
Sample records for high energy vhe

  1. Early warning for VHE gamma-ray flares with the ARGO-YBJ detector

    Energy Technology Data Exchange (ETDEWEB)

    Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others


    Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.



    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.


    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...

  3. Very high energy gamma ray astronomy from Hanle

    International Nuclear Information System (INIS)

    Chitnis, Varsha R.


    Over a past decade very high energy (VHE) gamma ray astronomy has emerged as a major astronomical discipline. In India, we have a long tradition of experiments in this field. Few years ago, multi-institutional Himalayan Gamma Ray Observatory (HiGRO) collaboration was formed to set up VHE gamma rays experiments at Hanle, a high altitude location in Himalayas. HAGAR, the first phase of this collaboration is operational since 2008. HAGAR has successfully detected VHE gamma ray emission from some of the extragalactic objects like Mrk 421, Mrk 501 as well as galactic sources including Crab nebula/pulsar. Details of HAGAR telescope system and results obtained will be discussed. HiGRO is now gearing up for the next phase, i.e. 21 m diameter MACE telescope, which is being installed at Hanle at present. Details of MACE telescope system and future plans will be discussed. (author)

  4. Steady-state emission of blazars at very high energies

    International Nuclear Information System (INIS)

    Hoehne-Moench, Daniel


    One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) γ-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE γ-ray flux, only X-ray selected sources with a flux F X >2 μJy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z X-γ between the X-ray range at 1 keV and the VHE γ-ray regime at 200 GeV were calculated. The majority of objects show a spectral behaviour as expected from the source class of HBLs: The energy output in the VHE regime is in general lower than in X-rays. For the stacked blazar sample the broad-band spectral index was calculated to α X-γ =1.09, confirming the result found for the individual objects. Another evidence for the revelation of the baseline emission is the broad-band spectral energy distribution (SED) comprising archival as well as contemporaneous multi-wavelength data from the radio to the VHE band. The SEDs of known VHE γ-ray sources in low flux states matches well the SED of the stacked blazar sample. (orig.)

  5. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.


    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  6. Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3 (United States)

    HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.


    Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.

  7. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  8. Discovery of the hard spectrum VHE γ-ray source HESS J1641-463

    International Nuclear Information System (INIS)

    Abramowski, A.; Ait Benkhali, F.


    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  9. Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar (United States)

    Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.


    The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.


    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others


    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL

  11. Very high-energy gamma rays from gamma-ray bursts. (United States)

    Chadwick, Paula M


    Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.

  12. A Very High Energy Gamma-Ray Spectrum of 1ES 2344+514


    Schroedter, M.; Badran, H. M.; Buckley, J. H.; Gordo, J. Bussons; Carter-Lewis, D. A.; Duke, C.; Fegan, D. J.; Fegan, S. F.; Finley, J. P.; Gillanders, G. H.; Grube, J.; Horan, D.; Kenny, G. E.; Kertzman, M.; Kosack, K.


    The BL Lacertae (BL Lac) object 1ES 2344+514 (1ES 2344), at a redshift of 0.044, was discovered as a source of very high energy (VHE) gamma rays by the Whipple Collaboration in 1995 \\citep{2344Catanese98}. This detection was recently confirmed by the HEGRA Collaboration \\citep{2344Hegra03}. As is typical for high-frequency peaked blazars, the VHE gamma-ray emission is highly variable. On the night of 20 December, 1995, a gamma-ray flare of 5.3-sigma significance was detected, the brightest ou...

  13. The Crab pulsar at VHE

    Directory of Open Access Journals (Sweden)

    Zanin Roberta


    Full Text Available The last six years have witnessed major revisions of our knowledge about the Crab Pulsar. The consensus scenario for the origin of the high-energy pulsed emission has been challenged with the discovery of a very-high-energy power law tail extending up to ~400 GeV, above the expected spectral cut off at a few GeV. Now, new measurements obtained by the MAGIC collaboration extend the energy spectrum of the Crab Pulsar even further, on the TeV regime. Above ~400 GeV the pulsed emission comes mainly from the interpulse, which becomes more prominent with energy due to a harder spectral index. These findings require γ -ray production via inverse Compton scattering close to or beyond the light cylinder radius by an underlying particle population with Lorentz factors greater than 5 × 106. We will present those new results and discuss the implications in our current knowledge concerning pulsar environments.

  14. Very high energy gamma ray astrophysics. Progress report, August 1, 1980-July 31, 1981

    International Nuclear Information System (INIS)

    Lamb, R.C.


    Very high energy (VHE) gamma ray astronomy gives insight into fundamental questions regarding the origins of cosmic rays and the types of particle acceleration mechanisms which operate in nature. VHE photons are detected by means of the Cerenkov light their secondaries produce in the atmosphere. During June - September 1981 the solar collectors at Edwards Air Force Base will be used to detect the Cerenkov light from the photons from Cygnus X-3 thus extending its observation into a previously unexplored region. The time of each detector event will be recorded to the nearest 0.5 ms. If Cygnus X-3 is the neutron star remnant of a recent (unseen) supernova, then the VHE gamma rays may be pulsed at its rotation rate, and the data obtained will allow a sensitive test of this possibility. The equipment for the summer observations is nearly ready and will be tested in May prior to any early run in June

  15. Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20 (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.


    Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.

  16. Very high energy emission from passive supermassive black holes

    Energy Technology Data Exchange (ETDEWEB)

    Pedaletti, Giovanna


    The H.E.S.S. experiment, an array of four Imaging Cherenkov Telescopes, widened the horizon of Very High Energy (VHE) astronomy. Its unprecedented sensitivity is well suited for the study of new classes of expected VHE emitters, such as passive galactic nuclei that are the main focus of the work presented in this thesis. Acceleration of particles up to Ultra High Energies is expected in the magnetosphere of supermassive black holes (SMBH). The radiation losses of these accelerated particles are expected to reach the VHE regime in which H.E.S.S. operates. Predicted fluxes exceed the sensitivity of the array. However, strong photon fields in the surrounding of the acceleration region might absorb the produced radiation. Therefore observations focus on those galactic nuclei that are underluminous at lower photon energies. This work presents data collected by the H.E.S.S. telescopes on the test candidate NGC 1399 and their interpretation. While no detection has been achieved, important constraints can be derived from the obtained upper limits on the maximum energy attainable by the accelerated particles and on the magnetic field strength in the acceleration region. A limit on the magnetic field of B < 74 Gauss is given. The limit is model dependent and a scaling of the result with the assumptions is given. This is the tightest empirical constraint to date. Because of the lack of signal from the test candidate, a stacking analysis has been performed on similar sources in three cluster fields. A search for signal from classes of active galactic nuclei has also been made in the same three fields. None of the analyzed samples revealed a significant signal. Also presented are the expectations for the next generation of Cherenkov Telescopes and an outlook on the relativistic effects expected on the VHE emission close to SMBH. (orig.)


    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail:, E-mail: [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others


    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.


    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Celik, O.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.


    The recent detection by the Fermi γ-ray space telescope of high-energy γ-rays from the radio galaxy NGC 1275 makes the observation of the very high energy (VHE: E>100 GeV) part of its broadband spectrum particularly interesting, especially for the understanding of active galactic nuclei with misaligned multi-structured jets. The radio galaxy NGC 1275 was recently observed by VERITAS at energies above 100 GeV for about 8 hr. No VHE γ-ray emission was detected by VERITAS from NGC 1275. A 99% confidence level upper limit of 2.1% of the Crab Nebula flux level is obtained at the decorrelation energy of approximately 340 GeV, corresponding to 19% of the power-law extrapolation of the Fermi Large Area Telescope result.


    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Aune, T.; Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Federici, S., E-mail:, E-mail:, E-mail: [DESY, Platanenallee 6, 15738 Zeuthen (Germany); and others


    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays (E {sub {gamma}} > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On {approx}8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  20. Search for a Correlation Between Very-High-Energy Gamma Rays and Giant Radio Pulses in the Crab Pulsar (United States)

    Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; hide


    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays ( E(sub Gamma) > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On approx. 8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  1. Search for VHE γ-ray emission from the direction of the two millisecond pulsars PSR J0437-4715 and PSR J1824-2452 and the composite supernova remnant Kes 75 with H.E.S.S

    International Nuclear Information System (INIS)

    Fuessling, Matthias


    This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.

  2. Axion-like particle imprint in cosmological very-high-energy sources

    International Nuclear Information System (INIS)

    Domínguez, A.; Sánchez-Conde, M.A.; Prada, F.


    Discoveries of very high energy (VHE) photons from distant blazars suggest that, after correction by extragalactic background light (EBL) absorption, there is a flatness or even a turn-up in their spectra at the highest energies that cannot be easily explained by the standard framework. Here, it is shown that a possible solution to this problem is achieved by assuming the existence of axion-like particles (ALPs) with masses ∼ 1 neV. The ALP scenario is tested making use of observations of the highest redshift blazars known in the VHE energy regime, namely 3C 279, 3C 66A, PKS 1222+216 and PG 1553+113. In all cases, better fits to the observed spectra are found when including ALPs rather than considering EBL only. Interestingly, quite similar critical energies for photon/ALP conversions are also derived, independently of the source considered

  3. Search for very high-energy gamma-ray emission from the microquasar Cygnus X-1 with the MAGIC telescopes (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Bhattacharyya, W.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; da Vela, P.; Dazzi, F.; de Angelis, A.; de Lotto, B.; de Oña Wilhelmi, E.; di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hassan, T.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Ishio, K.; Konno, Y.; Kubo, H.; Kushida, J.; Kuveždić, D.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Maggio, C.; Majumdar, P.; Makariev, M.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Minev, M.; Mirzoyan, R.; Moralejo, A.; Moreno, V.; Moretti, E.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Ninci, D.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Righi, C.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sitarek, J.; Šnidarić, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Torres-Albà, N.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Zarić, D.; MAGIC Collaboration; Bosch-Ramon, V.; Pooley, G. G.; Trushkin, S. A.; Zanin, R.


    The microquasar Cygnus X-1 displays the two typical soft and hard X-ray states of a black hole transient. During the latter, Cygnus X-1 shows a one-sided relativistic radio-jet. Recent detection of the system in the high energy (HE; E ≳ 60 MeV) gamma-ray range with Fermi-LAT associates this emission with the outflow. Former MAGIC observations revealed a hint of flaring activity in the very high-energy (VHE; E ≳ 100 GeV) regime during this X-ray state. We analyse ∼97 h of Cygnus X-1 data taken with the MAGIC telescopes between July 2007 and October 2014. To shed light on the correlation between hard X-ray and VHE gamma rays as previously suggested, we study each main X-ray state separately. We perform an orbital phase-folded analysis to look for variability in the VHE band. Additionally, to place this variability behaviour in a multiwavelength context, we compare our results with Fermi-LAT, AGILE, Swift-BAT, MAXI, RXTE-ASM, AMI and RATAN-600 data. We do not detect Cygnus X-1 in the VHE regime. We establish upper limits for each X-ray state, assuming a power-law distribution with photon index Γ = 3.2. For steady emission in the hard and soft X-ray states, we set integral upper limits at 95 per cent confidence level for energies above 200 GeV at 2.6 × 10-12 photons cm-2 s-1 and 1.0 × 10-11 photons cm-2 s-1, respectively. We rule out steady VHE gamma-ray emission above this energy range, at the level of the MAGIC sensitivity, originating in the interaction between the relativistic jet and the surrounding medium, while the emission above this flux level produced inside the binary still remains a valid possibility.

  4. Very high-energy gamma-ray signature of ultrahigh-energy cosmic-ray acceleration in Centaurus A (United States)

    Joshi, Jagdish C.; Miranda, Luis Salvador; Razzaque, Soebur; Yang, Lili


    The association of at least a dozen ultrahigh-energy cosmic-ray (UHECR) events with energy ≳ 55 EeV detected by the Pierre Auger Observatory (PAO) from the direction of Centaurus-A, the nearest radio galaxy, supports the scenario of UHECR acceleration in the jets of radio galaxies. In this work, we model radio to very high energy (VHE,≳ 100 GeV) γ-ray emission from Cen A, including GeV hardness detected by Fermi-LAT and TeV emission detected by HESS. We consider two scenarios: (i) Two zone synchrotron self-Compton (SSC) and external-Compton (EC) models, (ii) Two zone SSC, EC and photo-hadronic emission from cosmic ray interactions. The GeV hardness observed by Fermi-LAT can be explained using these two scenarios, where zone 2 EC emission is very important. Hadronic emission in scenario (ii) can explain VHE data with the same spectral slope as obtained through fitting UHECRs from Cen A. The peak luminosity in cosmic ray proton at 1 TeV, to explain the VHE γ-ray data is ≈2.5 × 1046 erg/s. The bolometric luminosity in cosmic ray protons is consistent with the luminosity required to explain the origin of 13 UHECR signal events that are correlated with Cen A.

  5. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  6. Steady-state emission of blazars at very high energies

    Energy Technology Data Exchange (ETDEWEB)

    Hoehne-Moench, Daniel


    One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) {gamma}-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE {gamma}-ray flux, only X-ray selected sources with a flux F{sub X}>2 {mu}Jy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z<0.15 and z<0.4, depending on the declination of the objects. The latter determines the zenith distance during culmination which should not exceed 30 (for z<0.4) and 45 (for z<0.15), respectively. Between August 2005 and April 2009, a sample of 24 X-ray selected high-frequency peaked blazars has been observed with the MAGIC telescope. Three of them were detected including 1ES 1218+304 being the first high-frequency peaked BL Lacertae object (HBL) to be discovered with MAGIC in VHE {gamma}-rays. One previously detected object was not confirmed as VHE emitter in this campaign by MAGIC. A set of 20 blazars previously not detected is treated more closely in this work. In this campaign, during almost four years {proportional_to}450 hrs or {proportional_to}22% of the available observation time for extragalactic objects were dedicated to investigate the baseline emission of blazars and their broadband spectral properties in this emission state. For the sample of 20 objects in a redshift range of 0.018VHE range on the 99.7% confidence level (corresponding to 3 standard deviations) were calculated resulting in values between 2.9% and 14.7% of the integral flux of the Crab Nebula. As the distribution of significances


    Energy Technology Data Exchange (ETDEWEB)

    Hada, Kazuhiro; Giroletti, Marcello; Giovannini, Gabriele [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Kino, Motoki; Nagai, Hiroshi [National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Doi, Akihiro [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo, Sagamihara 252-5210 (Japan); Hagiwara, Yoshiaki; Honma, Mareki; Kawaguchi, Noriyuki [Department of Astronomical Science, Graduate University for Advanced Studies (SOKENDAI), 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)


    We report on the detailed radio status of the M 87 jet during the very high energy (VHE) {gamma}-ray flaring event in 2010 April, obtained from high-resolution, multi-frequency, phase-referencing Very Long Baseline Array observations. We especially focus on the properties of the jet base (the radio core) and the peculiar knot HST-1, which are currently favored as the {gamma}-ray emitting sites. During the VHE flaring event, the HST-1 region remains stable in terms of its structure and flux density in the optically thin regime above 2 GHz, being consistent with no signs of enhanced activities reported at X-ray for this feature. The radio core shows an inverted spectrum at least up to 43 GHz during this event. Astrometry of the core position, which is specified as {approx}20 R {sub s} from the central engine in our previous study, shows that the core position is stable on a level of 4 R {sub s}. The core at 43 and 22 GHz tends to show slightly ({approx}10%) higher flux level near the date of the VHE flux peak compared with the epochs before/after the event. The size of the 43 GHz core is estimated to be {approx}17 R {sub s}, which is close to the size of the emitting region suggested from the observed timescale of rapid variability at VHE. These results tend to favor the scenario that the VHE {gamma}-ray flare in 2010 April is associated with the radio core.

  8. Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes

    International Nuclear Information System (INIS)

    Mirzoyan, R.


    The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV

  9. Systematic search for very-high-energy gamma-ray emission from bow shocks of runaway stars (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.


    Context. Runaway stars form bow shocks by ploughing through the interstellar medium at supersonic speeds and are promising sources of non-thermal emission of photons. One of these objects has been found to emit non-thermal radiation in the radio band. This triggered the development of theoretical models predicting non-thermal photons from radio up to very-high-energy (VHE, E ≥ 0.1 TeV) gamma rays. Subsequently, one bow shock was also detected in X-ray observations. However, the data did not allow discrimination between a hot thermal and a non-thermal origin. Further observations of different candidates at X-ray energies showed no evidence for emission at the position of the bow shocks either. A systematic search in the Fermi-LAT energy regime resulted in flux upper limits for 27 candidates listed in the E-BOSS catalogue. Aim. Here we perform the first systematic search for VHE gamma-ray emission from bow shocks of runaway stars. Methods: Using all available archival H.E.S.S. data we search for very-high-energy gamma-ray emission at the positions of bow shock candidates listed in the second E-BOSS catalogue release. Out of the 73 bow shock candidates in this catalogue, 32 have been observed with H.E.S.S. Results: None of the observed 32 bow shock candidates in this population study show significant emission in the H.E.S.S. energy range. Therefore, flux upper limits are calculated in five energy bins and the fraction of the kinetic wind power that is converted into VHE gamma rays is constrained. Conclusions: Emission from stellar bow shocks is not detected in the energy range between 0.14 and 18 TeV.The resulting upper limits constrain the level of VHE gamma-ray emission from these objects down to 0.1-1% of the kinetic wind energy.

  10. Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)


    The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.

  11. Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S. (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.


    The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the

  12. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias


    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  13. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias


    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  14. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park


    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  15. A Strong Limit on the Very-high-energy Emission from GRB 150323A (United States)

    Abeysekara, A. U.; Archer, A.; Benbow, W.; Bird, R.; Brose, R.; Buchovecky, M.; Bugaev, V.; Connolly, M. P.; Cui, W.; Errando, M.; Falcone, A.; Feng, Q.; Finley, J. P.; Flinders, A.; Fortson, L.; Furniss, A.; Gillanders, G. H.; Hütten, M.; Hanna, D.; Hervet, O.; Holder, J.; Hughes, G.; Humensky, T. B.; Johnson, C. A.; Kaaret, P.; Kar, P.; Kelley-Hoskins, N.; Kertzman, M.; Kieda, D.; Krause, M.; Krennrich, F.; Lang, M. J.; Lin, T. T. Y.; Maier, G.; McArthur, S.; Moriarty, P.; Mukherjee, R.; O’Brien, S.; Ong, R. A.; Park, N.; Perkins, J. S.; Petrashyk, A.; Pohl, M.; Popkow, A.; Pueschel, E.; Quinn, J.; Ragan, K.; Reynolds, P. T.; Richards, G. T.; Roache, E.; Rulten, C.; Sadeh, I.; Santander, M.; Sembroski, G. H.; Shahinyan, K.; Tyler, J.; Wakely, S. P.; Weiner, O. M.; Weinstein, A.; Wells, R. M.; Wilcox, P.; Wilhelm, A.; Williams, D. A.; Zitzer, B.; VERITAS Collaboration; Vurm, Indrek; Beloborodov, Andrei


    On 2015 March 23, the Very Energetic Radiation Imaging Telescope Array System (VERITAS) responded to a Swift-Burst Alert Telescope (BAT) detection of a gamma-ray burst, with observations beginning 270 s after the onset of BAT emission, and only 135 s after the main BAT emission peak. No statistically significant signal is detected above 140 GeV. The VERITAS upper limit on the fluence in a 40-minute integration corresponds to about 1% of the prompt fluence. Our limit is particularly significant because the very-high-energy (VHE) observation started only ∼2 minutes after the prompt emission peaked, and Fermi-Large Area Telescope observations of numerous other bursts have revealed that the high-energy emission is typically delayed relative to the prompt radiation and lasts significantly longer. Also, the proximity of GRB 150323A (z = 0.593) limits the attenuation by the extragalactic background light to ∼50% at 100–200 GeV. We conclude that GRB 150323A had an intrinsically very weak high-energy afterglow, or that the GeV spectrum had a turnover below ∼100 GeV. If the GRB exploded into the stellar wind of a massive progenitor, the VHE non-detection constrains the wind density parameter to be A ≳ 3 × 1011 g cm‑1, consistent with a standard Wolf–Rayet progenitor. Alternatively, the VHE emission from the blast wave would be weak in a very tenuous medium such as the interstellar medium, which therefore cannot be ruled out as the environment of GRB 150323A.

  16. Probing the very-high-energy gamma-ray spectral curvature in the blazar PG 1553+113 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J.; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J.L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fidalgo, D; Fonseca, M.V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Knoetig, M L; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Neustroev, V; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Vogler, P; Will, M; Zanin, R; D'Ammando, F; Lähteenmäki, A; Tornikoski, M; Hovatta, T; Readhead, A C S; Max-Moerbeck, W; Richards, J.L


    PG 1553+113 is a very-high-energy (VHE, E>100 GeV) gamma-ray emitter classified as a BL Lac object. Its redshift is constrained by intergalactic absorption lines in the range 0.40.2). The observed curvature is compatible with the extragalactic background light (EBL) imprint predicted by the current generation of EBL models assuming a redshift z~0.4. New constraints on the redshift were derived from the VHE spectrum. These constraints are compatible with previous limits and suggest that the source is most likely located around the optical lower limit, z=0.4. Finally, we find that the synchrotron self-Compton (SSC) model gives a satisfactory description of the observed multi-wavelength spectral energy distribution during the flare.

  17. High Energy $\

    CERN Multimedia


    This experiment is a high statistics exposure of BEBC filled with hydrogen to both @n and &bar.@n beams. The principal physics aims are : \\item a) The study of the production of charmed mesons and baryons using fully constrained events. \\end{enumerate} b) The study of neutral current interactions on the free proton. \\item c) Measurement of the cross-sections for production of exclusive final state N* and @D resonances. \\item d) Studies of hadronic final states in charged and neutral current reactions. \\item e) Measurement of inclusive charged current cross-sections and structure functions. \\end{enumerate}\\\\ \\\\ The neutrino flux is determined by monitoring the flux of muons in the neutrino shield. The Internal Picket Fence and External Muon Identifier of BEBC are essential parts of the experiment. High resolution cameras are used to search for visible decays of short-lived particles.

  18. Discovery of a point-like very-high-energy gamma-ray source in Monoceros

    International Nuclear Information System (INIS)

    Aharonian, F.A.; Benbow, W.; Berge, D.; Bernlohr, K.; Bolz, O.; Braun, I.; Buhler, R.; Carrigan, S.; Costamante, L.; Domainko, W.; Egberts, K.; Forster, A.; Funk, S.; Hauser, D.; Hermann, G.; Hinton, J.A.; Hofmann, W.; Hoppe, S.; Khelifi, B.; Kosack, K.; Masterson, C.; Panter, M.; Rowell, G.; van Eldik, C.; Volk, H.J.; Akhperjanian, A.G.; Sahakian, V.; Bazer-Bachi, A.R.; Borrel, V.; Marcowith, A.; Olive, J.P.; Beilicke, M.; Cornils, R.; Heinzelmann, G.; Raue, M.; Ripken, J.; Bernlohr, K.; Funk, Seb.; Fussling, M.; Kerschhaggl, M.; Lohse, T.; Schlenker, S.; Schwanke, U.; Boisson, C.; Martin, J.M.; Sol, H.; Brion, E.; Glicenstein, J.F.; Goret, P.; Moulin, E.; Rolland, L.


