analyses of BP changes during follow-up revealed a 30% reduction in the risk of new-onset diabetes per 1-SD decrease in asleep systolic ABP mean, independent of changes in clinic BP or awake or 48 h ABP means. Sleep-time BP is a highly significant independent prognostic marker for new-onset diabetes. Alteration in sleep-time BP regulation seems to precede, rather than follow, the development of new-onset diabetes. Most important, lowering asleep BP, a novel therapeutic target requiring ABP evaluation, could be a significant method for reducing new-onset diabetes risk.
CHANDRA X-RAY DETECTION OF THE ENIGMATIC FIELD STAR BP Psc
International Nuclear Information System (INIS)
Kastner, Joel H.; Montez, Rodolfo; Rodriguez, David; Zuckerman, B.; Perrin, Marshall D.; Grosso, Nicolas; Forveille, Thierry; Graham, James R.
2010-01-01
BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity, log(L X /L bol ), lies in the range -5.8 to -4.2. This is smaller than log(L X /L bol ) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L X /L bol ) range observed for rapidly rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its very recently engulfing a companion star or a giant planet, as the primary star ascended the giant branch.
Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma
International Nuclear Information System (INIS)
Sun, Shiren; Ning, Xiaoxuan; Liu, Jie; Liu, Lili; Chen, Yu; Han, Shuang; Zhang, Yanqi; Liang, Jie; Wu, Kaichun; Fan, Daiming
2007-01-01
Calcyclin-binding protein/Siah-1-interacting protein (CacyBP/SIP), a target protein of S100, has been identified as a component of a novel ubiquitinylation complex leading to β-catenin degradation, which was found to be related to the malignant phenotypes of gastric cancer. However, the roles of CacyBP/SIP in renal cell carcinoma still remain unclear. In the present study, we had analyzed the expression of the CacyBP/SIP protein in human renal cancer cells and clinical tissue samples. The possible roles of CacyBP/SIP in regulating the malignant phenotype of renal cancer cells were also investigated. The results demonstrated that the expression of CacyBP/SIP was markedly down-regulated in renal cell carcinoma tissues and cell lines. Ectopic overexpression of CacyBP/SIP in A498 cells inhibited the proliferation of this cell and delayed cell cycle progression significantly, which might be related to the down-regulation of Cyclin D1 through reducing β-catenin protein. CacyBP/SIP also suppressed colony formation in soft agar and its tumorigenicity in nude mice. Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells
BP Oil Company's approach to risk management
International Nuclear Information System (INIS)
Fryman, C.E.
1996-01-01
The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams
Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches
Directory of Open Access Journals (Sweden)
Gurmanik Kaur
2014-01-01
Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Prediction of BP reactivity to talking using hybrid soft computing approaches.
Kaur, Gurmanik; Arora, Ajat Shatru; Jain, Vijender Kumar
2014-01-01
High blood pressure (BP) is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI), and arm circumference (AC) were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA) was fused with artificial neural network (ANN), adaptive neurofuzzy inference system (ANFIS), and least square-support vector machine (LS-SVM) model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R (2)), root mean square error (RMSE), and mean absolute percentage error (MAPE) revealed that PCA based LS-SVM (PCA-LS-SVM) model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Abdallah, Cosette; Lejamtel, Charlène; Benzoubir, Nassima; Battaglia, Serena; Sidahmed-Adrar, Nazha; Desterke, Christophe; Lemasson, Matthieu; Rosenberg, Arielle R; Samuel, Didier; Bréchot, Christian; Pflieger, Delphine; Le Naour, François; Bourgeade, Marie-Françoise
2017-08-22
Hepatitis C virus (HCV) is a leading cause of liver diseases including the development of hepatocellular carcinoma (HCC). Particularly, core protein has been involved in HCV-related liver pathologies. However, the impact of HCV core on signaling pathways supporting the genesis of HCC remains largely elusive. To decipher the host cell signaling pathways involved in the oncogenic potential of HCV core, a global quantitative phosphoproteomic approach was carried out. This study shed light on novel differentially phosphorylated proteins, in particular several components involved in translation. Among the eukaryotic initiation factors that govern the translational machinery, 4E-BP1 represents a master regulator of protein synthesis that is associated with the development and progression of cancers due to its ability to increase protein expression of oncogenic pathways. Enhanced levels of 4E-BP1 in non-modified and phosphorylated forms were validated in human hepatoma cells and in mouse primary hepatocytes expressing HCV core, in the livers of HCV core transgenic mice as well as in HCV-infected human primary hepatocytes. The contribution of HCV core in carcinogenesis and the status of 4E-BP1 expression and phosphorylation were studied in HCV core/Myc double transgenic mice. HCV core increased the levels of 4E-BP1 expression and phosphorylation and significantly accelerated the onset of Myc-induced tumorigenesis in these double transgenic mice. These results reveal a novel function of HCV core in liver carcinogenesis potentiation. They position 4E-BP1 as a tumor-specific target of HCV core and support the involvement of the 4E-BP1/eIF4E axis in hepatocarcinogenesis.
Divergent homologs of the predicted small RNA BpCand697 in Burkholderia spp.
Damiri, Nadzirah; Mohd-Padil, Hirzahida; Firdaus-Raih, Mohd
2015-09-01
The small RNA (sRNA) gene candidate, BpCand697 was previously reported to be unique to Burkholderia spp. and is encoded at 3' non-coding region of a putative AraC family transcription regulator gene. This study demonstrates the conservation of BpCand697 sequence across 32 Burkholderia spp. including B. pseudomallei, B. mallei, B. thailandensis and Burkholderia sp. by integrating both sequence homology and secondary structural analyses of BpCand697 within the dataset. The divergent sequence of BpCand697 was also used as a discriminatory power in clustering the dataset according to the potential virulence of Burkholderia spp., showing that B. thailandensis was clearly secluded from the virulent cluster of B. pseudomallei and B. mallei. Finally, the differential co-transcript expression of BpCand697 and its flanking gene, bpsl2391 was detected in Burkholderia pseudomallei D286 after grown under two different culture conditions using nutrient-rich and minimal media. It is hypothesized that the differential expression of BpCand697-bpsl2391 co-transcript between the two standard prepared media might correlate with nutrient availability in the culture media, suggesting that the physical co-localization of BpCand697 in B. pseudomallei D286 might be directly or indirectly involved with the transcript regulation of bpsl2391 under the selected in vitro culture conditions.
PM : Cabinet likely to choose TNK-BP
2005-01-01
Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole
Sparks, Matthew A; Stegbauer, Johannes; Chen, Daian; Gomez, Jose A; Griffiths, Robert C; Azad, Hooman A; Herrera, Marcela; Gurley, Susan B; Coffman, Thomas M
2015-12-01
Inappropriate activation of the type 1A angiotensin (AT1A) receptor contributes to the pathogenesis of hypertension and its associated complications. To define the role for actions of vascular AT1A receptors in BP regulation and hypertension pathogenesis, we generated mice with cell-specific deletion of AT1A receptors in smooth muscle cells (SMKO mice) using Loxp technology and Cre transgenes with robust expression in both conductance and resistance arteries. We found that elimination of AT1A receptors from vascular smooth muscle cells (VSMCs) caused a modest (approximately 7 mmHg) yet significant reduction in baseline BP and exaggerated sodium sensitivity in mice. Additionally, the severity of angiotensin II (Ang II)-dependent hypertension was dramatically attenuated in SMKO mice, and this protection against hypertension was associated with enhanced urinary excretion of sodium. Despite the lower BP, acute vasoconstrictor responses to Ang II in the systemic vasculature were largely preserved (approximately 80% of control levels) in SMKO mice because of exaggerated activity of the sympathetic nervous system rather than residual actions of AT1B receptors. In contrast, Ang II-dependent responses in the renal circulation were almost completely eliminated in SMKO mice (approximately 5%-10% of control levels). These findings suggest that direct actions of AT1A receptors in VSMCs are essential for regulation of renal blood flow by Ang II and highlight the capacity of Ang II-dependent vascular responses in the kidney to effect natriuresis and BP control. Copyright © 2015 by the American Society of Nephrology.
Energy Technology Data Exchange (ETDEWEB)
Hatano, S; Hashimoto, T [Seikei University, Tokyo (Japan)
1997-10-01
In our previous study, we proposed a objective measure, i.e., Booming Level for quantifying booming sensation caused by car interior noise. In this paper, Booming Level was modified with its weighting function and within the process of calculation 1/3 octave band level was modified for the best match with subjective result. These modifications were conducted through a subjective experiment rating booming sensation with sounds having much lower frequency contents below 63Hz. With this modified Booming Level, we have obtained higher correlation for rating booming sensation with sounds having prominent low frequency components. 1 ref., 10 figs.
Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP
Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and
Architecture of the 99 bp DNA-six-protein regulatory complex of the lambda att site.
Sun, Xingmin; Mierke, Dale F; Biswas, Tapan; Lee, Sang Yeol; Landy, Arthur; Radman-Livaja, Marta
2006-11-17
The highly directional and tightly regulated recombination reaction used to site-specifically excise the bacteriophage lambda chromosome out of its E. coli host chromosome requires the binding of six sequence-specific proteins to a 99 bp segment of the phage att site. To gain structural insights into this recombination pathway, we measured 27 FRET distances between eight points on the 99 bp regulatory DNA bound with all six proteins. Triangulation of these distances using a metric matrix distance-geometry algorithm provided coordinates for these eight points. The resulting path for the protein-bound regulatory DNA, which fits well with the genetics, biochemistry, and X-ray crystal structures describing the individual proteins and their interactions with DNA, provides a new structural perspective into the molecular mechanism and regulation of the recombination reaction and illustrates a design by which different families of higher-order complexes can be assembled from different numbers and combinations of the same few proteins.
The prenyl-binding protein PrBP/δ: a chaperone participating in intracellular trafficking.
Zhang, Houbin; Constantine, Ryan; Frederick, Jeanne M; Baehr, Wolfgang
2012-12-15
Expressed ubiquitously, PrBP/δ functions as chaperone/co-factor in the transport of a subset of prenylated proteins. PrBP/δ features an immunoglobulin-like β-sandwich fold for lipid binding, and interacts with diverse partners. PrBP/δ binds both C-terminal C15 and C20 prenyl side chains of phototransduction polypeptides and small GTP-binding (G) proteins of the Ras superfamily. PrBP/δ also interacts with the small GTPases, ARL2 and ARL3, which act as release factors (GDFs) for prenylated cargo. Targeted deletion of the mouse Pde6d gene encoding PrBP/δ resulted in impeded trafficking to the outer segments of GRK1 and cone PDE6 which are predicted to be farnesylated and geranylgeranylated, respectively. Rod and cone transducin trafficking was largely unaffected. These trafficking defects produce progressive cone-rod dystrophy in the Pde6d(-/-) mouse. Copyright © 2012 Elsevier Ltd. All rights reserved.
[Segmentation of whole body bone SPECT image based on BP neural network].
Zhu, Chunmei; Tian, Lianfang; Chen, Ping; He, Yuanlie; Wang, Lifei; Ye, Guangchun; Mao, Zongyuan
2007-10-01
In this paper, BP neural network is used to segment whole body bone SPECT image so that the lesion area can be recognized automatically. For the uncertain characteristics of SPECT images, it is hard to achieve good segmentation result if only the BP neural network is employed. Therefore, the segmentation process is divided into three steps: first, the optimal gray threshold segmentation method is employed for preprocessing, then BP neural network is used to roughly identify the lesions, and finally template match method and symmetry-removing program are adopted to delete the wrongly recognized areas.
Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W
1997-12-05
The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.
Electron-positron annihilation into hadrons at the higher-loop levels
Energy Technology Data Exchange (ETDEWEB)
Nesterenko, A.V. [Joint Institute for Nuclear Research, Bogoliubov Laboratory of Theoretical Physics, Dubna (Russian Federation)
2017-12-15
The strong corrections to the R-ratio of electron-positron annihilation into hadrons are studied at the higher-loop levels. Specifically, the derivation of a general form of the commonly employed approximate expression for the R-ratio (which constitutes its truncated re-expansion at high energies) is delineated, the appearance of the pertinent π{sup 2}-terms is expounded, and their basic features are examined. It is demonstrated that the validity range of such approximation is strictly limited to √(s)/Λ > exp(π/2) ≅ 4.81 and that it converges rather slowly when the energy scale approaches this value. The spectral function required for the proper calculation of the R-ratio is explicitly derived and its properties at the higher-loop levels are studied. The developed method of calculation of the spectral function enables one to obtain the explicit expression for the latter at an arbitrary loop level. By making use of the derived spectral function the proper expression for the R-ratio is calculated up to the five-loop level and its properties are examined. It is shown that the loop convergence of the proper expression for the R-ratio is better than that of its commonly employed approximation. The impact of the omitted higher-order π{sup 2}-terms on the latter is also discussed. (orig.)
Sanders, Dirk; Moser, Andrea; Newton, Jason; van Veen, F J Frank
2016-03-16
Trophic assimilation efficiency (conversion of resource biomass into consumer biomass) is thought to be a limiting factor for food chain length in natural communities. In host-parasitoid systems, which account for the majority of terrestrial consumer interactions, a high trophic assimilation efficiency may be expected at higher trophic levels because of the close match of resource composition of host tissue and the consumer's resource requirements, which would allow for longer food chains. We measured efficiency of biomass transfer along an aphid-primary-secondary-tertiary parasitoid food chain and used stable isotope analysis to confirm trophic levels. We show high efficiency in biomass transfer along the food chain. From the third to the fourth trophic level, the proportion of host biomass transferred was 45%, 65% and 73%, respectively, for three secondary parasitoid species. For two parasitoid species that can act at the fourth and fifth trophic levels, we show markedly increased trophic assimilation efficiencies at the higher trophic level, which increased from 45 to 63% and 73 to 93%, respectively. In common with other food chains, δ(15)N increased with trophic level, with trophic discrimination factors (Δ(15)N) 1.34 and 1.49‰ from primary parasitoids to endoparasitic and ectoparasitic secondary parasitoids, respectively, and 0.78‰ from secondary to tertiary parasitoids. Owing to the extraordinarily high efficiency of hyperparasitoids, cryptic higher trophic levels may exist in host-parasitoid communities, which could alter our understanding of the dynamics and drivers of community structure of these important systems. © 2016 The Authors.
Directory of Open Access Journals (Sweden)
Anna L Shen
Full Text Available We have previously described a mouse model of human posterior polymorphous corneal dystrophy (PPCD and localized the causative mutation to a 6.2 Mbp region of chromosome 2, termed Ppcd1. We now show that the gene rearrangement linked to mouse Ppcd1 is a 3.9 Mbp chromosomal inversion flanked by 81 Kbp and 542 bp deletions. This recombination event leads to deletion of Csrp2bp Exons 8 through 11, Dzank1 Exons 20 and 21, and the pseudogene Znf133. In addition, we identified translocation of novel downstream sequences to positions adjacent to Csrp2bp Exon 7 and Dzank1 Exon 20. Twelve novel fusion transcripts involving Csrp2bp or Dzank1 linked to downstream sequences have been identified. Eight are expressed at detectable levels in PPCD1 but not wildtype eyes. Upregulation of two Csrp2bp fusion transcripts, as well as upregulation of the adjacent gene, Ovol2, was observed. Absence of the PPCD1 phenotype in animals haploinsufficient for Csrp2bp or both Csrp2bp and Dzank1 rules out haploinsufficiency of these genes as a cause of mouse PPCD1. Complementation experiments confirm that PPCD1 embryonic lethality is due to disruption of Csrp2bp expression. The ocular expression pattern of Csrp2bp is consistent with a role for this protein in corneal development and pathogenesis of PPCD1.
Higher-level gait disorders: an open frontier.
Nutt, John G
2013-09-15
The term higher-level gait disorders (HLGD) defines a category of balance and gait disorders that are not explained by deficits in strength, tone, sensation, or coordination. HLGD are characterized by various combinations of disequilibrium and impaired locomotion. A plethora of new imaging techniques are beginning to determine the neural circuits that are the basis of these disorders. Although a variety of neurodegenerative and other pathologies can produce HLGD, the most common cause appears to be microvascular disease that causes white-matter lesions and thereby disrupts balance/locomotor circuits. © 2013 Movement Disorder Society.
Holocene sea-level fluctuation in the southern hemisphere
Isla, Federico Ignacio
If rising sea levels dominate in the northern hemisphere (NH), falling or fluctuating sea levels predominate in the southern hemisphere (SH). Endogenic processes (tectonics, isostasy or geoidal changes) could explain local or regional mean sea level (MSL) fluctuations but not an hemispherical one. Evidence from South America, Africa, Antarctica, Australia and the Pacific and Indian Oceans suggest that the Holocene transgression rose above the present MSL, in higher latitudes before the tropics. By plotting latitude against the age of MSL arrival at present coasts, good correlation is observed. Oceanic salinity mixing has been already proposed to explain this mid-Holocene sea-level fluctuation. Climate could be the only factor responsible for this hemisphere-wide behavior of MSL. It has been suggested previously that the climate of the SH precedes that of the NH by 3000 years. The climatic optimum, or maximum warmth, occurred predominantly about 6000 BP in the NH, but about 10-9000 BP in the SH. Short-term climatic effects on the sea level (monsoons, southern oscillation/El Niño phenomena) should have significant occurrences during the past in the windiest oceanic hemisphere. This latitudinal trend in former MSL should be considered when using shorelines as reference points for measuring vertical crustal movements.
Sahin, Figen Kir; Sahin, Serap Baydur; Ural, Ulku Mete; Cure, Medine Cumhur; Senturk, Senol; Tekin, Yesim Bayoglu; Balik, Gulsah; Cure, Erkan; Yuce, Suleyman; Kirbas, Aynur
2015-07-09
Obesity, insulin resistance (IR), inflammation, and hyperandrogenism may lead to polycystic ovary syndrome (PCOS) and hypertension. Nesfatin-1 (N1) may be related to IR, obesity, and hypertension. Furthermore, a vitamin D (VD) deficiency is associated with hypertension and PCOS. We aimed to investigate N1 and VD levels in PCOS that have an effect on systolic and diastolic blood pressure (BP) and heart rate (HR).This study included 54 patients with PCOS and 48 age-body mass index (BMI)-matched healthy controls. PCOS was diagnosed according to clinical practice guidelines. Ferriman-Gallwey scores (FGS) were calculated, while N1, VD, and other hormonal and biochemical parameters were measured for all subjects. Systolic and diastolic BP was measured as well. HR was calculated using an electrocardiogram.The levels of N1 (p < 0.001), high-sensitivity C-reactive protein (hs-CRP) (p = 0.036), homeostasis model assessment as an index of insulin resistance (HOMA-IR) (p < 0.001), systolic (p < 0.001) and diastolic (p < 0.001) BP and HR (p < 0.001) in the PCOS group were significantly higher than in the control group. However, the VD levels of the PCOS group were lower than the control group (p = 0.004). N1 had a strong positive correlation with BMI, HOMA-IR, hs-CRP, luteinizing hormone, systolic and diastolic BP, and HR. VD levels were negatively correlated with HOMA-IR and luteinizing hormone.Elevated N1 and decreased VD levels may be related to the presence of high-normal BP or hypertension in PCOS subjects. N1 level may be associated with an increased BP due to its relation to inflammation and IR.
A 31,000 year record of paleoenvironmental and lake-level change from Harding Lake, Alaska, USA
Finkenbinder, Matthew S.; Abbott, Mark B.; Edwards, Mary E.; Langdon, Catherine T.; Steinman, Byron A.; Finney, Bruce P.
2014-03-01
Physical and geochemical proxy analyses of sediment cores from Harding Lake in central Alaska are used to reconstruct paleoenvironmental change and millennial scale fluctuations in lake level for the last ˜31,000 years. We analyzed a composite 422 cm core from the lake depocenter (42.1 m water depth) and identified 4 distinct lithologic units based on variability in dry bulk density, organic matter, biogenic silica, carbon to nitrogen mass ratios (C/N), organic matter carbon isotopes (δ13C), pollen, and elemental abundances via scanning X-ray fluorescence, with age control provided by 16 Accelerator Mass Spectrometry radiocarbon dates and 210Pb dating. In addition, we analyzed a transect of cores from 7.1 m, 10.75 m, 15.91 m, and 38.05 m water depths to identify lake level fluctuations and to characterize sediment compositional changes as a function of water depth. Organic matter content and magnetic susceptibility values in surface sediments from all transect cores show a strong correlation with water depth. Interpretation of four lithologic units with well-dated contacts produced a record of water-depth variations that is consistent with independent climate records from eastern Beringia. Basal coarse-grained sediments (quartz pebble diamicton) were deposited prior to 30,700 calendar years before present (yr BP), possibly from fluvial reworking or deflation during a period of severe aridity. Unit 1 sediments were deposited between 30,700 and 15,700 yr BP and are characterized by a low organic matter content, a high magnetic susceptibility, and low biogenic silica concentrations resulting from very low lake levels, low terrestrial and in-lake productivity and a high flux of clastic sediment. An abrupt increase in organic matter and biogenic silica concentration marks the transition into Unit 2 sediments, which were deposited between 15,700 and 9,400 yr BP when lake levels were higher and variable (relative to Unit 1). The transition to full interglacial
BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme
Tamme, Jürgen
2010-01-01
Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart
EST Table: BP117517 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %
Directory of Open Access Journals (Sweden)
Hua Bai
Full Text Available Mutations of the insulin/IGF signaling (IIS pathway extend Drosophila lifespan. Based on genetic epistasis analyses, this longevity assurance is attributed to downstream effects of the FOXO transcription factor. However, as reported FOXO accounts for only a portion of the observed longevity benefit, suggesting there are additional outputs of IIS to mediate aging. One candidate is target of rapamycin complex 1 (TORC1. Reduced TORC1 activity is reported to slow aging, whereas reduced IIS is reported to repress TORC1 activity. The eukaryotic translation initiation factor 4E binding protein (4E-BP is repressed by TORC1, and activated 4E-BP is reported to increase Drosophila lifespan. Here we use genetic epistasis analyses to test whether longevity assurance mutants of chico, the Drosophila insulin receptor substrate homolog, require Drosophila d4eBP to slow aging. In chico heterozygotes, which are robustly long-lived, d4eBP is required but not sufficient to slow aging. Remarkably, d4eBP is not required or sufficient for chico homozygotes to extend longevity. Likewise, chico heterozygote females partially require d4eBP to preserve age-dependent locomotion, and both chico genotypes require d4eBP to improve stress-resistance. Reproduction and most measures of growth affected by either chico genotype are always independent of d4eBP. In females, chico heterozygotes paradoxically produce more rather than less phosphorylated 4E-BP (p4E-BP. Altered IRS function within the IIS pathway of Drosophila appears to have partial, conditional capacity to regulate aging through an unconventional interaction with 4E-BP.
MCM-BP regulates unloading of the MCM2–7 helicase in late S phase
Nishiyama, Atsuya; Frappier, Lori; Méchali, Marcel
2011-01-01
Origins of DNA replication are licensed by recruiting MCM2–7 to assemble the prereplicative complex (pre-RC). How MCM2–7 is inactivated or removed from chromatin at the end of S phase is still unclear. Here, we show that MCM-BP can disassemble the MCM2–7 complex and might function as an unloader of MCM2–7 from chromatin. In Xenopus egg extracts, MCM-BP exists in a stable complex with MCM7, but is not associated with the MCM2–7 hexameric complex. MCM-BP accumulates in nuclei in late S phase, well after the loading of MCM2–7 onto chromatin. MCM-BP immunodepletion in Xenopus egg extracts inhibits replication-dependent MCM dissociation without affecting pre-RC formation and DNA replication. When excess MCM-BP is incubated with Xenopus egg extracts or immunopurified MCM2–7, it binds to MCM proteins and promotes disassembly of the MCM2–7 complex. Recombinant MCM-BP also releases MCM2–7 from isolated late-S-phase chromatin, but this activity is abolished when DNA replication is blocked. MCM-BP silencing in human cells also delays MCM dissociation in late S phase. We propose that MCM-BP plays a key role in the mechanism by which pre-RC is cleared from replicated DNA in vertebrate cells. PMID:21196493
A central role for R7bp in the regulation of itch sensation.
Pandey, Mritunjay; Zhang, Jian-Hua; Mishra, Santosh K; Adikaram, Poorni R; Harris, Benjamin; Kahler, John F; Loshakov, Anna; Sholevar, Roxanne; Genis, Allison; Kittock, Claire; Kabat, Juraj; Ganesan, Sundar; Neubig, Richard R; Hoon, Mark A; Simonds, William F
2017-05-01
Itch is a protective sensation producing a desire to scratch. Pathologic itch can be a chronic symptom of illnesses such as uremia, cholestatic liver disease, neuropathies and dermatitis, however current therapeutic options are limited. Many types of cell surface receptors, including those present on cells in the skin, on sensory neurons and on neurons in the spinal cord, have been implicated in itch signaling. The role of G protein signaling in the regulation of pruriception is poorly understood. We identify here 2 G protein signaling components whose mutation impairs itch sensation. R7bp (a.k.a. Rgs7bp) is a palmitoylated membrane anchoring protein expressed in neurons that facilitates Gαi/o -directed GTPase activating protein activity mediated by the Gβ5/R7-RGS complex. Knockout of R7bp diminishes scratching responses to multiple cutaneously applied and intrathecally-administered pruritogens in mice. Knock-in to mice of a GTPase activating protein-insensitive mutant of Gαo (Gnao1 G184S/+) produces a similar pruriceptive phenotype. The pruriceptive defect in R7bp knockout mice was rescued in double knockout mice also lacking Oprk1, encoding the G protein-coupled kappa-opioid receptor whose activation is known to inhibit itch sensation. In a model of atopic dermatitis (eczema), R7bp knockout mice showed diminished scratching behavior and enhanced sensitivity to kappa opioid agonists. Taken together, our results indicate that R7bp is a key regulator of itch sensation and suggest the potential targeting of R7bp-dependent GTPase activating protein activity as a novel therapeutic strategy for pathological itch.
CacyBP/SIP binds ERK1/2 and affects transcriptional activity of Elk-1
International Nuclear Information System (INIS)
Kilanczyk, Ewa; Filipek, Slawomir; Jastrzebska, Beata; Filipek, Anna
2009-01-01
In this work we showed for the first time that mouse CacyBP/SIP interacts with extracellular signal regulated kinases 1 and 2 (ERK1/2). We also established that a calcium binding protein, S100A6, competes for this interaction. Moreover, the E217K mutant of CacyBP/SIP does not bind significantly to ERK1/2 although it retains the ability to interact with S100A6. Molecular modeling shows that the E217K mutation in the 189-219 CacyBP/SIP fragment markedly changes its electrostatic potential, suggesting that the binding with ERK1/2 might have an electrostatic character. We also demonstrate that CacyBP/SIP-ERK1/2 interaction inhibits phosphorylation of the Elk-1 transcription factor in vitro and in the nuclear fraction of NB2a cells. Altogether, our data suggest that the binding of CacyBP/SIP with ERK1/2 might regulate Elk-1 phosphorylation/transcriptional activity and that S100A6 might further modulate this effect via Ca 2+ -dependent interaction with CacyBP/SIP and competition with ERK1/2.
BP and sustainable development and biodiversity in Azerbaijan
International Nuclear Information System (INIS)
Grant, Vidrine; Askerov, Faig
2002-01-01
Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in
TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells
DEFF Research Database (Denmark)
Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob
2015-01-01
mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...
BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.
Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo
2011-10-01
To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.
EST Table: BP124521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP123885 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125106 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1
EST Table: BP125521 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP125005 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1
EST Table: BP121749 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121749 ceN-5256 10/09/28 100 %/172 aa ref|NP_001036831.1| saposin-related [Bombyx...|GB16561-PA 10/09/10 44 %/178 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...
EST Table: BP121763 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121763 ceN-5273 10/09/28 99 %/184 aa ref|NP_001036831.1| saposin-related [Bombyx ...GB16561-PA 10/09/10 43 %/192 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...
Magnetoresistance Effect in NiFe/BP/NiFe Vertical Spin Valve Devices
Directory of Open Access Journals (Sweden)
Leilei Xu
2017-01-01
Full Text Available Two-dimensional (2D layered materials such as graphene and transition metal dichalcogenides are emerging candidates for spintronic applications. Here, we report magnetoresistance (MR properties of a black phosphorus (BP spin valve devices consisting of thin BP flakes contacted by NiFe ferromagnetic (FM electrodes. The spin valve effect has been observed from room temperature to 4 K, with MR magnitudes of 0.57% at 4 K and 0.23% at 300 K. In addition, the spin valve resistance is found to decrease monotonically as temperature is decreased, indicating that the BP thin film works as a conductive interlayer between the NiFe electrodes.
IntCal04 terrestrial radiocarbon age calibration, 0-26 cal kyr BP
Reimer, Paula J.; Baillie, Mike G.L.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, R. Lawrence; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Hogg, Alan G.; Hughen, Konrad A.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
A new calibration curve for the conversion of radiocarbon ages to calibrated (cal) ages has been constructed and internationally ratified to replace IntCal98, which extended from 0–24 cal kyr BP (Before Present, 0 cal BP = AD 1950). The new calibration data set for terrestrial samples extends from
BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer
Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.
2010-01-01
Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436
Cerebrospinal fluid cortisol levels are higher in patients with delirium versus controls
Directory of Open Access Journals (Sweden)
White Timothy O
2010-02-01
Full Text Available Abstract Background High plasma cortisol levels can cause acute cognitive and neuropsychiatric dysfunction, and have been linked with delirium. CSF cortisol levels more closely reflect brain exposure to cortisol, but there are no studies of CSF cortisol levels in delirium. In this pilot study we acquired CSF specimens at the onset of spinal anaesthesia in patients undergoing hip fracture surgery, and compared CSF and plasma cortisol levels in delirium cases versus controls. Findings Delirium assessments were performed the evening before or on the morning of operation with a standard battery comprising cognitive tests, mental status assessments and the Confusion Assessment Method. CSF and plasma samples were obtained at the onset of the operation and cortisol levels measured. Twenty patients (15 female, 5 male aged 62 - 93 years were studied. Seven patients were diagnosed with delirium. The mean ages of cases (81.4 (SD 7.2 and controls (80.5 (SD 8.7 were not significantly different (p = 0.88. The median (interquartile range CSF cortisol levels were significantly higher in cases (63.9 (40.4-102.1 nmol/L than controls (31.4 (21.7-43.3 nmol/L; Mann-Whitney U, p = 0.029. The median (interquartile range of plasma cortisol was also significantly higher in cases (968.8 (886.2-1394.4 nmol/L, than controls (809.4 (544.0-986.4 nmol/L; Mann Whitney U, p = 0.036. Conclusions These findings support an association between higher CSF cortisol levels and delirium. This extends previous findings linking higher plasma cortisol and delirium, and suggests that more definitive studies of the relationship between cortisol levels and delirium are now required.
Blom, Kimberly C; Farina, Sasha; Gomez, Yessica-Haydee; Campbell, Norm R C; Hemmelgarn, Brenda R; Cloutier, Lyne; McKay, Donald W; Dawes, Martin; Tobe, Sheldon W; Bolli, Peter; Gelfer, Mark; McLean, Donna; Bartlett, Gillian; Joseph, Lawrence; Featherstone, Robin; Schiffrin, Ernesto L; Daskalopoulou, Stella S
2015-04-01
Despite progress in automated blood pressure measurement (BPM) technology, there is limited research linking hard outcomes to automated office BPM (OBPM) treatment targets and thresholds. Equivalences for automated BPM devices have been estimated from approximations of standardized manual measurements of 140/90 mmHg. Until outcome-driven targets and thresholds become available for automated measurement methods, deriving evidence-based equivalences between automated methods and standardized manual OBPM is the next best solution. The MeasureBP study group was initiated by the Canadian Hypertension Education Program to close this critical knowledge gap. MeasureBP aims to define evidence-based equivalent values between standardized manual OBPM and automated BPM methods by synthesizing available evidence using a systematic review and individual subject-level data meta-analyses. This manuscript provides a review of the literature and MeasureBP study protocol. These results will lay the evidenced-based foundation to resolve uncertainties within blood pressure guidelines which, in turn, will improve the management of hypertension.