    Aims. The complex Monoceros Loop SNR/Rosette Nebula region contains several potential sources of very-high-energy (VHE) γ-ray emission and two as yet unidentified high-energy EGRET sources. Sensitive VHE observations are required to probe acceleration processes in this region. Methods. The HESS telescope array has been used to search for very high-energy gamma-ray sources in this region. CO data from the NANTEN telescope were used to map the molecular clouds in the region, which could act as target material for γ-ray production via hadronic interactions. Results. We announce the discovery of a new γ-ray source, HESS J0632+057, located close to the rim of the Monoceros SNR. This source is unresolved by HESS and has no clear counterpart at other wavelengths but is possibly associated with the weak X-ray source 1RXS J063258.3+054857, the Be-star MWC148 and/or the lower energy γ-ray source 3EGJ0634+0521. No evidence for an associated molecular cloud was found in the CO data. (authors)

  19. IceCube constraints on fast-spinning pulsars as high-energy neutrino sources

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Ke [Department of Astronomy, University of Maryland, College Park, MD, 20742 (United States); Kotera, Kumiko [Institut d' Astrophysique de Paris, UMR 7095 – CNRS, Université Pierre $ and $ Marie Curie, 98 bis boulevard Arago, 75014, Paris (France); Murase, Kohta [Department of Physics, Department of Astronomy and Astrophysics, Center for Particle and Gravitational Astrophysics, The Pennsylvania State University, PA 16802 (United States); Olinto, Angela V., E-mail:, E-mail:, E-mail:, E-mail: [Department of Astronomy and Astrophysics, Kavli Institute for Cosmological Physics, University of Chicago, Chicago, IL 60637 (United States)


    Relativistic winds of fast-spinning pulsars have been proposed as a potential site for cosmic-ray acceleration from very high energies (VHE) to ultrahigh energies (UHE). We re-examine conditions for high-energy neutrino production, considering the interaction of accelerated particles with baryons of the expanding supernova ejecta and the radiation fields in the wind nebula. We make use of the current IceCube sensitivity in diffusive high-energy neutrino background, in order to constrain the parameter space of the most extreme neutron stars as sources of VHE and UHE cosmic rays. We demonstrate that the current non-observation of 10{sup 18} eV neutrinos put stringent constraints on the pulsar scenario. For a given model, birthrates, ejecta mass and acceleration efficiency of the magnetar sources can be constrained. When we assume a proton cosmic ray composition and spherical supernovae ejecta, we find that the IceCube limits almost exclude their significant contribution to the observed UHE cosmic-ray flux. Furthermore, we consider scenarios where a fraction of cosmic rays can escape from jet-like structures piercing the ejecta, without significant interactions. Such scenarios would enable the production of UHE cosmic rays and help remove the tension between their EeV neutrino production and the observational data.


    International Nuclear Information System (INIS)

    Zweerink, J.; Ball, J.; Carson, J. E.; Jarvis, A.; Ong, R. A.; Kildea, J.; Hanna, D. S.; Lindner, T.; Mueller, C.; Ragan, K.; Covault, C. E.; Driscoll, D. D.; Fortin, P.; Mukherjee, R.; Gingrich, D. M.; Williams, D. A.


    The Solar Tower Atmospheric Cherenkov Effect Experiment (STACEE) is a ground-based telescope that uses the wave-front-sampling technique to detect very high energy (VHE) gamma rays. STACEE's sensitivity in the energy range near 100 GeV permits useful observations of pulsars with the potential to discriminate between various proposed mechanisms for pulsed gamma-ray emission. Based on the 11.3 hr of data taken during the 2005 and 2006 observing seasons, we derive an upper limit on the pulsed gamma-ray emission from PSR B1951+32 of -11 photons cm -2 s -1 above an energy threshold of 117 GeV.

  1. VHE and UHE gamma ray astronomy: transients and sources

    International Nuclear Information System (INIS)

    Fegan, D.J.


    The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy

  2. High energy

    International Nuclear Information System (INIS)

    Bonner, B.E.; Roberts, J.B. Jr.


    We report here on progress made for the period from December 1, 1992 (the date of submission of our latest progress report) to November 30, 1993 for DOE Grant No. DE-FG05-92ER40717. The new results from the SMC experiment have generated a buzz of theoretical activity. Our involvement with the D0 experiment and the upgrade has increased substantially during the past two years so that we now have six people heavily committed and making what can only be described as a large and disproportionate impact on D0 physics output. Some of the new developments made here at Rice in Neural Network and Probability Density Estimation techniques for data analysis promise to have applications both in D0 and beyond. We report a load of new results from our high-p t jet photoproduction experiment. In addition we have been working on KTeV, albeit without having adequate funding for this work. Progress on the theoretical front has been nothing short of amazing, as is reported herein. In a grand lecture tour during this sabbatical year, Paul Stevenson has already reported his breakthroughs at ten institutions, including CERN, Oxford, Cambridge, Rutherford Lab, Imperial College, and Durham University. The group at Rice University has had an exceptionally productive year and we are justifiably proud of the progress which is reported here

  3. Relevance of axionlike particles for very-high-energy astrophysics

    International Nuclear Information System (INIS)

    De Angelis, Alessandro; Galanti, Giorgio; Roncadelli, Marco


    Several extensions of the standard model and, in particular, superstring theories suggest the existence of axionlike particles (ALPs), which are very light spin-zero bosons with a two-photon coupling. As a consequence, photon-ALP oscillations occur in the presence of an external magnetic field, and ALPs can lead to observable effects on the measured photon spectrum of astrophysical sources. An intriguing situation arises when blazars are observed in the very-high-energy (VHE) band--namely, above 100 GeV--as it is the case with the presently operating Imaging Atmospheric Cherenkov Telescopes H.E.S.S, Major Atmospheric Gamma Imaging Cherenkov telescope, Collaboration of Australia and Nippon for a Gamma Ray Observatory in the Outback III, and VERITAS. The extragalactic background light produced by galaxies during cosmic evolution gives rise to a source dimming which becomes important in the VHE band and increases with energy, since hard photons from a blazar scatter off soft extragalactic background light photons thereby disappearing into e + e - pairs. This dimming can be considerably reduced by photon-ALP oscillations, and since they are energy independent the resulting blazar spectra become harder than expected. We consider throughout a scenario first proposed by De Angelis, Roncadelli, and Mansutti in which the above strategy is implemented with photon-ALP oscillations triggered by large-scale magnetic fields, and we systematically investigate its implications for VHE blazars. We find that for ALPs lighter than 5·10 -10 eV the photon survival probability is larger than predicted by conventional physics above a few hundred GeV. Specifically, a boost factor of 10 can easily occur for sources at large distance and large energy, e.g. at 8 TeV for the blazar 1ES 0347-121 at redshift z=0.188. This is a clear-cut prediction which can be tested with the planned Cherenkov Telescope Array and the High Altitude Water Cherenkov Experiment (HAWC) water Cherenkov

  4. A new method for the reconstruction of very-high-energy gamma-ray spectra and application to galatic cosmic-ray accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Milton Virgilio


    In this thesis, high-energy (HE; E>0.1 GeV) and very-high-energy (VHE; E>0.1 TeV) γ-ray data were investigated to probe Galactic stellar clusters (SCs) and star-forming regions (SFRs) as sites of hadronic Galactic cosmic-ray (GCR) acceleration. In principle, massive SCs and SFRs could accelerate GCRs at the shock front of the collective SC wind fed by the individual high-mass stars. The subsequently produced VHE γ rays would be measured with imaging air-Cherenkov telescopes (IACTs). A couple of the Galactic VHE γ-ray sources, including those potentially produced by SCs, fill a large fraction of the field-of-view (FoV) and require additional observations of source-free regions to determine the dominant background for a spectral reconstruction. A new method of reconstructing spectra for such extended sources without the need of further observations is developed: the Template Background Spectrum (TBS). This methods is based on a method to generate skymaps, which determines background in parameter space. The idea is the creation of a look-up of the background normalisation in energy, zenith angle, and angular separation and to account for possible systematics. The results obtained with TBS and state-of-the-art background-estimation methods on H.E.S.S. data are in good agreement. With TBS even those sources could be reconstructed that normally would need further observations. Therefore, TBS is the third method to reconstruct VHE γ-ray spectra, but the first one to not need additional observations in the analysis of extended sources. The discovery of the largest VHE γ-ray source HESSJ1646-458 (2.2 in size) towards the SC Westerlund 1 (Wd1) can be plausibly explained by the SC-wind scenario. But owing to its size, other alternative counterparts to the TeV emission (pulsar, binary system, magnetar) were found in the FoV. Therefore, an association of HESSJ1646-458 with the SC is favoured, but cannot be confirmed. The SC Pismis 22 is located in the centre of the

  5. A new method for the reconstruction of very-high-energy gamma-ray spectra and application to galatic cosmic-ray accelerators

    International Nuclear Information System (INIS)

    Fernandes, Milton Virgilio


    In this thesis, high-energy (HE; E>0.1 GeV) and very-high-energy (VHE; E>0.1 TeV) γ-ray data were investigated to probe Galactic stellar clusters (SCs) and star-forming regions (SFRs) as sites of hadronic Galactic cosmic-ray (GCR) acceleration. In principle, massive SCs and SFRs could accelerate GCRs at the shock front of the collective SC wind fed by the individual high-mass stars. The subsequently produced VHE γ rays would be measured with imaging air-Cherenkov telescopes (IACTs). A couple of the Galactic VHE γ-ray sources, including those potentially produced by SCs, fill a large fraction of the field-of-view (FoV) and require additional observations of source-free regions to determine the dominant background for a spectral reconstruction. A new method of reconstructing spectra for such extended sources without the need of further observations is developed: the Template Background Spectrum (TBS). This methods is based on a method to generate skymaps, which determines background in parameter space. The idea is the creation of a look-up of the background normalisation in energy, zenith angle, and angular separation and to account for possible systematics. The results obtained with TBS and state-of-the-art background-estimation methods on H.E.S.S. data are in good agreement. With TBS even those sources could be reconstructed that normally would need further observations. Therefore, TBS is the third method to reconstruct VHE γ-ray spectra, but the first one to not need additional observations in the analysis of extended sources. The discovery of the largest VHE γ-ray source HESSJ1646-458 (2.2 in size) towards the SC Westerlund 1 (Wd1) can be plausibly explained by the SC-wind scenario. But owing to its size, other alternative counterparts to the TeV emission (pulsar, binary system, magnetar) were found in the FoV. Therefore, an association of HESSJ1646-458 with the SC is favoured, but cannot be confirmed. The SC Pismis 22 is located in the centre of the

  6. Very-high-energy gamma-ray observations of the Type Ia Supernova SN 2014J with the MAGIC telescopes (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.


    Context. In this work we present data from observations with the MAGIC telescopes of SN 2014J detected on January 21 2014, the closest Type Ia supernova since Imaging Air Cherenkov Telescopes started to operate. Aims: We aim to probe the possibility of very-high-energy (VHE; E ≥ 100 GeV) gamma rays produced in the early stages of Type Ia supernova explosions. Methods: We performed follow-up observations after this supernova (SN) explosion for five days, between January 27 and February 2 2014. We searched for gamma-ray signals in the energy range between 100 GeV and several TeV from the location of SN 2014J using data from a total of 5.5 h of observations. Prospects for observing gamma rays of hadronic origin from SN 2014J in the near future are also being addressed. Results: No significant excess was detected from the direction of SN 2014J. Upper limits at 95% confidence level on the integral flux, assuming a power-law spectrum, dF/dE ∝ E- Γ, with a spectral index of Γ = 2.6, for energies higher than 300 GeV and 700 GeV, are established at 1.3 × 10-12 and 4.1 × 10-13 photons cm-2 s-1, respectively. Conclusions: For the first time, upper limits on the VHE emission of a Type Ia supernova are established. The energy fraction isotropically emitted into TeV gamma rays during the first 10 days after the supernova explosion for energies greater than 300 GeV is limited to 10-6 of the total available energy budget ( 1051 erg). Within the assumed theoretical scenario, the MAGIC upper limits on the VHE emission suggest that SN 2014J will not be detectable in the future by any current or planned generation of Imaging Atmospheric Cherenkov Telescopes.

  7. Spatially resolving the very high energy emission from MGRO J2019+37 with VERITAS

    International Nuclear Information System (INIS)

    Aliu, E.; Errando, M.; Aune, T.; Behera, B.; Chen, X.; Federici, S.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Benbow, W.; Cerruti, M.; Berger, K.; Bird, R.; Bouvier, A.; Ciupik, L.; Connolly, M. P.; Cui, W.; Dumm, J.; Dwarkadas, V. V.; Falcone, A.


    We present very high energy (VHE) imaging of MGRO J2019+37 obtained with the VERITAS observatory. The bright extended (∼2°) unidentified Milagro source is located toward the rich star formation region Cygnus-X. MGRO J2019+37 is resolved into two VERITAS sources. The faint, point-like source VER J2016+371 overlaps CTB 87, a filled-center remnant (SNR) with no evidence of a supernova remnant shell at the present time. Its spectrum is well fit in the 0.65-10 TeV energy range by a power-law model with photon index 2.3 ± 0.4. VER J2019+378 is a bright extended (∼1°) source that likely accounts for the bulk of the Milagro emission and is notably coincident with PSR J2021+3651 and the star formation region Sh 2–104. Its spectrum in the range 1-30 TeV is well fit with a power-law model of photon index 1.75 ± 0.3, among the hardest values measured in the VHE band, comparable to that observed near Vela-X. We explore the unusual spectrum and morphology in the radio and X-ray bands to constrain possible emission mechanisms for this source.

  8. Very-high-energy gamma-ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs (United States)

    Lopez-Coto, Ruben


    The history of astronomy is as ancient as the reach of our written records. All the human civilizations have been interested in the study and interpretation of the night sky and its objects and phenomena. These observations were performed with the naked eye until the beginning of the 17th century, when Galileo Galilei started to use an instrument recently developed called telescope. Since then, the range of accessible wavelengths has been increasing, with a burst in the 20th century with the developing of instruments to observe them: antennas (radio and submillimeter), telescopes (optical, IR) and satellites (UV, X-rays and soft gamma rays). The last wavelength range accessed was the Very-High-Energy (VHE) gamma rays. At this range fluxes are so low that it is not possible to use space-based instruments with typical collection areas of O(1) m2. We must resort to the imaging atmospheric Cherenkov technique, which is based on the detection of the flashes of Cherenkov light that VHE gamma rays produce when they interact with the Earth's atmosphere. The field is very young, with the first source discovered in 1989 by the pioneering Whipple telescope. It is very dynamic with more than 150 sources detected to date, most of them by MAGIC, HESS and VERITAS, that make up the current generation of instruments. Finally, the field is also very promising, with the preparation of a next generation of imaging atmospheric Cherenkov telescopes: CTA, that is expected to start full operation in 2020. The work presented in this thesis comprises my efforts to take the ground-based γ-ray astronomy one step forward. Part I of the thesis is an introduction to the non- thermal universe, the imaging atmospheric Cherenkov technique and the Imaging Atmospheric Cherenkov Telescopes (IACTs) MAGIC and CTA. Part II deals with several ways to reduce the trigger threshold of IACTs. This includes the simula- tion, characterization and test of an analog trigger especially designed to achieve the

  9. Why high energy physics

    International Nuclear Information System (INIS)

    Diddens, A.N.; Van de Walle, R.T.


    An argument is presented for high energy physics from the point of view of the practitioners. Three different angles are presented: The cultural consequence and scientific significance of practising high energy physics, the potential application of the results and the discovery of high energy physics, and the technical spin-offs from the techniques and methods used in high energy physics. (C.F.)

  10. The TeV γ-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    International Nuclear Information System (INIS)

    Kerschhaggl, Matthias


    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV γ-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE γ-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of stat ±0.2 sys and flux normalisation Φ 0 =(1.1±0.1 stat ±0.2 sys ) x 10 -12 TeV -1 cm -2 s -1 . PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of γ-rays is seen in those observations. PSR B1259-63 has been re-confirmed as a variable TeV γ-ray emitter. The firm detection of VHE photons emitted at a true anomaly θ∼0.35 of the pulsar orbit, i.e. already ∝50 days prior to the periastron passage, disfavors the stellar disc target scenario as a primary emission mechanism, based on current knowledge about the companion star's disc inclination, extension, and density profile. In a phenomenological study indirect evidence that PSR B1259-63 could in fact be a periodical VHE emitter is presented using the TeV data discussed in this work. While the TeV energy flux level seems to be only dependent on the binary separation this behavior is not seen in X-rays. Moreover, model calculations based on inverse compton (IC) scattering of

  11. Discovery of Very High Energy Gamma Rays from PKS 1424+240 and Multiwavelength Constraints on its Redshift

    Energy Technology Data Exchange (ETDEWEB)

    Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..


    We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.


    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.


    We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  13. Very high energy colliders

    International Nuclear Information System (INIS)

    Richter, B.


    The luminosity and energy requirements are considered for both proton colliders and electron-positron colliders. Some of the basic design equations for high energy linear electron colliders are summarized, as well as design constraints. A few examples are given of parameters for very high energy machines. 4 refs., 6 figs


    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Dickinson, H. J.; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A., E-mail:, E-mail:, E-mail:, E-mail: [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others


    The binary millisecond radio pulsar PSR J1023+0038 exhibits many characteristics similar to the gamma-ray binary system PSR B1259–63/LS 2883, making it an ideal candidate for the study of high-energy nonthermal emission. It has been the subject of multiwavelength campaigns following the disappearance of the pulsed radio emission in 2013 June, which revealed the appearance of an accretion disk around the neutron star. We present the results of very high energy (VHE) gamma-ray observations carried out by the Very Energetic Radiation Imaging Telescope Array System before and after this change of state. Searches for steady and pulsed emission of both data sets yield no significant gamma-ray signal above 100 GeV, and upper limits are given for both a steady and pulsed gamma-ray flux. These upper limits are used to constrain the magnetic field strength in the shock region of the PSR J1023+0038 system. Assuming that VHE gamma rays are produced via an inverse Compton mechanism in the shock region, we constrain the shock magnetic field to be greater than ∼2 G before the disappearance of the radio pulsar and greater than ∼10 G afterward.

  15. High energy neutron radiography

    International Nuclear Information System (INIS)

    Gavron, A.; Morley, K.; Morris, C.; Seestrom, S.; Ullmann, J.; Yates, G.; Zumbro, J.


    High-energy spallation neutron sources are now being considered in the US and elsewhere as a replacement for neutron beams produced by reactors. High-energy and high intensity neutron beams, produced by unmoderated spallation sources, open potential new vistas of neutron radiography. The authors discuss the basic advantages and disadvantages of high-energy neutron radiography, and consider some experimental results obtained at the Weapons Neutron Research (WNR) facility at Los Alamos

  16. High energy hadron scattering

    International Nuclear Information System (INIS)

    Johnson, R.C.


    High energy and small momentum transfer 2 'yields' 2 hadronic scattering processes are described in the physical framework of particle exchange. Particle production in high energy collisions is considered with emphasis on the features of inclusive reactions though with some remarks on exclusive processes. (U.K.)

  17. The high energy galaxy

    International Nuclear Information System (INIS)

    Cesarsky, C.J.


    The galaxy is host to a wide variety of high energy events. I review here recent results on large scale galactic phenomena: cosmic-ray origin and confinement, the connexion to ultra high energy gamma-ray emission from X-ray binaries, gamma ray and synchrotron emission in interstellar space, galactic soft and hard X-ray emission

  18. High energy colliders

    International Nuclear Information System (INIS)

    Palmer, R.B.; Gallardo, J.C.


    The authors consider the high energy physics advantages, disadvantages and luminosity requirements of hadron (pp, p anti p), lepton (e + e - , μ + μ - ) and photon-photon colliders. Technical problems in obtaining increased energy in each type of machine are presented. The machines relative size are also discussed

  19. The Cherenkov Telescope Array For Very High-Energy Astrophysics (United States)

    Kaaret, Philip


    The field of very high energy (VHE) astrophysics had been revolutionized by the results from ground-based gamma-ray telescopes, including the current imaging atmospheric Cherenkov telescope (IACT) arrays: HESS, MAGIC and VERITAS. A worldwide consortium of scientists from 29 countries has formed to propose the Cherenkov Telescope Array (CTA) that will capitalize on the power of this technique to greatly expand the scientific reach of ground-based gamma-ray telescopes. CTA science will include key topics such as the origin of cosmic rays and cosmic particle acceleration, understanding extreme environments in regions close to neutron stars and black holes, and exploring physics frontiers through, e.g., the search for WIMP dark matter, axion-like particles and Lorentz invariance violation. CTA is envisioned to consist of two large arrays of Cherenkov telescopes, one in the southern hemisphere and one in the north. Each array will contain telescopes of different sizes to provide a balance between cost and array performance over an energy range from below 100 GeV to above 100 TeV. Compared to the existing IACT arrays, CTA will have substantially better angular resolution and energy resolution, will cover a much wider energy range, and will have up to an order of magnitude better sensitivity. CTA will also be operated as an open observatory and high-level CTA data will be placed into the public domain; these aspects will enable broad participation in CTA science from the worldwide scientific community to fully capitalize on CTA's potential. This talk will: 1) review the scientific motivation and capabilities of CTA, 2) provide an overview of the technical design and the status of prototype development, and 3) summarize the current status of the project in terms of its proposed organization and timeline. The plans for access to CTA data and opportunities to propose for CTA observing time will be highlighed.Presented on behalf of the CTA Consortium.

  20. High energy astrophysics

    International Nuclear Information System (INIS)

    Engel, A.R.


    High energy astrophysical research carried out at the Blackett Laboratory, Imperial College, London is reviewed. Work considered includes cosmic ray particle detection, x-ray astronomy, gamma-ray astronomy, gamma and x-ray bursts. (U.K.)


    Energy Technology Data Exchange (ETDEWEB)

    Ahnen, M. L.; Biland, A. [ETH Zurich, CH-8093 Zurich (Switzerland); Ansoldi, S.; Biasuzzi, B. [Università di Udine, and INFN Trieste, I-33100 Udine (Italy); Antonelli, L. A.; Bonnoli, G.; Carosi, A. [INAF National Institute for Astrophysics, I-00136 Rome (Italy); Antoranz, P. [Università di Siena, and INFN Pisa, I-53100 Siena (Italy); Babic, A. [Croatian MAGIC Consortium, Rudjer Boskovic Institute, University of Rijeka, University of Split and University of Zagreb (Croatia); Banerjee, B. [Saha Institute of Nuclear Physics, 1\\AF Bidhannagar, Salt Lake, Sector-1, Kolkata 700064 (India); Bangale, P.; Almeida, U. Barres de; Borracci, F. [Max-Planck-Institut für Physik, D-80805 München (Germany); Barrio, J. A.; Bonnefoy, S. [Universidad Complutense, E-28040 Madrid (Spain); Bednarek, W. [University of Łódź, PL-90236 Lodz (Poland); Bernardini, E. [Deutsches Elektronen-Synchrotron (DESY), D-15738 Zeuthen (Germany); Blanch, O. [IFAE, Campus UAB, E-08193 Bellaterra (Spain); Bretz, T. [Universität Würzburg, D-97074 Würzburg (Germany); Carmona, E., E-mail:, E-mail:, E-mail:, E-mail: [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Collaboration: MAGIC Collaboration; Fermi-LAT Collaboration; and others


    The flat-spectrum radio quasar PKS 1441+25 at a redshift of z = 0.940 is detected between 40 and 250 GeV with a significance of 25.5σ using the MAGIC telescopes. Together with the gravitationally lensed blazar QSO B0218+357 (z = 0.944), PKS 1441+25 is the most distant very high energy (VHE) blazar detected to date. The observations were triggered by an outburst in 2015 April seen at GeV energies with the Large Area Telescope on board Fermi. Multi-wavelength observations suggest a subdivision of the high state into two distinct flux states. In the band covered by MAGIC, the variability timescale is estimated to be 6.4 ± 1.9 days. Modeling the broadband spectral energy distribution with an external Compton model, the location of the emitting region is understood as originating in the jet outside the broad-line region (BLR) during the period of high activity, while being partially within the BLR during the period of low (typical) activity. The observed VHE spectrum during the highest activity is used to probe the extragalactic background light at an unprecedented distance scale for ground-based gamma-ray astronomy.

  2. High energy positron imaging

    International Nuclear Information System (INIS)

    Chen Shengzu


    The technique of High Energy Positron Imaging (HEPI) is the new development and extension of Positron Emission Tomography (PET). It consists of High Energy Collimation Imaging (HECI), Dual Head Coincidence Detection Imaging (DHCDI) and Positron Emission Tomography (PET). We describe the history of the development and the basic principle of the imaging methods of HEPI in details in this paper. Finally, the new technique of the imaging fusion, which combined the anatomical image and the functional image together are also introduced briefly

  3. The opacity of the universe for high and very high energy {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Manuel


    The flux of high energy (HE, energy 100 MeVhigh energy (VHE, E>or similar 100 GeV) {gamma}-rays originating from cosmological sources is attenuated due to pair production in interactions with photons at ultraviolet to infrared wavelengths of the extragalactic background light (EBL). The main components contributing to the EBL photon density are the starlight integrated over cosmic time and the starlight reprocessed by dust in galaxies. Consequently, the EBL is an integral measure of the cosmic star formation history. Depending on the source distance, the Universe should be opaque to {gamma}-rays above a certain energy. Nevertheless, the number of detected {gamma}-ray sources has increased continuously in recent years. VHE emitting objects beyond redshifts of z>0.5 have been detected with imaging air Cherenkov telescopes (IACTs), while HE {gamma}-rays from active galactic nuclei (AGN) above redshifts z>or similar 3 have been observed with the Large Area Telescope (LAT) on board the Fermi satellite. In this work, a large sample of VHE {gamma}-ray spectra will be combined with data of the Fermi-LAT to derive upper limits on the EBL photon density at z = 0. Generic EBL realizations are used to correct AGN spectra for absorption, which are subsequently tested against model assumptions. The evolution of the EBL with redshift is accounted for, and a possible formation of electromagnetic cascades is considered. As a result, the EBL density is constrained over almost three orders of magnitude in wavelength, between 0.4 {mu}m and 100 {mu}m. At optical wavelengths, an EBL intensity above 24 nW m{sup -2}sr{sup -1} is ruled out, and between 8 {mu}m and 31 {mu}m it is limited to be below 5 nW m{sup -2}sr{sup -1}. In the infrared, the constraints are within a factor {proportional_to} 2 of lower limits derived from galaxy number counts. Additionally,the behavior of VHE spectra in the transition from the optical depth regimes {tau

  4. High-energy detector (United States)

    Bolotnikov, Aleksey E [South Setauket, NY; Camarda, Giuseppe [Farmingville, NY; Cui, Yonggang [Upton, NY; James, Ralph B [Ridge, NY


    The preferred embodiments are directed to a high-energy detector that is electrically shielded using an anode, a cathode, and a conducting shield to substantially reduce or eliminate electrically unshielded area. The anode and the cathode are disposed at opposite ends of the detector and the conducting shield substantially surrounds at least a portion of the longitudinal surface of the detector. The conducting shield extends longitudinally to the anode end of the detector and substantially surrounds at least a portion of the detector. Signals read from one or more of the anode, cathode, and conducting shield can be used to determine the number of electrons that are liberated as a result of high-energy particles impinge on the detector. A correction technique can be implemented to correct for liberated electron that become trapped to improve the energy resolution of the high-energy detectors disclosed herein.

  5. Gamma radiation from active galaxy nuclei detected at very high energies with H.E.S.S: Multi-wavelength study and simulation of radioactive processes

    International Nuclear Information System (INIS)

    Lenain, J.P.


    Active Galactic Nuclei (AGN) are among the most energetic sources in the Universe. A subgroup of AGN possesses relativistic jets, the emission of which is purely non-thermal. In the case where the jet is aligned to the line of sight, these objects, called 'blazars', have their emission amplified by the relativistic Doppler effect. Since the advent of very high energy (VHE; E > 100 GeV) γ-ray astrophysics, Cerenkov telescopes like H.E.S.S. have observed almost thirty AGN, mainly blazars, from the ground. Cerenkov radiation from particle showers created by the interaction of γ-rays in the terrestrial atmosphere is used to derive the properties of the incident photon and thus to study these extragalactic sources. We have studied the highly variable VHE γ-ray emission from the blazar PKS 2155-304, from which 2 major outbursts were detected in July 2006, within the framework of a dynamic Synchrotron self-Compton (SSC) model. This variable emission presents properties excluding the most standard emission scenarios for blazars. We have also developed an SSC emission model for misaligned relativistic jets, to interpret the recent discovery of VHE γ-ray emission from 2 radio galaxies, M87 and Cen-A, which established the emergence of a new family of cosmic TeV emitters. We conclude with a systematic study conducted on all the AGN currently known at TeV with a stationary SSC model. We present tools for predictions of flux densities in these objects, which can be confronted with future observations by the Cerenkov Telescope Array (CTA). (author)

  6. High energy nuclear excitations

    International Nuclear Information System (INIS)

    Gogny, D.; Decharge, J.


    The main purpose of this talk is to see whether a simple description of the nuclear excitations permits one to characterize some of the high energy structures recently observed. The discussion is based on the linear response to different external fields calculated using the Random Phase Approximation. For those structure in heavy ion collisions at excitation energies above 50 MeV which cannot be explained with such a simple approach, we discuss a possible mechanism for this heavy ion scattering

  7. High energy radiation detector

    International Nuclear Information System (INIS)

    Vosburgh, K.G.


    The high energy radiation detector described comprises a set of closely spaced wedge reflectors. Each wedge reflector is composed of three sides forming identical isoceles triangles with a common apex and an open base forming an equilateral triangle. The length of one side of the base is less than the thickness of the coat of material sensitive to high energy radiation. The wedge reflectors reflect the light photons spreading to the rear of the coat in such a way that each reflected track is parallel to the incident track of the light photon spreading rearwards. The angle of the three isosceles triangles with a common apex is between 85 and 95 deg. The first main surface of the coat of high energy radiation sensitive material is in contact with the projecting edges of the surface of the wedge reflectors of the reflecting element [fr

  8. Theoretical high energy physics

    International Nuclear Information System (INIS)

    Lee, T.D.


    This report discusses theoretical research in high energy physics at Columbia University. Some of the research topics discussed are: quantum chromodynamics with dynamical fermions; lattice gauge theory; scattering of neutrinos by photons; atomic physics constraints on the properties of ultralight-ultraweak gauge bosons; black holes; Chern- Simons physics; S-channel theory of superconductivity; charged boson system; gluon-gluon interactions; high energy scattering in the presence of instantons; anyon physics; causality constraints on primordial magnetic manopoles; charged black holes with scalar hair; properties of Chern-Aimona-Higgs solitons; and extended inflationary universe

  9. Theoretical high energy physics

    International Nuclear Information System (INIS)

    Lee, T.D.


    This progress report discusses research by Columbia University staff in high energy physics. Some of the topics discussed are as follows: lattice gauge theory; quantum chromodynamics; parity doublets; solitons; baryon number violation; black holes; magnetic monopoles; gluon plasma; Chern-Simons theory; and the inflationary universe

  10. High energy astrophysics

    International Nuclear Information System (INIS)

    Shklorsky, I.S.


    A selected list of articles of accessible recent review articles and conference reports, wherein up-to-date summaries of various topics in the field of high energy astrophysics can be found, is presented. A special report outlines work done in the Soviet Union in this area. (Auth.)

  11. High energy battery. Hochenergiebatterie

    Energy Technology Data Exchange (ETDEWEB)

    Boehm, H.; Beyermann, G.; Bulling, M.


    In a high energy battery with a large number of individual cells in a housing with a cooling medium flowing through it, it is proposed that the cooling medium should be guided so that it only affects one or both sides of the cells thermally.

  12. High energy beam cooling

    International Nuclear Information System (INIS)

    Berger, H.; Herr, H.; Linnecar, T.; Millich, A.; Milss, F.; Rubbia, C.; Taylor, C.S.; Meer, S. van der; Zotter, B.


    The group concerned itself with the analysis of cooling systems whose purpose is to maintain the quality of the high energy beams in the SPS in spite of gas scattering, RF noise, magnet ripple and beam-beam interactions. Three types of systems were discussed. The status of these activities is discussed below. (orig.)

  13. High Energy Physics (United States)

    Untitled Document [Argonne Logo] [DOE Logo] High Energy Physics Home Division ES&H Personnel Collider Physics Cosmic Frontier Cosmic Frontier Theory & Computing Detector R&D Electronic Design Mechanical Design Neutrino Physics Theoretical Physics Seminars HEP Division Seminar HEP Lunch Seminar HEP

  14. Theoretical High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    Christ, Norman H.; Weinberg, Erick J.


    we provide reports from each of the six faculty supported by the Department of Energy High Energy Physics Theory grant at Columbia University. Each is followed by a bibliography of the references cited. A complete list of all of the publications in the 12/1/2010-04/30/2014 period resulting from research supported by this grant is provided in the following section. The final section lists the Ph.D. dissertations based on research supported by the grant that were submitted during this period.

  15. High energy dosimetry

    International Nuclear Information System (INIS)

    Ruhm, W.


    Full text: Currently, quantification of doses from high-energy radiation fields is a topical issue. This is so because high-energy neutrons play an important role for radiation exposure of air crew members and personnel outside the shielding of ion therapy facilities. In an effort to study air crew exposure from cosmic radiation in detail, two Bonner Sphere Spectrometers (BSSs) have recently been installed to measure secondary neutrons from cosmic radiation, one at the environmental research station 'Schneefernerhaus' at an altitude of 2650 m on the Zugspitze mountain, Germany, the other at the Koldewey station close to the North Pole on Spitsbergen. Based on the measured neutron fluence distributions and on fluence-to-dose conversion coefficients, mean ambient dose equivalent rate values of 75.0 ± 2.9 nSv/h and 8.7 ± 0.6 nSv/h were obtained for October 2008, respectively. Neutrons with energies above about 20 MeV contribute about 50% to dose, at 2650 m. Ambient dose equivalent rates measured by means of a standard rem counter and an extended rem counter at the Schneefernerhaus confirm this result. In order to study the response of state-of-the-art radiation instrumentation in such a high-energy radiation field, a benchmark exercise that included both measurements in and simulation of the stray neutron radiation field at the high-energy particle accelerator at GSI, Germany, were performed. This CONRAD (COordinated Network for RAdiation Dosimetry) project was funded by the European Commission, and the organizational framework was provided by the European Radiation Dosimetry Group, EURADOS. The Monte Carlo simulations of the radiation field and the experimental determination of the neutron spectra with various Bonner Sphere Spectrometers suggest the neutron fluence distributions to be very similar to those of secondary neutrons from cosmic radiation. The results of this intercomparison exercise in terms of ambient dose equivalent are also discussed

  16. High energy physics problems

    International Nuclear Information System (INIS)

    Arbuzov, B.A.


    Described are modern views on the particle structure and particle interactions at high energies. According to the latest data recieved, all particles can be classified in three groups: 1) strong interacting hadrons; 2) leptons, having no strong interactions; 3) photon. The particle structure is described in a quark model, and with the use of gluons. The elementary particle theory is based on the quantum field theory. The energy increase of interacting particles enables to check the main theory principles, such as conventions for causality, relativistic invariance and unitarity. Investigations of weak interactions are of great importance. The progress in this field is connected with unified gauge theories of weak and electromagnetic interactions. For weak interactions promissing are the experiments with colliding electron-proton rings. The new data, especially at higher energies, will lead to a further refinement of the nature of particles and their interactions

  17. High energy nuclear physics

    International Nuclear Information System (INIS)

    Meyer, J.


    The 1988 progress report of the High Energy Nuclear Physics laboratory (Polytechnic School, France), is presented. The Laboratory research program is focused on the fundamental physics of interactions, on the new techniques for the acceleration of charged particles and on the nuclei double beta decay. The experiments are performed on the following topics: the measurement of the π 0 inclusive production and the photons production in very high energy nuclei-nuclei interactions and the nucleon stability. Concerning the experiments under construction, a new detector for LEP, the study and simulation of the hadronic showers in a calorimeter and the H1 experiment (HERA), are described. The future research programs and the published papers are listed [fr

  18. High energy medical accelerators

    International Nuclear Information System (INIS)

    Mandrillon, P.


    The treatment of tumours with charged particles, ranging from protons to 'light ions' (carbon, oxygen, neon), has many advantages, but up to now has been little used because of the absence of facilities. After the successful pioneering work carried out with accelerators built for physics research, machines dedicated to this new radiotherapy are planned or already in construction. These high energy medical accelerators are presented in this paper. (author) 15 refs.; 14 figs.; 8 tabs

  19. Theoretical high energy physics

    International Nuclear Information System (INIS)

    Lee, T.D.


    This report discusses progress on theoretical high energy physics at Columbia University in New York City. Some of the topics covered are: Chern-Simons gauge field theories; dynamical fermion QCD calculations; lattice gauge theory; the standard model of weak and electromagnetic interactions; Boson-fermion model of cuprate superconductors; S-channel theory of superconductivity and axial anomaly and its relation to spin in the parton model

  20. Very high energy colliders

    International Nuclear Information System (INIS)

    Richter, B.


    The conclusions are relatively simple, but represent a considerable challenge to the machine builder. High luminosity is essential. We may in the future discover some new kind of high cross section physics, but all we know now indicates that the luminosity has to increase as the square of the center of mass energy. A reasonable luminosity to scale from for electron machines would be 10 33 cm -2 s -1 at a center of mass energy of 3 TeV. The required emittances in very high energy machines are small. It will be a real challenge to produce these small emittances and to maintain them during acceleration. The small emittances probably make acceleration by laser techniques easier, if such techniques will be practical at all. The beam spot sizes are very small indeed. It will be a challenge to design beam transport systems with the necessary freedom from aberration required for these small spot sizes. It would of course help if the beta functions at the collision points could be reduced. Beam power will be large - to paraphrase the old saying, ''power is money'' - and efficient acceleration systems will be required

  1. Theoretical high energy physics

    International Nuclear Information System (INIS)

    Lee, T.D.


    Brief reports are given on the work of several professors. The following areas are included: quantum chromodynamics calculations using numerical lattice gauge theory and a high-speed parallel computer; the ''spin wave'' description of bosonic particles moving on a lattice with same-site exclusion; a high-temperature expansion to 13th order for the O(4)-symmetric φ 4 model on a four-dimensional F 4 lattice; spin waves and lattice bosons; superconductivity of C 60 ; meson-meson interferometry in heavy-ion collisions; baryon number violation in the Standard Model in high-energy collisions; hard thermal loops in QCD; electromagnetic interactions of anyons; the relation between Bose-Einstein and BCS condensations; Euclidean wormholes with topology S 1 x S 2 x R; vacuum decay and symmetry breaking by radiative corrections; inflationary solutions to the cosmological horizon and flatness problems; and magnetically charged black holes

  2. High frequency energy measurements

    International Nuclear Information System (INIS)

    Stotlar, S.C.


    High-frequency (> 100 MHz) energy measurements present special problems to the experimenter. Environment or available electronics often limit the applicability of a given detector type. The physical properties of many detectors are frequency dependent and in some cases, the physical effect employed can be frequency dependent. State-of-the-art measurements generally involve a detection scheme in association with high-speed electronics and a method of data recording. Events can be single or repetitive shot requiring real time, sampling, or digitizing data recording. Potential modification of the pulse by the detector and the associated electronics should not be overlooked. This presentation will review typical applications, methods of choosing a detector, and high-speed detectors. Special considerations and limitations of some applications and devices will be described

  3. High energy ion implantation

    International Nuclear Information System (INIS)

    Ziegler, J.F.


    High energy ion implantation offers the oppertunity for unique structures in semiconductor processing. The unusual physical properties of such implantations are discussed as well as the special problems in masking and damage annealing. A review is made of proposed circuit structures which involve deep implantation. Examples are: deep buried bipolar collectors fabricated without epitaxy, barrier layers to reduce FET memory sensitivity to soft-fails, CMOS isolation well structures, MeV implantation for customization and correction of completed circuits, and graded reach-throughs to deep active device components. (orig.)

  4. High energy physics

    International Nuclear Information System (INIS)

    Fortney, L.R.; Goshaw, A.T.; Walker, W.D.


    This progress report presents a review of research done over the past five years by the Duke High Energy Physics Group. This research has been centered at Fermilab where we have had a continuing involvement with both the Tevatron collider and fixed-target programs. In 1988 we began extensive detector R ampersand D for the SSC through its Major Subsystem Program. Duke has been an active member of the Solenoidal Detector Collaboration (SDC) since its formation. These last five years has also been used to finish the analysis of data from a series of hybrid bubble chamber experiments which formed the core of Duke's research program in the early 1980's

  5. High energy cosmic rays

    CERN Document Server

    Stanev, Todor


    Offers an accessible text and reference (a cosmic-ray manual) for graduate students entering the field and high-energy astrophysicists will find this an accessible cosmic-ray manual Easy to read for the general astronomer, the first part describes the standard model of cosmic rays based on our understanding of modern particle physics. Presents the acceleration scenario in some detail in supernovae explosions as well as in the passage of cosmic rays through the Galaxy. Compares experimental data in the atmosphere as well as underground are compared with theoretical models

  6. Prospects at high energies

    International Nuclear Information System (INIS)

    Quigg, C.


    I discuss some possibilities for neutrino experiments in the fixed-target environment of the SPS, Tevatron, and UNK, with their primary proton beams of 0.4, 0.9, and 3.0 TeV. The emphasis is on unfinished business: issues that have been recognized for some time, but not yet resolved. Then I turn to prospects for proton-proton colliders to explore the 1-TeV scale. I review the motivation for new physics in the neighborhood of 1 TeV and mention some discovery possibilities for high-energy, high-luminosity hadron colliders and the implications they would have for neutrino physics. I raise the possibility of the direct study of neutrino interactions in hadron colliders. I close with a report on the status of the SSC project. 38 refs., 17 figs

  7. High energy physics

    International Nuclear Information System (INIS)

    Kernan, A.; Shen, B.C.; Ma, E.


    This proposal is for the continuation of the High Energy Physics program at the University of California at Riverside. In hadron collider physics the authors will complete their transition from experiment UA1 at CERN to the DZERO experiment at Fermilab. On experiment UA1 their effort will concentrate on data analysis at Riverside. At Fermilab they will coordinate the high voltage system for all detector elements. They will also carry out hardware/software development for the D0 muon detector. The TPC/Two-Gamma experiment has completed its present phase of data-taking after accumulating 160 pb - 1 of luminosity. The UC Riverside group will continue data and physics analysis and make minor hardware improvement for the high luminosity run. The UC Riverside group is participating in design and implementation of the data acquisition system for the OPAL experiment at LEP. Mechanical and electronics construction of the OPAL hadron calorimeter strip readout system is proceeding on schedule. Data analysis and Monte Carlo detector simulation efforts are proceeding in preparation for the first physics run when IEP operation comenses in fall 1989

  8. High energy astrophysical techniques

    CERN Document Server

    Poggiani, Rosa


    This textbook presents ultraviolet and X-ray astronomy, gamma-ray astronomy, cosmic ray astronomy, neutrino astronomy, and gravitational wave astronomy as distinct research areas, focusing on the astrophysics targets and the requirements with respect to instrumentation and observation methods. The purpose of the book is to bridge the gap between the reference books and the specialized literature. For each type of astronomy, the discussion proceeds from the orders of magnitude for observable quantities. The physical principles of photon and particle detectors are then addressed, and the specific telescopes and combinations of detectors, presented. Finally the instruments and their limits are discussed with a view to assisting readers in the planning and execution of observations. Astronomical observations with high-energy photons and particles represent the newest additions to multimessenger astronomy and this book will be of value to all with an interest in the field.

  9. High energy magnetic excitations

    International Nuclear Information System (INIS)

    Endoh, Yasuo


    The report emphasizes that the current development in condensed matter physics opens a research field fit to inelastic neutron scattering experiments in the eV range which is easilly accessed by spallation neutron sources. Several important subjects adopted at thermal reactors are shown. It is desired to extend the implementation of the spectroscopic experiments for investigation of higher energy magnetic excitations. For La 2 CuO 4 , which is the mother crystal of the first high Tc materials found by Bednortz and Muller, it seems to be believed that the magnetism is well characterized by the two-dimensional Heisenberg antiferromagnetic Hamiltonian, and it is widely accepted that the magnetism is a most probable progenitor of high Tc superconductors. The unusual properties of spin correlations in this crystal have been studied extensively by standard neutron scattering techniques with steady neutrons at BNL. FeSi is not ordered magnetically but shows a very unique feature of temperature induced magnetism, which also has been studied extensively by using the thermal neutron scattering technique at BNL. In these experiments, polarized neutrons are indispensable to extract the clean magnetic components out of other components of non-magnetic scattering. (N.K.)

  10. First detection of very-high-energy gamma-ray emission from the extreme blazar PGC 2402248 with the MAGIC telescopes (United States)

    Mirzoyan, Razmik


    The MAGIC collaboration reports the first detection of very-high-energy (VHE; E > 100 GeV) gamma-ray emission from PGC 2402248, also known as 2WHSP J073326.7+515354 (Chang et al. 2016, A & A, 598, A17) with coordinates R.A.: 07:33:26.7 h, Dec: +51:53:54.99 deg. The source is classified as an extreme high-energy peaked BL Lacertae object of unknown redshift, included in the 2WHSP catalog with a synchrotron peak located at 10^17.9 Hz. PGC 2402248 was observed with the MAGIC telescopes from 2018/01/23 to 2018/04/18 (MJD 58141-58226) for about 23 h. The preliminary analysis of these data resulted in the detection of PGC 2402248 with a statistical significance of more than 6 standard deviations.

  11. The opacity of the universe for high and very high energy γ-rays

    International Nuclear Information System (INIS)

    Meyer, Manuel


    The flux of high energy (HE, energy 100 MeV or similar 100 GeV) γ-rays originating from cosmological sources is attenuated due to pair production in interactions with photons at ultraviolet to infrared wavelengths of the extragalactic background light (EBL). The main components contributing to the EBL photon density are the starlight integrated over cosmic time and the starlight reprocessed by dust in galaxies. Consequently, the EBL is an integral measure of the cosmic star formation history. Depending on the source distance, the Universe should be opaque to γ-rays above a certain energy. Nevertheless, the number of detected γ-ray sources has increased continuously in recent years. VHE emitting objects beyond redshifts of z>0.5 have been detected with imaging air Cherenkov telescopes (IACTs), while HE γ-rays from active galactic nuclei (AGN) above redshifts z>or similar 3 have been observed with the Large Area Telescope (LAT) on board the Fermi satellite. In this work, a large sample of VHE γ-ray spectra will be combined with data of the Fermi-LAT to derive upper limits on the EBL photon density at z = 0. Generic EBL realizations are used to correct AGN spectra for absorption, which are subsequently tested against model assumptions. The evolution of the EBL with redshift is accounted for, and a possible formation of electromagnetic cascades is considered. As a result, the EBL density is constrained over almost three orders of magnitude in wavelength, between 0.4 μm and 100 μm. At optical wavelengths, an EBL intensity above 24 nW m -2 sr -1 is ruled out, and between 8 μm and 31 μm it is limited to be below 5 nW m -2 sr -1 . In the infrared, the constraints are within a factor ∝ 2 of lower limits derived from galaxy number counts. Additionally,the behavior of VHE spectra in the transition from the optical depth regimes τ γγ γγ ≥2 is investigated. The absorption-corrected spectra consistently show an upturn at high optical depths, significant at the

  12. Computing in high energy physics

    Energy Technology Data Exchange (ETDEWEB)

    Watase, Yoshiyuki


    The increasingly important role played by computing and computers in high energy physics is displayed in the 'Computing in High Energy Physics' series of conferences, bringing together experts in different aspects of computing - physicists, computer scientists, and vendors.