Azaki, Alaa; Diab, Reem; Harb, Aya; Asmar, Roland; Chahine, Mirna N
2017-01-01
Two oscillometric devices, the Microlife WatchBP O3 ® and the Omron RS6 ® , designed for self-blood pressure measurement were evaluated according to the European Society of Hypertension (ESH)-International Protocol (IP) Revision 2010 in the obese population. The Microlife WatchBP O3 measures blood pressure (BP) at the brachial level and the Omron RS6 measures BP at the wrist level. The ESH-IP revision 2010 includes a total of 33 subjects. The difference between observers' and device BP values was calculated for each measure. A total of 99 pairs of BP differences were classified into three categories (≤5, ≤10, and ≤15 mmHg). The protocol procedures were followed precisely in each of the two studies. Microlife WatchBP O3 and Omron RS6 failed to fulfill the criteria of the ESH-IP. The mean differences between the device and the mercury readings were: 0.3±7.8 mmHg and -1.9±6.4 mmHg for systolic BP and diastolic BP, respectively, for Microlife WatchBP O3, and 2.7±9.9 mmHg for SBP and 3.5±11.1 mmHg for diastolic BP for Omron RS6. Microlife WatchBP O3 and Omron RS6 readings differing from the mercury standard by more than 5, 10, and 15 mmHg failed to fulfill the ESH-IP revision 2010 requirements in obese subjects. Therefore, the two devices cannot be recommended for use in obese subjects.
Storytelling in the digital world: achieving higher-level learning objectives.
Schwartz, Melissa R
2012-01-01
Nursing students are not passive media consumers but instead live in a technology ecosystem where digital is the language they speak. To prepare the next generation of nurses, educators must incorporate multiple technologies to improve higher-order learning. The author discusses the evolution and use of storytelling as part of the digital world and how digital stories can be aligned with Bloom's Taxonomy so that students achieve higher-level learning objectives.
EST Table: BP182610 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP182610 NRPG0829 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 NRPG ...
Directory of Open Access Journals (Sweden)
Christian eBarbato
2014-02-01
Full Text Available Neurodegeneration associated with amyloid β (Aβ peptide accumulation, synaptic loss, and memory impairment are pathophysiological features of Alzheimer's disease (AD. Numerous microRNAs regulate amyloid precursor protein (APP expression and metabolism. We previously reported that miR-101 is a negative regulator of APP expression in cultured hippocampal neurons. In this study, a search for predicted APP metabolism-associated miR-101 targets led to the identification of a conserved miR-101 binding site within the 3’ untranslated region (UTR of the mRNA encoding Ran-binding protein 9 (RanBP9. RanBP9 increases APP processing by β-amyloid converting enzyme 1 (BACE1, secretion of soluble APPβ (sAPPβ, and generation of Aβ. MiR-101 significantly reduced reporter gene expression when co-transfected with a RanBP9 3'-UTR reporter construct, while site-directed mutagenesis of the predicted miR-101 target site eliminated the reporter response. To investigate the effect of stable inhibition of miR-101 both in vitro and in vivo, a microRNA sponge was developed to bind miR-101 and derepress its targets. Four tandem bulged miR-101 responsive elements (REs, located downstream of the enhanced green fluorescence protein (EGFP open reading frame and driven by the synapsin promoter, were placed in a lentiviral vector to create the pLSyn-miR-101 sponge. Delivery of the sponge to primary hippocampal neurons significantly increased both APP and RanBP9 expression, as well as sAPPβ levels in the conditioned medium. Importantly, silencing of endogenous RanBP9 reduced sAPPβ levels in miR-101 sponge-containing hippocampal cultures, indicating that miR-101 inhibition may increase amyloidogenic processing of APP by RanBP9. Lastly, the impact of miR-101 on its targets was demonstrated in vivo by intrahippocampal injection of the pLSyn-miR-101 sponge into C57BL6 mice. This study thus provides the basis for studying the consequences of long-term miR-101 inhibition on
Ion-beam-induced reactions in metal-thin-film-/BP system
International Nuclear Information System (INIS)
Kobayashi, N.; Kumashiro, Y.; Revesz, P.; Mayer, J.W.
1989-01-01
Ion-beam-induced reactions in Ni thin films on BP(100) have been investigated and compared with the results of the thermal reaction. The full reaction of Ni layer with BP induced by energetic heavy ion bombardments (600 keV Xe) was observed at 200degC and the formation of the crystalline phase corresponding to a composition of Ni 4 BP was observed. Amorphous layer with the same composition was formed by the bombardments below RT. For thermally annealed samples the reaction of the Ni layer on BP started at temperatures between 350degC and 400degC and full reaction was observed at 450degC. Metal-rich ternary phase or mixed binary phase is thought to be the first crystalline phase formed both in the ion-beam-induced and in the thermally induced reactions. The crystalline phase has the same composition and X-ray diffraction pattern both for ion-beam-induced and thermal reactions. Linear dependence of the reacted thickness on the ion fluence was also observed. The authors would like to express their sincere gratitude to Jian Li and Shi-Qing Wang for X-ray diffraction measurements at Cornell University. One of the authors (N.K.) acknowledge the Agency of Science and Technology of Japan for the financial support of his stay at Cornell. We also acknowledge Dr. H. Tanoue at ETL for his help in ion bombardment experiments. (author)
Mutant p53 perturbs DNA replication checkpoint control through TopBP1 and Treslin.
Liu, Kang; Lin, Fang-Tsyr; Graves, Joshua D; Lee, Yu-Ju; Lin, Weei-Chin
2017-05-09
Accumulating evidence supports the gain-of-function of mutant forms of p53 (mutp53s). However, whether mutp53 directly perturbs the DNA replication checkpoint remains unclear. Previously, we have demonstrated that TopBP1 forms a complex with mutp53s and mediates their gain-of-function through NF-Y and p63/p73. Akt phosphorylates TopBP1 and induces its oligomerization, which inhibits its ATR-activating function. Here we show that various contact and conformational mutp53s bypass Akt to induce TopBP1 oligomerization and attenuate ATR checkpoint response during replication stress. The effect on ATR response caused by mutp53 can be exploited in a synthetic lethality strategy, as depletion of another ATR activator, DNA2, in mutp53-R273H-expressing cancer cells renders cells hypersensitive to cisplatin. Expression of mutp53-R273H also makes cancer cells more sensitive to DNA2 depletion or DNA2 inhibitors. In addition to ATR-activating function during replication stress, TopBP1 interacts with Treslin in a Cdk-dependent manner to initiate DNA replication during normal growth. We find that mutp53 also interferes with TopBP1 replication function. Several contact, but not conformational, mutp53s enhance the interaction between TopBP1 and Treslin and promote DNA replication despite the presence of a Cdk2 inhibitor. Together, these data uncover two distinct mechanisms by which mutp53 enhances DNA replication: ( i ) Both contact and conformational mutp53s can bind TopBP1 and attenuate the checkpoint response to replication stress, and ( ii ) during normal growth, contact (but not conformational) mutp53s can override the Cdk2 requirement to promote replication by facilitating the TopBP1/Treslin interaction.
M, Salahuddin; Ah, Sayed Ashfak; Sr, Syed; Km, Badaam
2014-03-01
Ramadan fasting is a religious obligation which is practised by Muslim population all over the world. However, there is scarcity of scientific literature regarding its effects on health determinants in cardiovascular disturbances like hypertension. The present study was done to assess the (BP), body weight and serum cholesterol changes over the period of Ramadan fasting in patients with hypertension. Materails And Methods:This prospective observational trial was done on 15 hypertensive subjects who were in the age group of 35 to 65 years, who were determined to complete Ramadan fast. All subjects were on antihypertensive therapy. Outcome measures of (BP), body weight and serum cholesterol were assessed in all the subjects before and after Ramadan month. Mean age of subjects was 44.6 ± 5.62 years. Systolic BP decreased from 148 ± 19.6 to 132.5 ± 17.9 mm of Hg. The decrease of 15.5 units (95% CI: 7.5 to 24.4) was statistically significant (p = 0.0009). Diastolic BP decreased from 90.4 ± 7.8 to 81.1 ± 6.3 mm of Hg. The decrease of 9.3 units (95% CI: 5.7 to 13) was statistically significant (p Ramadan fasting duration. However there was no change found in serum cholesterol levels.
Ma, Jun; Wang, Zhiqiang; Dong, Bin; Song, Yi; Hu, Peijin; Zhang, Bing
2012-11-14
Children in China are experiencing a rapid increase in the prevalence of obesity, which is associated with hypertension. To compare the effect of body fat on blood pressure (BP) with that of the normal physical growth, we compared BP levels in Chinese children with different body fat levels. In the present population-based study, 13 972 children in the highest-skinfold-thickness-quartile group were individually matched to 13 972 children in the lowest-skinfold-thickness-quartile group by height and weight. Similarly, 5103 children in the highest-waist-circumference-quartile group were matched to the same number of children in the lowest-waist-circumference-quartile group. The high- and low-fat groups had similar height and weight but the high-fat group had significantly higher skinfold and waist circumference measurements. The differences in systolic BP (SBP) between the high- and low-skinfold-thickness groups were small: 0·01 (95 % CI -0·41, 0·44) mmHg in boys and 0·20 (95 % CI -0·15, 0·54) mmHg in girls. The differences in diastolic BP (DBP) were also small (0·39 and 0·38 mmHg for boys and girls, respectively) but were statistically significant. The differences in both SBP and DBP between the high- and low-waist-circumference groups were small but not statistically significant. For a given body size as measured by height and weight, relative body fat had little impact on BP levels in these children. Fat mass and lean mass may have a similar quantitative impact on BP in healthy-weight children.
DEFF Research Database (Denmark)
Jeppesen, Jørgen L; Nielsen, Søren J; Torp-Pedersen, Christian
2012-01-01
-h ambulatory BP measurements (ABPMs) will influence the effect of NP gene variations on BP levels.MethodsWe used rs632793 at the NPPB (NP precursor B) locus to investigate the relationship between genetically determined serum N-terminal pro-brain NP (NT-proBNP) concentrations and BP levels...... determined by both 24-h ABPMs and OBPMs in a population consisting of 1,397 generally healthy individuals taking no BP-lowering drugs.Resultsrs632793 was significantly correlated with serum Nt-proBNP levels (r = 0.10, P = 0.0003), and participants with the A:A genotype had lower serum Nt-proBNP levels than......). Office BP decreased across the genotypes from A:A to G:G, but the differences did not reach statistical significance (P = 0.12).ConclusionsThis study suggests that 24-h ABPMs is a better method than OBPMs to detect significant differences in BP levels related to genetic variance and provides further...
Egyptian greenhouse cultivation at a higher level with Dutch Technology ; Annual Report 2013
Elings, A.; Helm, van der F.P.M.; Blok, C.; Meijer, R.J.M.; Lahiani, Y.; Janmaat, A.; Zaki, M.; Hassan, H.
2014-01-01
The project ‘Egyptian greenhouse cultivation at a higher level with Dutch technology’ is co-funded under the Top Sector Programme Horticulture and Starting Materials. The project wants to realizes through the use of Dutch technology a higher level of sustainability of Egyptian protected cultivation,
Cabinet chooses TNK-BP, but doors remain open
2005-01-01
Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega
Last Interglacial climate and sea-level evolution from a coupled ice sheet-climate model
Goelzer, Heiko; Huybrechts, Philippe; Marie-France, Loutre; Fichefet, Thierry
2016-01-01
As the most recent warm period in Earth's history with a sea-level stand higher than present, the Last Interglacial (LIG, ∼130 to 115kyrgBP) is often considered a prime example to study the impact of a warmer climate on the two polar ice sheets remaining today. Here we simulate the Last Interglacial
Phase 1 remedial investigation report for 200-BP-1 operable unit
International Nuclear Information System (INIS)
1993-09-01
The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit
Liu, Fenghong; Wang, Lei; Gu, Liang; Zhao, Wei; Su, Hongyan; Cheng, Xianhao
2015-12-01
In our preliminary study, the ripe fruits of two highbush blueberry (Vaccinium corymbosum L.) cultivars, cv 'Berkeley' and cv 'Bluecrop', were found to contain different levels of ascorbic acid. However, factors responsible for these differences are still unknown. In the present study, ascorbic acid content in fruits was compared with expression profiles of ascorbic acid biosynthetic and recycling genes between 'Bluecrop' and 'Berkeley' cultivars. The results indicated that the l-galactose pathway was the predominant route of ascorbic acid biosynthesis in blueberry fruits. Moreover, higher expression levels of the ascorbic acid biosynthetic genes GME, GGP, and GLDH, as well as the recycling genes MDHAR and DHAR, were associated with higher ascorbic acid content in 'Bluecrop' compared with 'Berkeley', which indicated that a higher efficiency ascorbic acid biosynthesis and regeneration was likely to be responsible for the higher ascorbic acid accumulation in 'Bluecrop'. Copyright © 2015 Elsevier Ltd. All rights reserved.
Kario, Kazuomi; James, Gary D; Marion, RoseMerie; Ahmed, Mustafa; Pickering, Thomas G
2002-07-01
The purpose of this study was to examine the effects of self-reported perceived stress at work and home on the levels, variation and co-variation of ambulatory blood pressure (BP), pulse rate (PR) and urinary catecholamine, cortisol, and aldosterone excretion measured at work, home and during sleep in women employed outside the home. The subjects of the study were 134 women (mean age 34.4 +/- 9.6 years, range 18 to 64 years) who were employed in managerial, technical or clerical positions at the same work place. Perceived stress at work and home was self-reported on a scale from 0 (low) to 10 (high). BP, PR and the urinary rates of excretion of epinephrine, norepinephrine, cortisol and aldosterone were averaged in the daily work environment from 11 AM to 3 PM, in the daily home environment from approximately 6 PM to 10 PM, and during sleep from approximately 10 PM to 6 AM the following morning. The results showed that systolic and diastolic BP (SBP and DBP) and the rates of urinary catecholamine, cortisol, and aldosterone excretion measured in the work environment were significantly higher than corresponding measurements taken in the home environment. SBP measured at work was also positively correlated with the difference in perceived stress between work and home (p home environment were positively correlated with stress at home. When the subjects were divided into groups based on whether the work or home environment was perceived to be most stressful, women reporting greater stress at work (n=85) had higher work SBP (p work DBP (p home environment to be more stressful (n=34). There were no differences in the urinary hormonal excretion rates between these perceived-stress groups. Among women with greater perceived stress at home, the home-stress score was positively correlated with sleep SBP level (r = 0.310, p home pulse rate ( r= 0.414, p work stress may increase ambulatory BP levels throughout the day, while home stress may induce additional sympathetic
EST Table: BP121050 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP121050 ceN-4078 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 ceN- ...
Breakout Prediction Based on BP Neural Network in Continuous Casting Process
Directory of Open Access Journals (Sweden)
Zhang Ben-guo
2016-01-01
Full Text Available An improved BP neural network model was presented by modifying the learning algorithm of the traditional BP neural network, based on the Levenberg-Marquardt algorithm, and was applied to the breakout prediction system in the continuous casting process. The results showed that the accuracy rate of the model for the temperature pattern of sticking breakout was 96.43%, and the quote rate was 100%, that verified the feasibility of the model.
BP-Mobil partnership. The common network takes place
International Nuclear Information System (INIS)
Anon.
1997-01-01
After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)
INTCAL09 AND MARINE09 RADIOCARBON AGE CALIBRATION CURVES, 0-50,000 YEARS CAL BP
Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.
2009-01-01
The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and
Angiogenenic effects of BpLec, a C-type lectin isolated from Bothrops pauloensis snake venom.
Castanheira, Letícia Eulalio; Lopes, Daiana Silva; Gimenes, Sarah Natalie Cirilo; Deconte, Simone Ramos; Ferreira, Bruno Antônio; Alves, Patricia Terra; Filho, Luiz Ricardo Goulart; Tomiosso, Tatiana Carla; Rodrigues, Renata Santos; Yoneyama, Kelly Aparecida Geraldo; Araújo, Fernanda de Assis; Rodrigues, Veridiana de Melo
2017-09-01
The present work reports the effects of a C-type lectin (BpLec) isolated from Bothrops pauloensis snake venom upon in vitro and in vivo angiogenesis models. Initially, we noted that BpLec was not cytotoxic to endothelial cells (tEnd) in doses up to 40μg/mL, but lower doses (2.5μg/mL, 5μg/mL, 10μg/mL and 20μg/mL) reduced tEnd cells adhesion to some extracellular matrix proteins and inhibited the in vitro vessel formation in Matrigel assay stimulated by bFGF. β-galactosides (d-lactose, N-acetyl-d-galactosamine and d-galactose) at 400mM reversed the effect of BpLec on tEnd cells adhesion, whereas d-galactose (400mM) partially reversed BpLec property of inhibiting vessel formation by tEnd cells in Matrigel. In vivo assays showed that BpLec increased hemoglobin content and capillary vessels number in polyether-polyurethane sponge discs subcutaneously implanted into dorsal skin mice. Additionally, BpLec also reduced collagen deposition and did not induce a pro-inflammatory response, as demonstrated by the decreased the secretion of some inflammatory cytokines, whereas myeloperoxidase (MPO) and N-acetylglucosaminidase (NAG) activities were not altered by BpLec. Taken together, our results indicate that BpLec might represent an interesting angiogenesis and inflammatory modulator that could also be used for searching possible therapeutic targets involved in these processes. Copyright © 2017 Elsevier B.V. All rights reserved.
GEMC1 is a TopBP1 interacting protein required for chromosomal DNA replication
Balestrini, Alessia; Cosentino, Claudia; Errico, Alessia; Garner, Elizabeth; Costanzo, Vincenzo
2010-01-01
Many factors required for chromosomal DNA replication have been identified in unicellular eukaryotes. However, DNA replication in complex multicellular organisms is poorly understood. Here, we report the identification of GEMC1, a novel vertebrate protein required for chromosomal DNA replication. GEMC1 is highly conserved in vertebrates and is preferentially expressed in proliferating cells. Using Xenopus egg extract we show that Xenopus GEMC1 (xGEMC1) binds to checkpoint and replication factor TopBP1, which promotes xGEMC1 binding to chromatin during pre-replication complex (pre-RC) formation. We demonstrate that xGEMC1 directly interacts with replication factors such as Cdc45 and Cdk2-CyclinE by which it is heavily phosphorylated. Phosphorylated xGEMC1 stimulates initiation of DNA replication whereas depletion of xGEMC1 prevents DNA replication onset due to impairment of Cdc45 loading onto chromatin. Likewise, inhibition of GEMC1 expression by morpholino and siRNA oligos prevents DNA replication in embryonic and somatic vertebrate cells. These data suggest that GEMC1 promotes initiation of chromosomal DNA replication in higher eukaryotes by mediating TopBP1 and Cdk2 dependent recruitment of Cdc45 onto replication origins. PMID:20383140
Moreno, Heriberto; Linford, Alicia S; Gilchrist, Carol A; Petri, William A
2010-05-01
The Entamoeba histolytica upstream regulatory element 3-binding protein (URE3-BP) is a transcription factor that binds DNA in a Ca(2+)-inhibitable manner. The protein is located in both the nucleus and the cytoplasm but has also been found to be enriched in the plasma membrane of amebic trophozoites. We investigated the reason for the unusual localization of URE3-BP at the amebic plasma membrane. Here we identify and characterize a 22-kDa Ca(2+)-dependent binding partner of URE3-BP, EhC2A, a novel member of the C2-domain superfamily. Immunoprecipitations of URE3-BP and EhC2A showed that the proteins interact and that such interaction was enhanced in the presence of Ca(2+). Recombinant and native EhC2A bound phospholipid liposomes in a Ca(2+)-dependent manner, with half-maximal binding occurring at 3.4 muM free Ca(2+). A direct interaction between EhC2A and URE3-BP was demonstrated by the ability of recombinant EhC2A to recruit recombinant URE3-BP to phospholipid liposomes in a Ca(2+)-dependent manner. URE3-BP and EhC2A were observed to translocate to the amebic plasma membrane upon an increase in the intracellular Ca(2+) concentration of trophozoites, as revealed by subcellular fractionation and immunofluorescent staining. Short hairpin RNA-mediated knockdown of EhC2A protein expression significantly modulated the mRNA levels of URE3-BP-regulated transcripts. Based on these results, we propose a model for EhC2A-mediated regulation of the transcriptional activities of URE3-BP via Ca(2+)-dependent anchoring of the transcription factor to the amebic plasma membrane.
Directory of Open Access Journals (Sweden)
Jaime Gosálvez
2013-02-01
Full Text Available We aimed to evaluate the association between the progressive stages of cervical neoplasia and DNA damage in 5-bp classical satellite DNA sequences from chromosome-1 in cervical epithelium and in peripheral blood lymphocytes using DNA breakage detection/fluorescence in situ hybridization (DBD-FISH. A hospital-based unmatched case-control study was conducted in 2011 with a sample of 30 women grouped according to disease stage and selected according to histological diagnosis; 10 with low-grade squamous intraepithelial lesions (LG-SIL, 10 with high-grade SIL (HG-SIL, and 10 with no cervical lesions, from the Unidad Medica de Alta Especialidad of The Mexican Social Security Institute, IMSS, Mexico. Specific chromosome damage levels in 5-bp classical satellite DNA sequences from chromosome-1 were evaluated in cervical epithelium and peripheral blood lymphocytes using the DBD-FISH technique. Whole-genome DNA hybridization was used as a reference for the level of damage. Results of Kruskal-Wallis test showed a significant increase according to neoplastic development in both tissues. The instability of 5-bp classical satellite DNA sequences from chromosome-1 was evidenced using chromosome-orientation FISH. In conclusion, we suggest that the progression to malignant transformation involves an increase in the instability of 5-bp classical satellite DNA sequences from chromosome-1.
Cortés-Gutiérrez, Elva I; Ortíz-Hernández, Brenda L; Dávila-Rodríguez, Martha I; Cerda-Flores, Ricardo M; Fernández, José Luis; López-Fernández, Carmen; Gosálvez, Jaime
2013-02-19
We aimed to evaluate the association between the progressive stages of cervical neoplasia and DNA damage in 5-bp classical satellite DNA sequences from chromosome-1 in cervical epithelium and in peripheral blood lymphocytes using DNA breakage detection/fluorescence in situ hybridization (DBD-FISH). A hospital-based unmatched case-control study was conducted in 2011 with a sample of 30 women grouped according to disease stage and selected according to histological diagnosis; 10 with low-grade squamous intraepithelial lesions (LG-SIL), 10 with high-grade SIL (HG-SIL), and 10 with no cervical lesions, from the Unidad Medica de Alta Especialidad of The Mexican Social Security Institute, IMSS, Mexico. Specific chromosome damage levels in 5-bp classical satellite DNA sequences from chromosome-1 were evaluated in cervical epithelium and peripheral blood lymphocytes using the DBD-FISH technique. Whole-genome DNA hybridization was used as a reference for the level of damage. Results of Kruskal-Wallis test showed a significant increase according to neoplastic development in both tissues. The instability of 5-bp classical satellite DNA sequences from chromosome-1 was evidenced using chromosome-orientation FISH. In conclusion, we suggest that the progression to malignant transformation involves an increase in the instability of 5-bp classical satellite DNA sequences from chromosome-1.
Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network
Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan
2018-01-01
In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.
TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells
Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob
2015-01-01
Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin recruitment of SLX4 and by facilitating unscheduled DNA synthesis. PMID:26283799
High-resolution records of thermocline in the Okinawa Trough since about 10000 aBP
Institute of Scientific and Technical Information of China (English)
无
2001-01-01
The present paper uses planktonic foraminifera and their stableisotopes to study the changes in the depth of thermocline (DOT) in the Okinawa Trough since the last 10000 a based on the analysis of Core B-3GC in the northern Okinawa Trough, together with that of the core in the southern Okinawa Trough. As results show, the thermocline was shallow before 6400 aBP, and deepened afterward, then became shallow again from 4000 to 2000 aBP. The DOT fluctuations display a positive correlation with those of sea surface temperature (SST). In addition, the changes in the northern Okinawa Trough are similar to those in the southern trough, implying a possible connection with the variation of the Kuroshio Current. The changes of SST and DOT suggest that the Kuroshio Current changed its intensity or main axis from 4000 to 2000 aBP and around about 6400 aBP respectively. Moreover, the changes of DOT from 8200 to 6400 aBP may indicate a gradual intensification of the Kuroshio Current.
Higher fuel prices are associated with lower air pollution levels.
Barnett, Adrian G; Knibbs, Luke D
2014-05-01
Air pollution is a persistent problem in urban areas, and traffic emissions are a major cause of poor air quality. Policies to curb pollution levels often involve raising the price of using private vehicles, for example, congestion charges. We were interested in whether higher fuel prices were associated with decreased air pollution levels. We examined an association between diesel and petrol prices and four traffic-related pollutants in Brisbane from 2010 to 2013. We used a regression model and examined pollution levels up to 16 days after the price change. Higher diesel prices were associated with statistically significant short-term reductions in carbon monoxide and nitrogen oxides. Changes in petrol prices had no impact on air pollution. Raising diesel taxes in Australia could be justified as a public health measure. As raising taxes is politically unpopular, an alternative political approach would be to remove schemes that put a downward pressure on fuel prices, such as industry subsidies and shopping vouchers that give fuel discounts. Copyright © 2014 Elsevier Ltd. All rights reserved.
Based on BP Neural Network Stock Prediction
Liu, Xiangwei; Ma, Xin
2012-01-01
The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…
Porcine SOX9 Gene Expression Is Influenced by an 18 bp Indel in the 5'-Untranslated Region.
Directory of Open Access Journals (Sweden)
Bertram Brenig
Full Text Available Sex determining region Y-box 9 (SOX9 is an important regulator of sex and skeletal development and is expressed in a variety of embryonal and adult tissues. Loss or gain of function resulting from mutations within the coding region or chromosomal aberrations of the SOX9 locus lead to a plethora of detrimental phenotypes in humans and animals. One of these phenotypes is the so-called male-to-female or female-to-male sex-reversal which has been observed in several mammals including pig, dog, cat, goat, horse, and deer. In 38,XX sex-reversal French Large White pigs, a genome-wide association study suggested SOX9 as the causal gene, although no functional mutations were identified in affected animals. However, besides others an 18 bp indel had been detected in the 5'-untranslated region of the SOX9 gene by comparing affected animals and controls. We have identified the same indel (Δ18 between position +247 bp and +266 bp downstream the transcription start site of the porcine SOX9 gene in four other pig breeds; i.e., German Large White, Laiwu Black, Bamei, and Erhualian. These animals have been genotyped in an attempt to identify candidate genes for porcine inguinal and/or scrotal hernia. Because the 18 bp segment in the wild type 5'-UTR harbours a highly conserved cAMP-response element (CRE half-site, we analysed its role in SOX9 expression in vitro. Competition and immunodepletion electromobility shift assays demonstrate that the CRE half-site is specifically recognized by CREB. Both binding of CREB to the wild type as well as the absence of the CRE half-site in Δ18 reduced expression efficiency in HEK293T, PK-15, and ATDC5 cells significantly. Transfection experiments of wild type and Δ18 SOX9 promoter luciferase constructs show a significant reduction of RNA and protein levels depending on the presence or absence of the 18 bp segment. Hence, the data presented here demonstrate that the 18 bp indel in the porcine SOX9 5'-UTR is of functional
Quantitative analysis of the interplay between hsc70 and its co-chaperone HspBP1
Directory of Open Access Journals (Sweden)
Hicham Mahboubi
2015-12-01
Full Text Available Background. Chaperones and their co-factors are components of a cellular network; they collaborate to maintain proteostasis under normal and harmful conditions. In particular, hsp70 family members and their co-chaperones are essential to repair damaged proteins. Co-chaperones are present in different subcellular compartments, where they modulate chaperone activities.Methods and Results. Our studies assessed the relationship between hsc70 and its co-factor HspBP1 in human cancer cells. HspBP1 promotes nucleotide exchange on hsc70, but has also chaperone-independent functions. We characterized the interplay between hsc70 and HspBP1 by quantitative confocal microscopy combined with automated image analyses and statistical evaluation. Stress and the recovery from insult changed significantly the subcellular distribution of hsc70, but had little effect on HspBP1. Single-cell measurements and regression analysis revealed that the links between the chaperone and its co-factor relied on (i the physiological state of the cell and (ii the subcellular compartment. As such, we identified a linear relationship and strong correlation between hsc70 and HspBP1 distribution in control and heat-shocked cells; this correlation changed in a compartment-specific fashion during the recovery from stress. Furthermore, we uncovered significant stress-induced changes in the colocalization between hsc70 and HspBP1 in the nucleus and cytoplasm.Discussion. Our quantitative approach defined novel properties of the co-chaperone HspBP1 as they relate to its interplay with hsc70. We propose that changes in cell physiology promote chaperone redistribution and thereby stimulate chaperone-independent functions of HspBP1.
Energy Technology Data Exchange (ETDEWEB)
Vogue, A. de
1997-08-01
The annual production of the Dunkerque`s refinery (France) represents 330000 t of lubricants, 16000 t of paraffins, 17000 t of wax, 34000 t of extracts, 304000 t of diesel fuel and 300000 t of bitumens. From the legal aspect, Mobil is operator of the unit which belongs to an independent company held by BP (60%) and Elf (40%). After the BP-Mobil agreement was signed, the Dunkerque`s refinery entered into new Mobil`s network of 6 lubricants refineries which represent an overall over-capacity of 400000 t/year. This over-capacity is a consequence of export limitations due to profits reduction. (J.S.)
Last Interglacial climate and sea-level evolution from a coupled ice sheet-climate model
Goelzer, Heiko; Huybrechts, Philippe; Loutre, Marie-France; Fichefet, Thierry
2016-12-01
As the most recent warm period in Earth's history with a sea-level stand higher than present, the Last Interglacial (LIG, ˜ 130 to 115 kyr BP) is often considered a prime example to study the impact of a warmer climate on the two polar ice sheets remaining today. Here we simulate the Last Interglacial climate, ice sheet, and sea-level evolution with the Earth system model of intermediate complexity LOVECLIM v.1.3, which includes dynamic and fully coupled components representing the atmosphere, the ocean and sea ice, the terrestrial biosphere, and the Greenland and Antarctic ice sheets. In this setup, sea-level evolution and climate-ice sheet interactions are modelled in a consistent framework.Surface mass balance change governed by changes in surface meltwater runoff is the dominant forcing for the Greenland ice sheet, which shows a peak sea-level contribution of 1.4 m at 123 kyr BP in the reference experiment. Our results indicate that ice sheet-climate feedbacks play an important role to amplify climate and sea-level changes in the Northern Hemisphere. The sensitivity of the Greenland ice sheet to surface temperature changes considerably increases when interactive albedo changes are considered. Southern Hemisphere polar and sub-polar ocean warming is limited throughout the Last Interglacial, and surface and sub-shelf melting exerts only a minor control on the Antarctic sea-level contribution with a peak of 4.4 m at 125 kyr BP. Retreat of the Antarctic ice sheet at the onset of the LIG is mainly forced by rising sea level and to a lesser extent by reduced ice shelf viscosity as the surface temperature increases. Global sea level shows a peak of 5.3 m at 124.5 kyr BP, which includes a minor contribution of 0.35 m from oceanic thermal expansion. Neither the individual contributions nor the total modelled sea-level stand show fast multi-millennial timescale variations as indicated by some reconstructions.
14C concentrations in the old woods at 6000yrBP and the variations of cosmic rays
International Nuclear Information System (INIS)
Sato, Taiichi; Sakurai, Hirohisa; Tokanai, Huyuki
2008-01-01
A large quantity of old woods was recently excavated with the Chuetsu-oki Earthquake in the bottom of the sea of near the Izumozaki-oki Nigata Prefecture. First of all, we have measured the radiocarbon ages for the three samples to identify the calendar ages of the woods. The radiocarbon ages were 5357±45 yrBP, 4573±52 yrBP, and 4812±52 yrBP, respectively. Using the OXCAL program, the calendar ages were calculated in the range from 6300 yrBP to 5100 yrBP. The IntCal04 data shows that the 14 C concentrations with the era are very variable with 20 per mille variations. We show a plan to investigate 14 C concentrations of the old tree rings around 6000 yrBP. (author)
SHOCKS AND A GIANT PLANET IN THE DISK ORBITING BP PISCIUM?
International Nuclear Information System (INIS)
Melis, C.; Zuckerman, B.; Gielen, C.; Chen, C. H.; Rhee, Joseph H.; Song, Inseok
2010-01-01
Spitzer Infrared Spectrograph data support the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ∼75 K crystalline, magnesium-rich olivine; ∼75 K crystalline, magnesium-rich pyroxene; ∼200 K amorphous, magnesium-rich pyroxene; and ∼200 K annealed silica (cristobalite). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.
Directory of Open Access Journals (Sweden)
Jie-sheng Wang
2014-01-01
Full Text Available For meeting the forecasting target of key technology indicators in the flotation process, a BP neural network soft-sensor model based on features extraction of flotation froth images and optimized by shuffled cuckoo search algorithm is proposed. Based on the digital image processing technique, the color features in HSI color space, the visual features based on the gray level cooccurrence matrix, and the shape characteristics based on the geometric theory of flotation froth images are extracted, respectively, as the input variables of the proposed soft-sensor model. Then the isometric mapping method is used to reduce the input dimension, the network size, and learning time of BP neural network. Finally, a shuffled cuckoo search algorithm is adopted to optimize the BP neural network soft-sensor model. Simulation results show that the model has better generalization results and prediction accuracy.
Association of von Willebrand factor blood levels with exercise hypertension.
Nikolic, Sonja B; Adams, Murray J; Otahal, Petr; Edwards, Lindsay M; Sharman, James E
2015-05-01
A hypertensive response to moderate intensity exercise (HRE) is associated with increased cardiovascular risk. The mechanisms of an HRE are unclear, although previous studies suggest this may be due to haemostatic and/or haemodynamic factors. We investigated the relationships between an HRE with haemostatic and hemodynamic indices. Sixty-four participants (57 ± 10 years, 71 % male) with indication for exercise stress testing underwent cardiovascular assessment at rest and during moderate intensity exercise, from which 20 participants developed an HRE (defined as moderate exercise systolic BP ≥ 170 mmHg/men and ≥ 160 mmHg/women). Rest, exercise and post-exercise blood samples were analysed for haemostatic markers, including von Willebrand factor (vWf), and haemodynamic measures of brachial and central blood pressure (BP), aortic stiffness and systemic vascular resistance index (SVRi). HRE participants had higher rest vWf compared with normotensive response to exercise (NRE) participants (1,927 mU/mL, 95 % CI 1,240-2,615, vs. 1,129 mU/mL, 95 % CI 871-1,386; p = 0.016). vWf levels significantly decreased from rest to post-exercise in HRE participants (p = 0.005), whereas vWf levels significantly increased from rest to exercise in NRE participants (p = 0.030). HRE participants also had increased triglycerides, rest BP, aortic stiffness and exercise SVRi (p HRE at moderate intensity.
International Nuclear Information System (INIS)
Yu, Feng; Xu, Xiaozhong
2014-01-01
Highlights: • A detailed data processing will make more accurate results prediction. • Taking a full account of more load factors to improve the prediction precision. • Improved BP network obtains higher learning convergence. • Genetic algorithm optimized by chaotic cat map enhances the global search ability. • The combined GA–BP model improved by modified additional momentum factor is superior to others. - Abstract: This paper proposes an appropriate combinational approach which is based on improved BP neural network for short-term gas load forecasting, and the network is optimized by the real-coded genetic algorithm. Firstly, several kinds of modifications are carried out on the standard neural network to accelerate the convergence speed of network, including improved additional momentum factor, improved self-adaptive learning rate and improved momentum and self-adaptive learning rate. Then, it is available to use the global search capability of optimized genetic algorithm to determine the initial weights and thresholds of BP neural network to avoid being trapped in local minima. The ability of GA is enhanced by cat chaotic mapping. In light of the characteristic of natural gas load for Shanghai, a series of data preprocessing methods are adopted and more comprehensive load factors are taken into account to improve the prediction accuracy. Such improvements facilitate forecasting efficiency and exert maximum performance of the model. As a result, the integration model improved by modified additional momentum factor gets more ideal solutions for short-term gas load forecasting, through analyses and comparisons of the above several different combinational algorithms
The Application and Research of the GA-BP Neural Network Algorithm in the MBR Membrane Fouling
Directory of Open Access Journals (Sweden)
Chunqing Li
2014-01-01
Full Text Available It is one of the important issues in the field of today's sewage treatment of researching the MBR membrane flux prediction for membrane fouling. Firstly this paper used the principal component analysis method to achieve dimensionality and correlation of input variables and obtained the three major factors affecting membrane fouling most obvious: MLSS, total resistance, and operating pressure. Then it used the BP neural network to establish the system model of the MBR intelligent simulation, the relationship between three parameters, and membrane flux characterization of the degree of membrane fouling, because the BP neural network has slow training speed, is sensitive to the initial weights and the threshold, is easy to fall into local minimum points, and so on. So this paper used genetic algorithm to optimize the initial weights and the threshold of BP neural network and established the membrane fouling prediction model based on GA-BP network. As this research had shown, under the same conditions, the BP network model optimized by GA of MBR membrane fouling is better than that not optimized for prediction effect of membrane flux. It demonstrates that the GA-BP network model of MBR membrane fouling is more suitable for simulation of MBR membrane fouling process, comparing with the BP network.
EST Table: BP182659 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP182659 NRPG0886 10/09/28 51 %/153 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 NRPG ...
EST Table: BP125370 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti
EST Table: BP182152 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP182152 NRPG0186 10/09/28 87 %/125 aa ref|NP_001098702.1| nanos-like protein [Bomb...yx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/08/29 low homology 10/08/28 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology NM_001105232 NRPG ...
Yang, Jing; Wang, Cheng; Cai, Gan; Dong, Xiaona
2016-10-01
The incidence and mortality rate of the primary liver cancer are very high and its postoperative metastasis and recurrence have become important factors to the prognosis of patients. Circulating tumor cells (CTC), as a new tumor marker, play important roles in the early diagnosis and individualized treatment. This paper presents an effective method to distinguish liver cancer based on the cellular scattering spectrum, which is a non-fluorescence technique based on the fiber confocal microscopic spectrometer. Combining the principal component analysis (PCA) with back propagation (BP) neural network were utilized to establish an automatic recognition model for backscatter spectrum of the liver cancer cells from blood cell. PCA was applied to reduce the dimension of the scattering spectral data which obtained by the fiber confocal microscopic spectrometer. After dimensionality reduction by PCA, a neural network pattern recognition model with 2 input layer nodes, 11 hidden layer nodes, 3 output nodes was established. We trained the network with 66 samples and also tested it. Results showed that the recognition rate of the three types of cells is more than 90%, the relative standard deviation is only 2.36%. The experimental results showed that the fiber confocal microscopic spectrometer combining with the algorithm of PCA and BP neural network can automatically identify the liver cancer cell from the blood cells. This will provide a better tool for investigating the metastasis of liver cancers in vivo, the biology metabolic characteristics of liver cancers and drug transportation. Additionally, it is obviously referential in practical application.
Wu, Jingbo; Zhang, Hui; Wang, Yuanzhi; Qiao, Jun; Chen, Chuangfu; Gao, Goege F.; Allain, Jean-Pierre; Li, Chengyao
2012-01-01
More than 35,000 new cases of human brucellosis were reported in 2010 by the Chinese Center for Disease Control and Prevention. An attenuated B. melitensis vaccine M5-90 is currently used for vaccination of sheep and goats in China. In the study, a periplasmic protein BP26 from M5-90 was characterized for its epitope reactivity with mouse monoclonal and sheep antibodies. A total of 29 monoclonal antibodies (mAbs) against recombinant BP26 (rBP26) were produced, which were tested for reactivity with a panel of BP26 peptides, three truncated rBP26 and native BP26 containing membrane protein extracts (NMP) of B. melitensis M5-90 in ELISA and Western-Blot. The linear, semi-conformational and conformational epitopes from native BP26 were identified. Two linear epitopes recognized by mAbs were revealed by 28 of 16mer overlapping peptides, which were accurately mapped as the core motif of amino acid residues 93DRDLQTGGI101 (position 93 to 101) or residues 104QPIYVYPD111, respectively. The reactivity of linear epitope peptides, rBP26 and NMP was tested with 137 sheep sera by ELISAs, of which the two linear epitopes had 65–70% reactivity and NMP 90% consistent with the results of a combination of two standard serological tests. The results were helpful for evaluating the reactivity of BP26 antigen in M5-90. PMID:22457830
Agyemang, Charles; Bhopal, Raj
2003-01-01
The aim of the study was to review published evidence on whether blood pressure (BP) levels and the prevalence of hypertension are higher in adult populations of African descent living in the UK as compared to the white population. A systematic literature review was carried out using MEDLINE
Lake-level variation in the Lahontan basin for the past 50,000 years
Benson, L.V.; Thompson, R.S.
1987-01-01
Selected radiocarbon data on surficial materials from the Lahontan basin, Nevada and California, provide a chronology of lake-level variation for the past 50,000 yr. A moderate-sized lake connected three western Lahontan subbasins (the Smoke Creek-Black Rock Desert subbasin, the Pyramid Lake subbasin, and the Winnemucca Dry Lake subbasin) from about 45,000 to 16,500 yr B.P. Between 50,000 and 45,000 yr B.P., Walker Lake rose to its sill level in Adrian Valley and spilled to the Carson Desert subbasin. By 20,000 yr B.P., lake level in the western Lahontan subbasins had risen to about 1265 m above sea level, where it remained for 3500 yr. By 16,000 yr B.P., lake level in the western Lahontan subbasins had fallen to 1240 m. This recession appears synchronous with a desiccation of Walker Lake; however, whether the Walker Lake desiccation resulted from climate change or from diversion of the Walker River is not known. From about 15,000 to 13,500 yr B.P., lake level rapidly rose, so that Lake Lahontan was a single body of water by 14,000 yr B.P. The lake appears to have reached a maximum highstand altitude of 1330 m by 13,500 yr B.P., a condition that persisted until about 12,500 yr B.P., at which time lake level fell ???100 m. No data exist that indicate the level of lakes in the various subbasins between 12,000 and 10,000 yr B.P. During the Holocene, the Lahontan basin was the site of shallow lakes, with many subbasins being the site of one or more periods of desiccation. The shape of the lake-level curve for the three western subbasins indicates that past changes in the hydrologic balance (and hence climate) of the Lahontan basin were large in magnitude and took place in a rapid step-like manner. The rapid changes in lake level are hypothesized to have resulted from changes in the mean position of the jet stream, as it was forced north or south by the changing size and shape of the continental ice sheet. ?? 1987.
An empirical study on educational investment for all levels of higher education in China
YANG Juan; David MAYSTON
2009-01-01
With the expanding of higher education in China from 1999, more and more youngsters are able to invest in higher education, resulting a high unemployment rate for higher education graduates and more and more graduates employed in non-graduate position, while the analysis upon risk and return to each level of high education is absent due to the limitation of dataset. The paper employs college students sample survey to research the determinants of all levels of higher education beginning wages,...
BP Spill in the Gulf of Mexico Sediment Data
U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...
TopBP1/Dpb11 binds DNA anaphase bridges to prevent genome instability
DEFF Research Database (Denmark)
Germann, Susanne Manuela; Schramke, Vera; Pedersen, Rune Troelsgaard
2014-01-01
yeast Saccharomyces cerevisiae and the avian DT40 cell line as model systems for studying DNA anaphase bridges and show that TopBP1/Dpb11 plays an evolutionarily conserved role in their metabolism. Together with the single-stranded DNA binding protein RPA, TopBP1/Dpb11 binds to UFBs, and depletion...
NotCal04 : Comparison/calibration C-14 records 26-50 cal kyr BP
Plicht, J. van der; Beck, J.W.; Bard, E.; Baillie, M.G.L.; Blackwell, P.G.; Buck, C.E.; Friedrich, M.; Guilderson, T.P.; Hughen, K.A.; Kromer, B.; McCormac, F.G.; Bronk Ramsey, C.; Reimer, P.J.; Reimer, R.W.; Remmele, S.; Richards, D.A.; Southon, J.R.; Stuiver, M.; Weyhenmeyer, C.E.
2004-01-01
The radiocarbon calibration curve ImCal04 extends back to 26 cal kyr BP. While several high-resolution records exist beyond this limit, these data sets exhibit discrepancies of up, to several millennia. As a result, no calibration curve for the time range 26-50 cal kyr BP can be recommended as yet,
A higher-level MRP supertree of placental mammals
Directory of Open Access Journals (Sweden)
Bininda-Emonds Olaf RP
2006-11-01
Full Text Available Abstract Background The higher-level phylogeny of placental mammals has long been a phylogenetic Gordian knot, with disagreement about both the precise contents of, and relationships between, the extant orders. A recent MRP supertree that favoured 'outdated' hypotheses (notably, monophyly of both Artiodactyla and Lipotyphla has been heavily criticised for including low-quality and redundant data. We apply a stringent data selection protocol designed to minimise these problems to a much-expanded data set of morphological, molecular and combined source trees, to produce a supertree that includes every family of extant placental mammals. Results The supertree is well-resolved and supports both polyphyly of Lipotyphla and paraphyly of Artiodactyla with respect to Cetacea. The existence of four 'superorders' – Afrotheria, Xenarthra, Laurasiatheria and Euarchontoglires – is also supported. The topology is highly congruent with recent (molecular phylogenetic analyses of placental mammals, but is considerably more comprehensive, being the first phylogeny to include all 113 extant families without making a priori assumptions of suprafamilial monophyly. Subsidiary analyses reveal that the data selection protocol played a key role in the major changes relative to a previously published higher-level supertree of placentals. Conclusion The supertree should provide a useful framework for hypothesis testing in phylogenetic comparative biology, and supports the idea that biogeography has played a crucial role in the evolution of placental mammals. Our results demonstrate the importance of minimising poor and redundant data when constructing supertrees.
Mass spectroscopic phosphoprotein mapping of Ral binding protein 1 (RalBP1/Rip1/RLIP76)
International Nuclear Information System (INIS)
Herlevsen, Mikael C.; Theodorescu, Dan
2007-01-01
RalBP1, a multifunctional protein implicated in cancer cell proliferation, radiation and chemoresistance, and ligand dependent receptor internalization, is upregulated in bladder cancer and is a downstream effector of RalB, a GTPase associated with metastasis. RalBP1 can be regulated by phosphorylation by protein kinase C (PKC). No studies have comprehensively mapped RalBP1 phosphorylation sites or whether RalB affects these. We identified 14 phosphorylation sites of RalBP1 in human bladder carcinoma UMUC-3 and embryonic kidney derived 293T cells. The phosphorylated residues are concentrated at the N-terminus. Ten of the first 100 amino acids of the primary structure were phosphorylated. Nine were serine residues, and one a threonine. We evaluated the effect of RalB overexpression on RalBP1 phosphorylation and found the largest change in phosphorylation status at S463 and S645. Further characterization of these sites will provide novel insights on RalBP1 biology, its functional relationship to RalB and possible avenues for therapeutic intervention
Application of the GA-BP Neural Network in Earthwork Calculation
Fang, Peng; Cai, Zhixiong; Zhang, Ping
2018-01-01
The calculation of earthwork quantity is the key factor to determine the project cost estimate and the optimization of the scheme. It is of great significance and function in the excavation of earth and rock works. We use optimization principle of GA-BP intelligent algorithm running process, and on the basis of earthwork quantity and cost information database, the design of the GA-BP neural network intelligent computing model, through the network training and learning, the accuracy of the results meet the actual engineering construction of gauge fan requirements, it provides a new approach for other projects the calculation, and has good popularization value.
Comparison of two bone anchored hearing instruments: BP100 and Ponto Pro
DEFF Research Database (Denmark)
Olsen, Steen Østergaard; Glad, Henrik; Nielsen, Lars Holme
2011-01-01
This study aimed at investigating if there were differences in auditory performance, operation, or user preference between the Ponto Pro or the BP100, two bone anchored hearing instruments (BAHI) with modern sound processing technology.......This study aimed at investigating if there were differences in auditory performance, operation, or user preference between the Ponto Pro or the BP100, two bone anchored hearing instruments (BAHI) with modern sound processing technology....
Association between the CCR5 32-bp deletion allele and late onset of schizophrenia
DEFF Research Database (Denmark)
Rasmussen, H.B.; Timm, S.; Wang, A.G.
2006-01-01
OBJECTIVE: The 32-bp deletion allele in chemokine receptor CCR5 has been associated with several immune-mediated diseases and might be implicated in schizophrenia as well. METHOD: The authors genotyped DNA samples from 268 schizophrenia patients and 323 healthy subjects. Age at first admission...... to a psychiatric hospital department served as a measure of disease onset. RESULTS: Patients and comparison subjects differed marginally in their genotype distribution, with a slightly higher frequency of the deletion allele seen in the patients. The authors found the deletion allele to be associated with higher......-onset schizophrenia) and healthy subjects differed significantly. This was reflected in an increased frequency of the deletion allele in the patient subgroup. Patients with ages at first admission below and above 40 years significantly differed in distribution of genotypes and alleles, with an overrepresentation...
TopBP1/Dpb11 binds DNA anaphase bridges to prevent genome instability.
Germann, Susanne M; Schramke, Vera; Pedersen, Rune Troelsgaard; Gallina, Irene; Eckert-Boulet, Nadine; Oestergaard, Vibe H; Lisby, Michael
2014-01-06
DNA anaphase bridges are a potential source of genome instability that may lead to chromosome breakage or nondisjunction during mitosis. Two classes of anaphase bridges can be distinguished: DAPI-positive chromatin bridges and DAPI-negative ultrafine DNA bridges (UFBs). Here, we establish budding yeast Saccharomyces cerevisiae and the avian DT40 cell line as model systems for studying DNA anaphase bridges and show that TopBP1/Dpb11 plays an evolutionarily conserved role in their metabolism. Together with the single-stranded DNA binding protein RPA, TopBP1/Dpb11 binds to UFBs, and depletion of TopBP1/Dpb11 led to an accumulation of chromatin bridges. Importantly, the NoCut checkpoint that delays progression from anaphase to abscission in yeast was activated by both UFBs and chromatin bridges independently of Dpb11, and disruption of the NoCut checkpoint in Dpb11-depleted cells led to genome instability. In conclusion, we propose that TopBP1/Dpb11 prevents accumulation of anaphase bridges via stimulation of the Mec1/ATR kinase and suppression of homologous recombination.
Kjeldsen, Sverre E; Jamerson, Kenneth A; Bakris, George L; Pitt, Bertram; Dahlöf, Björn; Velazquez, Eric J; Hua, Tsushung A; Kelly, Roxzana Y; Zappe, Dion; Hester, Allen; Tuomilehto, Jaakko; Ostergren, Jan; Ibsen, Hans; Weber, Michael
2012-04-01
The ACCOMPLISH Trial investigated intensive antihypertensive combination treatment with benazepril + amlodipine (B+A) or benazepril + hydrochlorothiazide (B+H) on cardiovascular outcomes in patients with systolic hypertension. We analyzed the baseline predictors of achieving a systolic blood pressure (SBP) Nordic region) and Caucasian ethnicity in both randomization arms. A higher diastolic BP and the use of lipid lowering agents indicated favorable effects in the B+H arm only. The predictors of uncontrolled SBP were: (i) higher baseline SBP values, (ii) higher number of previous antihypertensive medications in both arms, (iii) the previous use of insulin in the B+A arm, and (iv) pre-trial calcium channel blocker (CCB) use in the B+H arm. Additionally, pre-trial use of thiazides and electrocardiogram (ECG)-left ventricular hypertrophy (LVH) at baseline predicted higher, and smoking lower absolute SBP in the B+A arm and the use of thiazides and proteinuria a higher SBP in the B+H arm. Irrespective of treatment, patients in the USA and Caucasians achieved better SBP control, whereas higher baseline SBP and more previous antihypertensive medications indicated less control. Concomitant use of lipid lowering treatment indicated a better SBP control in the benazepril + hydrochlorothiazide arm. Lastly, insulin use and ECG-LVH in the benazepril + amlodipine arm and proteinuria in the benazepril + hydrochlorothiazide arm indicated poor control.
Torres, L M F C; Braga, N A; Gomes, I P; Almeida, M T; Santos, T L; de Mesquita, J P; da Silva, L M; Martins, H R; Kato, K C; Dos Santos, W T P; Resende, J M; Pereira, M C; Bemquerer, M P; Rodrigues, M A; Verly, R M
2018-03-01
The functionalization of alumina nanoparticles of specific morphology with antimicrobial peptides (AMP) can be a promising strategy for modeling medical devices and packaging materials for cosmetics, medicines or food, since the contamination by pathogens could be reduced. In this paper, we show the synthesis of a fibrous-like alumina nanobiostructure, as well as its functionalization with the peptide EAAA-BP100, an analog of the antimicrobial peptide BP100. The antibacterial activity of the obtained material against some bacterial strains is also investigated. The covalent binding of the peptide to the nanoparticles was promoted by a reaction between the carboxyl group of the glutamate side chain (E1) of the peptide and the amino groups of the alumina nanoparticles, previously modified by reaction with 3-aminopropyltrietoxysilane (APTES). The functionalized nanoparticles were characterized by zeta potential measurements, Fourier transform infrared spectroscopy, and other physicochemical techniques. Although the obtained alumina nanobiostructure shows a relatively low degree of substitution with EAAA-BP100, antibacterial activities against Escherichia coli and Salmonella typhimurium strains are appreciably higher than the activities of the free peptide. The obtained results can affect the design of new hybrid nanobiomaterials based on nanoparticles functionalized with AMP. Copyright © 2018. Published by Elsevier B.V.
Impact of histone H4 lysine 20 methylation on 53BP1 responses to chromosomal double strand breaks.
Directory of Open Access Journals (Sweden)
Andrea J Hartlerode
Full Text Available Recruitment of 53BP1 to chromatin flanking double strand breaks (DSBs requires γH2AX/MDC1/RNF8-dependent ubiquitination of chromatin and interaction of 53BP1 with histone H4 methylated on lysine 20 (H4K20me. Several histone methyltransferases have been implicated in 53BP1 recruitment, but their quantitative contributions to the 53BP1 response are unclear. We have developed a multi-photon laser (MPL system to target DSBs to subfemtoliter nuclear volumes and used this to mathematically model DSB response kinetics of MDC1 and of 53BP1. In contrast to MDC1, which revealed first order kinetics, the 53BP1 MPL-DSB response is best fitted by a Gompertz growth function. The 53BP1 MPL response shows the expected dependency on MDC1 and RNF8. We determined the impact of altered H4K20 methylation on 53BP1 MPL response kinetics in mouse embryonic fibroblasts (MEFs lacking key H4K20 histone methyltransferases. This revealed no major requirement for the known H4K20 dimethylases Suv4-20h1 and Suv4-20h2 in 53BP1 recruitment or DSB repair function, but a key role for the H4K20 monomethylase, PR-SET7. The histone methyltransferase MMSET/WHSC1 has recently been implicated in 53BP1 DSB recruitment. We found that WHSC1 homozygous mutant MEFs reveal an alteration in balance of H4K20 methylation patterns; however, 53BP1 DSB responses in these cells appear normal.
EST Table: BP183868 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP183868 P5PG0462 10/09/28 50 %/126 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 P5PG ...
EST Table: BP126151 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP126151 ps4M0084 10/09/28 52 %/232 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 ps4M ...
Johansson, Mikael
2017-01-01
The BP Deepwater Horizon crisis in 2010 was one the largest catastrophes in the history of the oil industry. BP was sued over the disaster, and lost several billion dollars. This study examines the crisis response strategies and/or image repair strategies, which can be found in BP's press releases following the Deepwater Horizon crisis. In particular, the study looks closer at what established crisis communication strategies could be discerned in the material, and how they are used discursive...
Jozkow, Pawel; Slowinska-Lisowska, Malgorzata; Laczmanski, Lukasz; Medras, Marek
2013-03-01
Both animal and human studies have proved that the dopaminergic system of the brain controls many aspects of behavior, e.g. motivation, addiction, motor movement, locomotion. It has been hypothesized that dopamine signalling may regulate spontaneous physical activity as well. Literature data suggests that an intact function of dopamine receptors (DRD2-DRD4) inhibits physical activity. This study searched for associations between a propensity to be active (or sedentary) and genetic variants of DRD2 and DRD4. Invitations to participate in the study were sent to 900 randomly selected, adult men living in Lower Silesia, Poland. Genotyping of DRD2 C313T and DRD4 48-bp VNTR polymorphisms of enrolled subjects (371 (DRD2 C313T) and 397 (DRD4 48-bp VNTR)) was performed. Level of physical activity was evaluated using the International Physical Activity Questionnaire (IPAQ). No associations were found between level of physical activity (low, moderate, high) and the two polymorphisms: DRD2 C313T (p = 0.49) and DRD4 48-bp VNTR (p = 0.31). Studied subjects did not differ as to the number of hours spent sitting either. The results exclude the presence of significant relationships between polymorphic variants of the dopamine receptors genes and the level of physical activity in men.
Covic, Adrian; Mititiuc, Irina; Gusbeth-Tatomir, Paul; Goldsmith, David J
2002-01-01
Diurnal BP rhythm is known to be abnormal (reduced BP fall with sleep) in chronic renal failure, dialysis and renal transplantation patients. In subjects with primary hypertension and with reduced diurnal BP fall with sleep there is consistent evidence of increased target-organ damage. However, the few studies that have addressed the reproducibility of diurnal rhythm in normal or hypertensive subjects have concluded that the BP fall with sleep is poorly reproducible. It is not known whether the same is true for patients with renal disease. In 30 subjects with autosomal polycystic kidney disease (ADPKD), mild chronic renal failure and normal office BP levels on standardised anti-hypertensive treatment, ambulatory blood pressure monitoring (ABPM) was done three times over a twelve month period to assess the reproducibility of blood pressure fall with sleep. When comparing ABPM 2 with the ABPM 1 recording (3 months difference between measurements) only 43.3% of the patients maintained the initial dipping category (defined by quartiles of the ABPM 1 diurnal BP distribution). The same proportion of subjects had a similar dipping category, when ABPM 3 was compared to ABPM 1 (9 months difference between measurements), but a large (24%) subset of patients had dramatic shifts in their amplitude in nocturnal BP fall, significantly greater than those recorded after a shorter inter-measurement interval. Equally important, our study reveals the fact that, with time, there is no tendency to decrease circadian variation: a similar proportion (a quarter to one third) of patients increased or decreased their amplitude in nocturnal BP fall, at 3 and 9 months. When several ABPM measurements are repeated for the same patients, the repeatability is even worse, since only 36.6% of our study population maintained the initial dipping category across all three ABPM determinations (ABPM 1 and ABPM 2 and ABPM 3). There is a widespread abnormality in diurnal BP rhythm in ADPKD patients with
Association between the CCR5 32-bp deletion allele and late onset of schizophrenia
DEFF Research Database (Denmark)
Rasmussen, Henrik Berg; Timm, Sally; Wang, August G
2006-01-01
OBJECTIVE: The 32-bp deletion allele in chemokine receptor CCR5 has been associated with several immune-mediated diseases and might be implicated in schizophrenia as well. METHOD: The authors genotyped DNA samples from 268 schizophrenia patients and 323 healthy subjects. Age at first admission...... of the deletion allele in the latter subgroup of patients. CONCLUSIONS: These findings suggest that the CCR5 32-bp deletion allele is a susceptibility factor for schizophrenia with late onset. Alternatively, the CCR5 32-bp deletion allele may act as a modifier by delaying the onset of schizophrenia without...
Energy Technology Data Exchange (ETDEWEB)
Chihara, Kazuyasu [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Organization for Life Science Advancement Programs, University of Fukui, Fukui 910-1193 (Japan); Kimura, Yukihiro [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Division of Otorhinolaryngology Head and Neck Surgery, Department of Sensory and Locomotor Medicine, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Honjoh, Chisato [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Third Department of Internal Medicine, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Yamauchi, Shota; Takeuchi, Kenji [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Organization for Life Science Advancement Programs, University of Fukui, Fukui 910-1193 (Japan); Sada, Kiyonao, E-mail: ksada@u-fukui.ac.jp [Division of Genome Science and Microbiology, Department of Pathological Sciences, Faculty of Medical Sciences, Fukui 910-1193 (Japan); Organization for Life Science Advancement Programs, University of Fukui, Fukui 910-1193 (Japan)
2014-03-10
Adaptor protein c-Abl SH3 domain-binding protein-2 (3BP2) is known to play regulatory roles in immunoreceptor-mediated signal transduction. We have previously demonstrated that Tyr{sup 174}, Tyr{sup 183} and Tyr{sup 446} in mouse 3BP2 are predominantly phosphorylated by Syk, and the phosphorylation of Tyr{sup 183} and the Src homology 2 (SH2) domain of mouse 3BP2 are critical for B cell receptor (BCR)-induced activation of nuclear factor of activated T cells (NFAT) in human B cells. In this report, we have shown that Syk, but not Abl family protein-tyrosine kinases, is critical for BCR-mediated tyrosine phosphorylation of 3BP2 in chicken DT40 cells. Mutational analysis showed that Tyr{sup 174}, Tyr{sup 183} and Tyr{sup 426} of chicken 3BP2 are the major phosphorylation sites by Syk and the SH2 domain of 3BP2 is critical for tyrosine phosphorylation. In addition, phosphorylation of Tyr{sup 426} is required for the inducible interaction with the SH2 domain of Vav3. Moreover, the expression of the mutant form of 3BP2 in which Tyr{sup 426} was substituted to Phe resulted in the reduction in BCR-mediated Rac1 activation, when compared with the case of wild-type. Altogether, these data suggest that 3BP2 is involved in the activation of Rac1 through the regulation of Vav3 by Syk-dependent phosphorylation of Tyr{sup 426} following BCR stimulation. - Highlights: • 3BP2 is phosphorylated by Syk, but not Abl family kinases in BCR signaling. • Tyr183 and Tyr426 in chicken 3BP2 are the major phosphorylation sites by Syk. • The SH2 domain of 3BP2 is critical for tyrosine phosphorylation of 3BP2. • Phosphorylation of Tyr426 in 3BP2 is required for the inducible binding with Vav3. • 3BP2 is involved in the regulation of BCR-mediated Rac1 activation.