  13. FSU High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    Prosper, Harrison B. [Florida State Univ., Tallahassee, FL (United States); Adams, Todd [Florida State Univ., Tallahassee, FL (United States); Askew, Andrew [Florida State Univ., Tallahassee, FL (United States); Berg, Bernd [Florida State Univ., Tallahassee, FL (United States); Blessing, Susan K. [Florida State Univ., Tallahassee, FL (United States); Okui, Takemichi [Florida State Univ., Tallahassee, FL (United States); Owens, Joseph F. [Florida State Univ., Tallahassee, FL (United States); Reina, Laura [Florida State Univ., Tallahassee, FL (United States); Wahl, Horst D. [Florida State Univ., Tallahassee, FL (United States)


    The High Energy Physics group at Florida State University (FSU), which was established in 1958, is engaged in the study of the fundamental constituents of matter and the laws by which they interact. The group comprises theoretical and experimental physicists, who sometimes collaborate on projects of mutual interest. The report highlights the main recent achievements of the group. Significant, recent, achievements of the group’s theoretical physicists include progress in making precise predictions in the theory of the Higgs boson and its associated processes, and in the theoretical understanding of mathematical quantities called parton distribution functions that are related to the structure of composite particles such as the proton. These functions are needed to compare data from particle collisions, such as the proton-proton collisions at the CERN Large Hadron Collider (LHC), with theoretical predictions. The report also describes the progress in providing analogous functions for heavy nuclei, which find application in neutrino physics. The report highlights progress in understanding quantum field theory on a lattice of points in space and time (an area of study called lattice field theory), the progress in constructing several theories of potential new physics that can be tested at the LHC, and interesting new ideas in the theory of the inflationary expansion of the very early universe. The focus of the experimental physicists is the Compact Muon Solenoid (CMS) experiment at CERN. The report, however, also includes results from the D0 experiment at Fermilab to which the group made numerous contributions over a period of many years. The experimental group is particularly interested in looking for new physics at the LHC that may provide the necessary insight to extend the standard model (SM) of particle physics. Indeed, the search for new physics is the primary task of contemporary particle physics, one motivated by the need to explain certain facts, such as the

  14. High energy physics

    International Nuclear Information System (INIS)

    Kernan, A.; Shen, B.C.; Ma, E.


    This proposal is for the continuation of the High Energy Physics Program at the University of California, Riverside. In 1990, we will concentrate on analysis of LEP data from the OPAL detector. We expect to record 10 5 Z's by the end of 1989 and 10 6 in 1990. This data will be used to measure the number of quark-lepton families in the universe. In the second half of 1990 we will also be occupied with the installation of the D-Zero detector in the Tevatron Collider and the preparation of software for the 1991 run. A new initiative made possible by generous university support is a laboratory for detector development at UCR. The focus will be on silicon strip tracking detectors both for the D-Zero upgrade and for SSC physics. The theory program will pursue further various mass-generating radiative mechanisms for understanding small quark and lepton masses as well as some novel phenomenological aspects of supersymmetry

  15. High energy plasma accelerators

    International Nuclear Information System (INIS)

    Tajima, T.


    Colinear intense laser beams ω 0 , kappa 0 and ω 1 , kappa 1 shone on a plasma with frequency separation equal to the electron plasma frequency ω/sub pe/ are capable of creating a coherent large longitudinal electric field E/sub L/ = mc ω/sub pe//e of the order of 1GeV/cm for a plasma density of 10 18 cm -3 through the laser beat excitation of plasma oscillations. Accompanying favorable and deleterious physical effects using this process for a high energy beat-wave accelerator are discussed: the longitudinal dephasing, pump depletion, the transverse laser diffraction, plasma turbulence effects, self-steepening, self-focusing, etc. The basic equation, the driven nonlinear Schroedinger equation, is derived to describe this system. Advanced accelerator concepts to overcome some of these problems are proposed, including the plasma fiber accelerator of various variations. An advanced laser architecture suitable for the beat-wave accelerator is suggested. Accelerator physics issues such as the luminosity are discussed. Applications of the present process to the current drive in a plasma and to the excitation of collective oscillations within nuclei are also discussed

  16. High-Energy Pulsar Models: Developments and New Questions (United States)

    Venter, C.; Harding, A. K.


    our understanding of particle acceleration, emission, and magnetosphere geometry. One may now also study evolutionary trends of the measured or inferred quantities, and probe pulsar visibility and population properties such as radiation beam sizes of different pulsar classes, as well as the distribution of spin-down power, gamma-ray luminosity, conversion efficiency, spectral index, and cutoff energy across the population. Lastly, the recent detection of very-high-energy (VHE) pulsations from the Crab pulsar generated quite a few ideas to explain this emission, leading to an extension of standard models and possibly even a bridge between the physics of pulsars and pulsar wind nebulae (PWNe).

  17. High energy neutron generator

    International Nuclear Information System (INIS)

    Barjon, R.; Breynat, G.


    This patent describes a generator of fast neutrons only slightly contaminated by neutrons of energy less than 15 MeV, comprising a source of charged particles of energy equal to at least 15 MeV, a target made of lithium deuteride, and means for cooling the target. The target comprises at least two elements placed in series in the path of the charged particles and separated from each other, the thickness of each of the elements being selected as a function of the average energy of the charged particles emitted from the source and the energy of the fast neutrons to be generated such that neutrons of energy equal to at least 15 MeV are emitted in the forward direction in response to the bombardment of the target from behind by the charged particles. The target cooling means comprises means for circulating between and around the elements a gas which does not chemically react with lithium deuteride

  18. Dosimetry of high energy radiation

    CERN Document Server

    Sahare, P D


    High energy radiation is hazardous to living beings and a threat to mankind. The correct estimation of the high energy radiation is a must and a single technique may not be very successful. The process of estimating the dose (the absorbed energy that could cause damages) is called dosimetry. This book covers the basic technical knowledge in the field of radiation dosimetry. It also makes readers aware of the dangers and hazards of high energy radiation.

  19. Renewable Energy Riding High

    Institute of Scientific and Technical Information of China (English)


    China is putting greater emphasis on green energy as it tries to clean up industry and meet target for cuts in carbon emissions over the past two years, China has already leapfrogged competitors from Denmark, Germany, Spain and the United States to become the world's largest maker of wind turbines and solar panels. At the same time, the country is also taking steps to build more nuclear reactors and energy-efficient coal power plants.

  20. Energy peaks: A high energy physics outlook (United States)

    Franceschini, Roberto


    Energy distributions of decay products carry information on the kinematics of the decay in ways that are at the same time straightforward and quite hidden. I will review these properties and discuss their early historical applications, as well as more recent ones in the context of (i) methods for the measurement of masses of new physics particle with semi-invisible decays, (ii) the characterization of Dark Matter particles produced at colliders, (iii) precision mass measurements of Standard Model particles, in particular of the top quark. Finally, I will give an outlook of further developments and applications of energy peak method for high energy physics at colliders and beyond.

  1. BROOKHAVEN: High energy gold

    International Nuclear Information System (INIS)

    Bleser, Ed


    On April 24, Brookhaven's Alternating Gradient Synchrotron (AGS) started to deliver gold ions at 11.4 GeV per nucleon (2,000 GeV per ion) to experimenters who were delighted not only to receive the world's highest energy gold beam but also to receive it on schedule

  2. TARGET: A multi-channel digitizer chip for very-high-energy gamma-ray telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Bechtol, K.; Funk, S.; /Stanford U., HEPL /KIPAC, Menlo Park; Okumura, A.; /JAXA, Sagamihara /Stanford U., HEPL /KIPAC, Menlo Park; Ruckman, L.; /Hawaii U.; Simons, A.; Tajima, H.; Vandenbroucke, J.; /Stanford U., HEPL /KIPAC, Menlo Park; Varner, G.; /Hawaii U.


    The next-generation very-high-energy (VHE) gamma-ray observatory, the Cherenkov Telescope Array, will feature dozens of imaging atmospheric Cherenkov telescopes (IACTs), each with thousands of pixels of photosensors. To be affordable and reliable, reading out such a mega-channel array requires event recording technology that is highly integrated and modular, with a low cost per channel. We present the design and performance of a chip targeted to this application: the TeV Array Readout with GSa/s sampling and Event Trigger (TARGET). This application-specific integrated circuit (ASIC) has 16 parallel input channels, a 4096-sample buffer for each channel, adjustable input termination, self-trigger functionality, and tight window-selected readout. We report the performance of TARGET in terms of sampling frequency, power consumption, dynamic range, current-mode gain, analog bandwidth, and cross talk. The large number of channels per chip allows a low cost per channel ($10 to $20 including front-end and back-end electronics but not including photosensors) to be achieved with a TARGET-based IACT readout system. In addition to basic performance parameters of the TARGET chip itself, we present a camera module prototype as well as a second-generation chip (TARGET 2), both of which have been produced.

  3. Long-term spectral and temporal behavior of the high-frequency peaked BL LAC object 1ES 1959+650 (United States)

    Backes, M.; Uellenbeck, M.; Hayashida, M.; Satalecka, K.; Tescaro, D.; Terzić, T.; MAGIC Collaboration; Fuhrmann, L.; Nestoras, I.; F-GAMMA project; Lähteenmäki, A.; Tornikoski, M.; Nieppola, E.; Metsähovi; Böttcher, M.; Collmar, W.; Weidinger, M.


    The high-frequency peaked BL Lac object 1ES 1959+650 is well-known for an exceptional outburst, which was observed at very high energy (VHE) γ-rays by the Whipple 10m and HEGRA telescopes in 2002. Remarkably, this outburst lacked associated X-ray emission (a socalled "orphan flare") and by this cannot easily be described by standard Synchrotron Self Compton (SSC) models. Models based on hadronic emission processes have also been proposed to explain the observed behavior. Subsequent multi-wavelength observations during a low flux state at TeV energies in 2006 can, instead, be explained by a standard single-zone SSC model. In this context, 1ES 1959+650 has been regularly monitored by the MAGIC telescope since 2005. During these years, no significant variation in the VHE γ-ray flux has been observed. The low energy part of this is in very good agreement with the high-energy part of the time-integrated energy spectrum as measured by Fermi-LAT. Based on this constant flux level in VHE γ-rays, we assembled the time-integrated spectral energy distribution (SED) of 1ES 1959+650 from radio to VHE γ-rays. Despite the non-variability at very high energies, significant flux and spectral variations have been observed at optical and X-ray frequencies in the meanwhile. Furthermore, the shape of the SED at high energy γ-rays as measured by Fermi-LAT is essentially flat which cannot be explained by either conventional single-zone SSC models, or models invoking external radiation fields (EC).

  4. Laser-Driven Very High Energy Electron/Photon Beam Radiation Therapy in Conjunction with a Robotic System

    Directory of Open Access Journals (Sweden)

    Kazuhisa Nakajima


    Full Text Available We present a new external-beam radiation therapy system using very-high-energy (VHE electron/photon beams generated by a centimeter-scale laser plasma accelerator built in a robotic system. Most types of external-beam radiation therapy are delivered using a machine called a medical linear accelerator driven by radio frequency (RF power amplifiers, producing electron beams with an energy range of 6–20 MeV, in conjunction with modern radiation therapy technologies for effective shaping of three-dimensional dose distributions and spatially accurate dose delivery with imaging verification. However, the limited penetration depth and low quality of the transverse penumbra at such electron beams delivered from the present RF linear accelerators prevent the implementation of advanced modalities in current cancer treatments. These drawbacks can be overcome if the electron energy is increased to above 50 MeV. To overcome the disadvantages of the present RF-based medical accelerators, harnessing recent advancement of laser-driven plasma accelerators capable of producing 1-GeV electron beams in a 1-cm gas cell, we propose a new embodiment of the external-beam radiation therapy robotic system delivering very high-energy electron/photon beams with an energy of 50–250 MeV; it is more compact, less expensive, and has a simpler operation and higher performance in comparison with the current radiation therapy system.

  5. High energy cosmic ray astronomy

    International Nuclear Information System (INIS)

    Fonseca, V.


    A brief introduction to High Energy Cosmic Ray Astronomy is presented. This field covers a 17 decade energy range (2.10 4 -10 20 ) eV. Recent discoveries done with gamma-ray detectors on-board satellites and ground-based Cherenkov devices are pushing for a fast development of new and innovative techniques, specially in the low energy region which includes the overlapping of satellite and ground-based measurements in the yet unexplored energy range 20 keV-250 GeV. Detection of unexpected extremely high energy events have triggered the interest of the international scientific community. (orig.)

  6. High Energy Materials

    Indian Academy of Sciences (India)

    IAS Admin

    Propellants used in rockets, pyrotechnics used in festivities, explosives used for .... In World War II, Wernher von Braun designed the. V-2 rockets which were ... A. Solid Propellants. A solid propellant is made from low or diluted high explosives.

  7. Computing in high energy physics

    International Nuclear Information System (INIS)

    Watase, Yoshiyuki


    The increasingly important role played by computing and computers in high energy physics is displayed in the 'Computing in High Energy Physics' series of conferences, bringing together experts in different aspects of computing - physicists, computer scientists, and vendors

  8. High-energy communication

    CERN Multimedia

    CERN Communication Group


    On Wednesday at 10.40 a.m., the LHC operators declared “stable beams” after two years of technical stop and a few months of commissioning. It was an exciting day for all the teams involved, including those who worked on communicating the news to the public and the media on multiple platforms.   CERN’s most successful tweet on 3 June featured collision images from ALICE, ATLAS, CMS and LHCb and was shared 800 times by the Twitter audience. Live blogging, social media posts, a live webcast, and a constant outpouring of photos and videos: Wednesday morning was a crazy time for the communication teams from CERN, the experiments and various institutes around the world. Even though the event started very early in the morning (the live CCC blog started at 7 a.m. and the live webcast at 8.20 a.m.), the public and the media tuned in to follow and generously cover the start of the LHC’s physics run at an unprecedented energy of 13 TeV. The statistics showed th...

  9. High-energy cosmic rays

    Energy Technology Data Exchange (ETDEWEB)

    Gaisser, Thomas K. [Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States)]. E-mail:; Stanev, Todor [Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States)


    After a brief review of galactic cosmic rays in the GeV to TeV energy range, we describe some current problems of interest for particles of very high energy. Particularly interesting are two features of the spectrum, the knee above 10{sup 15} eV and the ankle above 10{sup 18} eV. An important question is whether the highest-energy particles are of extra-galactic origin and, if so, at what energy the transition occurs. A theme common to all energy ranges is use of nuclear abundances as a tool for understanding the origin of the cosmic radiation.

  10. Ultra high energy cosmic rays

    International Nuclear Information System (INIS)

    Watson, A.A.


    Cosmic radiation was discovered 70 years ago but its origin remains an open question. The background to this problem is outlined and attempts to discover the origin of the most energetic and rarest group above 10 15 eV are described. Measurements of the energy spectrum and arrival direction pattern of the very highest energy particles, mean energy about 6 x 10 19 eV, are used to argue that these particles originate outside our galaxy. Recent evidence from the new field of ultra high energy γ-ray astronomy are discussed in the context of a galactic origin hypothesis for lower energy cosmic rays. (author)

  11. High energy physics

    International Nuclear Information System (INIS)

    Kernan, A.; Shen, B.C.; Ma, E.


    Hadron collider studies will focus on: (i) the search for the top quark with the newly installed D0 detector at the Fermilab Tevatron collider, (ii) the upgrade of the D0 detector to match the new main injector luminosity and (iii) R ampersand D on silicon microstrip tracking devices for the SSC. High statistics studies of Z 0 decay will continue with the OPAL detector at LEP. These studies will include a direct measurement of Z decay to neutrinos, the search for Higgs and heavy quark decays of Z. Preparations for the Large Scintillation Neutrino Detector (LSND) to measure neutrino oscillations at LAMPF will focus on data acquisition and testing of photomultiplier tubes. In the theoretical area E. Ma will concentrate on mass-generating radiative mechanisms for light quarks and leptons in renormalizable gauge field theories. J. Wudka's program includes a detailed investigation of the magnetic-flip approach to the solar neutrino


    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Arlen, T.; Aune, T.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R.; Boettcher, M.; Boltuch, D.; Bradbury, S. M.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Finley, J. P.; Duke, C.; Errando, M.; Falcone, A.; Finnegan, G.


    The very high energy (VHE; E > 100 GeV) blazar Markarian 501 (Mrk 501) has a well-studied history of extreme spectral variability and is an excellent laboratory for studying the physical processes within the jets of active galactic nuclei. However, there are few detailed multiwavelength studies of Mrk 501 during its quiescent state, due to its low luminosity. A short-term multiwavelength study of Mrk 501 was coordinated in 2009 March, focusing around a multi-day observation with the Suzaku X-ray satellite and including γ-ray data from VERITAS, MAGIC, and the Fermi Gamma-ray Space Telescope with the goal of providing a well-sampled multiwavelength baseline measurement of Mrk 501 in the quiescent state. The results of these quiescent-state observations are compared to the historically extreme outburst of 1997 April 16, with the goal of examining variability of the spectral energy distribution (SED) between the two states. The derived broadband SED shows the characteristic double-peaked profile. We find that the X-ray peak shifts by over two orders of magnitude in photon energy between the two flux states while the VHE peak varies little. The limited shift in the VHE peak can be explained by the transition to the Klein-Nishina (KN) regime. Synchrotron self-Compton models are matched to the data and the implied KN effects are explored.

  13. Spectral Energy Distribution of Markarian 501: Quiescent State Versus Extreme Outburst (United States)

    Acciari, V. A.; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Böttcher, M.; Boltuch, D.; Bradbury, S. M.; Buckley, J. H.; Bugaev, V.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Dickherber, R.; Duke, C.; Errando, M.; Falcone, A.; Finley, J. P.; Finnegan, G.; Fortson, L.; Furniss, A.; Galante, N.; Gall, D.; Godambe, S.; Grube, J.; Guenette, R.; Gyuk, G.; Hanna, D.; Holder, J.; Huang, D.; Hui, C. M.; Humensky, T. B.; Imran, A.; Kaaret, P.; Karlsson, N.; Kertzman, M.; Kieda, D.; Konopelko, A.; Krawczynski, H.; Krennrich, F.; Madhavan, A. S.; Maier, G.; McArthur, S.; McCann, A.; Moriarty, P.; Ong, R. A.; Otte, A. N.; Pandel, D.; Perkins, J. S.; Pichel, A.; Pohl, M.; Quinn, J.; Ragan, K.; Reyes, L. C.; Reynolds, P. T.; Roache, E.; Rose, H. J.; Schroedter, M.; Sembroski, G. H.; Steele, D.; Swordy, S. P.; Theiling, M.; Thibadeau, S.; Varlotta, A.; Vassiliev, V. V.; Vincent, S.; Wakely, S. P.; Ward, J. E.; Weekes, T. C.; Weinstein, A.; Weisgarber, T.; Williams, D. A.; Wood, M.; Zitzer, B.; VERITAS Collaboration; Aleksić, J.; Antonelli, L. A.; Antoranz, P.; Backes, M.; Barrio, J. A.; Bastieri, D.; Becerra González, J.; Bednarek, W.; Berdyugin, A.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Bordas, P.; Borla Tridon, D.; Bosch-Ramon, V.; Bose, D.; Braun, I.; Bretz, T.; Camara, M.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Dazzi, F.; De Angelis, A.; De Cea del Pozo, E.; De Lotto, B.; De Maria, M.; De Sabata, F.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Elsaesser, D.; Errando, M.; Ferenc, D.; Fonseca, M. V.; Font, L.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giavitto, G.; Godinović, N.; Hadasch, D.; Herrero, A.; Hildebrand, D.; Höhne-Mönch, D.; Hose, J.; Hrupec, D.; Jogler, T.; Klepser, S.; Krähenbühl, T.; Kranich, D.; Krause, J.; La Barbera, A.; Leonardo, E.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Lorenz, E.; Majumdar, P.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Miyamoto, H.; Moldón, J.; Moralejo, A.; Nieto, D.; Nilsson, K.; Orito, R.; Oya, I.; Paoletti, R.; Paredes, J. M.; Partini, S.; Pasanen, M.; Pauss, F.; Pegna, R. G.; Perez-Torres, M. A.; Persic, M.; Peruzzo, L.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puchades, N.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rissi, M.; Rügamer, S.; Saggion, A.; Saito, K.; Saito, T. Y.; Salvati, M.; Sánchez-Conde, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Shayduk, M.; Shore, S. N.; Sierpowska-Bartosik, A.; Sillanpää, A.; Sitarek, J.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamerra, A.; Steinke, B.; Storz, J.; Strah, N.; Struebig, J. C.; Suric, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Vankov, H.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.; MAGIC Collaboration; Paneque, D.; Hayashida, M.


    The very high energy (VHE; E > 100 GeV) blazar Markarian 501 (Mrk 501) has a well-studied history of extreme spectral variability and is an excellent laboratory for studying the physical processes within the jets of active galactic nuclei. However, there are few detailed multiwavelength studies of Mrk 501 during its quiescent state, due to its low luminosity. A short-term multiwavelength study of Mrk 501 was coordinated in 2009 March, focusing around a multi-day observation with the Suzaku X-ray satellite and including γ-ray data from VERITAS, MAGIC, and the Fermi Gamma-ray Space Telescope with the goal of providing a well-sampled multiwavelength baseline measurement of Mrk 501 in the quiescent state. The results of these quiescent-state observations are compared to the historically extreme outburst of 1997 April 16, with the goal of examining variability of the spectral energy distribution (SED) between the two states. The derived broadband SED shows the characteristic double-peaked profile. We find that the X-ray peak shifts by over two orders of magnitude in photon energy between the two flux states while the VHE peak varies little. The limited shift in the VHE peak can be explained by the transition to the Klein-Nishina (KN) regime. Synchrotron self-Compton models are matched to the data and the implied KN effects are explored.

  14. High energy physics research

    International Nuclear Information System (INIS)

    Piroue, P.A.


    The goal of this research is to understand the fundamental constituents of matter and their interactions. At this time, the following activities are underway: e + e - interactions and Z 0 physics at CERN; studies to upgrade the L3 detector at LHC; very high statistics charm physics at Fermilab; search for the H particle at BNL; search for the fifth force; rare kaon decay experiments at BNL; study of B-meson physics at hadron colliders; e + e - pair creation by light at SLAC; R ampersand D related to SSC experiments and the GEM detector; and theoretical research in elementary particle physics and cosmology. The main additions to the activities described in detail in the original grant proposal are (1) an experiment at SLAC (E-144) to study strong-field QED effects in e-laser and γ-laser collisions, and (2) a search for the H particle at BNL (E-188). The R ampersand D efforts for the GEM detector have also considerably expanded. In this paper we give a brief status report for each activity currently under way

  15. High energy physics

    International Nuclear Information System (INIS)


    The Counter Group continues to work on data analysis for Fermilab Experiment E653. Altogether, they expect several thousand reconstructed charm events and approximately 25 B pair events of which 12 have been observed thus far. Preparation continue for Fermilab Experiment E781, a high statistics study of charm baryon production. In the Theory Group, Cutkosky and collaborators study hadron phenomenology and non-perturbative QCD calculations. Levine has a long standing program in computational QED to obtain improved theoretical values for g-2 of the electron. Wolfenstein, Li, and their collaborators have worked on areas of weak interaction phenomenology that may yield insights beyond the standard model, e.g. CP violation and non-zero neutrino masses. Holman has been concerned with phase transitions in gauge theories relevant to cosmological problems. During 1991 most of the group effort was concentrated on the L3 experiment at CERN. Highlights of the results from the analysis of the Z degrees resonance include (a) a measurement of the strong coupling constant α s for b quarks (b) a precision measurement of the average time of B hadrons and (c) a direct determination of the number of light neutrino faculties from the reaction e + e - → ν bar νγ. We also began a major upgrade of the L3 luminosity monitor by replacing PWC chamber by a Si strip system in front of the BGO calorimeters. Finally we have continued our SSC R ampersand D work on BaF 2 by joining the GEM collaboration

  16. Conference on High Energy Physics

    CERN Document Server


    Conference on High Energy Physics (HEP 2016) will be held from August 24 to 26, 2016 in Xi'an, China. This Conference will cover issues on High Energy Physics. It dedicates to creating a stage for exchanging the latest research results and sharing the advanced research methods. HEP 2016 will be an important platform for inspiring international and interdisciplinary exchange at the forefront of High Energy Physics. The Conference will bring together researchers, engineers, technicians and academicians from all over the world, and we cordially invite you to take this opportunity to join us for academic exchange and visit the ancient city of Xi’an.

  17. Future of high energy physics

    International Nuclear Information System (INIS)

    Panofsky, W.K.H.


    A rough overview is given of the expectations for the extension of high energy colliders and accelerators into the xtremely high energy range. It appears likely that the SSC or something like it will be the last gasp of the conventional method of producing high energy proton-proton collisions using synchrotron rings with superconducting magnets. It is likely that LEP will be the highest energy e+e - colliding beam storage ring built. The future beyond that depends on the successful demonstrations of new technologies. The linear collider offers hope in this respect for some extension in energy for electrons, and maybe even for protons, but is too early to judge whether, by how much, or when such an extension will indeed take place

  18. High Energy Transport Code HETC

    International Nuclear Information System (INIS)

    Gabriel, T.A.


    The physics contained in the High Energy Transport Code (HETC), in particular the collision models, are discussed. An application using HETC as part of the CALOR code system is also given. 19 refs., 5 figs., 3 tabs

  19. Research in high energy physics

    International Nuclear Information System (INIS)


    This report discusses research being conducted in high energy physics in the following areas; quantum chromodynamics; drift chambers; proton-antiproton interactions; particle decays; particle production; polarimeters; quark-gluon plasma; and conformed field theory

  20. Computing in high energy physics

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Sarah; Devenish, Robin [Nuclear Physics Laboratory, Oxford University (United Kingdom)


    Computing in high energy physics has changed over the years from being something one did on a slide-rule, through early computers, then a necessary evil to the position today where computers permeate all aspects of the subject from control of the apparatus to theoretical lattice gauge calculations. The state of the art, as well as new trends and hopes, were reflected in this year's 'Computing In High Energy Physics' conference held in the dreamy setting of Oxford's spires. The conference aimed to give a comprehensive overview, entailing a heavy schedule of 35 plenary talks plus 48 contributed papers in two afternoons of parallel sessions. In addition to high energy physics computing, a number of papers were given by experts in computing science, in line with the conference's aim – 'to bring together high energy physicists and computer scientists'.

  1. [Research in high energy physics

    International Nuclear Information System (INIS)


    This report discusses progress in the following research in high energy physics: The crystal ball experiment; delco at PEP; proton decay experiment; MACRO detector; mark III detector; SLD detector; CLEO II detector; and the caltech L3 group

  2. Computing in high energy physics

    International Nuclear Information System (INIS)

    Smith, Sarah; Devenish, Robin


    Computing in high energy physics has changed over the years from being something one did on a slide-rule, through early computers, then a necessary evil to the position today where computers permeate all aspects of the subject from control of the apparatus to theoretical lattice gauge calculations. The state of the art, as well as new trends and hopes, were reflected in this year's 'Computing In High Energy Physics' conference held in the dreamy setting of Oxford's spires. The conference aimed to give a comprehensive overview, entailing a heavy schedule of 35 plenary talks plus 48 contributed papers in two afternoons of parallel sessions. In addition to high energy physics computing, a number of papers were given by experts in computing science, in line with the conference's aim – 'to bring together high energy physicists and computer scientists'

  3. Problems of high energy physics

    International Nuclear Information System (INIS)

    Kadyshevskij, V.G.


    Some problems of high energy physics are discussed. The main attention is paid to describibg the standard model. The model comprises quantum chromodynamics and electroweak interaction theory. The problem of CP breaking is considered as well. 8 refs.; 1 tab

  4. Developments in high energy theory

    Indian Academy of Sciences (India)

    journal of. July 2009 physics pp. 3–60. Developments in high energy theory .... and operated by CERN (European Organization for Nuclear Research), this ma- ...... [2] S Dodelson, Modern cosmology (Academic Press, Amsterdam, 2003).

  5. Research in high energy physics

    International Nuclear Information System (INIS)


    This report discusses research being conducted in high energy physics in the following areas: quantum chromodynamics; drift chambers; proton-antiproton interactions; particle decays; particle production; polarimeters; quark-gluon plasma; and conformed field theory

  6. High Energy Density Laboratory Astrophysics

    CERN Document Server

    Lebedev, Sergey V


    During the past decade, research teams around the world have developed astrophysics-relevant research utilizing high energy-density facilities such as intense lasers and z-pinches. Every two years, at the International conference on High Energy Density Laboratory Astrophysics, scientists interested in this emerging field discuss the progress in topics covering: - Stellar evolution, stellar envelopes, opacities, radiation transport - Planetary Interiors, high-pressure EOS, dense plasma atomic physics - Supernovae, gamma-ray bursts, exploding systems, strong shocks, turbulent mixing - Supernova remnants, shock processing, radiative shocks - Astrophysical jets, high-Mach-number flows, magnetized radiative jets, magnetic reconnection - Compact object accretion disks, x-ray photoionized plasmas - Ultrastrong fields, particle acceleration, collisionless shocks. These proceedings cover many of the invited and contributed papers presented at the 6th International Conference on High Energy Density Laboratory Astrophys...

  7. High energy HF pulsed lasers

    International Nuclear Information System (INIS)

    Patterson, E.L.; Gerber, R.A.


    Recent experiments show that pulsed HF lasers are capable of producing high energy with good efficiency. Preliminary experiments show that the laser radiation from the high-gain medium can be controlled with a low-power probe laser beam or with low-level feedback. These results indicate that the HF laser may have potential for second-generation laser fusion experiments

  8. Assessing high wind energy penetration

    DEFF Research Database (Denmark)

    Tande, J.O.


    In order to convincingly promote installing wind power capacity as a substantial part of the energy supply system, a set of careful analyses must be undertaken. This paper applies a case study concentrated on assessing the cost/benefit of high wind energy penetration. The case study considers...... expanding the grid connected wind power capacity in Praia, the capital of Cape Verde. The currently installed 1 MW of wind power is estimated to supply close to 10% of the electric energy consumption in 1996. Increasing the wind energy penetration to a higher level is considered viable as the project...... with the existing wind power, supply over 30% of the electric consumption in 1996. Applying the recommended practices for estimating the cost of wind energy, the life-cycle cost of this 2.4 MW investment is estimated at a 7% discount rate and a 20 year lifetime to 0.26 DKK/kW h....

  9. High energy proton PIXE [HEPP

    International Nuclear Information System (INIS)

    McKee, J.S.C.


    Studies of particle induced X-ray emission (PIXE) have been widespread and detailed in recent years and despite the fact that most data obtained are from low energy 1-3 MeV experiments, the value of higher energy proton work with its emphasis on K X-ray emission has become more marked as time has progressed. The purpose of this review paper is to outline the history of analysis using high energy protons and to compare and contrast the results obtained with those from lower energy analysis using more firmly established analytical techniques. The work described will concentrate exclusively on proton induced processes and will attempt to outline the rationale for selecting an energy, greater than 20 and up to 70 MeV protons for initiating particles. The relative ease and accuracy of the measurements obtained will be addressed. Clearly such X-ray studies should be seen as complementing low energy work in many instances rather than competing directly with them. However, it will be demonstrated that above a Z value of approximately 20, K X-ray analysis using high energy protons is the only way to go in this type of analysis. (author)

  10. High energy elastic hadron scattering

    International Nuclear Information System (INIS)

    Fearnly, T.A.


    The paper deals with the WA7 experiment at the CERN super proton synchrotron (SPS). The elastic differential cross sections of pion-proton, kaon-proton, antiproton-proton, and proton-proton at lower SPS energies over a wide range of momentum transfer were measured. Some theoretical models in the light of the experimental results are reviewed, and a comprehensive impact parameter analysis of antiproton-proton elastic scattering over a wide energy range is presented. A nucleon valence core model for high energy proton-proton and antiproton-proton elastic scattering is described

  11. High Energy Physics Departments - Overview

    International Nuclear Information System (INIS)

    Bartke, J.


    Following the tradition, the activities of the seven new units created in 1997 on the basis of the former Department of High Energy Physics are presented under a common header, they are: Department of Particle Theory (Dept 5); Department of Leptonic Interactions (Dept 11); Department of Hadron Structure (Dept 12); Department of High Energy Nuclear Interactions (Dept 13); The ALICE Experiment Laboratory (NAL); The ATLAS Experiment Laboratory (NAT); High Energy Physics Detector Construction Group (PBD). The research covers a variety of problems of the experimental and theoretical high energy particle physics: the hadronic and leptonic interactions with nucleons and nuclei (characteristics of particle production, including heavy quark physics), e + e - interactions and tests of the Standard Model (also radiative corrections), ultrarelativistic heavy ion interactions and search for the quark-gluon plasma, as well as the spectra, composition and interactions of high energy cosmic ray particles. Research on detectors and accelerator components as well as the development of the apparatus for the high energy physics experiments at future accelerators: LHC (CERN, Geneva), RHIC (Brookhaven), B-Factory (KEK, Tsukuba) and TESLA (DESY) is also presented. The technology of new materials with unique properties such as carbon-carbon composites is also worked on from the point of view of their application in high energy physics experiments. The Division is located in a separate building on the campus of the University of Mining and Metallurgy (UMM). This location, close to the Jagiellonian University (JU), facilitates the collaboration with the latter and with the UMM. The joint weekly seminars carried out for nearly 40 years prove this long term tradition. A substantial part of the activities is teaching and training students from the academic community in Cracow. Joint research, teaching and academic training in the high energy physics are carried out within the M. Miesowicz

  12. Strong interactions at high energy

    International Nuclear Information System (INIS)

    Anselmino, M.


    Spin effects in strong interaction high energy processes are subtle phenomena which involve both short and long distance physics and test perturbative and non perturbative aspects of QCD. Moreover, depending on quantities like interferences between different amplitudes and relative phases, spin observables always test a theory at a fundamental quantum mechanical level; it is then no surprise that spin data are often difficult to accommodate within the existing models. A report is made on the main issues and contributions discussed in the parallel Session on the open-quote open-quote Strong interactions at high energy close-quote close-quote in this Conference. copyright 1995 American Institute of Physics

  13. High energy astrophysics. An introduction

    Energy Technology Data Exchange (ETDEWEB)

    Courvoisier, Thierry J.L. [Geneva Univ., Versoix (Switzerland). ISDC, Data Centre for Astrophysics


    Based on observational examples this book reveals and explains high-energy astrophysical processes. Presents the theory of astrophysical processes in a didactic approach by deriving equations step by step. With several attractive astronomical pictures. High-energy astrophysics has unveiled a Universe very different from that only known from optical observations. It has revealed many types of objects in which typical variability timescales are as short as years, months, days, and hours (in quasars, X-ray binaries, and other objects), and even down to milli-seconds in gamma ray bursts. The sources of energy that are encountered are only very seldom nuclear fusion, and most of the time gravitation, a paradox when one thinks that gravitation is, by many orders of magnitude, the weakest of the fundamental interactions. The understanding of these objects' physical conditions and the processes revealed by high-energy astrophysics in the last decades is nowadays part of astrophysicists' culture, even of those active in other domains of astronomy. This book evolved from lectures given to master and PhD students at the University of Geneva since the early 1990s. It aims at providing astronomers and physicists intending to be active in high-energy astrophysics a broad basis on which they should be able to build the more specific knowledge they will need. While in the first part of the book the physical processes are described and derived in detail, the second part studies astrophysical objects in which high-energy astrophysics plays a crucial role. This two-pronged approach will help students recognise physical processes by their observational signatures in contexts that may differ widely from those presented here.

  14. High-energy atomic physics

    CERN Document Server

    Drukarev, Evgeny G


    This self-contained text introduces readers to the field of high-energy atomic physics - a new regime of photon-atom interactions in which the photon energies significantly exceed the atomic or molecular binding energies, and which opened up with the recent advent of new synchrotron sources. From a theoretical point of view, a small-parameter characteristic of the bound system emerged, making it possible to perform analytic perturbative calculations that can in turn serve as benchmarks for more powerful numerical computations. The first part of the book introduces readers to the foundations of this new regime and its theoretical treatment. In particular, the validity of the small-parameter perturbation expansion and of the lowest-order approximation is critically reviewed. The following chapters then apply these insights to various atomic processes, such as photoionization as a many-body problem, dominant mechanisms for the production of ions at higher energies, Compton scattering and ionization accompanied b...

  15. Multiprocessors for high energy physics

    International Nuclear Information System (INIS)

    Pohl, M.


    I review the role, status and progress of multiprocessor projects relevant to high energy physics. A short overview of the large variety of multiprocessors architectures is given, with special emphasis on machines suitable for experimental data reconstruction. A lot of progress has been made in the attempt to make the use of multiprocessors less painful by creating a ''Parallel Programming Environment'' supporting the non-expert user. A high degree of usability has been reached for coarse grain (event level) parallelism. The program development tools available on various systems (subroutine packages, preprocessors and parallelizing compilers) are discussed in some detail. Tools for execution control and debugging are also developing, thus opening the path from dedicated systems for large scale, stable production towards support of a more general job mix. At medium term, multiprocessors will thus cover a growing fraction of the typical high energy physics computing task. (orig.)

  16. High energy astrophysics an introduction

    CERN Document Server

    Courvoisier, Thierry J -L


    High-energy astrophysics has unveiled a Universe very different from that only known from optical observations. It has revealed many types of objects in which typical variability timescales are as short as years, months, days, and hours (in quasars, X-ray binaries, and other objects), and even down to milli-seconds in gamma ray bursts. The sources of energy that are encountered are only very seldom nuclear fusion, and most of the time gravitation, a paradox when one thinks that gravitation is, by many orders of magnitude, the weakest of the fundamental interactions. The understanding of these objects' physical conditions and the processes revealed by high-energy astrophysics in the last decades is nowadays part of astrophysicists' culture, even of those active in other domains of astronomy. This book evolved from lectures given to master and PhD students at the University of Geneva since the early 1990s. It aims at providing astronomers and physicists intending to be active in high-energy astrophysics a broad...

  17. Instrumentation in high energy physics

    International Nuclear Information System (INIS)

    Serin, L.


    The instrumentation in high energy physics is a wide and advanced domain which cannot be covered in a single lesson. The main basic physics processes for charged and neutral particles are recalled with the definition of a few concepts needed to understand or design a detector. The application of these principles to charged particle measurement devices (momentum), light detection or energy measurement are presented mostly with examples from collider experiments. The particle identification which is often the combination of different techniques in a same experiment is also discussed. Finally in a very short section, a few considerations about electronics/processing with their impact on the detector performance are given

  18. Computing in high energy physics

    International Nuclear Information System (INIS)

    Hertzberger, L.O.; Hoogland, W.


    This book deals with advanced computing applications in physics, and in particular in high energy physics environments. The main subjects covered are networking; vector and parallel processing; and embedded systems. Also examined are topics such as operating systems, future computer architectures and commercial computer products. The book presents solutions that are foreseen as coping, in the future, with computing problems in experimental and theoretical High Energy Physics. In the experimental environment the large amounts of data to be processed offer special problems on-line as well as off-line. For on-line data reduction, embedded special purpose computers, which are often used for trigger applications are applied. For off-line processing, parallel computers such as emulator farms and the cosmic cube may be employed. The analysis of these topics is therefore a main feature of this volume

  19. Harvard University High Energy Physics

    International Nuclear Information System (INIS)


    The mainly experimental research program in high energy physics at Harvard is summarized in a descriptive fashion according to the following outline: Proton endash antiproton colliding beam program at Fermilab -- CDF (forward/backward electromagnetic calorimeters -- FEM, central muon extension -- CMX, gas calorimetry and electronics development, front-end electronics upgrades, software development, physics analysis, timetable), electron -- positron collisions in the upsilon region -- CLEO (the hardware projects including CLEO II barrel TOF system and silicon drift detector R ampersand D, physics analysis), search for ν μ to ν τ oscillations with the NOMAD experiment at CERN, the solenoidal detector collaboration at the SSC, muon scattering at FNAL -- E665, the L3 experiment, and phenomenological analysis of high-energy bar pp cross sections. 149 refs

  20. A high energy physics perspective

    International Nuclear Information System (INIS)

    Marciano, W.J.


    The status of the Standard model and role of symmetry in its development are reviewed. Some outstanding problems are surveyed and possible solutions in the form of additional open-quotes Hidden Symmetries close quotes are discussed. Experimental approaches to uncover open-quotes New Physicsclose quotes associated with those symmetries are described with emphasis on high energy colliders. An outlook for the future is given

  1. [Research in high energy physics

    International Nuclear Information System (INIS)

    LoSecco, J.


    We review the efforts of the Notre Dame non accelerator high energy physics group. Our major effort has been directed toward the IMB deep underground detector. Since the departure of the Michigan group our responsibilities to the group have grown. We are also very active in pursuing physics with the IMB 3 detector. Currently we are studying proton decay, point neutrino sources and neutrino oscillations with the contained event sample

  2. Cosmology for high energy physicists

    International Nuclear Information System (INIS)

    Albrecht, A.


    The standard big bang model of cosmology is presented. Although not perfect, its many successes make it a good starting point for most discussions of cosmology. Places are indicated where well understood laboratory physics is incorporated into the big bang, leading to successful predictions. Much less established aspects of high energy physics and some of the new ideas they have introduced into the field of cosmology are discussed, such as string theory, inflation and monopoles. 49 refs., 5 figs

  3. High Energy Physics in Europe

    International Nuclear Information System (INIS)



    A thorough survey of the present and possible future activities and resources in high energy physics in the CERN Member States has been carried out by a Working Group of ECFA (European Committee for Future Accelerators) under the Chairmanship of John Mulvey. The aim has been to obtain a view of the present European scene and to see whether it looks well adapted to the effective exploitation of possible future machines in Europe (particular LEP) and the rest of the world

  4. High energy electron positron physics

    International Nuclear Information System (INIS)

    Ali, A.; Soding, P.


    With the termination of the physics program at PETRA in a year from now, and with the start of TRISTAN and the SLC and later LEP, an era of e/sup +/e/sup -/ physics will come to an end and a new one begins. The field is changing from a field of a few specialists, to becoming one of the mainstream efforts of the high energy community. It seems appropriate at this moment to summarize what has been learned over the past years, in a way more useful to any high energy physicist in particular to newcomers in the e/sup +/e/sup -/ field. This is the purpose of the book. This book should be used as a reference for future workers in the field of e/sup +/e/sup -/ interactions. It includes the most relevant data, parametrizations, theoretical background, and a chapter on detectors. Contents: Foreword; Detectors for High Energy e/sup +/e/sup -/ Physics; Lepton Pair Production and Electroweak Parameters; Hadron Production, Strong and Electroweak Properties; tau Physics; Recent Results on the Charm Sector; Bottom Physics; Lifetime Measurements of tau, Charmed and Beauty Hadrons; Υ Spectroscopy; Hadronic Decays of the Υ; Quark and Gluon Fragmentation in the e/sup +/e/sup -/ Continuum; Jet Production and QCD; Two Photon Physics; Search for New Particles

  5. Astrophysics at very high energies

    International Nuclear Information System (INIS)

    Aharonian, Felix; Bergstroem, Lars; Dermer, Charles


    Presents three complementary lectures on very-high-energy astrophysics given by worldwide leaders in the field. Reviews the recent advances in and prospects of gamma-ray astrophysics and of multi-messenger astronomy. Prepares readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors. With the success of Cherenkov Astronomy and more recently with the launch of NASA's Fermi mission, very-high-energy astrophysics has undergone a revolution in the last years. This book provides three comprehensive and up-to-date reviews of the recent advances in gamma-ray astrophysics and of multi-messenger astronomy. Felix Aharonian and Charles Dermer address our current knowledge on the sources of GeV and TeV photons, gleaned from the precise measurements made by the new instrumentation. Lars Bergstroem presents the challenges and prospects of astro-particle physics with a particular emphasis on the detection of dark matter candidates. The topics covered by the 40th Saas-Fee Course present the capabilities of current instrumentation and the physics at play in sources of very-high-energy radiation to students and researchers alike. This book will encourage and prepare readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors.

  6. High Energy Physics Departments - Overview

    International Nuclear Information System (INIS)

    Bartke, J.


    Full text: Following our long-time tradition we will present under a common header the activities of the seven new units created in 1997 on the basis of the former Department of High Energy Physics: Department of Particle Theory (Dept. V); Department of Leptonic Interactions (Dept XI); Department of Hadron Structure (Dept XII); Department of High Energy Nuclear Interactions (Dept XIII); The ALICE Experiment Laboratory (NAL); The ATLAS Experiment Laboratory (NAT); High Energy Physics Detector Construction Group (PBD). At the end we will list our common activities: lectures and courses as well as seminars. Our research covers a variety of problems of the experimental and theoretical high energy particle physics: the hadronic and leptonic interactions with nucleons and nuclei (characteristics of particle production, including heavy quark physics), e + e - interactions and tests of the Standard Model (also evaluation of radiative corrections), ultrarelativistic heavy ion interactions and search for the quark-gluon plasma, as well as the spectra, composition and interactions of high energy cosmic ray particles. Research on detectors and accelerator components as well as the development of the apparatus for the high energy physics experiments at future accelerators: LHC (CERN, Geneva), RHIC (Brookhaven), B-Factory (KEK, Tsukuba) and TESLA (DESY, Hamburg) is also carried out. The technology of new materials with unique properties such as carbon-carbon composites is also worked on from the point of view of their application in high energy physics experiments. The Division is located in a separate building on the campus of the University of Mining and Metallurgy. This location, close to the Jagiellonian University, facilitates the collaboration with the latter and with the University of Mining and Metallurgy. The joint weekly seminars carried out for nearly 40 years prove this long term tradition. A substantial part of our activities is teaching and training students from

  7. Quantum chromodynamics at high energy

    CERN Document Server

    Kovchegov, Yuri V


    Filling a gap in the current literature, this book is the first entirely dedicated to high energy QCD including parton saturation. It presents groundbreaking progress on the subject and describes many of the problems at the forefront of research, bringing postgraduate students, theorists and advanced experimentalists up to date with the current status of the field. A broad range of topics in high energy QCD are covered, most notably on the physics of parton saturation and the Color Glass Condensate (CGC). The material is presented in a pedagogical way, with numerous examples and exercises. Discussion ranges from the quasi-classical McLerran–Venugopalan model to the linear and non-linear BFKL/BK/JIMWLK small-x evolution equations. The authors adopt both a theoretical and experimental outlook and present the physics of strong interactions in a universal way, making it useful to physicists from various sub-communities and applicable to processes studied at high energy accelerators around the world.

  8. High energy overcurrent protective device (United States)

    Praeg, Walter F.


    Electrical loads connected to capacitance elements in high voltage direct current systems are protected from damage by capacitance discharge overcurrents by connecting between the capacitance element and the load, a longitudinal inductor comprising a bifilar winding wound about a magnetic core, which forms an incomplete magnetic circuit. A diode is connected across a portion of the bifilar winding which conducts a unidirectional current only. Energy discharged from the capacitance element is stored in the inductor and then dissipated in an L-R circuit including the diode and the coil winding. Multiple high voltage circuits having capacitance elements may be connected to loads through bifilar windings all wound about the aforementioned magnetic core.

  9. Photoproduction at high energy and high intensity

    CERN Multimedia


    The photon beam used for this programme is tagged and provides a large flux up to very high energies (150-200 GeV). It is also hadron-free, since it is obtained by a two-step conversion method. A spectrometer is designed to exploit this beam and to perform a programme of photoproduction with a high level of sensitivity (5-50 events/picobarn).\\\\ \\\\ Priority will be given to the study of processes exhibiting the point-like behaviour of the photon, especially deep inelastic Compton scattering. The spectrometer has two magnets. Charged tracks are measured by MWPC's located only in field-free regions. Three calorimeters provide a large coverage for identifying and measuring electrons and photons. An iron filter downstream identifies muons. Most of the equipment is existing and recuperated from previous experiments.