International Nuclear Information System (INIS)
Chihara, Kazuyasu; Kimura, Yukihiro; Honjoh, Chisato; Yamauchi, Shota; Takeuchi, Kenji; Sada, Kiyonao
2014-01-01
Adaptor protein c-Abl SH3 domain-binding protein-2 (3BP2) is known to play regulatory roles in immunoreceptor-mediated signal transduction. We have previously demonstrated that Tyr 174 , Tyr 183 and Tyr 446 in mouse 3BP2 are predominantly phosphorylated by Syk, and the phosphorylation of Tyr 183 and the Src homology 2 (SH2) domain of mouse 3BP2 are critical for B cell receptor (BCR)-induced activation of nuclear factor of activated T cells (NFAT) in human B cells. In this report, we have shown that Syk, but not Abl family protein-tyrosine kinases, is critical for BCR-mediated tyrosine phosphorylation of 3BP2 in chicken DT40 cells. Mutational analysis showed that Tyr 174 , Tyr 183 and Tyr 426 of chicken 3BP2 are the major phosphorylation sites by Syk and the SH2 domain of 3BP2 is critical for tyrosine phosphorylation. In addition, phosphorylation of Tyr 426 is required for the inducible interaction with the SH2 domain of Vav3. Moreover, the expression of the mutant form of 3BP2 in which Tyr 426 was substituted to Phe resulted in the reduction in BCR-mediated Rac1 activation, when compared with the case of wild-type. Altogether, these data suggest that 3BP2 is involved in the activation of Rac1 through the regulation of Vav3 by Syk-dependent phosphorylation of Tyr 426 following BCR stimulation. - Highlights: • 3BP2 is phosphorylated by Syk, but not Abl family kinases in BCR signaling. • Tyr183 and Tyr426 in chicken 3BP2 are the major phosphorylation sites by Syk. • The SH2 domain of 3BP2 is critical for tyrosine phosphorylation of 3BP2. • Phosphorylation of Tyr426 in 3BP2 is required for the inducible binding with Vav3. • 3BP2 is involved in the regulation of BCR-mediated Rac1 activation
Directory of Open Access Journals (Sweden)
E. G. Starostina
2015-01-01
Full Text Available Background: Level of intelligence influences compliance of diabetic patients and their active and conscious participation in self-care. A potential association between IQ and surrogate efficacy markers of type 2 diabetes mellitus (T2DM treatment has not been studied in Russia.Aim: To assess potential association between level of intelligence, glucose control, blood pressure (BP control and obesity in T2DM patients.Materials and methods: This cross-sectional study included 161 T2DM patients (28 males, 133 females aged from 37 to 79 years with diabetes duration from 0,5 to 30 years. All patients underwent standard clinical and laboratory assessment, including glycated hemoglobin (HbA1c measurement and were seen by a psychiatrist to diagnose possible depressive and cognitive disorders according to International Classification of Diseases-10 criteria. Each participant underwent psychometrical assessment, including Hachinski Ischemia Scale and a battery of cognitive tests. IQ was measured with Wechsler Adult Intelligence Scale (WAIS.Results: Mean (± SD IQ was 100,6 ± 14,9, which corresponds to average IQ. There was no correlation between IQ and patients age. There were no differences in IQ in T2DM patients from various bodyweight categories. Correlation between HbA1c and IQ in the whole group was non-significant (r = -0,13. Only patients with high and very high IQ (≥ 110 had lower HbA1c than the rest of the group (with IQ < 110: 8,1 ± 2,4 и 8,9 ± 1,9%, respectively (р < 0,05. Level of education did not influence glucose control, BP and body mass index (BMI; HbA1c, BMI and BP values in patients with primary and higher education was virtually similar.Conclusion: Level of intelligence of T2DM patients does not contribute to risk factor control, such as bodyweight and BP. In majority of T2DM patients, glycemic control does not depend on their IQ and educational level; significantly better glucose control is achieved only by patients with higher
DEFF Research Database (Denmark)
Godschalk, Roger W L; Ersson, Clara; Stępnik, Maciej
2014-01-01
This study investigated the levels of DNA strand breaks and formamidopyrimidine DNA glycosylase (FPG) sensitive sites, as assessed by the comet assay, in peripheral blood mononuclear cells (PBMC) from healthy women from five different countries in Europe. The laboratory in each country (referred...... to as 'centre') collected and cryopreserved PBMC samples from three donors, using a standardised cell isolation protocol. The samples were analysed in 13 different laboratories for DNA damage, which is measured by the comet assay. The study aim was to assess variation in DNA damage in PBMC samples that were......%) by standardisation of the primary comet assay endpoint with calibration curve samples. The level of DNA strand breaks in the samples from two of the centres (0.56-0.61 lesions/10(6) bp) was significantly higher compared with the other three centres (0.41-0.45 lesions/10(6) bp). In contrast, there was no difference...
Directory of Open Access Journals (Sweden)
Barth Ortrud M.
2006-01-01
Full Text Available A sediment sample was obtained at 122 cm from the top of a drilling core in the Guapimirim mangrove, Bay of Guanabara, and analyzed using pollen analysis. This muddy core reached a sandy ground at 133 cm. 14C datation got the age of 1760 ? 50 years B.P. The most frequent pollen grains were mangrove species of Rhizophora mangle, Laguncularia racemosa and Avicennia schaueriana. "Restinga" and tropical rain forest vegetation was recognized behind the mangrove. After the last sea transgression at 2500 years B.P., the water level lowered to its actual size, allowing the installation of this mangrove.
Santoso, Hanna Yuanita Dana; Supriyana, Supriyana; Bahiyatun, Bahiyatun; Widyawati, Melyana Nurul; Fatmasari, Diyah; Sudiyono, Sudiyono; Widyastari, Dyah Anantalia; Sinaga, Doni Marisi
2017-03-01
Objective: WHO recommends Mobile health , a practice of medicine and public health supported by mobile devices, to improve community health status and change people's behavior for the health purposes. The present study sought to examine the effectiveness of the android application program of Suami Siaga Plus in increasing husband's scores in birth preparedness and complication readiness (BP/CR) intervention. Materials and methods: It was a randomized controlled trial with pretest-posttest design. A total of 38 couples of husbands and pregnant women from three health centers at three sub districts in Semarang was selected by proportional systematic random sampling technique and equally distributed into control and intervention group. A questionnaire related to BP/CR published by JHPIEGO was employed in data collection. Statistical analysis was performed to obtain the frequency distribution and percentage of the variables, and also to assess the mean difference of BP/CR score of husbands. Results: Husbands' knowledge of key danger signs and five standard elements in BP/CR practices in both intervention and control group increased after counseling. Moreover, the proportion of husbands who understand the key danger signs during pregnancy was higher among those who were exposed by Suami Siaga Plus application delivered via mobile phone. Counseling only increased husbands' score from 61.5 to 62.6 (2%), whilst the combination of counseling and the application boosted 20% of husbands' score from 60.4 to 72.9 (p-value 0.000). Conclusion: A combination of counseling and Suami Siaga Plus application significantly improves husbands and wives' score on BP/CR compared to those who received counseling only. The data suggests the application would be able to suppress the three delays, which in turn can reduce the maternal mortality rate. The study results could be important information for the Department of Health and health professionals to use android application program , in
ALS mutant SOD1 interacts with G3BP1 and affects stress granule dynamics.
Gal, Jozsef; Kuang, Lisha; Barnett, Kelly R; Zhu, Brian Z; Shissler, Susannah C; Korotkov, Konstantin V; Hayward, Lawrence J; Kasarskis, Edward J; Zhu, Haining
2016-10-01
Amyotrophic lateral sclerosis (ALS) is a fatal neurodegenerative disease. Mutations in Cu/Zn superoxide dismutase (SOD1) are responsible for approximately 20 % of the familial ALS cases. ALS-causing SOD1 mutants display a gain-of-toxicity phenotype, but the nature of this toxicity is still not fully understood. The Ras GTPase-activating protein-binding protein G3BP1 plays a critical role in stress granule dynamics. Alterations in the dynamics of stress granules have been reported in several other forms of ALS unrelated to SOD1. To our surprise, the mutant G93A SOD1 transgenic mice exhibited pathological cytoplasmic inclusions that co-localized with G3BP1-positive granules in spinal cord motor neurons. The co-localization was also observed in fibroblast cells derived from familial ALS patient carrying SOD1 mutation L144F. Mutant SOD1, unlike wild-type SOD1, interacted with G3BP1 in an RNA-independent manner. Moreover, the interaction is specific for G3BP1 since mutant SOD1 showed little interaction with four other RNA-binding proteins implicated in ALS. The RNA-binding RRM domain of G3BP1 and two particular phenylalanine residues (F380 and F382) are critical for this interaction. Mutant SOD1 delayed the formation of G3BP1- and TIA1-positive stress granules in response to hyperosmolar shock and arsenite treatment in N2A cells. In summary, the aberrant mutant SOD1-G3BP1 interaction affects stress granule dynamics, suggesting a potential link between pathogenic SOD1 mutations and RNA metabolism alterations in ALS.
Research on wind field algorithm of wind lidar based on BP neural network and grey prediction
Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei
2018-01-01
This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.
Visual Acuity does not Moderate Effect Sizes of Higher-Level Cognitive Tasks
Houston, James R.; Bennett, Ilana J.; Allen, Philip A.; Madden, David J.
2016-01-01
Background Declining visual capacities in older adults have been posited as a driving force behind adult age differences in higher-order cognitive functions (e.g., the “common cause” hypothesis of Lindenberger & Baltes, 1994). McGowan, Patterson and Jordan (2013) also found that a surprisingly large number of published cognitive aging studies failed to include adequate measures of visual acuity. However, a recent meta-analysis of three studies (LaFleur & Salthouse, 2014) failed to find evidence that visual acuity moderated or mediated age differences in higher-level cognitive processes. In order to provide a more extensive test of whether visual acuity moderates age differences in higher-level cognitive processes, we conducted a more extensive meta-analysis of topic. Methods Using results from 456 studies, we calculated effect sizes for the main effect of age across four cognitive domains (attention, executive function, memory, and perception/language) separately for five levels of visual acuity criteria (no criteria, undisclosed criteria, self-reported acuity, 20/80-20/31, and 20/30 or better). Results As expected, age had a significant effect on each cognitive domain. However, these age effects did not further differ as a function of visual acuity criteria. Conclusion The current meta-analytic, cross-sectional results suggest that visual acuity is not significantly related to age group differences in higher-level cognitive performance—thereby replicating LaFleur and Salthouse (2014). Further efforts are needed to determine whether other measures of visual functioning (e.g. contrast sensitivity, luminance) affect age differences in cognitive functioning. PMID:27070044
Study on application of adaptive fuzzy control and neural network in the automatic leveling system
Xu, Xiping; Zhao, Zizhao; Lan, Weiyong; Sha, Lei; Qian, Cheng
2015-04-01
This paper discusses the adaptive fuzzy control and neural network BP algorithm in large flat automatic leveling control system application. The purpose is to develop a measurement system with a flat quick leveling, Make the installation on the leveling system of measurement with tablet, to be able to achieve a level in precision measurement work quickly, improve the efficiency of the precision measurement. This paper focuses on the automatic leveling system analysis based on fuzzy controller, Use of the method of combining fuzzy controller and BP neural network, using BP algorithm improve the experience rules .Construct an adaptive fuzzy control system. Meanwhile the learning rate of the BP algorithm has also been run-rate adjusted to accelerate convergence. The simulation results show that the proposed control method can effectively improve the leveling precision of automatic leveling system and shorten the time of leveling.
Chen, Thomas C; Yu, Jiali; Nouri Nigjeh, Eslam; Wang, Weijun; Myint, Phyo Thazin; Zandi, Ebrahim; Hofman, Florence M; Schönthal, Axel H
2017-08-01
The anticancer agent 3-bromopyruvate (3-BP) is viewed as a glycolytic inhibitor that preferentially kills glycolytic cancer cells through energy depletion. However, its cytotoxic activity is dependent on cellular drug import through transmembrane monocarboxylate transporter 1 (MCT-1), which restricts its anticancer potential to MCT-1-positive tumor cells. We created and characterized an MCT-1-independent analog of 3-BP, called NEO218. NEO218 was synthesized by covalently conjugating 3-BP to perillyl alcohol (POH), a natural monoterpene. The responses of various tumor cell lines to treatment with either compound were characterized in the presence or absence of supplemental pyruvate or antioxidants N-acetyl-cysteine (NAC) and glutathione (GSH). Drug effects on glyceraldehyde 3-phosphate dehydrogenase (GAPDH) enzyme activity were investigated by mass spectrometric analysis. The development of 3-BP resistance was investigated in MCT-1-positive HCT116 colon carcinoma cells in vitro. Our results show that NEO218: (i) pyruvylated GAPDH on all 4 of its cysteine residues and shut down enzymatic activity; (ii) severely lowered cellular ATP content below life-sustaining levels, and (iii) triggered rapid necrosis. Intriguingly, supplemental antioxidants effectively prevented cytotoxic activity of NEO218 as well as 3-BP, but supplemental pyruvate powerfully protected cells only from 3-BP, not from NEO218. Unlike 3-BP, NEO218 exerted its potent cytotoxic activity irrespective of cellular MCT-1 status. Treatment of HCT116 cells with 3-BP resulted in prompt development of resistance, based on the emergence of MCT-1-negative cells. This was not the case with NEO218, and highly 3-BP-resistant cells remained exquisitely sensitive to NEO218. Thus, our study identifies a mechanism by which tumor cells develop rapid resistance to 3-BP, and presents NEO218 as a superior agent not subject to this cellular defense. Furthermore, our results offer alternative interpretations of previously
Le, Wei; Qi, Lixin; Li, Jiaxuan; Wu, DengIong; Xu, Jun; Zhang, Jinfu
2016-01-01
The present study aims to examine the effect of low-dose ionizing irradiation on DNA double strand breaks (DSB) in mouse spermatogonial stem cells (SSCs) and reveal the underlying pathways for the DNA repair for DSB in SSCs. Eighteen one-month-old mice were divided into 6 groups and sacrificed separately at 45 minutes, 2 hours, 24 hours, 48 hours, and 72 hours after 0.1Gy X-ray irradiation (mice without receiving ionizing irradiation served as control). After perfusion fixation, testes were removed, sectioned, and followed by staining of γH2AX, 53BP1, Caspase 3, and promyelocytic leukemia zinc-finger (PLZF) for analysis among the different groups. The staining was observed by immunofluorescence visualized by confocal laser scanning. After low-dose irradiation, only 53BP1, but not Caspase3 or γH2AX was upregulated in PLZF positive SSCs within 45 minutes. The expression level of 53BP1 gradually decreased 24 hours after irradiation. Moreover, low-dose irradiation had no effect on the cell number and apoptotic status of SSCs. However other spermatogenic cells highly expressed γH2AX shortly after irradiation which was dramatically reduced following the events of DNA repair. It appears that low-dose ionizing irradiation may cause the DNA DSB of mouse spermatogenic cells. 53BP1, but not γH2AX, is involved in the DNA repair for DSB in SSCs. Our data indicates that 53BP1 plays an important role in the pathophysiological repair of DNA DSB in SSCs. This may open a new avenue to understanding the mechanisms of DNA repair of SSCs and male infertility.
Franck--Hertz experiment with higher excitation level measurements
International Nuclear Information System (INIS)
Liu, F.H.
1987-01-01
The measurement of the higher levels of 6 3 P 2 and 6 1 P 1 of the mercury atom in the Franck--Hertz experiment has been introduced into the junior and senior laboratory course by using a homemade tetrode Franck--Hertz tube. The main structure of the tube is described. The optimum operating conditions are in the temperature range between 130 and 150 0 C and the collector currents are of the order of 10 -9 A. The additional observations of the famous Franck--Hertz experiment in the laboratory course will give the students more familiarity with the quantum behavior of atoms
DEFF Research Database (Denmark)
Li, Yan; Thijs, Lutgarde; Boggia, José
2014-01-01
Experts proposed blood pressure (BP) load derived from 24-hour ambulatory BP recordings as a more accurate predictor of outcome than level, in particular in normotensive people. We analyzed 8711 subjects (mean age, 54.8 years; 47.0% women) randomly recruited from 10 populations. We expressed BP...... load as percentage (%) of systolic/diastolic readings ≥135/≥85 mm Hg and ≥120/≥70 mm Hg during day and night, respectively, or as the area under the BP curve (mm Hg×h) using the same ceiling values. During a period of 10.7 years (median), 1284 participants died and 1109 experienced a fatal or nonfatal...... cardiovascular end point. In multivariable-adjusted models, the risk of cardiovascular complications gradually increased across deciles of BP level and load (Pbased on 24-hour systolic or diastolic BP level (generalized R(2) statistic ≤0.294%; net...
Modeling and Prediction of Coal Ash Fusion Temperature based on BP Neural Network
Directory of Open Access Journals (Sweden)
Miao Suzhen
2016-01-01
Full Text Available Coal ash is the residual generated from combustion of coal. The ash fusion temperature (AFT of coal gives detail information on the suitability of a coal source for gasification procedures, and specifically to which extent ash agglomeration or clinkering is likely to occur within the gasifier. To investigate the contribution of oxides in coal ash to AFT, data of coal ash chemical compositions and Softening Temperature (ST in different regions of China were collected in this work and a BP neural network model was established by XD-APC PLATFORM. In the BP model, the inputs were the ash compositions and the output was the ST. In addition, the ash fusion temperature prediction model was obtained by industrial data and the model was generalized by different industrial data. Compared to empirical formulas, the BP neural network obtained better results. By different tests, the best result and the best configurations for the model were obtained: hidden layer nodes of the BP network was setted as three, the component contents (SiO2, Al2O3, Fe2O3, CaO, MgO were used as inputs and ST was used as output of the model.
Perceived Effectiveness of Professional Development Programs of Teachers at Higher Education Level
Malik, Sufiana Khatoon; Nasim, Uzma; Tabassum, Farkhanda
2015-01-01
The major purpose of the study was to assess the perceived effectiveness of professional development programs of teachers at higher educational level. The objectives of the study were: "to assess university level teachers'" opinion about effectiveness of professional development training with reference to quality teaching, to measure…
Directory of Open Access Journals (Sweden)
Hosseini, S.D.
2013-12-01
Full Text Available Brucellosis is a debilitative disease that imposes costs on both economy and society. It is shown that although the vaccine can prevent abortion, it does not provide complete protection against infection. In Iran, Brucella melitensis is a common causative agent for brucellosis and BP26 protein of this bacterium having a good antigenesity and an important vaccine candidate. In this study B. melitensis bp26 gene was cloned first in to PTZ57R/T vector and accessed on the PET28a vector and sequenced. Recombinant vector transformed and expressed in to E. coli BL21 (DE3 and then recombinant protein was purified with Ni-NTA column of chromatography against His tag. Obtained rOmp28 could be used as a research experimental tool to find its potential as a detection kit and vaccine candidate.
Directory of Open Access Journals (Sweden)
Maike Wolters
Full Text Available The recent obesity epidemic in children also showed an increase in the prevalence of hypertension. As blood pressure (BP is associated with (long-chain polyunsaturated fatty acids (LC PUFA, genetic variation in desaturase enzymes being involved in the synthesis of LC PUFA may be associated with BP. This study aimed to investigate the direct effects (independent of mediating variables and indirect effects (mediated through intermediate variables of a common variant in the FADS1 gene, rs174546, known to affect delta-5 desaturase (D5D activity on PUFA level, body mass index (BMI and BP.A subsample of the IDEFICS (Identification and prevention of dietary- and lifestyle-induced health effects in children and infants baseline survey including 520 children aged 2 to <10 years from six European countries was included. The association between rs174546 (T
Dai, Faxiang; Xuan, Yi; Jin, Jie-Jie; Yu, Shengjia; Long, Zi-Wen; Cai, Hong; Liu, Xiao-Wen; Zhou, Ye; Wang, Ya-Nong; Chen, Zhong; Huang, Hua
2017-04-25
C-terminal binding protein-2 (CtBP2), a transcriptional corepressor, has been reported to correlate with tumorigenesis and progression and predict a poor prognosis in several human cancers. However, few studies on CtBP2 in gastric cancer (GC) have been performed. In this research, we evaluated the correlations between CtBP2 expression and the clinicopathological characteristics, as well as prognosis of GC patients. The effects of silencing CtBP2 expression on GC cells biology activity were also assessed. The results showed that CtBP2 was overexpressed in GC tissues and closely correlated with poor differentiation, advanced tumor stage and poor prognosis in GC patients. CtBP2 induced epithelial-to-mesenchymal transition (EMT) and repressed PTEN to increase proliferation rate, migration, and invasion in GC cells. Silencing CtBP2 inhibited GC growth in nude mice model. In conclusion, CtBP2 is overexpressed in GC and may accelerate GC tumorigenesis and metastasis, which could represent an independent prognostic marker and promising therapeutic target for GC.
Directory of Open Access Journals (Sweden)
Greenfield Sheila
2010-08-01
Full Text Available Abstract Background Blood pressure (BP lowering in people who have had a stroke or transient ischaemic attack (TIA leads to reduced risk of further stroke. However, it is not clear what the target BP should be, since intensification of therapy may lead to additional adverse effects. PAST BP will determine whether more intensive BP targets can be achieved in a primary care setting, and whether more intensive therapy is associated with adverse effects on quality of life. Methods/Design This is a randomised controlled trial (RCT in patients with a past history of stroke or TIA. Patients will be randomised to two groups and will either have their blood pressure (BP lowered intensively to a target of 130 mmHg systolic, (or by 10 mmHg if the baseline systolic pressure is between 125 and 140 mmHg compared to a standard group where the BP will be reduced to a target of 140 mmHg systolic. Patients will be managed by their practice at 1-3 month intervals depending on level of BP and followed-up by the research team at six monthly intervals for 12 months. 610 patients will be recruited from approximately 50 general practices. The following exclusion criteria will be applied: systolic BP The primary outcome will be change in systolic BP over twelve months. Secondary outcomes include quality of life, adverse events and cardiovascular events. In-depth interviews with 30 patients and 20 health care practitioners will be undertaken to investigate patient and healthcare professionals understanding and views of BP management. Discussion The results of this trial will inform whether intensive blood pressure targets can be achieved in people who have had a stroke or TIA in primary care, and help determine whether or not further research is required before recommending such targets for this population. Trial Registration ISRCTN29062286
Seeking a Higher Level of Arts Integration across the Curriculum
Sotiropoulou-Zormpala, Marina
2016-01-01
To seek a higher level of arts integration across the education curriculum, I investigated designs of teaching through arts activities that would motivate educators to adopt the spirit of "aesthetic teaching." Two different designs were tested, with the second as a continuation of the first. Each ascribes a different educational role to…
Spontaneous 8bp Deletion in Nbeal2 Recapitulates the Gray Platelet Syndrome in Mice
Tomberg, Kärt; Khoriaty, Rami; Westrick, Randal J.; Fairfield, Heather E.; Reinholdt, Laura G.; Brodsky, Gary L.; Davizon-Castillo, Pavel; Ginsburg, David; Di Paola, Jorge
2016-01-01
During the analysis of a whole genome ENU mutagenesis screen for thrombosis modifiers, a spontaneous 8 base pair (bp) deletion causing a frameshift in exon 27 of the Nbeal2 gene was identified. Though initially considered as a plausible thrombosis modifier, this Nbeal2 mutation failed to suppress the synthetic lethal thrombosis on which the original ENU screen was based. Mutations in NBEAL2 cause Gray Platelet Syndrome (GPS), an autosomal recessive bleeding disorder characterized by macrothrombocytopenia and gray-appearing platelets due to lack of platelet alpha granules. Mice homozygous for the Nbeal2 8 bp deletion (Nbeal2gps/gps) exhibit a phenotype similar to human GPS, with significantly reduced platelet counts compared to littermate controls (p = 1.63 x 10−7). Nbeal2gps/gps mice also have markedly reduced numbers of platelet alpha granules and an increased level of emperipolesis, consistent with previously characterized mice carrying targeted Nbeal2 null alleles. These findings confirm previous reports, provide an additional mouse model for GPS, and highlight the potentially confounding effect of background spontaneous mutation events in well-characterized mouse strains. PMID:26950939
Spontaneous 8bp Deletion in Nbeal2 Recapitulates the Gray Platelet Syndrome in Mice.
Directory of Open Access Journals (Sweden)
Kärt Tomberg
Full Text Available During the analysis of a whole genome ENU mutagenesis screen for thrombosis modifiers, a spontaneous 8 base pair (bp deletion causing a frameshift in exon 27 of the Nbeal2 gene was identified. Though initially considered as a plausible thrombosis modifier, this Nbeal2 mutation failed to suppress the synthetic lethal thrombosis on which the original ENU screen was based. Mutations in NBEAL2 cause Gray Platelet Syndrome (GPS, an autosomal recessive bleeding disorder characterized by macrothrombocytopenia and gray-appearing platelets due to lack of platelet alpha granules. Mice homozygous for the Nbeal2 8 bp deletion (Nbeal2gps/gps exhibit a phenotype similar to human GPS, with significantly reduced platelet counts compared to littermate controls (p = 1.63 x 10-7. Nbeal2gps/gps mice also have markedly reduced numbers of platelet alpha granules and an increased level of emperipolesis, consistent with previously characterized mice carrying targeted Nbeal2 null alleles. These findings confirm previous reports, provide an additional mouse model for GPS, and highlight the potentially confounding effect of background spontaneous mutation events in well-characterized mouse strains.
18 Ka BP records of climatic changes, Bay of Bengal: Isotopic and sedimentological evidences
Digital Repository Service at National Institute of Oceanography (India)
Chauhan, O.S.; Suneethi, J.
are also identified at 10.3 and 11.5 Ka BP. The later event matches well with that of the ‘Younger Dryas’ event of world climate models. The beginning of the Holocene is marked by lighter d18O values (at around 9.5 Ka BP), which has been interpreted...
CtBP1/BARS Gly172 → Glu mutant structure: Impairing NAD(H)-binding and dimerization
International Nuclear Information System (INIS)
Nardini, Marco; Valente, Carmen; Ricagno, Stefano; Luini, Alberto; Corda, Daniela; Bolognesi, Martino
2009-01-01
C-terminal binding proteins (CtBPs) are multi-functional proteins involved in nuclear transcriptional co-repression, Golgi membrane fission, and synaptic ribbon formation. Binding of NAD(H) to CtBPs promotes dimerization. CtBP dimers act as a scaffold for multimeric protein complex formation, thus bridging transcriptional repressors and their targets in the nucleus. Based on size-exclusion chromatography experiments and on the crystal structure of the NAD(H)-free G172E CtBP mutant, we show here that absence of NAD(H) induces flexibility/backbone conformational changes at the dimerization interface and at the CtBP interdomain region. The results presented shed first light on the correlation between NAD(H)-binding and functional CtBP dimerization.
Huang, Ai; Yao, Jing; Liu, Tao; Lin, Zhenyu; Zhang, Sheng; Zhang, Tao; Ma, Hong
2018-04-01
This study aimed to investigate the influence of the expression of P53-binding protein 1 (53BP1), a key component in DNA damage repair pathways, on the radiosensitizing effect of icotinib hydrochloride in colorectal cancer and to elucidate the mechanisms underlying this influence. Real-time RT-PCR and Western blotting were performed to verify the gene-knockout effect of 53BP1 small hairpin RNA (ShRNA), and colony formation assay was employed to investigate the influence of 53BP1 downregulation on the radiosensitizing effect of icotinib hydrochloride in HCT116 cells. Cell apoptosis, cell cycle distributions, and histone H2AX (γ-H2AX) fluorescence foci after 53BP1 knockdown were evaluated. Relative protein expression in the ataxia telangiectasia mutated kinase (ATM)-checkpoint kinase-2 (CHK2)-P53 pathway was measured by Western blot analysis to unravel the molecular mechanisms linking the pathway to the above phenomena. Icotinib hydrochloride increased the radiosensitivity of HCT116 cells; however, this effect was suppressed by the downregulation of 53BP1 expression, a change that inhibited cell apoptosis, increased the percentage of HCT116 cells arrested in S-phase and inhibited the protein expression of key molecules in the ATM-CHK2-P53 apoptotic pathway. Our studies confirmed that the loss of 53BP1 serves as a negative regulator of the radiosensitizing effect of icotinib in part by suppressing the ATM-CHK2-P53 apoptotic pathway.
EST Table: BP183486 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti
The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity
Abulfaraj, Aala A.; Mariappan, Kiruthiga; Bigeard, Jean; Manickam, Prabhu; Blilou, Ikram; Guo, Xiujie; Al-Babili, Salim; Pflieger, Delphine; Hirt, Heribert; Rayapuram, Naganand
2018-01-01
Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.
The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity
Abulfaraj, Aala Abdulaziz Hussien
2018-05-31
Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.
Bonanno, Laura; Costa, Carlota; Majem, Margarita; Sanchez, Jose Javier; Gimenez-Capitan, Ana; Rodriguez, Ignacio; Vergenegre, Alain; Massuti, Bartomeu; Favaretto, Adolfo; Rugge, Massimo; Pallares, Cinta; Taron, Miquel; Rosell, Rafael
2013-01-01
Platinum-based chemotherapy is the standard first-line treatment for non-oncogene-addicted non-small cell lung cancers (NSCLCs) and the analysis of multiple DNA repair genes could improve current models for predicting chemosensitivity. We investigated the potential predictive role of components of the 53BP1 pathway in conjunction with BRCA1. The mRNA expression of BRCA1, MDC1, CASPASE3, UBC13, RNF8, 53BP1, PIAS4, UBC9 and MMSET was analyzed by real-time PCR in 115 advanced NSCLC patients treated with first-line platinum-based chemotherapy. Patients expressing low levels of both BRCA1 and 53BP1 obtained a median progression-free survival of 10.3 months and overall survival of 19.3 months, while among those with low BRCA1 and high 53BP1 progression-free survival was 5.9 months (P <0.0001) and overall survival was 8.2 months (P=0.001). The expression of 53BP1 refines BRCA1-based predictive modeling to identify patients most likely to benefit from platinum-based chemotherapy. PMID:24197907
Directory of Open Access Journals (Sweden)
Smita Srivastava
2008-05-01
Full Text Available Vpx is a small virion-associated adaptor protein encoded by viruses of the HIV-2/SIVsm lineage of primate lentiviruses that enables these viruses to transduce monocyte-derived cells. This probably reflects the ability of Vpx to overcome an as yet uncharacterized block to an early event in the virus life cycle in these cells, but the underlying mechanism has remained elusive. Using biochemical and proteomic approaches, we have found that Vpx protein of the pathogenic SIVmac 239 strain associates with a ternary protein complex comprising DDB1 and VprBP subunits of Cullin 4-based E3 ubiquitin ligase, and DDA1, which has been implicated in the regulation of E3 catalytic activity, and that Vpx participates in the Cullin 4 E3 complex comprising VprBP. We further demonstrate that the ability of SIVmac as well as HIV-2 Vpx to interact with VprBP and its associated Cullin 4 complex is required for efficient reverse transcription of SIVmac RNA genome in primary macrophages. Strikingly, macrophages in which VprBP levels are depleted by RNA interference resist SIVmac infection. Thus, our observations reveal that Vpx interacts with both catalytic and regulatory components of the ubiquitin proteasome system and demonstrate that these interactions are critical for Vpx ability to enable efficient SIVmac replication in primary macrophages. Furthermore, they identify VprBP/DCAF1 substrate receptor for Cullin 4 E3 ubiquitin ligase and its associated protein complex as immediate downstream effector of Vpx for this function. Together, our findings suggest a model in which Vpx usurps VprBP-associated Cullin 4 ubiquitin ligase to enable efficient reverse transcription and thereby overcome a block to lentivirus replication in monocyte-derived cells, and thus provide novel insights into the underlying molecular mechanism.
PRE-SERVICE MATHEMATICS TEACHERS’ CONCEPTION OF HIGHER-ORDER THINKING LEVEL IN BLOOM'S TAXONOMY
Damianus D Samo
2017-01-01
The purpose of this study is to explore pre-service mathematics teachers' conception of higher-order thinking in Bloom's Taxonomy, to explore pre-service mathematics teachers' ability in categorizing six cognitive levels of Bloom's Taxonomy as lower-order thinking and higher-order thinking, and pre-service mathematics teachers' ability in identifying some questionable items as lower-order and higher-order thinking. The higher-order thinking is the type of non-algorithm thinking which include ...