  10. IV. Workshop on High Energy Spin Physics

    International Nuclear Information System (INIS)

    Nurushev, S.


    In this proceedings the results on high energy spin physics are summarized. The theory of spin phenomenon and the experimental results at intermediate energy and at high energy spin physics and new technical developments in polarization experiments are presented

  11. Developments in high energy physics

    International Nuclear Information System (INIS)

    Mukhi, Sunil; Roy, Probir


    This non-technical review article is aimed at readers with some physics background, including beginning research students. It provides a panoramic view of the main theoretical developments in high energy physics since its inception more than half a century ago, a period in which experiments have spanned an enormous range of energies, theories have been developed leading up to the standard model, and proposals - including the radical paradigm of string theory - have been made to go beyond the standard model. The list of references provided here is not intended to properly credit all original work but rather to supply the reader with a few pointers to the literature, specifically highlighting work done by Indian authors. (author)

  12. Assessing high wind energy penetration

    International Nuclear Information System (INIS)

    Tande, J.O.


    In order to convincingly promote installing wind power capacity as a substantial part of the energy supply system, a set of careful analyses must be undertaken. This paper applies a case study concentrated on assessing the cost/benefit of high wind energy penetration. The case study considers expanding the grid connected wind power capacity in Praia, the capital of Cape Verde. The currently installed 1 MW of wind power is estimated to supply close to 10% of the electric energy consumption in 1996. Increasing the wind energy penetration to a higher level is considered viable as the project settings are close to ideal, including a very capable national utility company, Electra, a conventional power supply system based on imported heavy fuel and gas oil, and favourable wind conditions with an estimated annual average of 9.3 m/s at the hub height of the wind turbines. With the applied case study assumptions, simulations with WINSYS over the lifetime of the assessed wind power investment show that investments up to 4.2 MW are economically viable. The economic optimum is found at 2.4 MW reaching an internal rate of return of almost 8% p.a. This 2.4 MW of wind power would, together with the existing wind power, supply over 30% of the electric consumption in 1996. Applying the recommended practices for estimating the cost of wind energy, the life-cycle cost of this 2.4 MW investment is estimated at a 7% discount rate and a 20 year lifetime to 0.26 DKK/kW h. (Author)

  13. Energy Systems High-Pressure Test Laboratory | Energy Systems Integration (United States)

    Facility | NREL Energy Systems High-Pressure Test Laboratory Energy Systems High-Pressure Test Laboratory In the Energy Systems Integration Facility's High-Pressure Test Laboratory, researchers can safely test high-pressure hydrogen components. Photo of researchers running an experiment with a hydrogen fuel

  14. Duke University high energy physics

    International Nuclear Information System (INIS)

    Fortney, L.R.; Goshaw, A.T.; Walker, W.D.


    This Progress Report presents a review of the research done in 1992 by the Duke High Energy Physics Group. This is the first year of a three-year grant which was approved by the Office of High Energy Physics at DOE after an external review of our research program during the summer of 1991. Our research is centered at Fermilab where we are involved with two active experiments, one using the Tevatron collider (CDF, the Collider Detector Facility) and the other using a proton beam in the high intensity laboratory (E771, study of beauty production). In addition to these running experiments we are continuing the analysis of data from experiments E735 (collider search for a quark-gluon plasma), E705 (fixed target study of direct photon and Χ meson production) and E597 (particle production from hadron-nucleus collisions). Finally, this year has seen an expansion of our involvement with the design of the central tracking detector for the Solenoidal Detector Collaboration (SDC) and an increased role in the governance of the collaboration. Descriptions of these research activities are presented in this report

  15. The high energy astronomy observatories (United States)

    Neighbors, A. K.; Doolittle, R. F.; Halpers, R. E.


    The forthcoming NASA project of orbiting High Energy Astronomy Observatories (HEAO's) designed to probe the universe by tracing celestial radiations and particles is outlined. Solutions to engineering problems concerning HEAO's which are integrated, yet built to function independently are discussed, including the onboard digital processor, mirror assembly and the thermal shield. The principle of maximal efficiency with minimal cost and the potential capability of the project to provide explanations to black holes, pulsars and gamma-ray bursts are also stressed. The first satellite is scheduled for launch in April 1977.

  16. Weak interactions at high energies

    International Nuclear Information System (INIS)

    Ellis, J.


    Review lectures are presented on the phenomenological implications of the modern spontaneously broken gauge theories of the weak and electromagnetic interactions, and some observations are made about which high energy experiments probe what aspects of gauge theories. Basic quantum chromodynamics phenomenology is covered including momentum dependent effective quark distributions, the transverse momentum cutoff, search for gluons as sources of hadron jets, the status and prospects for the spectroscopy of fundamental fermions and how fermions may be used to probe aspects of the weak and electromagnetic gauge theory, studies of intermediate vector bosons, and miscellaneous possibilities suggested by gauge theories from the Higgs bosons to speculations about proton decay. 187 references

  17. High temperature thermoelectric energy conversion

    International Nuclear Information System (INIS)

    Wood, C.


    Considerable advances were made in the late '50's and early early '60's in the theory and development of materials for high-temperature thermoelectric energy conversion. This early work culminated in a variety of materials, spanning a range of temperatures, with the product of the figure of merit, Z, and temperature, T, i.e., the dimensionless figure of merit, ZT, of the order of one. This experimental limitation appeared to be universal and led a number of investigators to explore the possibility that a ZT - also represents a theoretical limitation. It was found not to be so

  18. High energy beam manufacturing technologies

    International Nuclear Information System (INIS)

    Geskin, E.S.; Leu, M.C.


    Technological progress continues to enable us to utilize ever widening ranges of physical and chemical conditions for material processing. The increasing cost of energy, raw materials and environmental control make implementation of advanced technologies inevitable. One of the principal avenues in the development of material processing is the increase of the intensity, accuracy, flexibility and stability of energy flow to the processing site. The use of different forms of energy beams is an effective way to meet these sometimes incompatible requirements. The first important technological applications of high energy beams were welding and flame cutting. Subsequently a number of different kinds of beams have been used to solve different problems of part geometry control and improvement of surface characteristics. Properties and applications of different specific beams were subjects of a number of fundamental studies. It is important now to develop a generic theory of beam based manufacturing. The creation of a theory dealing with general principles of beam generation and beam-material interaction will enhance manufacturing science as well as practice. For example, such a theory will provide a format approach for selection and integration of different kinds of beams for a particular application. And obviously, this theory will enable us to integrate the knowledge bases of different manufacturing technologies. The War of the Worlds by H. G. Wells, as well as a number of more technical, although less exciting, publications demonstrate both the feasibility and effectiveness of the generic approach to the description of beam oriented technology. Without any attempt to compete with Wells, we still hope that this volume will contribute to the creation of the theory of beam oriented manufacturing

  19. High energy polarized electron beams

    International Nuclear Information System (INIS)

    Rossmanith, R.


    In nearly all high energy electron storage rings the effect of beam polarization by synchrotron radiation has been measured. The buildup time for polarization in storage rings is of the order of 10 6 to 10 7 revolutions; the spins must remain aligned over this time in order to avoid depolarization. Even extremely small spin deviations per revolution can add up and cause depolarization. The injection and the acceleration of polarized electrons in linacs is much easier. Although some improvements are still necessary, reliable polarized electron sources with sufficiently high intensity and polarization are available. With the linac-type machines SLC at Stanford and CEBAF in Virginia, experiments with polarized electrons will be possible

  20. Duke University High Energy Physics

    International Nuclear Information System (INIS)

    Fortney, L.R.; Goshaw, A.T.; Walker, W.D.


    The research program of the Duke High Energy Physics Group is described in this Progress Report and a separate Proposal containing their plans for 1994. These two documents are supplemented by compilations of selected publications, thesis abstracts, and the curriculum vitae of the eleven Ph.D. physicists who are carrying out this research program. This Progress Report contains a review of the research which has been done over the first half (1992 and 1993 to date) of the current three-year DOE grant, plus some earlier research to establish a broader perspective of the research interests. High energy physics research at Duke has three components. The first, Task A, is based upon experiments carried out at Fermilab's Tevatron Collider. The group is finishing the analysis of data from their first collider experiment (E735), a study of inclusive particle production from bar p p collisions at √ bar s = 1.8 TeV. The second component of the research, Task B, deals primarily with heavy flavor physics. The third part of the research program, Task D, deals with preparation for research at the SSC. The authors have been active in the development of tracking detectors for the SSC since 1989, and are now concentrating on the design and construction of straw tube drift chambers for the solenoid detector

  1. Spinoff from high energy physics

    International Nuclear Information System (INIS)

    Hoffmann, Hans


    This year the CERN Courier is featuring the spinoff and technological benefits arising from research in fundamental physics. After initial illustrations in applied data processing sectors, this article by Hans Hoffman of CERN examines the rationale and underlying objectives of the 'new awareness' of the market value of basic science. He is the Chairman of a new panel on the subject set up recently by the International Committee for Future Accelerators (ICFA). The other members are: Oscar Barbalat of CERN, Hans Christian Dehne of DESY, Sin-ichi Kurakawa of KEK, Gennady Kulipanov of the Budker Institute (Novosibirsk), Anthony Montgomery, formerly of the SSC, A. H. Walenta of Siegen, Germany, and Zhongqiang Yu of IHEP Beijing. High energy physics - the quest to find and understand the structure of matter - is mainly seen as an essential part of human culture. However this basic science increasingly has to jostle for funding attention with other branches of science. Applied sciences aim for a rapid transformation of investment cash into viable market products. In times of economic difficulties this is attractive to funding agencies and governments, and economic usefulness and technological relevance also become criteria for a basic science like high energy physics.

  2. High energy physics and cosmology

    International Nuclear Information System (INIS)

    Silk, J.I.


    This research will focus on the implications of recent theories and experiments in high energy physics of the evolution of the early universe, and on the constraints that cosmological considerations can place on such theories. Several problems are under investigation, including studies of the nature of dark matter and the signature of annihilations in the galactic halo, where the resulting γ-ray fluxes are potentially observable, and in stars, where stellar evolution may be affects. We will develop constraints on the inflationary predictions of scale-free primordial fluctuations in a universe at critical closure density by studying their linear and non-linear evolution after they re-enter the particle horizon, examining the observable imprint of primordial density fluctuations on the cosmic microwave background radiation in both flat and curved cosmological models, and implications for observations of large-scale galaxy clustering and structure formation theories. We will also study spectral distortions in the microwave background radiation that are produced by exotic particle decays in the very early universe. We expect such astrophysical considerations to provide fruitful insights both into high-energy particle physics and into possible cosmological for the early universe

  3. Experimental High Energy Physics Research

    Energy Technology Data Exchange (ETDEWEB)

    Hohlmann, Marcus [Florida Inst. of Technology, Melbourne, FL (United States). Dept. of Physics and Space Sciences


    This final report summarizes activities of the Florida Tech High Energy Physics group supported by DOE under grant #DE-SC0008024 during the period June 2012 – March 2015. We focused on one of the main HEP research thrusts at the Energy Frontier by participating in the CMS experiment. We were exploiting the tremendous physics opportunities at the Large Hadron Collider (LHC) and prepared for physics at its planned extension, the High-Luminosity LHC. The effort comprised a physics component with analysis of data from the first LHC run and contributions to the CMS Phase-2 upgrades in the muon endcap system (EMU) for the High-Luminosity LHC. The emphasis of our hardware work was the development of large-area Gas Electron Multipliers (GEMs) for the CMS forward muon upgrade. We built a production and testing site for such detectors at Florida Tech to complement future chamber production at CERN. The first full-scale CMS GE1/1 chamber prototype ever built outside of CERN was constructed at Florida Tech in summer 2013. We conducted two beam tests with GEM prototype chambers at CERN in 2012 and at FNAL in 2013 and reported the results at conferences and in publications. Principal Investigator Hohlmann served as chair of the collaboration board of the CMS GEM collaboration and as co-coordinator of the GEM detector working group. He edited and authored sections of the detector chapter of the Technical Design Report (TDR) for the GEM muon upgrade, which was approved by the LHCC and the CERN Research Board in 2015. During the course of the TDR approval process, the GEM project was also established as an official subsystem of the muon system by the CMS muon institution board. On the physics side, graduate student Kalakhety performed a Z' search in the dimuon channel with the 2011 and 2012 CMS datasets that utilized 20.6 fb⁻¹ of p-p collisions at √s = 8 TeV. For the dimuon channel alone, the 95% CL lower limits obtained on the mass of a Z' resonance are 2770 Ge

  4. Dynamics of high energy reactions

    International Nuclear Information System (INIS)

    Field, R.D.


    During last several years, a new framework to describe strong interaction physics has emerged, i.e. quantum chromodynamics (QCD). It is the simplest field theory which incorporates color-dependent force among quarks. This force is generated by the exchange of colored vector gluons coupled to the quarks in gauge-invariant manner. The theory is closely related to the most successful quantum field theory, QED, and the only but very important difference is the gauge group involved. Although the theory is well defined, precisely what it predicts is not yet clearly known. However, at very high energy or momentum transfer Q, the effective coupling between quarks and gluons decreases toward zero with increasing Q 2 , and the calculation of a process involving high Q 2 is possible by the use of perturbation theory. In this paper, many applications of QCD to the processes involving high momentum transfer are examined. The effective coupling resulting from strong interaction between quarks and gluons, the scale violation in deep inelastic lepton scattering, large mass muon pair production, quark and gluon fragmentation functions, large transverse momentum meson and jet production in hadron-hadron collision, and the search for three-jet events are discussed. (Kako, I.)

  5. High-energy particle diffraction

    International Nuclear Information System (INIS)

    Barone, V.; Predazzi, E.


    This monograph gives a comprehensive and up-to-date overview of soft and hard diffraction processes in strong interaction physics. The first part covers the general formalism (the optical analogy, the eikonal picture, high-energy kinematics, S-matrix theory) and soft hadron-hadron scattering (including the Regge theory) in a complete and mature presentation. It can be used as a textbook in particle physics classes. The remainder of the book is devoted to the 'new diffraction': the pomeron in QCD, low-x physics, diffractive deep inelastic scattering and related processes, jet production etc. It presents recent results and experimental findings and their phenomenological interpretations. This part addresses graduate students as well as researchers. (orig.)

  6. Diffraction of high energy electrons

    International Nuclear Information System (INIS)

    Bourret, A.


    The diffraction of electrons by a crystal is examined to study its structure. As the electron-substance interaction is strong, it must be treated in a dynamic manner. Using the N waves theory and physical optics the base equations giving the wave at the outlet are deduced for a perfect crystal and their equivalence is shown. The more complex case of an imperfect crystal is then envisaged in these two approaches. In both cases, only the diffraction of high energy electrons ( > 50 KeV) are considered since in the diffraction of slow electrons back scattering cannot be ignored. Taking into account an increasingly greater number of beams, through fast calculations computer techniques, enables images to be simulated in very varied conditions. The general use of the Fast Fourier Transform has given a clear cut practical advantage to the multi-layer method [fr

  7. Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field

    Energy Technology Data Exchange (ETDEWEB)

    Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE


    The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.

  8. Caging in high energy reactions

    International Nuclear Information System (INIS)

    Ache, H.J.


    The concept of caging high energy reactions is considered. It is noted that there is no easy and unambiguous way, short of a complete and very tedious product and mechanistic analysis, which is feasible only for very few systems, to determine the contribution made by caging. It is emphasized that some products resulting from the hot reaction with a certain substrate may be formed via caging while others are not. In research on the mechanism of caging the results of Roots work on the reactions of hot 18 F with the CF 3 CH 3 system seem to provide evidence for caging, with 18 F being the caged moiety, thus proceeding via a radical--radical recombination mechanism. Their work with H 2 S additive also seems to indicate that scavenging via hydrogen abstraction from H 2 S to form does not interfere with the radical--radical recombination consistent with Bunkers molecular approach to explain the cage effects. In other research a series of observations resulting from stereochemical and combined stereochemical density variation techniques seem to favor a caged-complex. It is clear that a more conclusive answer can only be reached by more systematic studies, utilizing the whole range of nuclear reactions such as (n,2n), (n,γ) and E.C. processes in mechanistically well defined systems to elucidate the effect of variations in the recoil energies, by carrying out studies in different solvents or host substances to assess the effect of the physical parameters, such as molecule size and intermolecular interactions on the escape probability or caging efficiencies

  9. High energy physics and cosmology

    International Nuclear Information System (INIS)

    Silk, J.I.; Davis, M.


    This research will focus on the implications of recent theories and experiments in high energy physics for the evolution of the early Universe, and on the constraints that cosmological considerations can place on such theories. Several problems are under investigation, including the development of constraints on the inflationary predictions of scale--free primordial fluctuations in a universe at critical closure density by studying their linear and non-linear evolution after they re-enter the particle horizon. We will examine the observable imprint of primordial density fluctuations on the cosmic microwave background radiation curved cosmological models. Most astronomical evidence points to an open universe: one of our goals is to reconcile this conclusion with the particle physics input. We will investigate the response of the matter distribution to a network of cosmic strings produced during an early symmetry-breaking transition, and compute the resulting cosmic microwave background anisotropies. We will simulate the formation of large-scale structures whose dynamics are dominated by weakly interacting particles such as axions, massive neutrinos or photinos in order to model the formation of galaxies, galaxy clusters and superclusters. We will study of the distortions in the microwave background radiation, both spectral and angular, that are produced by ionized gas associated with forming clusters and groups of galaxies. We will also study constraints on exotic cooling mechanisms involving axions and majorons set by stellar evolution and the energy input into low mass stars by cold dark matter annihilation galactic nuclei. We will compute the detailed gamma ray spectrum predicted by various cold dark matter candidates undergoing annihilation in the galactic halo and bulge

  10. [High energy physics and cosmology

    International Nuclear Information System (INIS)

    Silk, J.I.; Davis, M.


    This research will focus on the implications of recent theories and experiments in high energy physics for the evolution of the early Universe, and on the constraints that cosmological considerations can place on such theories. Several problems are under investigation, including the development of constraints on the inflationary predictions of scale-free primordial fluctuations in a universe at critical closure density by studying their linear and non-linear evolution after they re-enter the particle horizon. We will examine the observable imprint of primordial density fluctuations on the cosmic microwave background radiation in curved cosmological models. Most astronomical evidence points to an open universe: one of our goals is to reconcile this conclusion with the particle physics input. We will investigate the response of the matter distribution to a network of cosmic strings produced during an early symmetry--breaking transition, and compute the resulting cosmic microwave background anisotropies. We will simulate the formation of large--scale structures whose dynamics are dominated by weakly interacting particles such as axions massive neutrinos or photinos in order to model the formation of galaxies, galaxy clusters and superclusters. We will study the distortions in the microwave background radiation, both spectral and angular, that are produced by ionized gas associated with forming clusters and groups of galaxies. We will also study constraints on exotic cooling mechanisms involving axions and majorons set by stellar evolution and the energy input into low mass stars by cold dark matter annihilation in galactic nuclei. We will compute the detailed gamma ray spectrum predicted by various cold dark matter candidates undergoing annihilation in the galactic halo and bulge

  11. Quantum Sensing for High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    Ahmed, Zeeshan; et al.


    Report of the first workshop to identify approaches and techniques in the domain of quantum sensing that can be utilized by future High Energy Physics applications to further the scientific goals of High Energy Physics.


    International Nuclear Information System (INIS)

    PARSA, Z.


    In this paper, high energy physics possibilities and future colliders are discussed. The μ + μ - collider and experiments with high intensity muon beams as the stepping phase towards building Higher Energy Muon Colliders (HEMC) are briefly reviewed and encouraged

  13. Lasers and future high energy colliders

    International Nuclear Information System (INIS)

    Parsa, Z.


    Future high energy colliders, directions for particle physics and relationship to new technology such as lasers are discussed. Experimental approaches to explore New Physics with emphasis on the utility of high energy colliders are also discussed

  14. Hadron dynamics at high energies

    International Nuclear Information System (INIS)

    Storrow, J.K.


    The nine lectures give a very brief introduction to hadron dynamics at high energies. They concentrate on basic concepts such as Regge poles, duality and geometrical ideas, and simple applications of these ideas to the problem of understanding data. To some extent two body phenomenology is emphasized at the expense of multiparticle final states and when the latter have been considered they have concentrated on inclusive reactions. One lecture discussed data on 2-2 reactions in order to provide the motivation for Regge pole theory, then two lectures are devoted to basic concepts. Then duality is introduced and shown to provide reasonable restrictions on a pole model. A lecture is then devoted to discussing geometrical ideas i.e. the t-dependence of data is looked at from an s-channel point of view. The section on two-body phenomenology is then concluded by discussing applications of the above ideas to two reactions-pion-nucleon scattering and np charge exchange scattering. The remaining three lectures are devoted to multiparticle reactions. Exclusive reactions are considered briefly and then the remainder of the course is concerned with inclusive reactions. The concepts of scaling and limiting fragmentation are discussed and Mueller's generalised optical theorem introduced and then applied in various kinematic limits. (author)

  15. Superconducting magnets in high energy physics

    International Nuclear Information System (INIS)

    Prodell, A.G.


    The applications of superconducting magnets in high energy physics in the last ten years have made feasible developments which are vital to high energy research. These developments include high magnetic field, large volume detectors, such as bubble chambers, required for effective resolution of high energy particle trajectories, particle beam transport magnets, and superconducting focusing and bending magnets for the very high energy accelerators and storage rings needed to pursue the study of interactions between elementary particles. The acceptance of superconductivity as a proven technology in high energy physics was reinforced by the recognition that the existing large accelerators using copper-iron magnets had reached practical limits in terms of magnetic field intensity, cost, space, and energy usage, and that large-volume, high-field, copper-iron magnets were not economically feasible. Some of the superconducting magnets and associated systems being used in and being developed for high energy physics are described

  16. High energy physics and grid computing

    International Nuclear Information System (INIS)

    Yu Chuansong


    The status of the new generation computing environment of the high energy physics experiments is introduced briefly in this paper. The development of the high energy physics experiments and the new computing requirements by the experiments are presented. The blueprint of the new generation computing environment of the LHC experiments, the history of the Grid computing, the R and D status of the high energy physics grid computing technology, the network bandwidth needed by the high energy physics grid and its development are described. The grid computing research in Chinese high energy physics community is introduced at last. (authors)

  17. High density energy storage capacitor

    International Nuclear Information System (INIS)

    Whitham, K.; Howland, M.M.; Hutzler, J.R.


    The Nova laser system will use 130 MJ of capacitive energy storage and have a peak power capability of 250,000 MW. This capacitor bank is a significant portion of the laser cost and requires a large portion of the physical facilities. In order to reduce the cost and volume required by the bank, the Laser Fusion Program funded contracts with three energy storage capacitor producers: Aerovox, G.E., and Maxwell Laboratories, to develop higher energy density, lower cost energy storage capacitors. This paper describes the designs which resulted from the Aerovox development contract, and specifically addresses the design and initial life testing of a 12.5 kJ, 22 kV capacitor with a density of 4.2 J/in 3 and a projected cost in the range of 5 cents per joule

  18. States of high energy density

    International Nuclear Information System (INIS)

    Murray, M.


    The transverse energy, E/sub tau/ spectra for O 16 and S 32 incident for various elements at 200 GeVnucleon are shown. The target and projectile dependencies of the data are discussed. The energy density achieved is estimated. For O 16 on Tungsten the multiplicity spectrum is also presented as well as the pseudorapidity spectra as a function of the transverse energy. The multiplicity cross section dσdN as measured in the backward hemisphere (0.9 < /eta/ < 2.9/ is found to be very similar in shape to the transverse energy distribution dσdE/tau/ reflecting the particular geometry of nucleus nucleus nucleus collisions. The dependence on the atomic mass of the target, A/sub tau/ and projectile A/sub p/ is not what one would expect from naive considerations

  19. Observations of VHE γ-Ray Sources with the MAGIC Telescope (United States)

    Bartko, H.