Garfinkel, Benjamin P; Arad, Shiri; Le, Phuong T; Bustin, Michael; Rosen, Clifford J; Gabet, Yankel; Orly, Joseph
2015-12-01
Heterochromatin protein 1 binding protein 3 (HP1BP3) is a recently described histone H1-related protein with roles in chromatin structure and transcriptional regulation. To explore the potential physiological role of HP1BP3, we have previously described an Hp1bp3(-/-) mouse model with reduced postnatal viability and growth. We now find that these mice are proportionate dwarfs, with reduction in body weight, body length, and organ weight. In addition to their small size, microcomputed tomography analysis showed that Hp1bp3(-/-) mice present a dramatic impairment of their bone development and structure. By 3 weeks of age, mice of both sexes have severely impaired cortical and trabecular bone, and these defects persist into adulthood and beyond. Primary cultures of both osteoblasts and osteoclasts from Hp1bp3(-/-) bone marrow and splenocytes, respectively, showed normal differentiation and function, strongly suggesting that the impaired bone accrual is due to noncell autonomous systemic cues in vivo. One major endocrine pathway regulating both body growth and bone acquisition is the IGF regulatory system, composed of IGF-1, the IGF receptors, and the IGF-binding proteins (IGFBPs). At 3 weeks of age, Hp1bp3(-/-) mice exhibited a 60% reduction in circulating IGF-1 and a 4-fold increase in the levels of IGFBP-1 and IGFBP-2. These alterations were reflected in similar changes in the hepatic transcripts of the Igf1, Igfbp1, and Igfbp2 genes. Collectively, these results suggest that HP1BP3 plays a key role in normal growth and bone development by regulating transcription of endocrine IGF-1 components.
Sea level and global ice volumes from the Last Glacial Maximum to the Holocene.
Lambeck, Kurt; Rouby, Hélène; Purcell, Anthony; Sun, Yiying; Sambridge, Malcolm
2014-10-28
The major cause of sea-level change during ice ages is the exchange of water between ice and ocean and the planet's dynamic response to the changing surface load. Inversion of ∼1,000 observations for the past 35,000 y from localities far from former ice margins has provided new constraints on the fluctuation of ice volume in this interval. Key results are: (i) a rapid final fall in global sea level of ∼40 m in sea level, the main phase of deglaciation occurred from ∼16.5 ka BP to ∼8.2 ka BP at an average rate of rise of 12 m⋅ka(-1) punctuated by periods of greater, particularly at 14.5-14.0 ka BP at ≥40 mm⋅y(-1) (MWP-1A), and lesser, from 12.5 to 11.5 ka BP (Younger Dryas), rates; (iv) no evidence for a global MWP-1B event at ∼11.3 ka BP; and (v) a progressive decrease in the rate of rise from 8.2 ka to ∼2.5 ka BP, after which ocean volumes remained nearly constant until the renewed sea-level rise at 100-150 y ago, with no evidence of oscillations exceeding ∼15-20 cm in time intervals ≥200 y from 6 to 0.15 ka BP.
Hydraulic Pump Fault Diagnosis Control Research Based on PARD-BP Algorithm
Directory of Open Access Journals (Sweden)
LV Dongmei
2014-12-01
Full Text Available Combining working principle and failure mechanism of RZU2000HM hydraulic press, with its present fault cases being collected, the working principle of the oil pressure and faults phenomenon of the hydraulic power unit –swash-plate axial piston pump were studied with some emphasis, whose faults will directly affect the dynamic performance of the oil pressure and flow. In order to make hydraulic power unit work reliably, PARD-BP (Pruning Algorithm based Random Degree neural network fault algorithm was introduced, with swash-plate axial piston pump’s vibration fault sample data regarded as input, and fault mode matrix regarded as target output, so that PARD-BP algorithm could be trained. In the end, the vibration results were verified by the vibration modal test, and it was shown that the biggest upward peaks of vacuum pump in X-direction, Y-direction and Z- direction have fallen by 30.49 %, 21.13 % and 18.73 % respectively, so that the reliability of the fact that PARD-BP algorithm could be used for the online fault detection and diagnosis of the hydraulic pump was verified.
Late Holocene higher sea level and its radiocarbon dates in Okierabu-jima, Ryukyus
International Nuclear Information System (INIS)
Koba, Motoharu; Omoto, Kunio; Takahashi, Tatsuo.
1980-01-01
Okierabu-jima of the Ryukyu Islands, which is a poly-terraced Pleistocene raised coral reef island, doesn't have a Holocene raised coral reef, but coastal erosional features showing higher sea levels in Holocene. The authors obtained some data indicating the period of one of the Holocene higher sea levels. All radiocarbon dates concerning Okierabu-jima's Holocene sea-level changes are plotted on the date-height coordinates. The paleo sea level between 5000 and 2000 y. B. P. lies above the broken line drawn from 6 m below to 2.18 m above the present sea level. The period of the highest sea level in Holocene seems to be about 3000 to 2000 y. B. P. in this island. Its height is presumably 2.4 m a. s. l. derived on an average from heights of stacks and coastal benches in the almost all coasts of the island (Koba, 1974). Beach rocks were already formed at the landward extremity of the reef flat corresponding to the almost present sea level about 1300 y. B. P. (author)
Directory of Open Access Journals (Sweden)
Hanna Yuanita Dana Santoso
2017-08-01
Full Text Available Objective: WHO recommends Mobile health, a practice of medicine and public health supported by mobile devices, to improve community health status and change people's behavior for the health purposes. The present study sought to examine the effectiveness of the android application program of Suami Siaga Plus in increasing husband’s scores in birth preparedness and complication readiness (BP/CR intervention.Materials and methods: It was a randomized controlled trial with pretest-posttest design. A total of 38 couples of husbands and pregnant women from three health centers at three sub districts in Semarang was selected by proportional systematic random sampling technique and equally distributed into control and intervention group. A questionnaire related to BP/CR published by JHPIEGO was employed in data collection. Statistical analysis was performed to obtain the frequency distribution and percentage of the variables, and also to assess the mean difference of BP/CR score of husbands.Results: Husbands’ knowledge of key danger signs and five standard elements in BP/CR practices in both intervention and control group increased after counseling. Moreover, the proportion of husbands who understand the key danger signs during pregnancy was higher among those who were exposed by Suami Siaga Plus application delivered via mobile phone. Counseling only increased husbands’ score from 61.5 to 62.6 (2%, whilst the combination of counseling and the application boosted 20% of husbands’ score from 60.4 to 72.9 (p-value 0.000.Conclusion: A combination of counseling and Suami Siaga Plus application significantly improves husbands and wives’ score on BP/CR compared to those who received counseling only. The data suggests the application would be able to suppress the three delays, which in turn can reduce the maternal mortality rate. The study results could be important information for the Department of Health and health professionals to use android
Kario, Kazuomi; Tomitani, Naoko; Buranakitjaroen, Peera; Chen, Chen-Huan; Chia, Yook-Chin; Divinagracia, Romeo; Park, Sungha; Shin, Jinho; Siddique, Saulat; Sison, Jorge; Soenarta, Arieska Ann; Sogunuru, Guru Prasad; Tay, Jam Chin; Turana, Yuda; Wang, Ji-Guang; Wong, Lawrence; Zhang, Yuqing; Wanthong, Sirisawat; Hoshide, Satoshi; Kanegae, Hiroshi
2018-01-01
Home blood pressure (BP) monitoring is endorsed in multiple guidelines as a valuable adjunct to office BP measurements for the diagnosis and management of hypertension. In many countries throughout Asia, physicians are yet to appreciate the significant contribution of BP variability to cardiovascular events. Furthermore, data from Japanese cohort studies have shown that there is a strong association between morning BP surge and cardiovascular events, suggesting that Asians in general may benefit from more effective control of morning BP. We designed the Asia BP@Home study to investigate the distribution of hypertension subtypes, including white-coat hypertension, masked morning hypertension, and well-controlled and uncontrolled hypertension. The study will also investigate the determinants of home BP control status evaluated by the same validated home BP monitoring device and the same standardized method of home BP measurement among 1600 or more medicated patients with hypertension from 12 countries/regions across Asia. ©2017 Wiley Periodicals, Inc.
Phase 1 remedial investigation report for 200-BP-1 operable unit. Volume 1
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit.
Postglacial relative sea level change at Fildes Peninsula, King George Island (West Antarctic
Directory of Open Access Journals (Sweden)
K. V. Polishchuk
2016-01-01
Full Text Available Analysis and integration of data obtained in our field and laboratory investigations of 2008–2012 together with results of previous paleogeographic studies were conducted to reveal parameters and factors of the post-glacial changes in the relative sea-level on the Fildes Peninsula and the King George Island. Results of dating of organic material taken from cross-sections of Quaternary deposits, data on morphology of marine landforms as well as on bottom sediments in lakes were used to construct a curve of changes in the relative sea-level.Our research has shown that the rapid rise of relative sea level in the area (since the beginning of the Holocene decelerated about 8000 years BP, achieving its maximum about 7000 years BP. This was followed by the fall of relative sea-level (the land elevation by 18–20 m in total, and it was characterized by relatively high rate of fall during periods of 6000– 5000 years BP, 4000–2500 years BP, and during the last 1500 years; the rate decreased in 5000–4000 years BP and 2500– 1600 years BP. The changes in relative sea level in this region were determined by the following factors: the eustatic component of the global changes in sea-level and, possibly, oscillations in the global sea level of another nature; local parameters of the Last glacial maximum; a course of the Peninsula deglaciation; regional physical characteristics of the Earth's crust and the mantle substances; local tectonic processes, including the isostatic rebound. Since the beginning of the Holocene up to about 7000 years BP, the main contribution to changes of the relative sea-level in this area was made by the global eustatic factor. The subsequent fall of the relative sea-level (elevation of the Peninsula surface proceeded under condition of reduced role of the eustatic factor and predominance of other factors.
Higher glucose levels associated with lower memory and reduced hippocampal microstructure.
Kerti, Lucia; Witte, A Veronica; Winkler, Angela; Grittner, Ulrike; Rujescu, Dan; Flöel, Agnes
2013-11-12
For this cross-sectional study, we aimed to elucidate whether higher glycosylated hemoglobin (HbA1c) and glucose levels exert a negative impact on memory performance and hippocampal volume and microstructure in a cohort of healthy, older, nondiabetic individuals without dementia. In 141 individuals (72 women, mean age 63.1 years ± 6.9 SD), memory was tested using the Rey Auditory Verbal Learning Test. Peripheral levels of fasting HbA1c, glucose, and insulin and 3-tesla MRI scans were acquired to assess hippocampal volume and microstructure, as indicated by gray matter barrier density. Linear regression and simple mediation models were calculated to examine associations among memory, glucose metabolism, and hippocampal parameters. Lower HbA1c and glucose levels were significantly associated with better scores in delayed recall, learning ability, and memory consolidation. In multiple regression models, HbA1c remained strongly associated with memory performance. Moreover, mediation analyses indicated that beneficial effects of lower HbA1c on memory are in part mediated by hippocampal volume and microstructure. Our results indicate that even in the absence of manifest type 2 diabetes mellitus or impaired glucose tolerance, chronically higher blood glucose levels exert a negative influence on cognition, possibly mediated by structural changes in learning-relevant brain areas. Therefore, strategies aimed at lowering glucose levels even in the normal range may beneficially influence cognition in the older population, a hypothesis to be examined in future interventional trials.
Directory of Open Access Journals (Sweden)
K. Seelos
2010-03-01
Full Text Available A high resolution continuous reconstruction of last glacial wind directions is based on provenance analysis of eolian sediments in a sediment core from the Dehner dry Maar in the Eifel region (Germany. This Maar is suitable to archive easterly wind directions due to its location west of the Devonian carbonate basins of the Eifel-North-South-Zone. Thus, eolian sediments with high clastic carbonate content can be interpreted as an east wind signal. The detection of such east wind sediments is applied by a new module of the RADIUS grain size analyze technique. The investigated time period from 40.3–12.9 ka BP can be subclassified in three units: The first unit covers the periods of the ending GIS-9, H4, and GIS-8. With the exception of H4 (40–38 ka BP the content of organics in our record is relatively high. With the end of GIS-8 (38–36.5 ka the content of organics decrease and the content of dust increases rapidly. The second time slice (36–24 ka BP has an increased content of dust accumulation and a high amount of east winds layers (up to 19% of the dust storms per century came from the east. In comparison, the subsequent period (24–12.9 ka BP is characterized by lower east wind sediments again. Increased frequencies of east wind occur during the time intervals corresponding with the Heinrich events H1 and H2. The unusual H3 show no higher east wind frequency but so do its former and subsequent Greenland stadials. The late LGM (21–18 ka BP is characterized by a slightly elevated east wind frequency again.
Ojo, Oluwaseun S; Malomo, Sunday O; Sogunle, Peter T
2016-01-01
Nonadherence to therapeutic plans has been reported among hypertensive patients. Researchers have also shown that adherence to therapeutic plans improves if motivation in the form of social support is provided. There is a dearth of local studies that explore the influence of family support on treatment outcomes of hypertensive patients. The aim of the study was to determine the relationship between BP control and perceived family support in patients with essential hypertension seen at a primary care setting in Western Nigeria. This was a cross-sectional hospital-based study. Systematic random sampling technique was used in selecting 360 hypertensive respondents between April and July 2013. Data were collected through a pretested interviewer-administered questionnaire and a standardized tool, Perceived Social Support Family Scale, which measured the respondents' level of perceived family support. Statistical Package for Social Sciences (SPSS) version 17.0 was used to analyze data. The majority of the respondents were middle-aged (61.1%) and female (59.4%). Blood pressure (BP) was controlled in 46.4% of the respondents. Most of the respondents (79.4%) had "strong" perceived family support. Strong perceived family support (odds ratio [OR] 4.778, 95% confidence interval [CI] =2.569-8.887) and female gender (OR 1.838, 95% CI = 1.177-2.869) were independent predictors of controlled BP. The proportion of hypertensive patients with optimal BP control is low in this practice setting. The positive association between BP control and perceived family support emphasizes the need for physicians to reflect on the available family support when managing hypertensive patients.
Prediction of size-fractionated airborne particle-bound metals using MLR, BP-ANN and SVM analyses.
Leng, Xiang'zi; Wang, Jinhua; Ji, Haibo; Wang, Qin'geng; Li, Huiming; Qian, Xin; Li, Fengying; Yang, Meng
2017-08-01
Size-fractionated heavy metal concentrations were observed in airborne particulate matter (PM) samples collected from 2014 to 2015 (spanning all four seasons) from suburban (Xianlin) and industrial (Pukou) areas in Nanjing, a megacity of southeast China. Rapid prediction models of size-fractionated metals were established based on multiple linear regression (MLR), back propagation artificial neural network (BP-ANN) and support vector machine (SVM) by using meteorological factors and PM concentrations as input parameters. About 38% and 77% of PM 2.5 concentrations in Xianlin and Pukou, respectively, were beyond the Chinese National Ambient Air Quality Standard limit of 75 μg/m 3 . Nearly all elements had higher concentrations in industrial areas, and in winter among the four seasons. Anthropogenic elements such as Pb, Zn, Cd and Cu showed larger percentages in the fine fraction (ø≤2.5 μm), whereas the crustal elements including Al, Ba, Fe, Ni, Sr and Ti showed larger percentages in the coarse fraction (ø > 2.5 μm). SVM showed a higher training correlation coefficient (R), and lower mean absolute error (MAE) as well as lower root mean square error (RMSE), than MLR and BP-ANN for most metals. All the three methods showed better prediction results for Ni, Al, V, Cd and As, whereas relatively poor for Cr and Fe. The daily airborne metal concentrations in 2015 were then predicted by the fully trained SVM models and the results showed the heaviest pollution of airborne heavy metals occurred in December and January, whereas the lightest pollution occurred in June and July. Copyright © 2017 Elsevier Ltd. All rights reserved.
The First Report of a 290-bp Deletion in β-Globin Gene in the South of Iran
Hamid, Mohammad; Nejad, Ladan Dawoody; Shariati, Gholamreza; Galehdari, Hamid; Saberi, Alihossein; Mohammadi-Anaei, Marziye
2017-01-01
Background: β-thalassemia is one of the most widespread diseases in the world, including Iran. In this study, we reported, for the first time, a 290-bp β-globin gene deletion in the south of Iran. Methods: Four individuals from three unrelated families with Arabic ethnic background were studied in Khuzestan Province. Red blood cell indices and hemoglobin analysis were carried out according to the standard methods. Genomic DNA was obtained from peripheral blood cells by salting out procedures. β-globin gene amplification, multiplex ligation-dependent probe amplification (MLPA), and DNA sequencing were performed. Results: The PCR followed by sequencing and MLPA test of the β-globin gene confirmed the presence of a 290-bp deletion in the heterozygous form, along with -88C>A mutation. All the individuals had elevated hemoglobin A2 and normal fetal hemoglobin levels. Conclusions: This mutation causes β0-thalassemia and can be highly useful for prenatal diagnosis in compound heterozygous condition with different β-globin gene mutations. PMID:26948378
Directory of Open Access Journals (Sweden)
Zhang JJ
2017-08-01
Full Text Available Jingjing Zhang,1,* Qing Ji,2,* Chunhua Jiao,3,* Lihua Ren,4 Ye Zhao,4 Yanfang Chen,4 Ruihua Shi,4 Yadong Feng4 1State Key Laboratory of Reproductive Medicine, Department of Prenatal Diagnosis, Obstetrics and Gynecology Hospital Affiliated to Nanjing Medical University, Nanjing, 2Department of Emergency, Jingjiang People’s Hospital, Jingjiang, 3Department of Gastroenterology, First Affiliated Hospital with Nanjing Medical University, 4Department of Gastroenterology, Zhongda Hospital, School of Medicine, Southeast University, Nanjing, People’s Republic of China *These authors contributed equally to this work Background: The clinical significance of insulin-like growth factor-II mRNA-binding protein-3 (IGF2BP3 in esophageal high-grade intraepithelial neoplasia (HGIN is not clear. This study was designed to characterize the expression of IGF2BP3 in HGIN. Patients and methods: IGF2BP3 expression was evaluated by Western blot analyses in 12 cases and by immunohistochemistry (IHC in 112 cases. The associations between IGF2BP3 expression in HGIN and the clinicopathological parameters were examined. Results: Moderate to strong IGF2BP3 expression was present in HGIN samples. Using IHC, it was found that IGF2BP3 was positive in 68 (60.71% cases. Intense IHC of IGF2BP3 in HGIN was associated with a deeper lesion depth, and the lesion depth was the only predictor of the positive expression of IGF2BP3. Conclusion: Our results suggested that IGF2BP3 may be a supplementary tissue marker for preoperative diagnosis of HGIN. Keywords: esophageal squamous cell carcinoma, precancerous lesion, immunohistochemistry detection, early diagnosis
Factors identified with higher levels of career satisfaction of physicians in Andalusia, Spain
Directory of Open Access Journals (Sweden)
Juan Nicolás Peña-Sánchez
2014-09-01
Full Text Available The satisfaction of physicians is a world-wide issue linked with the quality of health services; their satisfaction needs to be studied from a multi-dimensional perspective, considering lower- and higher-order needs. The objectives of this study were to: i measure the career satisfaction of physicians; ii identify differences in the dimensions of career satisfaction; and iii test factors that affect higher- and lower-order needs of satisfaction among physicians working in Andalusian hospitals (Spain. Forty-one percent of 299 eligible physicians participated in a study conducted in six selected hospitals. Physicians reported higher professional, inherent, and performance satisfaction than personal satisfaction. Foreign physicians reported higher levels of personal and performance satisfaction than local physicians, and those who received non-monetary incentives had higher professional and performance satisfaction. In conclusion, physicians in the selected Andalusian hospitals reported low levels of personal satisfaction. Non-monetary incentives were more relevant to influence their career satisfaction. Further investigations are recommended to study differences in the career satisfaction between foreign and local physicians.
Area near Monkman, B.C., becoming world class exploration play, BP says
International Nuclear Information System (INIS)
Anon.
1992-01-01
This paper reports on two major oil companies in the western Canada sedimentary basin which have completed several significant gas discoveries, including a well with one of the highest flow rates ever in Canada. BP Canada Inc. completed discoveries at its Brazion and Burnt River wells in the Monkman area of northeastern British Columbia. The Monkman area is developing into a world class natural gas exploration play. Meanwhile, Amoco Canada Petroleum Co. Ltd. completed four Alberta gas discoveries in 1991 and participated with BP and PetroCanada Inc. in four British Columbia discoveries
Energy Technology Data Exchange (ETDEWEB)
Navarro Hervas, F.; Rodriguez Estrella, T.; Carrion Garcia, J. S.; Ros Sala, M. M.; Fernandez Jimenez, S.; Garcia Martinez, M. S.; Mancheno Jimenez, M. A.; Alvarez Rogel, Y.
2009-07-01
Here we describe a formerly unrecognized dry spell dated at between c. 4330 and 3950 radiocarbon years BP, and located in the Puerto de Mazarron (Murcia, southeastern Spain). The palaeoclimatical inference is provided by halite levels within a long sequence of a multiple core study carried in a palaeo-lagoon. The lithological inference is corroborated by palynological records involving a forest depletion. The event is also linked to a population decline in the study region. (Author) 6 refs.
Initiation of sulfonylureas versus metformin is associated with higher blood pressure at one year.
Roumie, Christianne L; Liu, Xulei; Choma, Neesha N; Greevy, Robert A; Hung, Adriana M; Grijalva, Carlos G; Griffin, Marie R
2012-05-01
To determine if incident oral antidiabetic drug (OAD) use was associated with 12-month systolic blood pressure (BP) and if this was mediated through body mass index (BMI) changes. A retrospective cohort of veterans with hypertension who initiated metformin (n = 2057) or sulfonylurea (n = 1494) between 1 January 2000 and 31 December 2007 in the Veterans Administration Mid-South Network was assembled. Patients were included if they had complete covariates, including 12-month BP and BMI, and persisted on therapy for 12 months. Linear regression was conducted to investigate the effect of OADs on 12-month systolic BP adjusting for demographics, glycated hemoglobin, creatinine, BMI, health care utilization, and comorbidities, including cardiovascular disease (CVD). A second analysis examined if these effects were mediated by BMI change. The secondary outcome was the proportion of patients who had a controlled BP (≤ 140/90 mmHg) at 12 months adjusted for baseline BP and covariates. Patients were white (82%) males (97%) with median age of 64 years (interquartile range [IQR] 57, 72), and 27% had history of CVD. Sulfonylurea users had a 1.33 mmHg (0.16, 2.50, p = 0.03) higher 12-month systolic BP than metformin users. The median change in BMI from OAD initiation to 12 months was -0.76 (IQR -1.78, 0.07) and 0.21 (IQR -0.57, 1.03) among metformin and sulfonylurea users, respectively. In a model adjusting for BMI change, the difference in 12-month systolic BP between sulfonylurea and metformin users became insignificant (0.23 (-1.00, 1.45), p = 0.72), while one BMI unit change was associated with an increase in 12-month systolic BP of 1.07 mmHg (0.74, 1.40, p metformin patients had controlled BP versus 64.2% of sulfonylurea patients (p = 0.01). Compared with metformin, sulfonylurea initiation was associated with increased systolic BP at 12 months, which appears to be mediated by the differential effects of these drugs on BMI. Copyright © 2012 John Wiley & Sons, Ltd.
Intake of Lutein-Rich Vegetables Is Associated with Higher Levels of Physical Activity
Directory of Open Access Journals (Sweden)
Georgina Crichton
2015-09-01
Full Text Available Levels of physical inactivity, a major contributor to burden of disease, are high in many countries. Some preliminary research suggests that circulating lutein concentrations are associated with high levels of physical activity (PA. We aimed to assess whether the intake of lutein-containing foods, including vegetables and eggs, is associated with levels of PA in two studies conducted in different countries. Dietary data and PA data collected from participants in two cross-sectional studies: the Maine-Syracuse Longitudinal Study (MSLS, conducted in Central New York, USA (n = 972, and the Observation of Cardiovascular Risk Factors in Luxembourg Study (ORISCAV-LUX (n = 1331 were analyzed. Higher intakes of lutein containing foods, including green leafy vegetables, were associated with higher levels of PA in both study sites. Increasing the consumption of lutein-rich foods may have the potential to impact positively on levels of PA. This needs to be further explored in randomized controlled trials.
Pilot-scale treatability test plan for the 200-BP-5 operable unit
International Nuclear Information System (INIS)
1994-08-01
This document presents the treatability test plan for pilot-scale pump and treat testing at the 200-BP-5 Operable Unit. This treatability test plan has been prepared in response to an agreement between the U.S. Department of Energy (DOE), the U.S. Environmental Protection Agency (EPA), and the State of Washington Department of Ecology (Ecology), as documented in Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement, Ecology et al. 1989a) Change Control Form M-13-93-03 (Ecology et al. 1994) and a recent 200 NPL Agreement Change Control Form (Appendix A). The agreement also requires that, following completion of the activities described in this test plan, a 200-BP-5 Operable Unit Interim Remedial Measure (IRM) Proposed Plan be developed for use in preparing an Interim Action Record of Decision (ROD). The IRM Proposed Plan will be supported by the results of this treatability test plan, as well as by other 200-BP-5 Operable Unit activities (e.g., development of a qualitative risk assessment). Once issued, the Interim Action ROD will specify the interim action(s) for groundwater contamination at the 200-BP-5 Operable Unit. The treatability test approach is to conduct a pilot-scale pump and treat test for each of the two contaminant plumes associated with the 200-BP-5 Operable Unit. Primary contaminants of concern are 99 Tc and 60 Co for underwater affected by past discharges to the 216-BY Cribs, and 90 Sr, 239/240 Pu, and Cs for groundwater affected by past discharges to the 216-B-5 Reverse Well. The purpose of the pilot-scale treatability testing presented in this testplan is to provide the data basis for preparing an IRM Proposed Plan. To achieve this objective, treatability testing must: Assess the performance of groundwater pumping with respect to the ability to extract a significant amount of the primary contaminant mass present in the two contaminant plumes
Inhibition of HIF-1{alpha} activity by BP-1 ameliorates adjuvant induced arthritis in rats
Energy Technology Data Exchange (ETDEWEB)
Shankar, J. [Department of Microbiology and Immunology, University of Illinois at Chicago, Chicago (United States); Thippegowda, P.B., E-mail: btprabha@uic.edu [Department of Pharmacology, (M/C 868), College of Medicine, University of Illinois at Chicago, 835 S. Wolcott Ave., Chicago, IL 60612 (United States); Kanum, S.A. [Department of Chemistry, Yuvaraj' s College, University of Mysore, Mysore (India)
2009-09-18
Rheumatoid arthritis (RA) is a chronic inflammatory, angiogenic disease. Inflamed synovitis is a hallmark of RA which is hypoxic in nature. Vascular endothelial growth factor (VEGF), one of the key regulators of angiogenesis, is overexpressed in the pathogenesis of RA. VEGF expression is regulated by hypoxia-inducible factor-1{alpha} (HIF-1{alpha}), a master regulator of homeostasis which plays a pivotal role in hypoxia-induced angiogenesis. In this study we show that synthetic benzophenone analogue, 2-benzoyl-phenoxy acetamide (BP-1) can act as a novel anti-arthritic agent in an experimental adjuvant induced arthritis (AIA) rat model by targeting VEGF and HIF-1{alpha}. BP-1 administered hypoxic endothelial cells and arthritic animals clearly showed down regulation of VEGF expression. Further, BP-1 inhibits nuclear translocation of HIF-1{alpha}, which in turn suppresses transcription of the VEGF gene. These results suggest a further possible clinical application of the BP-1 derivative as an anti-arthritic agent in association with conventional chemotherapeutic agents.
Findeisen, Felix; Minor, Daniel L.
2010-01-01
Calcium-binding protein 1 (CaBP1), a calmodulin (CaM) homolog, endows certain voltage-gated calcium channels (CaVs) with unusual properties. CaBP1 inhibits CaV1.2 calcium-dependent inactivation (CDI) and introduces calcium-dependent facilitation (CDF). Here, we show that the ability of CaBP1 to inhibit CaV1.2 CDI and induce CDF arises from interaction between the CaBP1 N-lobe and interlobe linker residue Glu94. Unlike CaM, where functional EF hands are essential for channel modulation, CDI inhibition does not require functional CaBP1 EF-hands. Furthermore, CaBP1-mediated CDF has different molecular requirements than CaM-mediated CDF. Overall, the data show that CaBP1 comprises two structural modules having separate functions: similar to CaM, the CaBP1 C-lobe serves as a high-affinity anchor that binds the CaV1.2 IQ domain at a site that overlaps with the Ca2+/CaM C-lobe site, whereas the N-lobe/linker module houses the elements required for channel modulation. Discovery of this division provides the framework for understanding how CaBP1 regulates CaVs. PMID:21134641
Findeisen, Felix; Minor, Daniel L
2010-12-08
Calcium-binding protein 1 (CaBP1), a calmodulin (CaM) homolog, endows certain voltage-gated calcium channels (Ca(V)s) with unusual properties. CaBP1 inhibits Ca(V)1.2 calcium-dependent inactivation (CDI) and introduces calcium-dependent facilitation (CDF). Here, we show that the ability of CaBP1 to inhibit Ca(V)1.2 CDI and induce CDF arises from interaction between the CaBP1 N-lobe and interlobe linker residue Glu94. Unlike CaM, where functional EF hands are essential for channel modulation, CDI inhibition does not require functional CaBP1 EF hands. Furthermore, CaBP1-mediated CDF has different molecular requirements than CaM-mediated CDF. Overall, the data show that CaBP1 comprises two structural modules having separate functions: similar to CaM, the CaBP1 C-lobe serves as a high-affinity anchor that binds the Ca(V)1.2 IQ domain at a site that overlaps with the Ca²+/CaM C-lobe site, whereas the N-lobe/linker module houses the elements required for channel modulation. Discovery of this division provides the framework for understanding how CaBP1 regulates Ca(V)s. Copyright © 2010 Elsevier Ltd. All rights reserved.
Evaluation of Water Resource Security Based on an MIV-BP Model in a Karst Area
Directory of Open Access Journals (Sweden)
Liying Liu
2018-06-01
Full Text Available Evaluation of water resource security deserves particular attention in water resource planning and management. A typical karst area in Guizhou Province, China, was used as the research area in this paper. First, based on data from Guizhou Province for the past 10 years, the mean impact value–back propagation (MIV-BP model was used to analyze the factors influencing water resource security in the karst area. Second, 18 indices involving five aspects, water environment subsystem, social subsystem, economic subsystem, ecological subsystem, and human subsystem, were selected to establish an evaluation index of water resource security. Finally, a BP artificial neural network model was constructed to evaluate the water resource security of Guizhou Province from 2005 to 2014. The results show that water resource security in Guizhou, which was at a moderate warning level from 2005 to 2009 and a critical safety level from 2010 to 2014, has generally improved. Groundwater supply ratio, industrial water utilization rate, water use efficiency, per capita grain production, and water yield modulus were the obstacles to water resource security. Driving factors were comprehensive utilization rate of industrial solid waste, qualifying rate of industrial wastewater, above moderate rocky desertification area ratio, water requirement per unit gross domestic product (GDP, and degree of development and utilization of groundwater. Our results provide useful suggestions on the management of water resource security in Guizhou Province and a valuable reference for water resource research.
International Nuclear Information System (INIS)
Fan Tianli; Wang Ping; Han Lin; Liu Yulong; Liu Yumin
2010-01-01
To detect mitochondrial DNA(mtDNA) 4977bp deletion(triangle open mtDNA 4977 ) in human peripheral blood nucleated cells exposed to ionizing radiation in vitro by using real-time PCR, and explore possibility of the index as biodosimetry for estimating biological dose in radiation accident,six healthy individuals' peripheral blood was collected,and the blood samples were irradiated with 0,1,2,3,4 and 5 Gy 60 Co gamma-ray. The triangle open mtDNA 4977 and total mtDNA copy number(mtDNA total ) in the mtDNA samples were detected, and then the deletion rates were calculated. The results showed that the mtDNA total and triangle open mtDNA 4977 copy number, and the deletion rates of mtDNA 4977bp in the mtDNA samples from 6 healthy individuals' blood exposed to 1-5 Gy radiation were higher than that with the samples exposed to 0 Gy radiation(p 0.05). The results indicated that ionizing radiation can induce accumulation of the triangle open mtDNA 4977 and increase of mtDNA total copy number in human peripheral blood nucleated cells,but both the mtDNA 4977bp deletion and exposure dose(0-5 Gy) were not obviously correlated. (authors)
Yin, Jinghua; Zhang, Jian; Lu, Qianjin
2017-07-01
Basic leucine zipper transcription factor E4BP4 (also known as NFIL3) has been implicated in the molecular and cellular mechanisms of functions and activities in mammals. The interactions between E4BP4 and major regulators of cellular processes have triggered significant interest in the roles of E4BP4 in the pathogenesis of certain chronic diseases. Indeed, novel discoveries have been emerging to illustrate the involvement of E4BP4 in multiple disorders. It is recognized that E4BP4 is extensively involved in some immune-mediated diseases, but the mechanisms of E4BP4 involvement in these complex diseases remain poorly defined. Here we review the regulatory mechanisms of E4BP4 engaging in not only the biological function but also the development of immune-mediated diseases, paving the way for future therapies. Copyright © 2017. Published by Elsevier Inc.
1998-11-01
Undergraduate physics programmes for the 21st century were under discussion at a recent event held in Arlington, USA, open to two or three members of the physics faculties of universities from across the whole country. The conference was organized by the American Association of Physics Teachers with co-sponsorship from the American Institute of Physics, the American Physical Society and Project Kaleidoscope. Among the various aims were to learn about physics departments that have successfully revitalized their undergraduate physics programmes with innovative introductory physics courses and multi-track majors programmes. Engineers and life scientists were to be asked directly how physics programmes can better serve their students, and business leaders would be speaking on how physics departments can help to prepare their students for the diverse careers that they will eventually follow. It was planned to highlight ways that departments could fulfil their responsibilities towards trainee teachers, to identify the resources needed for revitalizing a department's programme, and to develop guidelines and recommendations for a funding programme to support collaborative efforts among physics departments for carrying out the enhancements required. More details about the conference can be found on the AAPT website (see http://www.aapt.org/programs/rupc.html). Meanwhile the UK's Higher Education Funding Council has proposed a two-pronged approach to the promotion of high quality teaching and learning, as well as widening participation in higher education from 1999-2000. A total of £60m should be available to support these initiatives by the year 2001-2002. As part of this scheme the Council will invite bids from institutions to support individual academics in enhancing learning and teaching, as well as in recognition of individual excellence. As with research grants, such awards would enable staff to pursue activities such as the development of teaching materials
[Circulating endothelial progenitor cell levels in treated hypertensive patients].
Maroun-Eid, C; Ortega-Hernández, A; Abad, M; García-Donaire, J A; Barbero, A; Reinares, L; Martell-Claros, N; Gómez-Garre, D
2015-01-01
Most optimally treated hypertensive patients still have an around 50% increased risk of any cardiovascular event, suggesting the possible existence of unidentified risk factors. In the last years there has been evidence of the essential role of circulating endothelial progenitor cells (EPCs) in the maintenance of endothelial integrity and function, increasing the interest in their involvement in cardiovascular disease. In this study, the circulating levels of EPCs and vascular endothelial growth factor (VEGF) are investigated in treated hypertensive patients with adequate control of blood pressure (BP). Blood samples were collected from treated hypertensive patients with controlled BP. Plasma levels of EPCs CD34+/KDR+ and CD34+/VE-cadherin+ were quantified by flow cytometry. Plasma concentration of VEGF was determined by ELISA. A group of healthy subjects without cardiovascular risk factors was included as controls. A total of 108 hypertensive patients were included (61±12 years, 47.2% men) of which 82.4% showed BP<140/90 mmHg, 91.7% and 81.5% controlled diabetes (HbA1c <7%) and cLDL (<130 or 100 mg/dL), respectively, and 85.2% were non-smokers. Around 45% of them were obese. Although patients had cardiovascular parameters within normal ranges, they showed significantly lower levels of CD34+/KDR+ and CD34+/VE-cadherin+ compared with healthy control group, although plasma VEGF concentration was higher in patients than in controls. Despite an optimal treatment, hypertensive patients show a decreased number of circulating EPCs that could be, at least in part, responsible for their residual cardiovascular risk, suggesting that these cells could be a therapeutic target. Copyright © 2015 SEHLELHA. Published by Elsevier España, S.L.U. All rights reserved.
The role of SH3BP2 in the pathophysiology of cherubism
Directory of Open Access Journals (Sweden)
Reichenberger Ernst J
2012-05-01
Full Text Available Abstract Cherubism is a rare bone dysplasia that is characterized by symmetrical bone resorption limited to the jaws. Bone lesions are filled with soft fibrous giant cell-rich tissue that can expand and cause severe facial deformity. The disorder typically begins in children at ages of 2-5 years and the bone resorption and facial swelling continues until puberty; in most cases the lesions regress spontaneously thereafter. Most patients with cherubism have germline mutations in the gene encoding SH3BP2, an adapter protein involved in adaptive and innate immune response signaling. A mouse model carrying a Pro416Arg mutation in SH3BP2 develops osteopenia and expansile lytic lesions in bone and some soft tissue organs. In this review we discuss the genetics of cherubism, the biological functions of SH3BP2 and the analysis of the mouse model. The data suggest that the underlying cause for cherubism is a systemic autoinflammatory response to physiologic challenges despite the localized appearance of bone resorption and fibrous expansion to the jaws in humans.
Soltis, Robert; Verlinden, Nathan; Kruger, Nicholas; Carroll, Ailey; Trumbo, Tiffany
2015-02-17
To determine if the process-oriented guided inquiry learning (POGIL) teaching strategy improves student performance and engages higher-level thinking skills of first-year pharmacy students in an Introduction to Pharmaceutical Sciences course. Overall examination scores and scores on questions categorized as requiring either higher-level or lower-level thinking skills were compared in the same course taught over 3 years using traditional lecture methods vs the POGIL strategy. Student perceptions of the latter teaching strategy were also evaluated. Overall mean examination scores increased significantly when POGIL was implemented. Performance on questions requiring higher-level thinking skills was significantly higher, whereas performance on questions requiring lower-level thinking skills was unchanged when the POGIL strategy was used. Student feedback on use of this teaching strategy was positive. The use of the POGIL strategy increased student overall performance on examinations, improved higher-level thinking skills, and provided an interactive class setting.
Extension of TFTR operations to higher toroidal field levels
International Nuclear Information System (INIS)
Woolley, R.D.
1995-01-01
For the past year, TFTR has sometimes operated at extended toroidal field (TF) levels. The extension to 5.6 Tesla (79 kA) was crucial for TFTR's November 1994 10.7 MW DT fusion power record. The extension to 6.0 Tesla (85 kA) was commissioned on 9 September 1995. There are several reasons that one could expect the TF coils to survive the higher stresses that develop at higher fields. They were designed to operate at 5.2 Tesla with a vertical field of 0.5 Tesla, whereas the actual vertical field needed for the plasma does not exceed 0.35 Tesla. Their design specification explicitly required they survive some pulses at 6.0 Tesla. TF coil mechanical analysis computer models available during coil design were crude, leading to conservative design. And design analyses also had to consider worst-case misoperations that TFTR's real time Coil Protection Calculators (CPCs) now positively prevent from occurring
Lee, Romeo B; Maria, Madelene Sta; Estanislao, Susana; Rodriguez, Cristina
2013-11-01
Over the years, the number of international university students has been increasing in the Philippines. Depression tends to be common among this demographic sector, because of the varying challenges and expectations associated with studying abroad. Depression can be prevented if its symptoms, particularly those at higher levels, are identified and addressed early and effectively. This survey examined the social and demographic factors that are significantly associated with higher levels of depressive symptoms. One hundred twenty-six international university students were interviewed using the University Students Depression Inventory. Of the 13 factors analyzed, 3 were found with statistically significant associations with more intense levels of depressive symptoms. These factors were: level of satisfaction with one's financial condition, level of closeness with parents, and level of closeness with peers. In identifying international students with greater risk for depression, characteristics related to their financial condition and primary group relationships can be considered. There is a need to carry out more studies to confirm this initial evidence. The findings can help guide further discourse, research and program to benefit international students with higher levels of depressive symptoms.
A minireview of E4BP4/NFIL3 in heart failure.
Velmurugan, Bharath Kumar; Chang, Ruey-Lin; Marthandam Asokan, Shibu; Chang, Chih-Fen; Day, Cecilia-Hsuan; Lin, Yueh-Min; Lin, Yuan-Chuan; Kuo, Wei-Wen; Huang, Chih-Yang
2018-06-01
Heart failure (HF) remains a major cause of morbidity and mortality worldwide. The primary cause identified for HF is impaired left ventricular myocardial function, and clinical manifestations may lead to severe conditions like pulmonary congestion, splanchnic congestion, and peripheral edema. Development of new therapeutic strategies remains the need of the hour for controlling the problem of HF worldwide. Deeper insights into the molecular mechanisms involved in etiopathology of HF indicate the significant role of calcium signaling, autocrine signaling pathways, and insulin-like growth factor-1 signaling that regulates the physiologic functions of heart growth and development such as contraction, metabolism, hypertrophy, cytokine signaling, and apoptosis. In view of these facts, a transcription factor (TF) regulating the myriad of these signaling pathways may prove as a lead candidate for development of therapeutics. Adenovirus E4 promoter-binding protein (E4BP4), also known as nuclear-factor, interleukin 3 regulated (NFIL3), a type of basic leucine zipper TF, is known to regulate the signaling processes involved in the functioning of heart. The current review discusses about the expression, structure, and functional role of E4BP4 in signaling processes with emphasis on calcium signaling mechanisms, autocrine signaling, and insulin-like growth factor II receptor-mediated processes regulated by E4BP4 that may regulate the pathogenesis of HF. We propose that E4BP4, being the critical component for the regulation of the above signaling processes, may serve as a novel therapeutic target for HF, and scientific investigations are merited in this direction. © 2018 Wiley Periodicals, Inc.
Sakhi, Amrit Kaur; Sabaredzovic, Azemira; Papadopoulou, Eleni; Cequier, Enrique; Thomsen, Cathrine
2018-05-01
Exposure to environmental phenols including parabens, bisphenols (BPs), oxybenzone/benzophenone-3 (BP-3) and triclosan (TCS) is ubiquitous. Due to evidence of their estrogenic activity, they have been considered as chemicals of concern. The exposure of the Norwegian population to these compounds is presently unknown. To measure urinary levels of twelve different environmental phenols including four emerging bisphenols: S, F, B and AF (abbreviated as BPS, BPF, BPB and BPAF, respectively) in a healthy Norwegian population. We have calculated short-term variability, estimated daily intakes and investigated important determinants of exposure. Urine samples were collected from mothers (n = 48) and their children (n = 56) during spring/summer 2012 in two counties in Norway. Six environmental phenols namely methyl, ethyl and propyl paraben, BPA, BP-3 and TCS were detected in almost 100% of the urine samples. Among the emerging bisphenols, BPS was detected most frequently in the urine samples (42-48%) followed by BPF (4-15%). Parabens were positively and significantly correlated to each other in both mothers and children. Levels of parabens and BP-3 were higher in mothers compared to children. All mothers and children had lower estimated daily intakes (back calculated from the urinary concentrations) of parabens and BPA than the respective acceptable and tolerable daily intakes (ADIs and TDIs) established by the European Food Safety Authority (EFSA). Observed intraclass correlation coefficients (ICCs) indicated moderate to high reliability of spot urine measurements for all the environmental phenols (ICCs: 0.70-0.97). Use of hair products, deodorants, face and hand creams were significantly associated with higher urinary levels of parabens. Occurrence of environmental phenols in healthy Norwegian women and children is abundant. Among emerging bisphenols, there is widespread exposure to BPS. A single spot urine sample can be used for estimating short-term exposures
Soil infiltration based on bp neural network and grey relational analysis
Directory of Open Access Journals (Sweden)
Wang Juan
2013-02-01
Full Text Available Soil infiltration is a key link of the natural water cycle process. Studies on soil permeability are conducive for water resources assessment and estimation, runoff regulation and management, soil erosion modeling, nonpoint and point source pollution of farmland, among other aspects. The unequal influence of rainfall duration, rainfall intensity, antecedent soil moisture, vegetation cover, vegetation type, and slope gradient on soil cumulative infiltration was studied under simulated rainfall and different underlying surfaces. We established a six factor-model of soil cumulative infiltration by the improved back propagation (BP-based artificial neural network algorithm with a momentum term and self-adjusting learning rate. Compared to the multiple nonlinear regression method, the stability and accuracy of the improved BP algorithm was better. Based on the improved BP model, the sensitive index of these six factors on soil cumulative infiltration was investigated. Secondly, the grey relational analysis method was used to individually study grey correlations among these six factors and soil cumulative infiltration. The results of the two methods were very similar. Rainfall duration was the most influential factor, followed by vegetation cover, vegetation type, rainfall intensity and antecedent soil moisture. The effect of slope gradient on soil cumulative infiltration was not significant.
GalaxyDock BP2 score: a hybrid scoring function for accurate protein-ligand docking
Baek, Minkyung; Shin, Woong-Hee; Chung, Hwan Won; Seok, Chaok
2017-07-01
Protein-ligand docking is a useful tool for providing atomic-level understanding of protein functions in nature and design principles for artificial ligands or proteins with desired properties. The ability to identify the true binding pose of a ligand to a target protein among numerous possible candidate poses is an essential requirement for successful protein-ligand docking. Many previously developed docking scoring functions were trained to reproduce experimental binding affinities and were also used for scoring binding poses. However, in this study, we developed a new docking scoring function, called GalaxyDock BP2 Score, by directly training the scoring power of binding poses. This function is a hybrid of physics-based, empirical, and knowledge-based score terms that are balanced to strengthen the advantages of each component. The performance of the new scoring function exhibits significant improvement over existing scoring functions in decoy pose discrimination tests. In addition, when the score is used with the GalaxyDock2 protein-ligand docking program, it outperformed other state-of-the-art docking programs in docking tests on the Astex diverse set, the Cross2009 benchmark set, and the Astex non-native set. GalaxyDock BP2 Score and GalaxyDock2 with this score are freely available at http://galaxy.seoklab.org/softwares/galaxydock.html.
Tasmaloum, Vanuatu Fossil Coral SST Reconstruction for 4200 YrBP
National Oceanic and Atmospheric Administration, Department of Commerce — Vanuatu Fossil Coral SST Reconstruction, 4200 YrBP. Paleobathymetry estimated at 10-15 m. SST reconstruction is based on the analysis of Sr/Ca and U/Ca ratios in...
Commensal microbiota contributes to chronic endocarditis in TAX1BP1 deficient mice.
Directory of Open Access Journals (Sweden)
Satoko Nakano
Full Text Available Tax1-binding protein 1 (Tax1bp1 negatively regulates NF-κB by editing the ubiquitylation of target molecules by its catalytic partner A20. Genetically engineered TAX1BP1-deficient (KO mice develop age-dependent inflammatory constitutions in multiple organs manifested as valvulitis or dermatitis and succumb to premature death. Laser capture dissection and gene expression microarray analysis on the mitral valves of TAX1BP1-KO mice (8 and 16 week old revealed 588 gene transcription alterations from the wild type. SAA3 (serum amyloid A3, CHI3L1, HP, IL1B and SPP1/OPN were induced 1,180-, 361-, 187-, 122- and 101-fold respectively. WIF1 (Wnt inhibitory factor 1 exhibited 11-fold reduction. Intense Saa3 staining and significant I-κBα reduction were reconfirmed and massive infiltration of inflammatory lymphocytes and edema formation were seen in the area. Antibiotics-induced 'germ free' status or the additional MyD88 deficiency significantly ameliorated TAX1BP1-KO mice's inflammatory lesions. These pathological conditions, as we named 'pseudo-infective endocarditis' were boosted by the commensal microbiota who are usually harmless by their nature. This experimental outcome raises a novel mechanistic linkage between endothelial inflammation caused by the ubiquitin remodeling immune regulators and fatal cardiac dysfunction.
Energy Technology Data Exchange (ETDEWEB)
Kalinina, I A; Dikun, P P
1983-01-01
Benz(a)pyrene (BP) levels in extracts and solvent cake obtained by alcoholic and aqueous extraction of specimens of 20 different medicinal plants were measured to explore into the possibility of its passage from these plants to drugs. Seventy percent alcoholic extracts were found to contain 40-60% of BP passed from raw material, while aqueous extracts--2-3% (in some cases 10-14%). Maximal concentrations of BP in alcoholic extracts were 0.6-0.7 micrograms/1 and 0.03-0.04 micrograms/1--in aqueous ones. A significant correlation between BP level in extracts and its content in plants was established. BP pathways in the course of solasodine manufacturing from nightshade (Solanum lacinatum) were studied. As little as 1% of BP passed to extract after primary extraction in 2%--sulfuric acid. Solasodine contained about 3 micrograms/kg of BP.
Hashemi, Mohammad; Rezaei, Hamzeh; Eskandari-Nasab, Ebrahim; Kaykhaei, Mahmoud-Ali; Taheri, Mohsen
2013-01-01
Metabolic syndrome (MeS), a cluster of several metabolic disorders, is increasingly being recognized as a risk factor for type II diabetes (T2D) and cardiovascular disease. Genetic and epigenetic alteration of the phosphatase and tensin homolog deleted on chromosome ten (PTEN) has been associated with components of MeS. The aim of the present study was to investigate the possible association of a 32-bp deletion polymorphism and promoter methylation of the PTEN gene with MeS. DNA was extracted from the peripheral blood of 151 subjects with and 149 subjects without MeS. The 32-bp deletion variant of PTEN was detected by polymerase chain reaction (PCR) and PTEN promoter methylation was defined by a nested methylation‑specific PCR (MSP) method. No significant differences were found in the allelic and genotypic frequencies of the 32-bp deletion variant of PTEN between the groups [odds ratio (OR), 0.77; 95% confidence interval (CI), 0.41-1.45; P=0.431]. However, patients with MeS were identified to have lower levels of PTEN promoter hypermethylation than subjects without MeS. Promoter methylation may be a protective factor against susceptibility to MeS (OR, 0.52; 95% CI, 0.29-0.92; P=0.029). Our findings suggest that PTEN promoter methylation may be a mechanism for PTEN downregulation or silencing in MeS, which remains to be fully clarified.
Holocene Lake-Level Fluctuations of Lake Aricota, Southern Peru
Placzek, Christa; Quade, Jay; Betancourt, Julio L.
2001-09-01
Lacustrine deposits exposed around Lake Aricota, Peru (17° 22‧S), a 7.5-km2 lake dammed by debris flows, provide a middle to late Holocene record of lake-level fluctuations. Chronological context for shoreline deposits was obtained from radiocarbon dating of vascular plant remains and other datable material with minimal 14C reservoir effects (<350 yr). Diatomites associated with highstands several meters above the modern lake level indicate wet episodes. Maximum Holocene lake level was attained before 6100 14C yr B.P. and ended ∼2700 14C yr B.P. Moderately high lake levels occurred at 1700 and 1300 14C yr B.P. The highstand at Lake Aricota during the middle Holocene is coeval with a major lowstand at Lake Titicaca (16°S), which is only 130 km to the northeast and shares a similar climatology. Comparisons with other marine and terrestrial records highlight emerging contradictions over the nature of mid-Holocene climate in the central Andes.
Qureshi, Bilal M.
2018-01-02
Isoprenylated proteins are associated with membranes and their inter-compartmental distribution is regulated by solubilization factors, which incorporate lipid moieties in hydrophobic cavities and thereby facilitate free diffusion during trafficking. Here we report the crystal structure of a solubilization factor, the prenyl-binding protein (PrBP/δ), at 1.81 Å resolution in its ligand-free apo-form. Apo-PrBP/δ harbors a preshaped, deep hydrophobic cavity, capacitating apo-PrBP/δ to readily bind its prenylated cargo. To investigate the molecular mechanism of cargo solubilization we analyzed the PrBP/δ-induced membrane dissociation of rod photoreceptor phosphodiesterase (PDE6). The results suggest that PrBP/δ exclusively interacts with the soluble fraction of PDE6. Depletion of soluble species in turn leads to dissociation of membrane-bound PDE6, as both are in equilibrium. This
Qureshi, Bilal M.; Schmidt, Andrea; Behrmann, Elmar; Bü rger, Jö rg; Mielke, Thorsten; Spahn, Christian M. T.; Heck, Martin; Scheerer, Patrick
2018-01-01
Isoprenylated proteins are associated with membranes and their inter-compartmental distribution is regulated by solubilization factors, which incorporate lipid moieties in hydrophobic cavities and thereby facilitate free diffusion during trafficking. Here we report the crystal structure of a solubilization factor, the prenyl-binding protein (PrBP/δ), at 1.81 Å resolution in its ligand-free apo-form. Apo-PrBP/δ harbors a preshaped, deep hydrophobic cavity, capacitating apo-PrBP/δ to readily bind its prenylated cargo. To investigate the molecular mechanism of cargo solubilization we analyzed the PrBP/δ-induced membrane dissociation of rod photoreceptor phosphodiesterase (PDE6). The results suggest that PrBP/δ exclusively interacts with the soluble fraction of PDE6. Depletion of soluble species in turn leads to dissociation of membrane-bound PDE6, as both are in equilibrium. This
Verlinden, Nathan; Kruger, Nicholas; Carroll, Ailey; Trumbo, Tiffany
2015-01-01
Objective. To determine if the process-oriented guided inquiry learning (POGIL) teaching strategy improves student performance and engages higher-level thinking skills of first-year pharmacy students in an Introduction to Pharmaceutical Sciences course. Design. Overall examination scores and scores on questions categorized as requiring either higher-level or lower-level thinking skills were compared in the same course taught over 3 years using traditional lecture methods vs the POGIL strategy. Student perceptions of the latter teaching strategy were also evaluated. Assessment. Overall mean examination scores increased significantly when POGIL was implemented. Performance on questions requiring higher-level thinking skills was significantly higher, whereas performance on questions requiring lower-level thinking skills was unchanged when the POGIL strategy was used. Student feedback on use of this teaching strategy was positive. Conclusion. The use of the POGIL strategy increased student overall performance on examinations, improved higher-level thinking skills, and provided an interactive class setting. PMID:25741027
DEFF Research Database (Denmark)
Silvestri, B; Calderazzo, F; Coppola, V
1998-01-01
We studied the effects of a 90-kD glycoprotein (gp90/Mac-2BP) belonging to the scavenger receptor family, present in normal serum and at increased levels in inflammatory disease and cancer patients, on some T cell function parameters. Whereas the lymphocyte proliferative response to non-specific ......We studied the effects of a 90-kD glycoprotein (gp90/Mac-2BP) belonging to the scavenger receptor family, present in normal serum and at increased levels in inflammatory disease and cancer patients, on some T cell function parameters. Whereas the lymphocyte proliferative response to non......-specific mitogens such as phytohaemagglutinin (PHA) and concanavalin A (Con A), but not pokeweed mitogen (PWM), was strongly reduced, probably due to the lectin-binding properties of gp90/Mac-2BP, the response to T cell receptor (TCR) agonists such as superantigens and allogeneic cells was potentiated. When...... lymphocytes were stimulated with different anti-TCR:CD3 MoAbs, both in soluble and solid-phase form, gp90/Mac-2BP was able to down-regulate the proliferative response to anti-CD3 MoAb, whereas the response to anti-TCR alphabeta MoAb was enhanced. A similar differential effect was observed when a MoAb against...
Joyner, JaNae; Moore, Ashley R; Mount, David L; Simmons, Debra R; Ferrario, Carlos M; Cline, David M
2012-12-01
Patient inertia is defined as an individual's failure to take responsibility for proactive lifestyle change and health conditions including hypertension. Generalized and hypertension-specific patient inertia factors were compared in 110 patients (48% women; 52% African American) from a Forsyth County, NC, emergency department (ED) and 104 community members (79% women; 70% African American) using the patient inertia-facilitated survey Patient Inertia-36. Statistically, more ED than community participants added salt to food at the table and consumed fast foods 5 to 7 days a week. ED patients agreed less often with health literacy questions about salt and BP. Hypertension associated Patient inertia questions asked of 45 ED and 40 community participants with a personal history of hypertension revealed a statistically higher sense of hopelessness surrounding blood pressure management in ED participants. Past BP control experiences of family members had statistically greater impact on community participants regarding their own BP control. Using a logistic regression model, advancing age and being surveyed in the ED were correlated with hopelessness towards BP control. ED patients make unhealthier diet choices and possess heightened generalized and hypertension-specific patient inertia including hopelessness towards controlling their BP that increases with age. These factors may contribute to this population's poor BP control, particularly self-efficacy barriers. © 2012 Wiley Periodicals, Inc.
Kharbanda, Elyse O; Nordin, James D; Sinaiko, Alan R; Ekstrom, Heidi L; Stultz, Jerry M; Sherwood, Nancy E; Fontaine, Patricia L; Asche, Steve E; Dehmer, Steven P; Amundson, Jerry H; Appana, Deepika X; Bergdall, Anna R; Hayes, Marcia G; O'Connor, Patrick J
2015-01-01
Blood pressure (BP) is routinely measured in children and adolescents during primary care visits. However, elevated BP or hypertension is frequently not diagnosed or evaluated further by primary care providers. Barriers to recognition include lack of clinician buy-in, competing priorities, and complexity of the standard BP tables. We have developed and piloted TeenBP- a web-based, electronic health record (EHR) linked system designed to improve recognition of prehypertension and hypertension in adolescents during primary care visits. Important steps in developing TeenBP included the following: review of national BP guidelines, consideration of clinic workflow, engagement of clinical leaders, and evaluation of the impact on clinical sites. Use of a web-based platform has facilitated updates to the TeenBP algorithm and to the message content. In addition, the web-based platform has allowed for development of a sophisticated display of patient-specific information at the point of care. In the TeenBP pilot, conducted at a single pediatric and family practice site with six clinicians, over a five-month period, more than half of BPs in the hypertensive range were clinically recognized. Furthermore, in this small pilot the TeenBP clinical decision support (CDS) was accepted by providers and clinical staff. Effectiveness of the TeenBP CDS will be determined in a two-year cluster-randomized clinical trial, currently underway at 20 primary care sites. Use of technology to extract and display clinically relevant data stored within the EHR may be a useful tool for improving recognition of adolescent hypertension during busy primary care visits. In the future, the methods developed specifically for TeenBP are likely to be translatable to a wide range of acute and chronic issues affecting children and adolescents.
Directory of Open Access Journals (Sweden)
Oluwaseun S Ojo
2016-01-01
Full Text Available Context: Nonadherence to therapeutic plans has been reported among hypertensive patients. Researchers have also shown that adherence to therapeutic plans improves if motivation in the form of social support is provided. There is a dearth of local studies that explore the influence of family support on treatment outcomes of hypertensive patients. Aims: The aim of the study was to determine the relationship between BP control and perceived family support in patients with essential hypertension seen at a primary care setting in Western Nigeria. Settings and Design: This was a cross-sectional hospital-based study. Subjects and Methods: Systematic random sampling technique was used in selecting 360 hypertensive respondents between April and July 2013. Data were collected through a pretested interviewer-administered questionnaire and a standardized tool, Perceived Social Support Family Scale, which measured the respondents′ level of perceived family support. Statistical Analysis Used: Statistical Package for Social Sciences (SPSS version 17.0 was used to analyze data. Results: The majority of the respondents were middle-aged (61.1% and female (59.4%. Blood pressure (BP was controlled in 46.4% of the respondents. Most of the respondents (79.4% had "strong" perceived family support. Strong perceived family support (odds ratio [OR] 4.778, 95% confidence interval [CI] =2.569-8.887 and female gender (OR 1.838, 95% CI = 1.177-2.869 were independent predictors of controlled BP. Conclusions: The proportion of hypertensive patients with optimal BP control is low in this practice setting. The positive association between BP control and perceived family support emphasizes the need for physicians to reflect on the available family support when managing hypertensive patients.
International Nuclear Information System (INIS)
Arnold, B.M.; Kuttner, M.; Willis, D.M.; Hitchman, A.J.W.; Harrison, J.E.; Murray, T.M.
1975-01-01
Using a specific radioimmunoassay for porcine intestinal calcium-binding protein (CaBP), we have measured the concentration of CaBP in the various tissues and organs of normal pigs. Intestinal CaBP was present in highest concentration in the upper small intestine, with lower concentrations in the distal small intestine. Intestinal CaBP was also found, in lower concentrations, in kidney, liver, thyroid, pancreas, and blood. In all other tissues, including parathyroid, bone, skeletal muscle, and brain, CaBP immunoreactivity was undetectable or less than in blood. The elution profile of calcium-binding activity and immunoreactivity from gel filtration analysis of kidney and parathyroid extracts suggest that the calcium-binding protein in the parathyroid gland, and the major calcium-binding protein(s) in the kidney, are chemically and immunochemically different from intestinal CaBP. (author)
Energy Technology Data Exchange (ETDEWEB)
Arnold, B M; Kuttner, M; Willis, D M; Hitchman, A J.W.; Harrison, J E; Murray, T M [Toronto Univ., Ontario (Canada). Dept. of Medicine
1975-12-01
Using a specific radioimmunoassay for porcine intestinal calcium-binding protein (CaBP), we have measured the concentration of CaBP in the various tissues and organs of normal pigs. Intestinal CaBP was present in highest concentration in the upper small intestine, with lower concentrations in the distal small intestine. Intestinal CaBP was also found, in lower concentrations, in kidney, liver, thyroid, pancreas, and blood. In all other tissues, including parathyroid, bone, skeletal muscle, and brain, CaBP immunoreactivity was undetectable or less than in blood. The elution profile of calcium-binding activity and immunoreactivity from gel filtration analysis of kidney and parathyroid extracts suggest that the calcium-binding protein in the parathyroid gland, and the major calcium-binding protein(s) in the kidney, are chemically and immunochemically different from intestinal CaBP.
Evaluation of the Specificity of BP3385 for Bordetella pertussis
BP3385 has been proposed as a diagnostic PCR target for discriminating between Bordetella pertussis and other Bordetella species that also infect humans. Our results demonstrate this gene is also present in some strains of Bordetella hinzii and Bordetella bronchiseptica....
Velaei, Kobra; Samadi, Nasser; Soltani, Sina; Barazvan, Balal; Soleimani Rad, Jafar
2017-07-01
Shedding light on chemoresistance biology of breast cancer could contribute to enhance the clinical outcome. Intrinsic or acquired resistance to chemotherapy is a major problem in breast cancer treatment. The NFκB pathway by siRNAP65 and JSH-23 as a translocational inhibitor of NFκBP65 in the doxorubicin-resistant MCF-7 (MCF-7/Dox) and MCF-7 cells was blocked. Then, the ABC transporter expression and function were assessed by real-time qRT-PCR and flow cytometry, respectively. Induction of apoptosis was evaluated after inhibition of the NFΚB pathway as well. Our study underlined the upregulation of NFκBP65 and anti-apoptotic Bcl-2 and downregulation of pro-apoptotic Bax in the MCF-7/Dox cells compared with control MCF-7 cells. Here, we showed that interplay between nuclear factor kappa B P65 (NFkBP65) as a transcriptional regulator and ABC transporters in the MCF-7/Dox cancer cells. We found that inhibition of the elevated expression of NFκBP65 in the resistant breast cancer, whether translocational inhibition or silencing by siRNA, decreased the expression and function of MDR1 and MRP1 efflux pumps. Furthermore, the blockade of NFκBP65 promoted apoptosis via modulating Bcl-2 and BAX expression. After inhibition of the NFκBP65 signaling pathway, elevated baseline expression of survival Bcl-2 gene in the resistant breast cells significantly decreased. Suppression of the NFκB pathway has a profound dual impact on promoting the intrinsic apoptotic pathway and reducing ABC transporter function and expression, which are some of the chemoresistance features. It was speculated that the NFκB pathway directly acts on doxorubicin-induced MDR1 and MRP1 expression in MCF-7/Dox cells.
Robinson, Michael D.; Bresin, Konrad
2014-01-01
A review of the literature suggests that higher levels of psychopathy may be linked to less effective behavioral control. However, several commentators have urged caution in making statements of this type in the absence of direct evidence. In two studies (total N = 142), moment-to-moment accuracy in a motor control task was examined as a function of dimensional variations in psychopathy in an undergraduate population. As hypothesized, motor control was distinctively worse at higher levels of ...