    The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.

  20. High energy neutrinos: sources and fluxes

    Energy Technology Data Exchange (ETDEWEB)

    Stanev, Todor [Bartol Research Institute, Department of Physics and Astronomy, University of Delaware, Newark DE 19716 (United States)


    We discuss briefly the potential sources of high energy astrophysical neutrinos and show estimates of the neutrino fluxes that they can produce. A special attention is paid to the connection between the highest energy cosmic rays and astrophysical neutrinos.

  1. Multiplicities in high energy interactions

    International Nuclear Information System (INIS)

    Derrick, M.


    Charged particle multiplicities in hadronic collision have been measured for all energies up to √s = 540 GeV in the center of mass. Similar measurements in e + e - annihilation cover the much smaller range - up to √s = 40 GeV. Data are also available from deep inelastic neutrino scattering up to √s approx. 10 GeV. The experiments measure the mean charged multiplicity , the rapidity density at y = O, and the distributions in prong number. The mean number of photons associated with the events can be used to measure the π 0 and eta 0 multiplicities. Some information is also available on the charged pion, kaon, and nucleon fractions as well as the K 0 and Λ 0 rates and for the higher energy data, the identically equal fraction. We review this data and consider the implications of extrapolations to SSC energies. 13 references

  2. High education and nuclear energy

    International Nuclear Information System (INIS)

    Ghitescu, Petre; Prisecaru, Ilie; Stefanescu, Petre


    The Faculty of Energy of the University 'Politecnica' in Bucharest is the only faculty in Romania in the field of nuclear energy education. With an experience of more than 29 years, the Faculty of Energy offers the major 'Nuclear Power Plants', which students graduate after a 5-year education as engineers in the Nuclear Power Plant major. Among the principal objectives of the development and reshape of the Romanian education system was mentioned the upgrading of organizational forms by introducing the transfer credit system, and starting in the fall '97 by accrediting Radioprotection and Nuclear Safety Master education. As a result of co-operation and assistance offered by TEMPUS-SENECA program, the new major is shaped and endowed with a modern curriculum harmonized with UE and IAEA requirements and a modern and performing laboratory. This way the Romanian higher education offers a fully correct and concordant structure with UE countries education. (authors)

  3. High energy particle accelerators as radiation Sources

    Energy Technology Data Exchange (ETDEWEB)

    Abdelaziz, M E [National Center for Nuclear Safety and Radiation Vontrol, Atomic Energy Authority, Cairo (Egypt)


    Small accelerators in the energy range of few million electron volts are usually used as radiation sources for various applications, like radiotherapy, food irradiation, radiation sterilization and in other industrial applications. High energy accelerators with energies reaching billions of electron volts also find wide field of applications as radiation sources. Synchrotrons with high energy range have unique features as radiation sources. This review presents a synopsis of cyclic accelerators with description of phase stability principle of high energy accelerators with emphasis on synchrotrons. Properties of synchrotron radiation are given together with their applications in basic and applied research. 13 figs.,1 tab.

  4. Moderate energy ions for high energy density physics experiments

    International Nuclear Information System (INIS)

    Grisham, L.R.


    This paper gives the results of a preliminary exploration of whether moderate energy ions (≅0.3-3 MeV/amu) could be useful as modest-cost drivers for high energy density physics experiments. It is found that if the target thickness is chosen so that the ion beam enters and then leaves the target in the vicinity of the peak of the dE/dX (stopping power) curve, high uniformity of energy deposition may be achievable while also maximizing the amount of energy per beam particle deposited within the target

  5. Harvard University High Energy Physics progress report

    International Nuclear Information System (INIS)


    The principal goals of this work are to carry out forefront programs in high energy physics research and to provide first rate educational opportunities for students. The experimental program supported through HEPL is carried out at the major accelerator centers in the world and addresses some of the most important questions in high energy physics. The program is based at Harvard's High Energy Physics Laboratory, which has offices, computing facilities, and engineering support, and both electronics and machine shops

  6. Split School of High Energy Physics 2015

    CERN Document Server


    Split School of High Energy Physics 2015 (SSHEP 2015) was held at the Faculty of Electrical Engineering, Mechanical Engineering and Naval Architecture (FESB), University of Split, from September 14 to September 18, 2015. SSHEP 2015 aimed at master and PhD students who were interested in topics pertaining to High Energy Physics. SSHEP 2015 is the sixth edition of the High Energy Physics School. Previous five editions were held at the Department of Physics, University of Sarajevo, Bosnia and Herzegovina.

  7. High-energy electron diffraction and microscopy

    CERN Document Server

    Peng, L M; Whelan, M J


    This book provides a comprehensive introduction to high energy electron diffraction and elastic and inelastic scattering of high energy electrons, with particular emphasis on applications to modern electron microscopy. Starting from a survey of fundamental phenomena, the authors introduce the most important concepts underlying modern understanding of high energy electron diffraction. Dynamical diffraction in transmission (THEED) and reflection (RHEED) geometries is treated using ageneral matrix theory, where computer programs and worked examples are provided to illustrate the concepts and to f

  8. Particle accelerators and lasers high energy sources

    International Nuclear Information System (INIS)

    Watteau, J.P.


    Particle accelerators and lasers are to-day precious devices for physicist and engineer. Their performance and scope do not stop growing. Producing thin beams of high energy particles or photons, they are able to be very high energy sources which interact strongly with matter. Numerous applications use them: research, industry, communication, medicine, agroalimentary, defence, and soon. In this note, their operation principles are described and some examples of their use as high energy sources are given [fr

  9. Renewable energy at high altitudes

    International Nuclear Information System (INIS)

    Beltramo, R.; Cuzzolin, B.


    Improving environmental performance by paying greater attention to the environment factor is becoming the prime objective of many companies and organizations in general. But not theirs alone. Even the tourism sector is making a number of efforts in this direction. This is the case, for example, of the Regina Margherita Refuge located on Point Gnifetti on the Monte Rosa massif, where a research project called Crest was conducted. This was a study on the feasibility of meeting the refuge's energy sources, that is, by using a photovoltaic or hybrid (wind-based and photovoltaic) energy production system. A plant thus able to exploit the landscape and meteorological characteristics typical of a mountain refuge, saving money and reducing the pollution load [it

  10. High-energy cosmic rays

    CERN Document Server

    Cronin, James Watson


    Recently two cosmic rays with energy in excess of 2 1020 eV have been recorded. These are some 108 times more energetic than the protons produced by accelerators on earth. There is no credible understanding of the mechanism of acceleration by known a Because of the short mean free path in the cosmic background radiation they must come from nearby distances on a cosmological scale (< 50 Mpc). Their magnetic rigidity suggests that they should point to their source. Lectures will cover the present available data on the highest energy cosmic rays, their detection, possible acceleration mechanisms, their propagation in the galaxy and in extra galactic space and design of new detectors where simulations of air show ers play an important role.

  11. High Energy Astrophysics Science Archive Research Center (United States)

    National Aeronautics and Space Administration — The High Energy Astrophysics Science Archive Research Center (HEASARC) is the primary archive for NASA missions dealing with extremely energetic phenomena, from...

  12. High Energy Solid State Laser Research Facility (United States)

    Federal Laboratory Consortium — A suite of laboratories with advanced spectroscopic and laser equipment, this facility develops materials and techniques for advanced solid state high energy lasers....

  13. High energy physics and cloud computing

    International Nuclear Information System (INIS)

    Cheng Yaodong; Liu Baoxu; Sun Gongxing; Chen Gang


    High Energy Physics (HEP) has been a strong promoter of computing technology, for example WWW (World Wide Web) and the grid computing. In the new era of cloud computing, HEP has still a strong demand, and major international high energy physics laboratories have launched a number of projects to research on cloud computing technologies and applications. It describes the current developments in cloud computing and its applications in high energy physics. Some ongoing projects in the institutes of high energy physics, Chinese Academy of Sciences, including cloud storage, virtual computing clusters, and BESⅢ elastic cloud, are also described briefly in the paper. (authors)

  14. High Average Power, High Energy Short Pulse Fiber Laser System

    Energy Technology Data Exchange (ETDEWEB)

    Messerly, M J


    Recently continuous wave fiber laser systems with output powers in excess of 500W with good beam quality have been demonstrated [1]. High energy, ultrafast, chirped pulsed fiber laser systems have achieved record output energies of 1mJ [2]. However, these high-energy systems have not been scaled beyond a few watts of average output power. Fiber laser systems are attractive for many applications because they offer the promise of high efficiency, compact, robust systems that are turn key. Applications such as cutting, drilling and materials processing, front end systems for high energy pulsed lasers (such as petawatts) and laser based sources of high spatial coherence, high flux x-rays all require high energy short pulses and two of the three of these applications also require high average power. The challenge in creating a high energy chirped pulse fiber laser system is to find a way to scale the output energy while avoiding nonlinear effects and maintaining good beam quality in the amplifier fiber. To this end, our 3-year LDRD program sought to demonstrate a high energy, high average power fiber laser system. This work included exploring designs of large mode area optical fiber amplifiers for high energy systems as well as understanding the issues associated chirped pulse amplification in optical fiber amplifier systems.

  15. URBox : High tech energy and informal housing

    NARCIS (Netherlands)

    Cuperus, Y.J.; Smets, D.


    This paper reports on the URBox concept encompassing the high tech end of solar energy and informal low cost and affordable housing. It aims to contribute to solving the global energy crisis by building solar energy settlements in deserts where land is affordable and sunshine in abundance. First the

  16. Responding to high energy prices: energy management services

    International Nuclear Information System (INIS)

    Raynolds, M.


    Rapid growth in the number and sophistication of energy management companies has been observed in the wake of rising energy prices. These companies offer energy-efficiency consulting services to utilities, government and industry with the promise of improved cost efficiency, marketplace competitiveness and environmental commitments. The environmental benefits result from the reduction in emissions and pollutants associated with power production and natural gas used for space heating. In general, the stock in trade of these energy management companies is the energy audit involving evaluation of existing equipment in buildings and facilities and the resulting recommendations to install energy-efficient equipment such as lighting retrofits, boiler replacement, chiller replacement, variable speed drives, high-efficiency motors, improved insulation and weather proofing, water heaters and piping. The North American market for energy management services was estimated in 1997 at $208 billion (rising to $350 billion by 2004). Current market penetration is less than two per cent

  17. High-Energy Neutrino Interactions

    CERN Multimedia


    This experiment studies neutrino interactions in iron at the highest available energies using the narrow-band neutrino beam N3 and the wide-band neutrino beam N1. The basis of the detector is a massive target-calorimeter in which the energy deposited by a neutrino (or antineutrino) is measured by electronic techniques and the momentum of outgoing muons is determined by magnetic deflection. The detector is constructed in the form of a 20 m long iron-cored toroidal magnet, composed of modules of length 70~cm and 90~cm, and of 3.75~m diameter. Drift chambers placed in between each module measure the trajectory of muons from the neutrino interactions. The modules are of three types. The first ten modules are constructed of 2.5~cm iron plates with 20~scintillator planes inserted between the plates. The next five modules are constructed of 5~cm plates with 15~planes of scintillator and the last six modules are constructed of 15~cm plates with 5~planes of scintillators. The total mass of the detector is @=~1400 tons...

  18. Interferometry of high energy nuclear collisions

    International Nuclear Information System (INIS)

    Padula, S.S.


    The interferometry is used for determining large space time dimensions of the Quark Gluon Plasma formed in high energy nuclear collisions or in high multiplicity fluctuations in p-barp collisions. (M.C.K.)

  19. High energy physics in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Month, M.


    The US program in high energy physics from 1985 to 1995 is reviewed. The program depends primarily upon work at the national accelerator centers, but includes a modest but diversified nonaccelerator program. Involvement of universities is described. International cooperation in high energy physics is discussed, including the European, Japanese, USSR, and the People's Republic of China's programs. Finally, new facilities needed by the US high energy physics program are discussed, with particular emphasis given to a Superconducting Super Collider for achieving ever higher energies in the 20 TeV range. (LEW)

  20. High energy physics in the United States

    International Nuclear Information System (INIS)

    Month, M.


    The US program in high energy physics from 1985 to 1995 is reviewed. The program depends primarily upon work at the national accelerator centers, but includes a modest but diversified nonaccelerator program. Involvement of universities is described. International cooperation in high energy physics is discussed, including the European, Japanese, USSR, and the People's Republic of China's programs. Finally, new facilities needed by the US high energy physics program are discussed, with particular emphasis given to a Superconducting Super Collider for achieving ever higher energies in the 20 TeV range

  1. A unified treatment of high energy interactions

    International Nuclear Information System (INIS)

    Drescher, H.J.; Werner, K.; Ostapchenko, S.; Centre National de la Recherche Scientifique, 44 - Nantes


    It is well known that high energy interactions as different as electron-positron annihilation, deep inelastic lepton-nucleon scattering, proton-proton interactions, and nucleus-nucleus collisions have many features in common. Based upon this observation, a model for all these interactions is constructed which relies on the fundamental hypothesis that the behavior of high energy interactions is universal. (author)

  2. CAMAC high energy physics electronics hardware

    International Nuclear Information System (INIS)

    Kolpakov, I.F.


    CAMAC hardware for high energy physics large spectrometers and control systems is reviewed as is the development of CAMAC modules at the High Energy Laboratory, JINR (Dubna). The total number of crates used at the Laboratory is 179. The number of CAMAC modules of 120 different types exceeds 1700. The principles of organization and the structure of developed CAMAC systems are described. (author)

  3. Expectations for ultra-high energy interactions

    International Nuclear Information System (INIS)

    Feynman, R.P.


    Strong interactions at ultra-high energies are discussed with emphasis on the hadrons produced in high energy collisions. Evidence is considered that quantum chromodynamics might be the right theory, and also some estimates are given of quantum chromodynamics asymptotic-freedom phenomena, the work under discussion being very preliminary. 6 references

  4. New aspects of high energy density plasma

    International Nuclear Information System (INIS)

    Hotta, Eiki


    The papers presented at the symposium on 'New aspects of high energy density plasma' held at National Institute for Fusion Science are collected in this proceedings. The papers reflect the present status and recent progress in the experiments and theoretical works on high energy density plasma produced by pulsed power technology. The 13 of the presented papers are indexed individually. (J.P.N.)

  5. High energy physics at UCR

    Energy Technology Data Exchange (ETDEWEB)

    Kernan, A.; Shen, B.C.


    The hadron collider group is studying proton-antiproton interactions at the world`s highest collision energy 2 TeV. Data-taking with the D0 detector is in progress at Fermilab and the authors have begun the search for the top quark. S. Wimpenny is coordinating the effort to detect t{bar t} decaying to two leptons, the most readily identifiable channel. At UC Riverside design and testing for a silicon tracker for the D0 upgrade is in progress; a parallel development for the SDC detector at SSC is also underway. The major group effort of the lepton group has been devoted to the OPAL experiment at LEP. They will continue to focus on data-taking to improve the quality and quantity of their data sample. A large number of papers have been published based on approximately 500,000 events taken so far. The authors will concentrate on physics analysis which provides stringent tests of the Standard Model. The authors are continuing participation in the RD5 experiment at the SPS to study muon triggering and tracking. The results of this experiment will provide critical input for the design of the Compact Muon Solenoid experiment being proposed for the LHC. The theory group has been working on problems concerning the possible vilation of e-{mu}-{tau} universality, effective Lagrangians, neutrino physics, as well as quark and lepton mass matrices.

  6. High energy physics at UCR

    International Nuclear Information System (INIS)

    Kernan, A.; Shen, B.C.


    The hadron collider group is studying proton-antiproton interactions at the world's highest collision energy 2 TeV. Data-taking with the D0 detector is in progress at Fermilab and the authors have begun the search for the top quark. S. Wimpenny is coordinating the effort to detect t bar t decaying to two leptons, the most readily identifiable channel. At UC Riverside design and testing for a silicon tracker for the D0 upgrade is in progress; a parallel development for the SDC detector at SSC is also underway. The major group effort of the lepton group has been devoted to the OPAL experiment at LEP. They will continue to focus on data-taking to improve the quality and quantity of their data sample. A large number of papers have been published based on approximately 500,000 events taken so far. The authors will concentrate on physics analysis which provides stringent tests of the Standard Model. The authors are continuing participation in the RD5 experiment at the SPS to study muon triggering and tracking. The results of this experiment will provide critical input for the design of the Compact Muon Solenoid experiment being proposed for the LHC. The theory group has been working on problems concerning the possible vilation of e-μ-τ universality, effective Lagrangians, neutrino physics, as well as quark and lepton mass matrices

  7. High energy density lithium batteries

    CERN Document Server

    Aifantis, Katerina E; Kumar, R Vasant


    Cell phones, portable computers and other electronic devices crucially depend on reliable, compact yet powerful batteries. Therefore, intensive research is devoted to improving performance and reducing failure rates. Rechargeable lithium-ion batteries promise significant advancement and high application potential for hybrid vehicles, biomedical devices, and everyday appliances. This monograph provides special focus on the methods and approaches for enhancing the performance of next-generation batteries through the use of nanotechnology. Deeper understanding of the mechanisms and strategies is

  8. Remarks on High Energy Evolution


    Kovner, Alex; Lublinsky, Michael


    We make several remarks on the B-JIMWLK hierarchy. First, we present a simple and instructive derivation of this equation by considering an arbitrary projectile wave function with small number of valence gluons. We also generalize the equation by including corrections which incorporate effects of high density in the projectile wave function. Second, we systematically derive the dipole model approximation to the hierarchy. We show that in the dipole approximation the hierarchy has a simplifyin...

  9. Ultra high energy gamma-ray astronomy

    International Nuclear Information System (INIS)

    Wdowczyk, J.


    The experimental data on ultra high energy γ-rays are reviewed and a comparison of the properties of photon and proton initiated shower is made. The consequences of the existence of the strong ultra high energy γ-ray sources for other observations is analysed and possible mechanisms for the production of ultra high energy γ-rays in the sources are discussed. It is demonstrated that if the γ-rays are produced via cosmic ray interactions the sources have to produce very high fluxes of cosmic ray particles. In fact it is possible that a small number of such sources can supply the whole Galactic cosmic ray flux

  10. Very high energy gamma-ray astronomy with H.E.S.S. Development of a multivariate analysis and application to study of pulsar wind nebulae

    International Nuclear Information System (INIS)

    Dubois, Florent


    H.E.S.S. (High Energy Stereoscopic System) is one of the leading systems of four Imaging Atmospheric Cherenkov Telescopes that investigates very high energy (VHE) cosmic gamma-rays in the 100 GeV to 100 TeV energy range. H.E.S.S. is located in Namibia, near the Gamsberg mountain and operational since December 2003. The H.E.S.S. experiment is mainly aimed to the observation of the southern sky including the galactic plan and the numerous astrophysics sources therein. Three analysis methods have been developed using various properties of the electromagnetic showers generated by the interaction of primary cosmic gamma-rays within the Earth atmosphere. The first goal of this thesis was to combine the information from these methods for the selection and the energy and direction reconstruction of gamma-ray events. The new analysis called X eff improves significantly the quality of the selection and the precision of the reconstruction. This analysis has been afterwards applied to the study of pulsar wind nebulae like Vela X, G0.9+0.1 and MSH 15-52. New results were found concerning the source extension (Vela X) or spectral analysis (G0.9+0.1 and MSH 15-52) at TeV energies, thanks to additional data and to the improved efficiency of the new method. In 2010, a new phase will begin with the achievement of a fifth telescope dedicated to gamma-ray observation from tens GeV. The calibration processes of the photomultipliers equipping the camera of the new telescope, as well as the results of the tests, are also described in this thesis. (author)

  11. High- and middle-energy geothermics

    International Nuclear Information System (INIS)



    High and middle energy geothermal resources correspond to temperature intervals of 220-350 C and 90-180 C, respectively, and are both exploited for electricity production. Exploitation techniques and applications of high and of middle energy geothermics are different. High energy geothermics is encountered in active volcanic and tectonic zones, such as the circum-Pacific fire-belt, the lesser Antilles, the peri-Mediterranean Alpine chain or the African rift zone. The geothermal steam is directly expanded in a turbine protected against gas and minerals corrosion. About 350 high energy plants are distributed in more than 20 different countries and represent 6000 M We. The cost of high energy installed geothermal kWh ranges from 0.20 to 0.50 French Francs. Middle energy geothermics is encountered in sedimentary basins (between 2000 and 4000 m of depth), in localized fractured zones or at lower depth in the high energy geothermal fields. Heat exchangers with organic fluid Rankine cycle technology is used to produce electricity. Unit power of middle energy plants generally ranges from few hundreds of k W to few MW and correspond to a worldwide installed power of about 400 M We. The annual progression of geothermal installed power is estimated to 4 to 8 % in the next years and concerns principally the circum-Pacific countries. In France, geothermal resources are mainly localized in overseas departments. (J.S.). 3 photos

  12. High energy hadron spin-flip amplitude

    International Nuclear Information System (INIS)

    Selyugin, O.V.


    The high-energy part of the hadron spin-flip amplitude is examined in the framework of the new high-energy general structure (HEGS) model of the elastic hadron scattering at high energies. The different forms of the hadron spin-flip amplitude are compared in the impact parameter representation. It is shown that the existing experimental data of the proton-proton and proton-antiproton elastic scattering at high energy in the region of the diffraction minimum and at large momentum transfer give support in the presence of the energy-independent part of the hadron spin-flip amplitude with the momentum dependence proposed in the works by Galynskii-Kuraev. [ru

  13. Individual Dosimetry for High Energy Radiation Fields

    International Nuclear Information System (INIS)

    Spurny, F.


    The exposure of individuals on board aircraft increased interest in individual dosimetry in high energy radiation fields. These fields, both in the case of cosmic rays as primary radiation and at high energy particle accelerators are complex, with a large diversity of particle types, their energies, and linear energy transfer (LET). Several already existing individual dosemeters have been tested in such fields. For the component with high LET (mostly neutrons) etched track detectors were tested with and without fissile radiators, nuclear emulsions, bubble detectors for both types available and an albedo dosemeter. Individual dosimetry for the low LET component has been performed with thermoluminescent detectors (TLDs), photographic film dosemeters and two types of electronic individual dosemeters. It was found that individual dosimetry for the low LET component was satisfactory with the dosemeters tested. As far as the high LET component is concerned, there are problems with both the sensitivity and the energy response. (author)

  14. Intercomparison of high energy neutron personnel dosimeters

    International Nuclear Information System (INIS)

    McDonald, J.C.; Akabani, G.; Loesch, R.M.


    An intercomparison of high-energy neutron personnel dosimeters was performed to evaluate the uniformity of the response characteristics of typical neutron dosimeters presently in use at US Department of Energy (DOE) accelerator facilities. It was necessary to perform an intercomparison because there are no national or international standards for high-energy neutron dosimetry. The testing that is presently under way for the Department of Energy Laboratory Accreditation Program (DOELAP) is limited to the use of neutron sources that range in energy from about 1 keV to 2 MeV. Therefore, the high-energy neutron dosimeters presently in use at DOE accelerator facilities are not being tested effectively. This intercomparison employed neutrons produced by the 9 Be(p,n) 9 B interaction at the University of Washington cyclotron, using 50-MeV protons. The resulting neutron energy spectrum extended to a maximum of approximately 50-MeV, with a mean energy of about 20-MeV. Intercomparison results for currently used dosimeters, including Nuclear Type A (NTA) film, thermoluminescent dosimeter (TLD)-albedo, and track-etch dosimeters (TEDs), indicated a wide variation in response to identical doses of high-energy neutrons. Results of this study will be discussed along with a description of plans for future work

  15. Practical neutron dosimetry at high energies

    International Nuclear Information System (INIS)

    McCaslin, J.B.; Thomas, R.H.