Study on the identifying of meat's visible spectrum based on BP artificial neural network
Li, Xiaotian; Zhang, Tieqiang; Li, Bo; Jiang, Yongheng; Liu, Binghui; Li, Zhaokai
2006-01-01
A method to identify different meat by the visible and reflected spectra of meat with BP artificial neural net (BP-ANN) was introduced in this paper. The visible and reflected spectra (from 420 to 535nm) of different meat (beef and pork) were measured with fiber sensor spectrometer. A kind of ANN with a double-hidden layer was created to identify the different meat automatically. Its right ratio reaches 92.71%.
Note: Primer Amysat 001; Fragment size is 211bp
Indian Academy of Sciences (India)
Renuka
Bhandara : Lanes 1–14 represent different strains of Bhandara Ecorace. Note: Primer Amysat 001; Fragment size is 211bp. Fig. 1. SSR profiles generated from genomic DNA of 16 strains from different individuals of (A.L, D. TV, D. BV, Modal, Sukinda, Raily, Bhandara) ecoraces of tasar silk worm, Antheraea mylitta using the.
Higher Level Visual Cortex Represents Retinotopic, Not Spatiotopic, Object Location
Kanwisher, Nancy
2012-01-01
The crux of vision is to identify objects and determine their locations in the environment. Although initial visual representations are necessarily retinotopic (eye centered), interaction with the real world requires spatiotopic (absolute) location information. We asked whether higher level human visual cortex—important for stable object recognition and action—contains information about retinotopic and/or spatiotopic object position. Using functional magnetic resonance imaging multivariate pattern analysis techniques, we found information about both object category and object location in each of the ventral, dorsal, and early visual regions tested, replicating previous reports. By manipulating fixation position and stimulus position, we then tested whether these location representations were retinotopic or spatiotopic. Crucially, all location information was purely retinotopic. This pattern persisted when location information was irrelevant to the task, and even when spatiotopic (not retinotopic) stimulus position was explicitly emphasized. We also conducted a “searchlight” analysis across our entire scanned volume to explore additional cortex but again found predominantly retinotopic representations. The lack of explicit spatiotopic representations suggests that spatiotopic object position may instead be computed indirectly and continually reconstructed with each eye movement. Thus, despite our subjective impression that visual information is spatiotopic, even in higher level visual cortex, object location continues to be represented in retinotopic coordinates. PMID:22190434
Real-Coded Quantum-Inspired Genetic Algorithm-Based BP Neural Network Algorithm
Directory of Open Access Journals (Sweden)
Jianyong Liu
2015-01-01
Full Text Available The method that the real-coded quantum-inspired genetic algorithm (RQGA used to optimize the weights and threshold of BP neural network is proposed to overcome the defect that the gradient descent method makes the algorithm easily fall into local optimal value in the learning process. Quantum genetic algorithm (QGA is with good directional global optimization ability, but the conventional QGA is based on binary coding; the speed of calculation is reduced by the coding and decoding processes. So, RQGA is introduced to explore the search space, and the improved varied learning rate is adopted to train the BP neural network. Simulation test shows that the proposed algorithm is effective to rapidly converge to the solution conformed to constraint conditions.
Directory of Open Access Journals (Sweden)
Sameer D Salem
Full Text Available BACKGROUND: The association of Insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2 common variants (rs4402960 and rs1470579 with type 2 diabetes (T2D has been performed in different populations. The aim of this study was to evaluate the association of alternative variants of IGF2BP2; rs6777038, rs16860234 and rs7651090 with glutamic acid decarboxylase antibodies (GADA negative diabetes in Malaysian Subjects. METHODS/PRINCIPAL FINDINGS: IGF2BP2; rs6777038, rs16860234 and rs7651090 single nucleotide polymorphisms (SNPs were genotyped in 1107 GADA negative diabetic patients and 620 control subjects of Asian from Malaysia. The additive genetic model adjusted for age, race, gender and BMI showed that alternative variants; rs6777038, rs16860234 and rs7651090 of IGF2BP2 associated with GADA negative diabetes (OR = 1.21; 1.36; 1.35, P = 0.03; 0.0004; 0.0002, respectively. In addition, the CCG haplotype and diplotype CCG-TCG increased the risk of diabetes (OR = 1.51, P = 0.01; OR = 2.36, P = 0.009, respectively. CONCLUSIONS/SIGNIFICANCE: IGF2BP2 alternative variants were associated with GADA negative diabetes. The IGF2BP2 haplotypes and diplotypes increased the risk of diabetes in Malaysian subject.
International Nuclear Information System (INIS)
Chen Xiaosui; Zhou Lijun; Wang Yuxiao; Qu Jia; Feng Jiangbing; Lu Xue; Chen Deqing; Liu Qingjie
2006-01-01
Objective: To construct a stable plasmid that spanning deleted human mitochondrial DNA (mtDNA) 4977 bp induced by ionizing radiation and another one for control DNA fragment, in order to use in the human mitochondrial genome study in the future. Methods: The peripheral blood, which had no mtDNA 4977 bp deletion found in previous study, was exposed to 10 Gy 60 Co γ-rays in vitro. The total cell DNA was extracted and PCR was carried out: a nest-PCR of three-round PCR was used for the mtDNA 4977 bp deletion and one- round regular PCR was used for the control ND1 gene. The PCR products were used for transfection by electroporation and the positive clones were obtained after screening. The plasmid DNA was isolated and sequenced after enzymatic digestion and purification. The sequence result was BLASTed with the human mitochondrial genome. Results: The sizes of PCR products for the flanked 4977 bp deletion and the ND1 gene were similar with those predicted according to GeneBank. The sequences for the positive clones were above 99 per cent homologous with the human mitochondrial genome after BLASTed. Conclusion: The plasmids for deleted human mtDNA 4977 bp and control DNA fragment have been constructed successfully, and they could be used in the quality and quantity studies on human mtDNA 4977 bp deletion. (authors)
Research on AHP decision algorithms based on BP algorithm
Ma, Ning; Guan, Jianhe
2017-10-01
Decision making is the thinking activity that people choose or judge, and scientific decision-making has always been a hot issue in the field of research. Analytic Hierarchy Process (AHP) is a simple and practical multi-criteria and multi-objective decision-making method that combines quantitative and qualitative and can show and calculate the subjective judgment in digital form. In the process of decision analysis using AHP method, the rationality of the two-dimensional judgment matrix has a great influence on the decision result. However, in dealing with the real problem, the judgment matrix produced by the two-dimensional comparison is often inconsistent, that is, it does not meet the consistency requirements. BP neural network algorithm is an adaptive nonlinear dynamic system. It has powerful collective computing ability and learning ability. It can perfect the data by constantly modifying the weights and thresholds of the network to achieve the goal of minimizing the mean square error. In this paper, the BP algorithm is used to deal with the consistency of the two-dimensional judgment matrix of the AHP.
Consequences of moral Kohlberg´s moral development levels in higher education
Bordignon, Nelso Antonio
2011-01-01
Abstract Introduction. This article presents the results of a research work about the implications of Kohlberg´s moral development level in higher education. Objective. To identify the state of moral development among higher education teachers, departing from the orientation they give to their lives and to those of their students, and from what they think and say they do for their students´ moral education.With the results, an analysis is done in order to establish the impli...
Investigating Student Choices in Performing Higher-Level Comprehension Tasks Using TED
Bianchi, Francesca; Marenzi, Ivana
2016-01-01
The current paper describes a first experiment in the use of TED talks and open tagging exercises to train higher-level comprehension skills, and of automatic logging of the student's actions to investigate the student choices while performing analytical tasks. The experiment took advantage of an interactive learning platform--LearnWeb--that…
Research on Environmental Adjustment of Cloud Ranch Based on BP Neural Network PID Control
Ren, Jinzhi; Xiang, Wei; Zhao, Lin; Wu, Jianbo; Huang, Lianzhen; Tu, Qinggang; Zhao, Heming
2018-01-01
In order to make the intelligent ranch management mode replace the traditional artificial one gradually, this paper proposes a pasture environment control system based on cloud server, and puts forward the PID control algorithm based on BP neural network to control temperature and humidity better in the pasture environment. First, to model the temperature and humidity (controlled object) of the pasture, we can get the transfer function. Then the traditional PID control algorithm and the PID one based on BP neural network are applied to the transfer function. The obtained step tracking curves can be seen that the PID controller based on BP neural network has obvious superiority in adjusting time and error, etc. This algorithm, calculating reasonable control parameters of the temperature and humidity to control environment, can be better used in the cloud service platform.
Bc→BP,BV Decays with the QCD Factorization Approach
International Nuclear Information System (INIS)
Chang, Qin; Wang, Na; Sun, Junfeng; Yang, Yueling
2015-01-01
We studied the nonleptonic B c →BP, BV decays with the QCD factorization approach. It is found that the Cabibbo favored processes of B c →B s π, B s ρ, B u K - are the promising decay channels with branching ratio larger than 1%, which should be observed earlier by the LHCb collaboration
Bonfante, Ivan Luiz Padilha; Chacon-Mikahil, Mara Patricia Traina; Brunelli, Diego Trevisan; Gáspari, Arthur Fernandes; Duft, Renata Garbellini; Oliveira, Alexandre Gabarra; Araujo, Tiago Gomes; Saad, Mario Jose Abdalla; Cavaglieri, Cláudia Regina
2017-12-01
Thus, the aim of this study was to compare if higher or smaller fibronectin type 3 domain-containing protein 5 (FNDC5)/irisin levels are associated with inflammatory and metabolic markers, caloric/macronutrient intake, physical fitness and type 2 diabetes mellitus (T2DM) risk in obese middle-aged men, and also to correlate all variables analyzed with FNDC5/irisin. On the basis of a cluster study, middle-aged obese men (IMC: 31.01 ± 1.64 kg/m2) were divided into groups of higher and smaller levels of FNDC5/irisin. The levels of leptin, resistin, adiponectin, tumor necrosis factor alpha (TNFα), interleukin 6 and 10 (IL6, IL10), lipopolysaccharide (LPS), glucose, insulin, glycated hemoglobin, insulin resistance and sensibility, lipid profile, risk of T2DM development, body composition, rest energy expenditure, caloric/macronutrient intake and physical fitness were measured. The higher FNDC5/ irisin group presented improved insulin sensibility (homeostasis model assessment - sensibility (HOMA-S) (p = 0.01) and QUICKI index (p risk of T2DM development (p = 0.02), tendency to decrease serum resistin (p = 0.08) and significant lower LPS levels (p = 0.02). Inverse correlations between FNDC5/irisin and body weight (r -0.46, p = 0.04), neck circumference (r -0.51, p = 0.02), free fat mass (r -0.49, p = 0.02), triglycerides (r -0.43, p = 0.05) and risk of developing T2DM (r -0.61, p = 0.04) were observed. These results suggest that higher FNDC5/irisin levels in obese middle-aged men are related to a better metabolic profile and lower risk of T2DM development and serum LPS, a potential inducer of insulin resistance.
Digital Immigrants and Digital Natives: Learning Business Informatics at Higher Educational Level
Directory of Open Access Journals (Sweden)
Suša Dalia
2014-09-01
Full Text Available Background: The term digital natives refer to those born since the 1980s and have been growing up surrounded by technology. On the other hand, digital immigrants are born before 1980s and learned how to use technology later in life. Objectives: Goal of the paper is to explore attitudes of digital native students on the course of Business Informatics at higher educational institutions (HEIs, and to compare them with attitudes of digital immigrants. Methods/Approach: The survey was conducted in 2014 using the sample of first-year Business Informatics students from the Faculty of Economics and Business in Zagreb, Croatia. Results were compared with a research conducted in 1998. Results: In comparison to an earlier research, digital natives perceive their level of competency in the subject of Business Informatics before teaching practices much higher compared to digital immigrants. However, there is still an increase in digital native students’ level of competency in the subject before and after teaching practices. Conclusions: The research confirms a shift from digital immigrants to digital natives who show high level of interest for Business Informatics course topics and find its utility very high. However, constant improvement of delivering knowledge is needed in order to keep these high levels.
Zhang, Ruijie; Lv, Wenhua; Luan, Meiwei; Zheng, Jiajia; Shi, Miao; Zhu, Hongjie; Li, Jin; Lv, Hongchao; Zhang, Mingming; Shang, Zhenwei; Duan, Lian; Jiang, Yongshuai
2015-11-24
Different human genes often exhibit different degrees of stability in their DNA methylation levels between tissues, samples or cell types. This may be related to the evolution of human genome. Thus, we compared the evolutionary conservation between two types of genes: genes with stable DNA methylation levels (SM genes) and genes with fluctuant DNA methylation levels (FM genes). For long-term evolutionary characteristics between species, we compared the percentage of the orthologous genes, evolutionary rate dn/ds and protein sequence identity. We found that the SM genes had greater percentages of the orthologous genes, lower dn/ds, and higher protein sequence identities in all the 21 species. These results indicated that the SM genes were more evolutionarily conserved than the FM genes. For short-term evolutionary characteristics among human populations, we compared the single nucleotide polymorphism (SNP) density, and the linkage disequilibrium (LD) degree in HapMap populations and 1000 genomes project populations. We observed that the SM genes had lower SNP densities, and higher degrees of LD in all the 11 HapMap populations and 13 1000 genomes project populations. These results mean that the SM genes had more stable chromosome genetic structures, and were more conserved than the FM genes.
Watson, Sheri; Aguas, Marita; Colegrove, Pat; Foisy, Nancy; Jondahl, Bonnie; Anastas, Zoe
2017-02-01
The purpose of the study was to determine if forearm blood pressures (BPs) measured in three different locations agree with the recommended upper arm location for noninvasive BP measurement. A method-comparison design was used. In a convenience sample of postanesthesia care unit patients with large upper arm circumference, BP's were obtained in three different forearm locations (lower forearm, middle forearm, and upper forearm) and compared to upper arm BP using an automated BP measuring device. The level of agreement (bias ± precision) between each forearm location and the upper arm BP was calculated using standard formulas. Acceptable levels of agreement based on expert opinion were set a priori at bias and precision values of less than ±5 mm Hg (bias) and ±8 mm Hg (precision). Forty-eight postanesthesia patients participated in the study. Bias and precision values were found to exceed the acceptable level of agreement for all but one of the systolic and diastolic BP comparisons in the three forearm BP locations. Fifty-six percent of all patients studied had one or more BP difference of at least 10 mm Hg in each of the three forearm locations, with 10% having one or more differences of at least 20 mm Hg. The differences in forearm BP measurements observed in this study indicate that the clinical practice of using a forearm BP with a regular-sized BP cuff in place of a larger sized BP cuff placed on the upper arm in postanesthesia care unit patients with large arm circumferences is inappropriate. The BPs obtained at the forearm location are not equivalent to the BPs obtained at the upper arm location. Copyright © 2015 American Society of PeriAnesthesia Nurses. Published by Elsevier Inc. All rights reserved.
Chihara, Kazuyasu; Kimura, Yukihiro; Honjoh, Chisato; Yamauchi, Shota; Takeuchi, Kenji; Sada, Kiyonao
2014-03-10
Adaptor protein c-Abl SH3 domain-binding protein-2 (3BP2) is known to play regulatory roles in immunoreceptor-mediated signal transduction. We have previously demonstrated that Tyr(174), Tyr(183) and Tyr(446) in mouse 3BP2 are predominantly phosphorylated by Syk, and the phosphorylation of Tyr(183) and the Src homology 2 (SH2) domain of mouse 3BP2 are critical for B cell receptor (BCR)-induced activation of nuclear factor of activated T cells (NFAT) in human B cells. In this report, we have shown that Syk, but not Abl family protein-tyrosine kinases, is critical for BCR-mediated tyrosine phosphorylation of 3BP2 in chicken DT40 cells. Mutational analysis showed that Tyr(174), Tyr(183) and Tyr(426) of chicken 3BP2 are the major phosphorylation sites by Syk and the SH2 domain of 3BP2 is critical for tyrosine phosphorylation. In addition, phosphorylation of Tyr(426) is required for the inducible interaction with the SH2 domain of Vav3. Moreover, the expression of the mutant form of 3BP2 in which Tyr(426) was substituted to Phe resulted in the reduction in BCR-mediated Rac1 activation, when compared with the case of wild-type. Altogether, these data suggest that 3BP2 is involved in the activation of Rac1 through the regulation of Vav3 by Syk-dependent phosphorylation of Tyr(426) following BCR stimulation. Copyright © 2014 Elsevier Inc. All rights reserved.
Higher TSH Levels Within the Normal Range Are Associated With Unexplained Infertility.
Orouji Jokar, Tahereh; Fourman, Lindsay T; Lee, Hang; Mentzinger, Katherine; Fazeli, Pouneh K
2018-02-01
Unexplained infertility (UI), defined as the inability to conceive after 12 months of unprotected intercourse with no diagnosed cause, affects 10% to 30% of infertile couples. An improved understanding of the mechanisms underlying UI could lead to less invasive and less costly treatment strategies. Abnormalities in thyroid function and hyperprolactinemia are well-known causes of infertility, but whether thyrotropin (TSH) and prolactin levels within the normal range are associated with UI is unknown. To compare TSH and prolactin levels in women with UI and women with a normal fertility evaluation except for an azoospermic or severely oligospermic male partner. Cross-sectional study including women evaluated at a large academic health system between 1 January 2000 and 31 December 2012 with normal TSH (levels within the normal range of the assay and ≤5 mIU/L) and normal prolactin levels (≤20 ng/mL) and either UI (n = 187) or no other cause of infertility other than an azoospermic or severely oligospermic partner (n = 52). TSH and prolactin. Women with UI had significantly higher TSH levels than controls [UI: TSH 1.95 mIU/L, interquartile range: (1.54, 2.61); severe male factor: TSH 1.66 mIU/L, interquartile range: (1.25, 2.17); P = 0.003]. This finding remained significant after we controlled for age, body mass index, and smoking status. Nearly twice as many women with UI (26.9%) had a TSH ≥2.5 mIU/L compared with controls (13.5%; P < 0.05). Prolactin levels did not differ between the groups. Women with UI have higher TSH levels compared with a control population. More studies are necessary to determine whether treatment of high-normal TSH levels decreases time to conception in couples with UI. Copyright © 2017 Endocrine Society
Energy Technology Data Exchange (ETDEWEB)
Baucom, P.C.; Rigsby, C.A. [East Carolina Univ., Greenville, NC (United States). Dept. of Geology
1999-05-01
Strata exposed in terraces and modern cutbanks along the Rio Desaguadero contain a variety of lithofacies that were deposited in four distinct facies associations. These facies associations document a history of aggradation and downcutting that is linked to Holocene climate change on the Altiplano. Braided-stream, meandering-stream, deltaic and shoreline, and lacustrine sediments preserved in multi-level terraces in the northern Rio Desaguadero valley record two high-water intervals: one between 4,500 and 3,900 yr BP and another between 2,000 and 2,200 yr BP. These wet periods were interrupted by three periods of fluvial downcutting, centered at approximately 4,000 yr BP, 3,600 yr BP, and after 2,000 yr BP. Braided-river sediments preserved in a single terrace level in the southern Rio Desaguadero valley record a history of nearly continuous fluvial sedimentation from at least 7,000 yr BP until approximately 3,200 yr BP that was followed by a single episode (post-3,210 yr BP) of down-cutting and lateral migration. The deposition and subsequent fluvial downcutting of the northern strata was controlled by changes in effective moisture that can be correlated to Holocene water-level fluctuations of Lake Titicaca. The deposition and dissection of braided-stream sediments to the south are more likely controlled by a combination of base-level change and sediment input from the Rio Mauri.
Synthesis and characterizations of two anhydrous metal borophosphates: MIII2BP3O12 (M=Fe, In)
International Nuclear Information System (INIS)
Zhang Weilong; Lin Chensheng; Geng Lei; Li Yeyu; Zhang Hao; He Zhangzhen; Cheng Wendan
2010-01-01
Two members of M III 2 BP 3 O 12 borophosphates, namely Fe 2 BP 3 O 12 and In 2 BP 3 O 12 , were synthesized by the solid-state method and characterized by the X-ray single crystal diffraction, the powder diffraction and the electron microscopy. They both crystallize in the hexagonal system, space group P6(3)/m (no. 176) and feature 3D architectures, build up of the M 2 O 9 units and B(PO 4 ) 3 groups via sharing the corners; however, they are not isomorphic for the different crystallographically distinct atomic positions. Optical property measurements of both compounds and magnetic susceptibility measurements of Fe 2 BP 3 O 12 also have been performed. Moreover, in order to gain further insights into the relationship between physical properties and band structure of the M III 2 BP 3 O 12 borophosphates, theoretical calculations based on density functional theory (DFT) were performed using the total-energy code CASTEP. - Graphical abstract: Two anhydrous metal borophosphates of M III 2 BP 3 O 12 (M=Fe, In) have been prepared and characterized. They both crystallize in the hexagonal system, space group P6(3)/m (no. 176) and feature 3D architectures build up of the M 2 O 9 units and B(PO 4 ) 3 groups via sharing the corners, but they are not isomorphic for the different crystallographically distinct atomic positions.
BRCA1-associated exclusion of 53BP1 from DNA damage sites underlies temporal control of DNA repair
Chapman, J. Ross; Sossick, Alex J.; Boulton, Simon J.; Jackson, Stephen P.
2012-01-01
Summary Following irradiation, numerous DNA-damage-responsive proteins rapidly redistribute into microscopically visible subnuclear aggregates, termed ionising-radiation-induced foci (IRIF). How the enrichment of proteins on damaged chromatin actually relates to DNA repair remains unclear. Here, we use super-resolution microscopy to examine the spatial distribution of BRCA1 and 53BP1 proteins within single IRIF at subdiffraction-limit resolution, yielding an unprecedented increase in detail that was not previously apparent by conventional microscopy. Consistent with a role for 53BP1 in promoting DNA double-strand break repair by non-homologous end joining, 53BP1 enrichment in IRIF is most prominent in the G0/G1 cell cycle phases, where it is enriched in dense globular structures. By contrast, as cells transition through S phase, the recruitment of BRCA1 into the core of IRIF is associated with an exclusion of 53BP1 to the focal periphery, leading to an overall reduction of 53BP1 occupancy at DNA damage sites. Our data suggest that the BRCA1-associated IRIF core corresponds to chromatin regions associated with repair by homologous recombination, and the enrichment of BRCA1 in IRIF represents a temporal switch in the DNA repair program. We propose that BRCA1 antagonises 53BP1-dependent DNA repair in S phase by inhibiting its interaction with chromatin proximal to damage sites. Furthermore, the genomic instability exhibited by BRCA1-deficient cells might result from a failure to efficiently exclude 53BP1 from such regions during S phase. PMID:22553214
A New Open-framework Iron Borophosphate from Ionic Liquids: KFe[BP2O8(OH
Directory of Open Access Journals (Sweden)
Guangmei Wang
2011-04-01
Full Text Available A new open-framework iron borophosphate, KFe[BP2O8(OH], has been obtained by ionothermal synthesis from KH2PO4, FeCl3∙4H2O, H3BO3 and [C4mpyr]Br (1-butyl-1-methylpyrrolidinium bromide. Single-crystal X-ray diffraction analysis shows that KFe[BP2O8(OH] (monoclinic, P21/c, a = 9.372(2 Å , b = 8.146(2Å , c = 9.587(2 Å, β = 101.18(3°, V = 718.0(2Å3 and Z = 4 has a three-dimensional (3-D framework structure composed by {Fe(IIIO5(OH} octahedra as well as {BO3(OH} and {PO4} tetrahedra. As anionic structural sub-unit, KFe[BP2O8(OH], contains an infinite open-branched {[BP2O8(OH]4-} chain which is formed by alternating {BO3(OH} and {PO4} tetrahedra. {Fe(IIIO5(OH} octahedra share common O corners with five phosphate tetrahedra and the OH corner links to the hydrogen borate group to give a 3D framework. The negative charges of the inorganic framework are balanced by K+ ions.
Higher Plasma Myostatin Levels in Cor Pulmonale Secondary to Chronic Obstructive Pulmonary Disease.
Ju, Chun-Rong; Chen, Miao; Zhang, Jian-Heng; Lin, Zhi-Ya; Chen, Rong-Chang
2016-01-01
To analyze plasma myostatin levels and investigate their relationship with right ventricular (RV) function in patients with cor pulmonale secondary to chronic obstructive pulmonary disease (COPD). The study recruited 81 patients with advanced COPD and 40 age-matched controls. The patients were divided into two groups: those with cor pulmonale and those without. Echocardiography was used to evaluate RV function and morphology, and the value of tricuspid annular plane systolic excursion (TAPSE) less than 16 mm was considered RV dysfunction. Plasma myostatin levels were analyzed by enzyme-linked immunosorbent assay, and B-type natriuretic peptide (BNP) levels were analyzed as a comparison of myostatin. The data detected cor pulmonale in 39/81 patients, with the mean value of TAPSE of 14.3 mm. Plasma myostatin levels (ng/mL) were significantly higher in patients with cor pulmonale (16.68 ± 2.95) than in those without (13.56 ± 3.09), and much higher than in controls (8.79±2.79), with each pmyostatin levels were significantly correlated with the values of TAPSE and RV myocardium performance index among the COPD patients, and that BNP levels were significantly correlated only with systolic pulmonary arterial pressure, with each pmyostatin levels are increased in COPD patients who have cor pulmonale. Stronger correlations of plasma myostatin levels with echocardiographic indexes of the right heart suggest that myostatin might be superior to BNP in the early diagnosis of cor pulmonale in COPD.
β-endorphins Plasma Level is Higher in Lean Polycystic Ovary Syndrome (PCOS) Women.
Kiałka, M; Milewicz, T; Spałkowska, M; Krzyczkowska-Sendrakowska, M; Wasyl, B; Pełka, A; Krzysiek, J
2016-01-01
The evaluation the β-endorphin plasma levels in lean women with polycystic ovary syndrome as well as in women without this disorder. The associations between β-endorphins and other laboratory parameters were also investigated. 31 women lean, defined as women with normal range body mass index, 15 with polycystic ovary syndrome and 16 without this disorder were included to the study. In all the patients the level of β-endorphins was measured. Also the diagnostic laboratory profile including hormone assessment was made in all patients. There were significant differences in β-endorphin levels between the 2 groups. The β-endorphin level was higher in the polycystic ovary syndrome group compared to the healthy controls (15.5±4.37 pg/ml vs. 6.9±2.47 pg/ml, ppolycystic ovary syndrome group. Increase in β-endorphin level of 1 pg/ml was associated with an increase of cortisol at 8 am level of 1.134 µg/dl and decrease of sex hormone binding globuline of 0.948 nmol/l in polycystic ovary syndrome group. Our study showed that the levels of β-endorphins were significantly higher in lean patients with polycystic ovary syndrome than in lean controls. Moreover, β-endorphins levels were found to be correlated with other hormonal parameters. In this respect, β-endorphins may play a role in polycystic ovary syndrome pathophysiology. © Georg Thieme Verlag KG Stuttgart · New York.
Peluso, Gonzalo; García-Espinosa, Victoria; Curcio, Santiago; Marota, Marco; Castro, Juan; Chiesa, Pedro; Giachetto, Gustavo; Bia, Daniel; Zócalo, Yanina
2017-03-01
In adults, central blood pressure (cBP) is reported to associate target organ damages (TODs) rather than peripheral blood pressure (pBP). However, data regarding the association of pre-clinical TODs with cBP and pBP in pediatric populations are scarce. To evaluate in children and adolescents the importance of cBP and pBP levels, in terms of their association with hemodynamic and vascular changes. 315 subjects [age (mean/range) 12/8-18 years] were included. pBP (oscillometry, Omron-HEM433INT and Mobil-O-Graph), cBP levels and waveforms (oscillometry, Mobil-O-Graph; applanation tonometry, SphygmoCor), aortic wave reflection-related parameters, carotid intima-media thickness (CIMT) and carotid (elastic modulus, stiffness-index) and aortic stiffness (carotid-femoral pulse wave velocity, PWV). Four groups were defined considering pBP and cBP percentiles (th): cBP ≥90th, cBP th, pBP ≥90th, pBP th. In each group, haemodynamic and vascular parameters were compared for subgroups defined considering the level of the remaining blood pressure (cBP or pBP). Subgroups were matched for anthropometric and cardiovascular risk factors (propensity matching-score). Subjects with high cBP showed a worse cardiovascular risk profile in addition to worse peripheral hemodynamic conditions. The CIMT, carotid and aortic stiffness levels were also higher in those subjects. CIMT and carotid stiffness remained statistically higher when subjects were matched for pBP and other cardiovascular risk factors. There were no differences in arterial properties when subjects were analyzed (compared) considering similar pBP levels, during normal and high cBP conditions. Compared with pBP, the cBP levels show a greater association with vascular alterations (high CIMT and arterial stiffness), in children and adolescents.
Change of direction ability test differentiates higher level and lower level soccer referees
Los, Arcos A; Grande, I; Casajús, JA
2016-01-01
This report examines the agility and level of acceleration capacity of Spanish soccer referees and investigates the possible differences between field referees of different categories. The speed test consisted of 3 maximum acceleration stretches of 15 metres. The change of direction ability (CODA) test used in this study was a modification of the Modified Agility Test (MAT). The study included a sample of 41 Spanish soccer field referees from the Navarre Committee of Soccer Referees divided into two groups: i) the higher level group (G1, n = 20): 2ndA, 2ndB and 3rd division referees from the Spanish National Soccer League (28.43 ± 1.39 years); and ii) the lower level group (G2, n = 21): Navarre Provincial League soccer referees (29.54 ± 1.87 years). Significant differences were found with respect to the CODA between G1 (5.72 ± 0.13 s) and G2 (6.06 ± 0.30 s), while no differences were encountered between groups in acceleration ability. No significant correlations were obtained in G1 between agility and the capacity to accelerate. Significant correlations were found between sprint and agility times in the G2 and in the total group. The results of this study showed that agility can be used as a discriminating factor for differentiating between national and regional field referees; however, no observable differences were found over the 5 and 15 m sprint tests. PMID:27274111
Inverse Solutionof BP Neural Network for Laser Remelting Parameters
Directory of Open Access Journals (Sweden)
LIU Li-jun
2017-06-01
Full Text Available Aim at highly nonlinear mapping relationship between the laser processing parameters and the melting cell body’s transverse size,a method of reverse engineering laser melting parameters by back - propagation ( BP neural network was put forward. The model was constructed by BP neural network,and the prediction error was reduced to less than 3% after training for many times. The DIEVAR die steel was melted by reverse engineering laser parameters,and the results show that the error was 1. 33% between the transverse dimensions of the melting cell body and the expected,the expected precision can be met well. Thermal fatigue property of the melted and non - melted DIEVAR die steel has been studied. The analysis about cracks growth presents that thermal fatigue property of DIEVAR die steel melted by the reverse engineering parameters has been greatly improved. The melting cell body could block crack effectively.
Directory of Open Access Journals (Sweden)
Elmståhl Sölve
2011-10-01
Full Text Available Abstract Background Systolic blood pressure (SBP decline has been reported in octogenarians. The aim was to study if it could be observed while measuring SBP with two methods: Korotkoff (K-BP and Strain-Gauge-Finger-Pletysmography (SG-BP, and which of them were more reliable in expressing vascular burden. Methods A cohort of 703 men from a population of Malmö, Sweden, were included in "Men born in 1914-study" and followed-up at ages: 68 and 81 years. 176 survivors were examined with K-BP and SG-BP at both ages, and 104 of them with Ambulatory Blood Pressure at age 81/82. Ankle Brachial Index (ABI was measured on both occasions, and Carotid Ultrasound at age 81. Results From age 68 to 81, mean K-BP decreased in the cohort with mean 8.3 mmHg, while SG-BP increased with 13.4 mmHg. K-BP decreased in 55% and SG-BP in 31% of the subjects. At age 81, K-BP was lower than SG-BP in 72% of subjects, and correlated to high K-BP at age 68 (r = --.22; p Conclusion In contrast to K-BP, values of SG-BP in octogenarians strongly correlated with Ambulatory Blood Pressure. The SG-BP decline in the last decade was rare, and increasing SG-BP better than K-BP reflected advanced atherosclerosis. It should be aware, that K-BP underdetected 46% of subjects with SG-BP equal/higher than 140 mmHg at age 81, which may lead to biased associations with risk factors due to differential misclassification by age.
Fang, Fang; Pan, Jian; Li, Yiping; Xu, Lixiao; Su, Guanghao; Li, Gang; Wang, Jian
2015-01-01
Many studies have focused on the relationship between interleukin 1 receptor antagonist (IL1RN) gene 86-bp VNTR polymorphism and sepsis, but the results remain inconsistent. Thus, a meta-analysis was carried out to derive a more precise estimation of the association between IL1RN 86-bp VNTR polymorphism and risk of sepsis and sepsis-related mortality. Relevant publications were searched in several widely used databases and six eligible studies were included in the meta-analysis. Pooled odds ratios (ORs) and 95% confidence intervals (CIs) were calculated to evaluate the strength of the association between IL1RN 86-bp VNTR polymorphism and risk of sepsis and sepsis-related mortality. Significant associations between IL1RN 86-bp VNTR polymorphism and sepsis risk were observed in both overall meta-analysis for L2 versus 22 (OR=0.75, 95% CI=0.59-0.94) and severe sepsis subgroup for LL+L2 versus 22 (OR=0.67, 95% CI=0.47-0.93). L stands for long alleles containing three to six repeats; 2 stands for short allele containing two repeats. However, no significant sepsis mortality variation was detected for all genetic models. According to the results of our meta-analysis, the IL1RN 86-bp VNTR polymorphism probably associates with sepsis risk but not with sepsis-related mortality. Copyright © 2014. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Ping Rao
2016-06-01
Full Text Available Background: Genome-wide association studies (GWAS found that IGF2BP2 rs4402960 and rs1470579 polymorphisms were associated with type 2 diabetes mellitus (T2DM risk. Many studies have replicated this association, but yielded inconsistent results. Materials and Methods: A case-control study consisting of 461 T2DM patients and 434 health controls was conducted to detect the genetic susceptibility of IGF2BP2 in a northern Han Chinese population. A meta-analysis was to evaluate the association more precisely in Asians. Results: In the case-control study, the carriers of TT genotype at rs4402960 had a higher T2DM risk than the G carriers (TG + GG (adjusted odd ratio (AOR = 1.962, 95% confidence interval (95% CI = 1.065–3.612, p = 0.031]; CC carriers at rs1470579 were more susceptible to T2DM than A carriers (CA + AA (AOR = 2.014, 95% CI = 1.114–3.642, p = 0.021. The meta-analysis containing 36 studies demonstrated that the two polymorphisms were associated with T2DM under the allele comparison, genetic models of dominant and recessive in Asians (p < 0.05. The rs4402960 polymorphisms were significantly associated with the T2DM risk after stratification by diagnostic criterion, size of sample and average age and BMI of cases, while there’re no consistent results for rs1470579. Conclusions: Our data suggests that IGF2BP2 polymorphisms are associated with T2DM in Asian populations.
Does peer learning or higher levels of e-learning improve learning abilities?
DEFF Research Database (Denmark)
Worm, Bjarne Skjødt; Jensen, Kenneth
2013-01-01
The fast development of e-learning and social forums demands us to update our understanding of e-learning and peer learning. We aimed to investigate if higher, pre-defined levels of e-learning or social interaction in web forums improved students' learning ability....
Energy Technology Data Exchange (ETDEWEB)
Groesser, Torsten; Chang, Hang; Fontenay, Gerald; Chen, James; Costes, Sylvain V.; Barcellos-Hoff, Mary Helen; Parvin, Bahram; Rydberg, Bjorn
2010-12-22
To investigate {gamma}-H2AX (phosphorylated histone H2AX) and 53BP1 (tumour protein 53 binding protein No. 1) foci formation and removal in proliferating and non-proliferating human mammary epithelial cells (HMEC) after exposure to sparsely and densely ionizing radiation under different cell culture conditions. HMEC cells were grown either as monolayers (2D) or in extracellular matrix to allow the formation of acinar structures in vitro (3D). Foci numbers were quantified by image analysis at various time points after exposure. Our results reveal that in non-proliferating cells under 2D and 3D cell culture conditions, iron-ion induced {gamma}-H2AX foci were still present at 72 h after exposure, although 53BP1 foci returned to control levels at 48 h. In contrast in proliferating HMEC, both {gamma}-H2AX and 53BP1 foci decreased to control levels during the 24-48 h time interval after irradiation under 2D conditions. Foci numbers decreased faster after {gamma}-ray irradiation and returned to control levels by 12 h regardless of marker, cell proliferation status, and cell culture condition. Conclusions: The disappearance of radiation induced {gamma}-H2AX and 53BP1 foci in HMEC have different dynamics that depend on radiation quality and proliferation status. Notably, the general patterns do not depend on the cell culture condition (2D versus 3D). We speculate that the persistent {gamma}-H2AX foci in iron-ion irradiated non-proliferating cells could be due to limited availability of double strand break (DSB) repair pathways in G0/G1-phase, or that repair of complex DSB requires replication or chromatin remodeling.
Ertl, P; Knaus, W; Metzler-Zebeli, B U; Klevenhusen, F; Khiaosa-Ard, R; Zebeli, Q
2015-07-01
A rumen simulation technique was used to evaluate the effects of the complete substitution of a common concentrate mixture (CON) with a mixture consisting solely of by-products from the food industry (BP) at 2 different forage-to-concentrate ratios on ruminal fermentation profile, nutrient degradation, and abundance of rumen microbiota. The experiment was a 2×2 factorial arrangement with 2 concentrate types (CON and BP) and 2 concentrate levels (25 and 50% of diet dry matter). The experiment consisted of 2 experimental runs with 12 fermentation vessels each (n=6 per treatment). Each run lasted for 10d, with data collection on the last 5d. The BP diets had lower starch, but higher neutral detergent fiber (NDF) and fat contents compared with CON. Degradation of crude protein was decreased, but NDF and nonfiber carbohydrate degradation were higher for the BP diets. At the 50% concentrate level, organic matter degradation tended to be lower for BP and CH4 formation per unit of NDF degraded was also lower for BP. The BP mixture led to a higher concentration of propionate and a lower acetate-to-propionate ratio, whereas concentrations of butyrate and caproate decreased. Concentrate type did not affect microbial community composition, except that the abundance of bacteria of the genus Prevotella was higher for BP. Increasing the concentrate level resulted in higher degradation of organic matter and crude protein. At the higher concentrate level, total short-chain fatty acid formation increased and concentrations of isobutyrate and valerate decreased. In addition, at the 50% concentrate level, numbers of protozoa increased, whereas numbers of methanogens, anaerobic fungi, and fibrolytic bacteria decreased. No interaction was noted between the 2 dietary factors on most variables, except that at the higher concentrate level the effects of BP on CH4 and CO2 formation per unit of NDF degraded, crude protein degradation, and the abundance of Prevotella were more prominent. In
Subramanian, T; Zhao, Ling-Jun; Chinnadurai, G
2013-09-01
Adenovirus E1A induces cell proliferation, oncogenic transformation and promotes viral replication through interaction with p300/CBP, TRRAP/p400 multi-protein complex and the retinoblastoma (pRb) family proteins through distinct domains in the E1A N-terminal region. The C-terminal region of E1A suppresses E1A/Ras co-transformation and interacts with FOXK1/K2, DYRK1A/1B/HAN11 and CtBP1/2 (CtBP) protein complexes. To specifically dissect the role of CtBP interaction with E1A, we engineered a mutation (DL→AS) within the CtBP-binding motif, PLDLS, and investigated the effect of the mutation on immortalization and Ras cooperative transformation of primary cells and viral replication. Our results suggest that CtBP-E1A interaction suppresses immortalization and Ras co-operative transformation of primary rodent epithelial cells without significantly influencing the tumorigenic activities of transformed cells in immunodeficient and immunocompetent animals. During productive infection, CtBP-E1A interaction enhances viral replication in human cells. Between the two CtBP family proteins, CtBP2 appears to restrict viral replication more than CtBP1 in human cells. Copyright © 2013 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Patricia Lassaux
Full Text Available Type IV pili are surface-exposed filaments and bacterial virulence factors, represented by the Tfpa and Tfpb types, which assemble via specific machineries. The Tfpb group is further divided into seven variants, linked to heterogeneity in the assembly machineries. Here we focus on PilO2(Bp, a protein component of the Tfpb R64 thin pilus variant assembly machinery from the pathogen Burkholderia pseudomallei. PilO2(Bp belongs to the PF06864 Pfam family, for which an improved definition is presented based on newly derived Hidden Markov Model (HMM profiles. The 3D structure of the N-terminal domain of PilO2(Bp (N-PilO2(Bp, here reported, is the first structural representative of the PF06864 family. N-PilO2(Bp presents an actin-like ATPase fold that is shown to be present in BfpC, a different variant assembly protein; the new HMM profiles classify BfpC as a PF06864 member. Our results provide structural insight into the PF06864 family and on the Type IV pili assembly machinery.
The antioxidant level of Alaska's wild berries: high, higher and highest
Directory of Open Access Journals (Sweden)
Roxie Rodgers Dinstel
2013-08-01
Full Text Available Background . In the last few years, antioxidants have become the stars of the nutritional world. Antioxidants are important in terms of their ability to protect against oxidative cell damage that can lead to conditions, such as Alzheimer's disease, cancer and heart disease – conditions also linked with chronic inflammation. The antioxidant and anti-inflammatory effects of Alaska's wild berries may have the potential to help prevent these diseases. Objective . To discover the antioxidant levels of Alaska wild berries and the ways these antioxidant levels translate when preservation methods are applied to the berry. Design . This research centred on both the raw berries and products made from the berries. In the first year, a variety of wild berries were tested to discover their oxygen radical absorption capacity (ORAC in the raw berries. The second level of the research project processed 4 different berries – blueberries, lingonberries, salmonberries, highbush cranberries – into 8 or 9 products made from these berries. The products were tested for both ORAC as well as specific antioxidants. Results . The Alaska wild berries collected and tested in the first experiment ranged from 3 to 5 times higher in ORAC value than cultivated berries from the lower 48 states. For instance, cultivated blueberries have an ORAC scale of 30. Alaska wild dwarf blueberries measure 85. This is also higher than lower 48 wild blueberries, which had a score of 61. All of the Alaskan berries tested have a level of antioxidant considered nutritionally valuable, ranging from 19 for watermelon berries to 206 for lingonberries on the ORAC scale. With the processed products made from 4 Alaska wild berries, one of the unexpected outcomes of the research was that the berries continued to have levels of antioxidants considered high, despite the effects of commonly used heat-processing techniques. When berries were dehydrated, per gram ORAC values increased. Conclusion
Dryness crisis of the late V BP milenium in the west coast of Port of Mazarron (Murcia, Spain)
International Nuclear Information System (INIS)
Navarro Hervas, F.; Rodriguez Estrella, T.; Carrion Garcia, J. S.; Ros Sala, M. M.; Fernandez Jimenez, S.; Garcia Martinez, M. S.; Mancheno Jimenez, M. A.; Alvarez Rogel, Y.
2009-01-01
Here we describe a formerly unrecognized dry spell dated at between c. 4330 and 3950 radiocarbon years BP, and located in the Puerto de Mazarron (Murcia, southeastern Spain). The palaeoclimatical inference is provided by halite levels within a long sequence of a multiple core study carried in a palaeo-lagoon. The lithological inference is corroborated by palynological records involving a forest depletion. The event is also linked to a population decline in the study region. (Author) 6 refs.
Iwasaki, Takeshi; Matsushita, Michiko; Nonaka, Daisuke; Kuwamoto, Satoshi; Kato, Masako; Murakami, Ichiro; Nagata, Keiko; Nakajima, Hideki; Sano, Shigetoshi; Hayashi, Kazuhiko
2015-02-01
Merkel cell polyomavirus (MCPyV) integrates monoclonally into the genomes of approximately 80% of Merkel cell carcinomas (MCCs), affecting their clinicopathological features. The molecular mechanisms underlying MCC development after MCPyV infection remain unclear. We investigated the association of MCPyV infection with activation of the Akt/mammalian target of rapamycin (mTOR)/4E-binding protein 1 (4E-BP1) signaling pathway in MCCs to elucidate the role of these signal transductions and to identify molecular targets for treatment. We analyzed the molecular and pathological characteristics of 41 MCPyV-positive and 27 MCPyV-negative MCCs. Expression of mTOR, TSC1, and TSC2 messenger RNA was significantly higher in MCPyV-negative MCCs, and Akt (T308) phosphorylation also was significantly higher (92% vs 66%; P = .019), whereas 4E-BP1 (S65 and T70) phosphorylation was common in both MCC types (92%-100%). The expression rates of most other tested signals were high (60%-100%) and not significantly correlated with MCPyV large T antigen expression. PIK3CA mutations were observed more frequently in MCPyV-positive MCCs (6/36 [17%] vs 2/20 [10%]). These results suggest that protein expression (activation) of most Akt/mTOR/4E-BP1 pathway signals was not significantly different in MCPyV-positive and MCPyV-negative MCCs, although these 2 types may differ in tumorigenesis, and MCPyV-negative MCCs showed significantly more frequent p-Akt (T308) activation. Therefore, certain Akt/mTOR/4E-BP1 pathway signals could be novel therapeutic targets for MCC regardless of MCPyV infection status. Copyright © 2015 Elsevier Inc. All rights reserved.
Research on the Prediction Model of CPU Utilization Based on ARIMA-BP Neural Network
Directory of Open Access Journals (Sweden)
Wang Jina
2016-01-01
Full Text Available The dynamic deployment technology of the virtual machine is one of the current cloud computing research focuses. The traditional methods mainly work after the degradation of the service performance that usually lag. To solve the problem a new prediction model based on the CPU utilization is constructed in this paper. A reference offered by the new prediction model of the CPU utilization is provided to the VM dynamic deployment process which will speed to finish the deployment process before the degradation of the service performance. By this method it not only ensure the quality of services but also improve the server performance and resource utilization. The new prediction method of the CPU utilization based on the ARIMA-BP neural network mainly include four parts: preprocess the collected data, build the predictive model of ARIMA-BP neural network, modify the nonlinear residuals of the time series by the BP prediction algorithm and obtain the prediction results by analyzing the above data comprehensively.
Directory of Open Access Journals (Sweden)
M. Jakobsson
2017-08-01
Full Text Available The Bering Strait connects the Arctic and Pacific oceans and separates the North American and Asian landmasses. The presently shallow ( ∼ 53 m strait was exposed during the sea level lowstand of the last glacial period, which permitted human migration across a land bridge today referred to as the Bering Land Bridge. Proxy studies (stable isotope composition of foraminifera, whale migration into the Arctic Ocean, mollusc and insect fossils and paleobotanical data have suggested a range of ages for the Bering Strait reopening, mainly falling within the Younger Dryas stadial (12.9–11.7 cal ka BP. Here we provide new information on the deglacial and post-glacial evolution of the Arctic–Pacific connection through the Bering Strait based on analyses of geological and geophysical data from Herald Canyon, located north of the Bering Strait on the Chukchi Sea shelf region in the western Arctic Ocean. Our results suggest an initial opening at about 11 cal ka BP in the earliest Holocene, which is later than in several previous studies. Our key evidence is based on a well-dated core from Herald Canyon, in which a shift from a near-shore environment to a Pacific-influenced open marine setting at around 11 cal ka BP is observed. The shift corresponds to meltwater pulse 1b (MWP1b and is interpreted to signify relatively rapid breaching of the Bering Strait and the submergence of the large Bering Land Bridge. Although the precise rates of sea level rise cannot be quantified, our new results suggest that the late deglacial sea level rise was rapid and occurred after the end of the Younger Dryas stadial.
Jakobsson, Martin; Pearce, Christof; Cronin, Thomas M.; Backman, Jan; Anderson, Leif G.; Barrientos, Natalia; Bjork, Goran; Coxhall, Helen; de Boer, Agatha; Mayer, Larry; Morth, Carl-Magnus; Nilsson, Johan; Rattray, Jayne; Sranne, Christian; Semiletov, Igor; O'Regan, Matt
2017-01-01
The Bering Strait connects the Arctic and Pacific oceans and separates the North American and Asian landmasses. The presently shallow ( ∼ 53 m) strait was exposed during the sea level lowstand of the last glacial period, which permitted human migration across a land bridge today referred to as the Bering Land Bridge. Proxy studies (stable isotope composition of foraminifera, whale migration into the Arctic Ocean, mollusc and insect fossils and paleobotanical data) have suggested a range of ages for the Bering Strait reopening, mainly falling within the Younger Dryas stadial (12.9–11.7 cal ka BP). Here we provide new information on the deglacial and post-glacial evolution of the Arctic–Pacific connection through the Bering Strait based on analyses of geological and geophysical data from Herald Canyon, located north of the Bering Strait on the Chukchi Sea shelf region in the western Arctic Ocean. Our results suggest an initial opening at about 11 cal ka BP in the earliest Holocene, which is later than in several previous studies. Our key evidence is based on a well-dated core from Herald Canyon, in which a shift from a near-shore environment to a Pacific-influenced open marine setting at around 11 cal ka BP is observed. The shift corresponds to meltwater pulse 1b (MWP1b) and is interpreted to signify relatively rapid breaching of the Bering Strait and the submergence of the large Bering Land Bridge. Although the precise rates of sea level rise cannot be quantified, our new results suggest that the late deglacial sea level rise was rapid and occurred after the end of the Younger Dryas stadial.
Tinga, Angelica Maria; Visser-Meily, Johanna Maria Augusta; van der Smagt, Maarten Jeroen; Van der Stigchel, Stefan; van Ee, Raymond; Nijboer, Tanja Cornelia Wilhelmina
2016-03-01
The aim of this systematic review was to integrate and assess evidence for the effectiveness of multisensory stimulation (i.e., stimulating at least two of the following sensory systems: visual, auditory, and somatosensory) as a possible rehabilitation method after stroke. Evidence was considered with a focus on low-level, perceptual (visual, auditory and somatosensory deficits), as well as higher-level, cognitive, sensory deficits. We referred to the electronic databases Scopus and PubMed to search for articles that were published before May 2015. Studies were included which evaluated the effects of multisensory stimulation on patients with low- or higher-level sensory deficits caused by stroke. Twenty-one studies were included in this review and the quality of these studies was assessed (based on eight elements: randomization, inclusion of control patient group, blinding of participants, blinding of researchers, follow-up, group size, reporting effect sizes, and reporting time post-stroke). Twenty of the twenty-one included studies demonstrate beneficial effects on low- and/or higher-level sensory deficits after stroke. Notwithstanding these beneficial effects, the quality of the studies is insufficient for valid conclusion that multisensory stimulation can be successfully applied as an effective intervention. A valuable and necessary next step would be to set up well-designed randomized controlled trials to examine the effectiveness of multisensory stimulation as an intervention for low- and/or higher-level sensory deficits after stroke. Finally, we consider the potential mechanisms of multisensory stimulation for rehabilitation to guide this future research.
DEFF Research Database (Denmark)
Lukas, Claudia; Savic, Velibor; Bekker-Jensen, Simon
2011-01-01
stress increases the frequency of chromosomal lesions that are transmitted to daughter cells. Throughout G1, these lesions are sequestered in nuclear compartments marked by p53-binding protein 1 (53BP1) and other chromatin-associated genome caretakers. We show that the number of such 53BP1 nuclear bodies...... increases after genetic ablation of BLM, a DNA helicase associated with dissolution of entangled DNA. Conversely, 53BP1 nuclear bodies are partially suppressed by knocking down SMC2, a condensin subunit required for mechanical stability of mitotic chromosomes. Finally, we provide evidence that 53BP1 nuclear...... bodies shield chromosomal fragile sites sequestered in these compartments against erosion. Together, these data indicate that restoration of DNA or chromatin integrity at loci prone to replication problems requires mitotic transmission to the next cell generations....
Wellbeing in the Welfare State: level not higher, distribution not more equitable
R. Veenhoven (Ruut)
2000-01-01
textabstract'Wellbeing' and 'welfare' are often bracketed together, in particular wellbeing and state-welfare. The level of wellbeing is believed to be higher in welfare states, and its distribution more equitable. This theory is tested in a comparative study of 40 nations 1980-1990. The size of
Higher Plasma Myostatin Levels in Cor Pulmonale Secondary to Chronic Obstructive Pulmonary Disease.
Directory of Open Access Journals (Sweden)
Chun-Rong Ju
Full Text Available To analyze plasma myostatin levels and investigate their relationship with right ventricular (RV function in patients with cor pulmonale secondary to chronic obstructive pulmonary disease (COPD.The study recruited 81 patients with advanced COPD and 40 age-matched controls. The patients were divided into two groups: those with cor pulmonale and those without. Echocardiography was used to evaluate RV function and morphology, and the value of tricuspid annular plane systolic excursion (TAPSE less than 16 mm was considered RV dysfunction. Plasma myostatin levels were analyzed by enzyme-linked immunosorbent assay, and B-type natriuretic peptide (BNP levels were analyzed as a comparison of myostatin.The data detected cor pulmonale in 39/81 patients, with the mean value of TAPSE of 14.3 mm. Plasma myostatin levels (ng/mL were significantly higher in patients with cor pulmonale (16.68 ± 2.95 than in those without (13.56 ± 3.09, and much higher than in controls (8.79±2.79, with each p<0.01. Significant differences were also found in plasma BNP levels among the three groups (p<0.05. Multivariate regression analysis suggested that myostatin levels were significantly correlated with the values of TAPSE and RV myocardium performance index among the COPD patients, and that BNP levels were significantly correlated only with systolic pulmonary arterial pressure, with each p<0.05.Plasma myostatin levels are increased in COPD patients who have cor pulmonale. Stronger correlations of plasma myostatin levels with echocardiographic indexes of the right heart suggest that myostatin might be superior to BNP in the early diagnosis of cor pulmonale in COPD.
Energy Technology Data Exchange (ETDEWEB)
Velasquez, Celestino; Cheng, Erdong; Shuda, Masahiro; Lee-Oesterreich, Paula J.; Pogge von Strandmann, Lisa; Gritsenko, Marina A.; Jacobs, Jon M.; Moore, Patrick S.; Chang, Yuan
2016-07-11
mTOR-directed 4E-BP1 phosphorylation promotes cap-dependent translation and tumorigen-esis. During mitosis, CDK1 substitutes for mTOR and fully phosphorylates 4E-BP1 at canoni-cal as well a non-canonical S83 site resulting in a mitosis-specific hyperphosphorylated δ isoform. Colocalization studies with a phospho-S83 specific antibody indicate that 4E-BP1 S83 phosphorylation accumulates at centrosomes during prophase, peaks at metaphase, and decreases through telophase. While S83 phosphorylation of 4E-BP1 does not affect in vitro cap-dependent translation, nor eIF4G/4E-BP1 cap-binding, expression of an alanine substitution mutant 4E-BP1.S83A partially reverses rodent cell transformation induced by Merkel cell polyomavirus (MCV) small T (sT) antigen viral oncoprotein. In contrast to inhibitory mTOR 4E-BP1 phosphorylation, these findings suggest that mitotic CDK1-directed phosphorylation of δ-4E-BP1 may yield a gain-of-function, distinct from translation regulation, that may be important in tumorigenesis and mitotic centrosome function.
Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide
DEFF Research Database (Denmark)
Kristensen, Ole
2015-01-01
-terminal domains of the G3BP1 and Rasputin proteins. Recently, a subset of G3BP interacting proteins was recognized to share a common sequence motif, FGDF. The most studied binding partners, USP10 and viral nsP3, interfere with essential G3BP functions related to assembly of cellular stress granules. Reported...
Fractional-order gradient descent learning of BP neural networks with Caputo derivative.
Wang, Jian; Wen, Yanqing; Gou, Yida; Ye, Zhenyun; Chen, Hua
2017-05-01
Fractional calculus has been found to be a promising area of research for information processing and modeling of some physical systems. In this paper, we propose a fractional gradient descent method for the backpropagation (BP) training of neural networks. In particular, the Caputo derivative is employed to evaluate the fractional-order gradient of the error defined as the traditional quadratic energy function. The monotonicity and weak (strong) convergence of the proposed approach are proved in detail. Two simulations have been implemented to illustrate the performance of presented fractional-order BP algorithm on three small datasets and one large dataset. The numerical simulations effectively verify the theoretical observations of this paper as well. Copyright © 2017 Elsevier Ltd. All rights reserved.
Cho, Yeoungjee; Johnson, David W.; Vesey, David A.; Hawley, Carmel M.; Pascoe, Elaine M.; Clarke, Margaret; Topley, Nicholas
2016-01-01
♦ Background: Peritoneal dialysis (PD) patients develop progressive and cumulative peritoneal injury with longer time spent on PD. The present study aimed to a) describe the trend of peritoneal injury biomarkers, matrix metalloproteinase-2 (MMP-2) and tissue inhibitor of metalloproteinase-1 (TIMP-1), in incident PD patients, b) to explore the capacity of dialysate MMP-2 to predict peritoneal solute transport rate (PSTR) and peritonitis, and c) to evaluate the influence of neutral pH, low glucose degradation product (GDP) PD solution on these outcomes. ♦ Methods: The study included 178 participants from the balANZ trial who had at least 1 stored dialysate sample. Changes in PSTR and peritonitis were primary outcome measures, and the utility of MMP-2 in predicting these outcomes was analyzed using multilevel linear regression and multilevel Poisson regression, respectively. ♦ Results: Significant linear increases in dialysate MMP-2 and TIMP-1 concentrations were observed (p < 0.001), but neither was affected by the type of PD solutions received (MMP-2: p = 0.07; TIMP-1: p = 0.63). An increase in PSTR from baseline was associated with higher levels of MMP-2 (p = 0.02), and the use of standard solutions over longer PD duration (p = 0.001). The risk of peritonitis was independently predicted by higher dialysate MMP-2 levels (incidence rate ratio [IRR] per ng/mL 1.01, 95% confidence interval [CI] 1.005 – 1.02, p = 0.002) and use of standard solutions (Biocompatible solution: IRR 0.45, 95% CI 0.24 – 0.85, p = 0.01). ♦ Conclusion: Dialysate MMP-2 and TIMP-1 concentrations increased with longer PD duration. Higher MMP-2 levels were associated with faster PSTR and future peritonitis risk. Administration of biocompatible solutions exerted no significant effect on dialysate levels of MMP-2 or TIMP-1, but did counteract the increase in PSTR and the risk of peritonitis associated with the use of standard PD solutions. This is the first longitudinal study to examine
Lower limb entheseal morphology in the Neandertal Krapina population (Croatia, 130,000 BP).
Mariotti, Valentina; Belcastro, Maria Giovanna
2011-06-01
Although the Neandertal locomotor system has been shown to differ from Homo sapiens, characteristics of Neandertal entheses, the skeletal attachments for muscles, tendons, ligaments and joint capsules, have never been specifically investigated. Here, we analyse lower limb entheses of the Krapina Neandertal bones (Croatia, 130,000 BP) with the aim of determining how they compare with modern humans, using a standard developed by our research group for describing modern human entheseal variability. The entheses examined are those of the gluteus maximus, iliopsoas and vastus medialis on the femur, the quadriceps tendon on the patella, and soleus on the tibia. For the entheses showing a different morphological pattern from H. sapiens, we discuss the possibility of recognising genetic versus environmental causes. Our results indicate that only the gluteus maximus enthesis (the gluteal tuberosity), falls out of the modern human range of variation. It displays morphological features that could imply histological differences from modern humans, in particular the presence of fibrocartilage. In both H. sapiens and the Krapina Neandertals, the morphological pattern of this enthesis is the same in adult and immature femurs. These results can be interpreted in light of genetic differences between the two hominins. The possibility of functional adaptations to higher levels of mechanical load during life in the Neandertals seems less likely. The particular morphology and large dimensions of the Krapina enthesis, and perhaps its fibrocartilaginous nature, could have been selected for in association with other pelvic and lower limb characteristics, even if genetic drift cannot be ruled out. Copyright © 2011 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Jenkins, Gilbert
1999-07-01
A critical analysis is provided of the recent reorganisations of the downstream and petrochemical activities of BP and Shell. BP (or BP Amoco including Arco) and Shell are preparing for the next decade anticipating the environment and changing the companies to maximise their profitability in that environment. For the oil producing countries of the Middle East and North Africa (MENA), there are lessons to be learned both from the forecasts which BP Amoco and Shell are making and from the way these companies intend to operate. BP Amoco's view of oil refining is that the surplus capacity is endemic; Shell's view is that it is transient. BP Amoco will market oil products selectively across the world; Shell is still intent on a global approach. Both BP Amoco and Shell will minimise their wholesaling activities in the retail market and expand their merchandising with ever better quality sites. In the petrochemicals sector, the companies are taking similar actions, ie concentrating on positions of strength and selling business activities with low market shares or poor profitability. Petrochemical sites will be favoured when they have access to company produced hydrocarbon feedstocks. From the analysis, it is suggested that MENA oil companies will need to consider carefully the timing of any new refinery building. The reorganisation of the major OECD-based oil companies should offer opportunities for MENA companies to secure outlets for LPG and condensates, to form marketing alliances in OECD markets and to become involved in OECD-based petrochemical businesses.
International Nuclear Information System (INIS)
Jenkins, Gilbert
1999-01-01
A critical analysis is provided of the recent reorganisations of the downstream and petrochemical activities of BP and Shell. BP (or BP Amoco including Arco) and Shell are preparing for the next decade anticipating the environment and changing the companies to maximise their profitability in that environment. For the oil producing countries of the Middle East and North Africa (MENA), there are lessons to be learned both from the forecasts which BP Amoco and Shell are making and from the way these companies intend to operate. BP Amoco's view of oil refining is that the surplus capacity is endemic; Shell's view is that it is transient. BP Amoco will market oil products selectively across the world; Shell is still intent on a global approach. Both BP Amoco and Shell will minimise their wholesaling activities in the retail market and expand their merchandising with ever better quality sites. In the petrochemicals sector, the companies are taking similar actions, ie concentrating on positions of strength and selling business activities with low market shares or poor profitability. Petrochemical sites will be favoured when they have access to company produced hydrocarbon feedstocks. From the analysis, it is suggested that MENA oil companies will need to consider carefully the timing of any new refinery building. The reorganisation of the major OECD-based oil companies should offer opportunities for MENA companies to secure outlets for LPG and condensates, to form marketing alliances in OECD markets and to become involved in OECD-based petrochemical businesses
Higher Levels of Albuminuria within the Normal Range Predict Incident Hypertension
Forman, John P.; Fisher, Naomi D.L.; Schopick, Emily L.; Curhan, Gary C.
2008-01-01
Higher levels of albumin excretion within the normal range are associated with cardiovascular disease in high-risk individuals. Whether incremental increases in urinary albumin excretion, even within the normal range, are associated with the development of hypertension in low-risk individuals is unknown. This study included 1065 postmenopausal women from the first Nurses’ Health Study and 1114 premenopausal women from the second Nurses’ Health Study who had an albumin/creatinine ratio
Bank Organizational Structure Choice Dilemma. Case of PKO BP
Directory of Open Access Journals (Sweden)
Adam Szafarczyk
2008-06-01
Full Text Available Organizational structures are differing for different banks. They depend on individual bank economic situation, its technology, strategy and form of competition struggle. Usually the biggest EU banks are consists from formally or really independent divisions. The most common divisions are Retail Banking, Corporate Banking, Treasury and Investment, sometimes Insurance. PKO BP, the biggest Polish Bank, ought to change its structure due to implementation new IT system.