    Dosimetry at high energy particle accelerators is discussed with emphasis on physical measurements which define the radiation environment and provide an immutable basis for the derivation of any quantities subsequently required for risk evaluation. Results of inter-laboratory dosimetric comparisons are reviewed and it is concluded that a well-supported systematic program is needed which would make possible detailed evaluations and inter-comparisons of instruments and techniques in well characterized high energy radiation fields. High-energy dosimetry is so coupled with radiation transport that it is clear their study should proceed concurrently

  16. Computing in high-energy physics

    International Nuclear Information System (INIS)

    Mount, Richard P.


    I present a very personalized journey through more than three decades of computing for experimental high-energy physics, pointing out the enduring lessons that I learned. This is followed by a vision of how the computing environment will evolve in the coming ten years and the technical challenges that this will bring. I then address the scale and cost of high-energy physics software and examine the many current and future challenges, particularly those of management, funding and software-lifecycle management. Lastly, I describe recent developments aimed at improving the overall coherence of high-energy physics software

  17. Computing in high-energy physics (United States)

    Mount, Richard P.


    I present a very personalized journey through more than three decades of computing for experimental high-energy physics, pointing out the enduring lessons that I learned. This is followed by a vision of how the computing environment will evolve in the coming ten years and the technical challenges that this will bring. I then address the scale and cost of high-energy physics software and examine the many current and future challenges, particularly those of management, funding and software-lifecycle management. Finally, I describe recent developments aimed at improving the overall coherence of high-energy physics software.

  18. CERN and the high energy frontier

    Directory of Open Access Journals (Sweden)

    Tsesmelis Emmanuel


    Full Text Available This paper presents the particle physics programme at CERN at the high-energy frontier. Starting from the key open questions in particle physics and the large-scale science facilities existing at CERN, concentrating on the Large Hadron Collider(LHC, this paper goes on to present future possibilities for global projects in high energy physics. The paper presents options for future colliders, all being within the framework of the recently updated European Strategy for Particle Physics, and all of which have a unique value to add to experimental particle physics. The paper concludes by outlining key messages for the way forward for high-energy physics research.

  19. On the Future High Energy Colliders

    Energy Technology Data Exchange (ETDEWEB)

    Shiltsev, Vladimir [Fermilab


    High energy particle colliders have been in the forefront of particle physics for more than three decades. At present the near term US, European and international strategies of the particle physics community are centered on full exploitation of the physics potential of the Large Hadron Collider (LHC) through its high-luminosity upgrade (HL-LHC). A number of the next generation collider facilities have been proposed and are currently under consideration for the medium and far-future of accelerator-based high energy physics. In this paper we offer a uniform approach to evaluation of various accelerators based on the feasibility of their energy reach, performance potential and cost range.

  20. Biological effects of high-energy radiation

    International Nuclear Information System (INIS)

    Curtis, S.B.


    The biological effects of high-energy radiation are reviewed, with emphasis on the effects of the hadronic component. Proton and helium ion effects are similar to those of the more conventional and sparsely ionizing x- and γ-radiation. Heavy-ions are known to be more biologically effective, but the long term hazard from accumulated damage has yet to be assessed. Some evidence of widely varying but dramatically increased effectiveness of very high-energy (approximately 70 GeV) hadron beams is reviewed. Finally, the importance of the neutron component in many situations around high-energy accelerators is pointed out

  1. New accelerators in high-energy physics

    International Nuclear Information System (INIS)

    Blewett, J.P.


    First, I should like to mention a few new ideas that have appeared during the last few years in the accelerator field. A couple are of importance in the design of injectors, usually linear accelerators, for high-energy machines. Then I shall review some of the somewhat sensational accelerator projects, now in operation, under construction or just being proposed. Finally, I propose to mention a few applications of high-energy accelerators in fields other than high-energy physics. I realize that this is a digression from my title but I hope that you will find it interesting

  2. High energy physics. Ultimate structure of matter and energy

    International Nuclear Information System (INIS)


    Some of the principle discoveries and insights and their development up to today are sketched. It is shown how one layer after another was discovered by penetrating farther into the structure of matter. Covered are the mounting energy scale, discoveries at high energy frontier, the families of quarks and leptons, the four forces of nature, some achievements of the past few years, particle accelerators and experimental apparatus. A glossary of terms is included

  3. High to ultra-high power electrical energy storage. (United States)

    Sherrill, Stefanie A; Banerjee, Parag; Rubloff, Gary W; Lee, Sang Bok


    High power electrical energy storage systems are becoming critical devices for advanced energy storage technology. This is true in part due to their high rate capabilities and moderate energy densities which allow them to capture power efficiently from evanescent, renewable energy sources. High power systems include both electrochemical capacitors and electrostatic capacitors. These devices have fast charging and discharging rates, supplying energy within seconds or less. Recent research has focused on increasing power and energy density of the devices using advanced materials and novel architectural design. An increase in understanding of structure-property relationships in nanomaterials and interfaces and the ability to control nanostructures precisely has led to an immense improvement in the performance characteristics of these devices. In this review, we discuss the recent advances for both electrochemical and electrostatic capacitors as high power electrical energy storage systems, and propose directions and challenges for the future. We asses the opportunities in nanostructure-based high power electrical energy storage devices and include electrochemical and electrostatic capacitors for their potential to open the door to a new regime of power energy.

  4. High energy physics and nuclear structure

    International Nuclear Information System (INIS)

    Measday, D.F.; Thomas, A.W.


    These proceedings contain the papers presented at the named conference. These concern eletromagnetic interactions, weak interactions, strong interactions at intermediate energy, pion reactions, proton reactions, strong interactions at high energy, as well as new facilities and applications. See hints under the relevant topics. (HSI)

  5. Ultra high-energy cosmic ray composition

    International Nuclear Information System (INIS)

    Longley, N.P.


    The Soudan 2 surface-underground cosmic ray experiment can simultaneously measure surface shower size, underground muon multiplicity, and underground muon separation for ultra high energy cosmic ray showers. These measurements are sensitive to the primary composition. Analysis for energies from 10 1 to 10 4 TeV favors a light flux consisting of predominantly H and He nuclei

  6. Pi-nucleon phenomenology at high energies

    International Nuclear Information System (INIS)

    Kogitz, S.


    A brief introduction to the phenomenology of strong interactions at high energy is presented. This includes discussion of the topics including absorption, finite energy sum rules, and duality. The application of these ideas to two-particle inelastic reactions is examined. (author)

  7. Experiments on very high energy heavy ions

    International Nuclear Information System (INIS)

    Willis, W.J.


    In this paper I describe experimental techniques which could be used to investigate central collision of very high energy heavy ions. For my purposes, the energy range is defined by the number of pions produced, Nsub(π) >> 100, and consequently Nsub(π) >> Nsub(nucleon). In this regime we may expect that new phenomena will appear. (orig.)

  8. Energy confinement of high-density tokamaks

    NARCIS (Netherlands)

    Schüller, F.C.; Schram, D.C.; Coppi, B.; Sadowski, W.


    Neoclassical ion heat conduction is the major energy loss mechanism in the center of an ohmically heated high-d. tokamak discharge (n>3 * 1020 m-3). This fixes the mutual dependence of plasma quantities on the axis and leads to scaling laws for the poloidal b and energy confinement time, given the

  9. Geometrical scaling in high energy hadron collisions

    International Nuclear Information System (INIS)

    Kundrat, V.; Lokajicek, M.V.


    The concept of geometrical scaling for high energy elastic hadron scattering is analyzed and its basic equations are solved in a consistent way. It is shown that they are applicable to a rather small interval of momentum transfers, e.g. maximally for |t| 2 for pp scattering at the ISR energies. (author)

  10. Low energy current accumulator for high-energy proton rings

    International Nuclear Information System (INIS)

    Month, M.


    Building current in high-energy p-p colliding beam machines is most appropriately done in a low-energy (small circumference) current accumulator. Three significant factors favor such a procedure: First, large rings tend to be susceptible to unstable longitudinal density oscillations. These can be avoided by pumping up the beam in the accumulator. When the current stack is injected into the storage ring, potentially harmful instability is essentially neutralized. Second, high-field magnets characteristic of future high energy proton rings are designed with superconducting coils within the iron magnetic shield. This means coil construction and placement errors propagate rapidly within the beam aperture. An intermediate ''stacking ring'' allows the minimum use of the superconducting ring aperture. Finally, the coils are vulnerable to radiation heating and possible magnet quenching. By minimizing beam manipulaion in the superconducting environment and using only the central portion of the beam aperture, coil vulnerability can be put at a minimum

  11. A Multiwavelength Study of Flaring Activity in the High-energy Peaked BL Lac Object 1ES 1959+650 During 2015–2016

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Navpreet; Chandra, S.; Baliyan, Kiran S; Sameer; Ganesh, S. [Astronomy and Astrophysics Division, Physical Research Laboratory, Ahmedabad, Gujarat 380009 (India)


    We present the results from a multiwavelength study of the flaring activity in the high-energy peaked BL Lac object 1ES 1959+650 during 2015 January–2016 June. The source underwent two major outbursts, during 2015 March and 2015 October, across the whole electromagnetic spectrum (EMS). We used data from Fermi -LAT and Swift -XRT/UVOT, and optical data from Mt. Abu InfraRed Observatory and Steward Observatory to look for possible correlations between the emissions at different energies and the nature of the variability during the flaring state. During the 2015 October outburst, the nightly averaged V -band brightest magnitude, 14.45(0.03), and faintest magnitude, 14.45(0.03), were recorded. Apart from long-term flares, rapid and short-term variabilities were noticed at all energies. Our study suggests that the flaring activities at all frequencies, with diverse flare durations and time lags, are correlated. The magnetic field strength is estimated to be 4 G using the synchrotron-cooling timescale (2.3 hr), and the upper limits on the sizes of both emission regions, γ -ray and optical, are estimated to be of the order of 10{sup 16} cm. The quasi-simultaneous flux enhancements in 15 GHz and VHE γ -ray emissions indicate a fresh injection of plasma into the jet, which interacts with a standing submillimeter core, resulting in co-spatial emissions across the EMS. The synchrotron peak shifts to higher frequency in the spectral energy distribution while the γ -ray spectra softens during the flaring. The shape of the inverse-Compton spectra indicates a change in the particle energy distribution pre- and post-flare.

  12. Laser fusion and high energy density science

    International Nuclear Information System (INIS)

    Kodama, Ryosuke


    High-power laser technology is now opening a variety of new fields of science and technology using laser-produced plasmas. The laser plasma is now recognized as one of the important tools for the investigation and application of matter under extreme conditions, which is called high energy density science. This chapter shows a variety of applications of laser-produced plasmas as high energy density science. One of the more attractive industrial and science applications is the generation of intense pulse-radiation sources, such as the generation of electro-magnetic waves in the ranges of EUV (Extreme Ultra Violet) to gamma rays and laser acceleration of charged particles. The laser plasma is used as an energy converter in this regime. The fundamental science applications of high energy density physics are shown by introducing laboratory astrophysics, the equation of state of high pressure matter, including warm dense matter and nuclear science. Other applications are also presented, such as femto-second laser propulsion and light guiding. Finally, a new systematization is proposed to explore the possibility of the high energy density plasma application, which is called high energy plasma photonics''. This is also exploration of the boundary regions between laser technology and beam optics based on plasma physics. (author)

  13. Physics at high energy photon photon colliders

    International Nuclear Information System (INIS)

    Chanowitz, M.S.


    I review the physic prospects for high energy photon photon colliders, emphasizing results presented at the LBL Gamma Gamma Collider Workshop. Advantages and difficulties are reported for studies of QCD, the electroweak gauge sector, supersymmetry, and electroweak symmetry breaking

  14. Organisation of high-energy physics

    CERN Document Server

    Kluyver, J C


    Tabulates details of major accelerator laboratories in western Europe, USA, and USSR, and describes the various organisations concerned with high-energy physics. The Dutch organisation uses the NIKHEF laboratory in Amsterdam and cooperates with CERN. (0 refs).

  15. New informative techniques in high energy physics

    International Nuclear Information System (INIS)

    Klimenko, S.V.; Ukhov, V.I.


    A number of new informative techniques applied to high energy physics are considered. These are the object-oriented programming, systems integration, UIMS, visualisation, expert systems, neural networks. 100 refs

  16. Multiplicity distributions in high energy collisions

    International Nuclear Information System (INIS)

    Giovannini, A.; Lupia, S.; Ugoccioni, R.


    We discuss the important phases in the evolution of our understanding of multiplicity distributions in high energy collisions with particular emphasis to intermittent behavior and shoulder structure problem. (orig.)

  17. Multiplicity distributions in high energy collisions

    Energy Technology Data Exchange (ETDEWEB)

    Giovannini, A.; Lupia, S.; Ugoccioni, R. (Dipt. di Fisica Teorica, Univ. Turin (Italy) INFN, Turin (Italy))


    We discuss the important phases in the evolution of our understanding of multiplicity distributions in high energy collisions with particular emphasis to intermittent behavior and shoulder structure problem. (orig.).

  18. The evolution of high energy accelerators

    International Nuclear Information System (INIS)

    Courant, E.D.


    In this lecture I would like to trace how high energy particle accelerators have grown from tools used for esoteric small-scale experiments to gigantic projects being hotly debated in Congress as well as in the scientific community

  19. High Energy Density Polymer Film Capacitors

    National Research Council Canada - National Science Library

    Boufelfel, Ali


    High-energy-density capacitors that are compact and light-weight are extremely valuable in a number of critical DoD systems that include portable field equipment, pulsed lasers, detection equipment...

  20. Research in High Energy Physics. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Conway, John S.


    This final report details the work done from January 2010 until April 2013 in the area of experimental and theoretical high energy particle physics and cosmology at the University of California, Davis.

  1. Studies In Theoretical High Energy Particle Physics

    Energy Technology Data Exchange (ETDEWEB)

    Keung, Wai Yee [Univ. of Illinois, Chicago, IL (United States)


    This is a final technical report for grant no. DE-SC0007948 describing research activities in theoretical high energy physics at University of Illinois at Chicago for the whole grant period from July 1, 2012 to March 31, 2017.

  2. Proceedings of progress in high energy physics

    International Nuclear Information System (INIS)

    Pauchy Hwang, W.Y.; Lee, S.C.; Lee, C.E.; Ernst, D.J.


    This book contains the proceedings of progress in high energy physics. Topics covered include: Particle Phenomology; Particles and Fields; Physics in 2 and 1 Dimensions; Cosmology, Astrophysics, and Gravitation; Some Perspertives on the Future of Particle Physics

  3. Elementary particle physics and high energy phenomena

    International Nuclear Information System (INIS)

    Barker, A.R.; Cumalat, J.P.; de Alwis, S.P.; DeGrand, T.A.; Ford, W.T.; Mahanthappa, K.T.; Nauenberg, U.; Rankin, P.; Smith, J.G.


    This report discusses the following research in high energy physics: the properties of the z neutral boson with the SLD detector; the research and development program for the SDC muon detector; the fixed-target k-decay experiments; the Rocky Mountain Consortium for HEP; high energy photoproduction of states containing heavy quarks; and electron-positron physics with the CLEO II and Mark II detectors. (LSP)

  4. Scaling violations at ultra-high energies

    International Nuclear Information System (INIS)

    Tung, W.K.


    The paper discusses some of the features of high energy lepton-hadron scattering, including the observed (Bjorken) scaling behavior. The cross-sections where all hadron final states are summed over, are examined and the general formulas for the differential cross-section are examined. The subjects of scaling, breaking and phenomenological consequences are studied, and a list of what ultra-high energy neutrino physics can teach QCD is given

  5. Elementary particle physics and high energy phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Barker, A.R.; Cumalat, J.P.; de Alwis, S.P.; DeGrand, T.A.; Ford, W.T.; Mahanthappa, K.T.; Nauenberg, U.; Rankin, P.; Smith, J.G.


    This report discusses the following research in high energy physics: the properties of the z neutral boson with the SLD detector; the research and development program for the SDC muon detector; the fixed-target k-decay experiments; the Rocky Mountain Consortium for HEP; high energy photoproduction of states containing heavy quarks; and electron-positron physics with the CLEO II and Mark II detectors. (LSP).

  6. Research of high energy radioactivity identification detector

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yong Kyun; Lee, Yong Bum; Hwang, Jong Sun; Choi, Seok Ki


    {Delta} {Epsilon}-{Epsilon} telescope high radioactivity detector was designed, fabricated, and tested at the 35 MeV proton energy. We developed the computer code to calculate the energy loss of projectile ions in the matter. Using the code, we designed and fabricated a detector to measure 15-50 MeV protons. The detector was successfully tested to measure the energy of protons and deuterons and to identify the ions. In future, we would like to extend the present result to the development of a higher energy proton detector and a heavy ion detector. (author). 10 refs., 3 tabs., 14 figs

  7. High-energy cosmic-ray acceleration

    CERN Document Server

    Bustamante, M; de Paula, W; Duarte Chavez, J A; Gago, A M; Hakobyan, H; Jez, P; Monroy Montañez, J A; Ortiz Velasquez, A; Padilla Cabal, F; Pino Rozas, M; Rodriguez Patarroyo, D J; Romeo, G L; Saldaña-Salazar , U J; Velasquez, M; von Steinkirch, M


    We briefly review the basics of ultrahigh-energy cosmic-ray acceleration. The Hillas criterion is introduced as a geometrical criterion that must be fulfilled by potential acceleration sites, and energy losses are taken into account in order to obtain a more realistic scenario. The different available acceleration mechanisms are presented, with special emphasis on Fermi shock acceleration and its prediction of a power-law cosmic-ray energy spectrum. We conclude that first-order Fermi acceleration, though not entirely satisfactory, is the most promising mechanism for explaining the ultra-high-energy cosmic-ray flux.

  8. Modeling the emission of the galactic very high energy γ-ray sources G 1.9+0.3, G 330.2+1.0, HESS J1303-631 and PSR B1259-63/LS 2883 observed with H.E.S.S

    International Nuclear Information System (INIS)

    Sushch, Iurii


    Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE γ-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F G1.9 (>260 GeV) -13 cm -2 s -1 for G1.9+0.3 and F G330 (>380 GeV) -12 cm -2 s -1 for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 μG for G1.9+0.3 and 14 μG for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with the pulsar PSR J1301-6305. The broadband emission of the source

  9. Modeling the emission of the galactic very high energy {gamma}-ray sources G 1.9+0.3, G 330.2+1.0, HESS J1303-631 and PSR B1259-63/LS 2883 observed with H.E.S.S

    Energy Technology Data Exchange (ETDEWEB)

    Sushch, Iurii


    Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE {gamma}-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F{sub G1.9}(>260 GeV)<4.6 x 10{sup -13} cm{sup -2}s{sup -1} for G1.9+0.3 and F{sub G330}(>380 GeV)<1.6 x 10{sup -12} cm{sup -2}s{sup -1} for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 {mu}G for G1.9+0.3 and 14 {mu}G for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with

  10. Report on high energy neutron dosimetry workshop

    International Nuclear Information System (INIS)

    Alvar, K.R.; Gavron, A.


    The workshop was called to assess the performance of neutron dosimetry per the responses from ten DOE accelerator facilities to an Office of Energy Research questionnaire regarding implementation of a personnel dosimetry requirement in DRAFT DOE 5480.ACC, ''Safety of Accelerator Facilities''. The goals of the workshop were to assess the state of dosimetry at high energy accelerators and if such dosimetry requires improvement, to reach consensus on how to proceed with such improvements. There were 22 attendees, from DOE Programs and contract facilities, DOE, Office of Energy Research (ER), Office of Environmental Safety and Health (EH), Office of Fusion Energy, and the DOE high energy accelerator facilities. A list of attendees and the meeting agenda are attached. Copies of the presentations are also attached

  11. Ultra-High-Energy Cosmic Rays

    CERN Document Server

    Dova, M.T.


    The origin of the ultra high energy cosmic rays (UHECR) with energies above E > 10 17 eV, is still unknown. The discovery of their sources will reveal the engines of the most energetic astrophysical accelerators in the universe. This is a written version of a series of lectures devoted to UHECR at the 2013 CERN-Latin-American School of High-Energy Physics. We present anintroduction to acceleration mechanisms of charged particles to the highest energies in astrophysical objects, their propagation from the sources to Earth, and the experimental techniques for their detection. We also discuss some of the relevant observational results from Telescope Array and Pierre Auger Observatory. These experiments deal with particle interactions at energies orders of magnitude higher than achieved in terrestrial accelerators.

  12. Cosmic physics: the high energy frontier

    International Nuclear Information System (INIS)

    Stecker, F W


    Cosmic rays have been observed up to energies 10 8 times larger than those of the best particle accelerators. Studies of astrophysical particles (hadrons, neutrinos and photons) at their highest observed energies have implications for fundamental physics as well as astrophysics. Thus, the cosmic high energy frontier is the nexus to new particle physics. This overview discusses recent advances being made in the physics and astrophysics of cosmic rays and cosmic γ-rays at the highest observed energies as well as the related physics and astrophysics of very high energy cosmic neutrinos. These topics touch on questions of grand unification, violations of Lorentz invariance as well as Planck scale physics and quantum gravity. (topical review)

  13. High energy physics advisory panel's subpanel on vision for the future of high-energy physics

    International Nuclear Information System (INIS)


    This report was requested by the Secretary of Energy to (1) define a long-term program for pursuing the most important high-energy physics goals since the termination of the Superconducting Super Collider (SSC) project, (2) assess the current US high-energy physics program, and (3) make recommendations regarding the future of the field. Subjects on which recommendations were sought and which the report addresses were: high-energy physics funding priorities; facilitating international collaboration for future construction of large high-energy physics facilities; optimizing uses of the investment made in the SSC; how to encourage displaced scientists and engineers to remain in high-energy physics and to attract young scientists to enter the field in the future. The report includes a description of the state of high-energy physics research in the context of history, a summary of the SSC project, and documentation of the report's own origins and development

  14. The high energy accelerator program in Japan

    International Nuclear Information System (INIS)

    Ozaki, S.


    The author observes that in order to survey the intentions of Japanese high energy physicists and to make a recommendation to the High Energy Committee on future plans for high energy physics in Japan, including accelerators after TRISTAN, international collaboration projects and non-accelerator physics, a subcommittee of fifteen members is formed. The committee recommendation reads: A) For a new energy frontier, 1. Immediate initiation of R/D efforts for an e/sup +/e/sup -/ linear collider of TeV class, constructs a possible home-based facility, 2. Promotes international collaborative experiments using the SSC for the hadron sector, B) As projects of immediate concern: 1. The energy of the TRISTAN main ring increases further makes a possible low energy, high luminosity e/sup +/e/sup -/ collider operation in the TRISTAN complex, 2. The intensity of the 12 GeV PS at KEK increases, 3. Experiments in non-accelerator particle physics are promoted. In this contribution, the current status of the TRISTAN project and some of the R/D program on accelerator technology are reported

  15. Indiana University High Energy Physics, Task A

    International Nuclear Information System (INIS)

    Brabson, B.; Crittenden, R.; Dzierba, A.


    This report discusses research at Indians University on the following high energy physics experiments: A search for mesons with unusual quantum numbers; hadronic states produced in association with high-mass dimuons; FNAL E740 (D0); superconducting super collider; and OPAL experiment at CERN

  16. High energy experimental physics: Progress report

    International Nuclear Information System (INIS)

    Rosen, J.; Miller, D.


    This report contains papers of high energy physics experiments and detector equipment design. Proposals are also given for future experiments. Some of the topics covered in this report are: high energy predictions for /bar char/pp and pp elastic scattering and total cross sections; D0 forward drift chambers; polarized beam facility; analyzing power measurment in inclusive pion production at high transverse momentum; Skyrme model for baryons; string models for color flux tubes; hadronic decays for the /tau/ lepton; and meson form factors in perturbative QCD

  17. Opportunities for high wind energy penetration

    DEFF Research Database (Denmark)

    Tande, J.O.; Hansen, J.C.


    Wind power is today a mature technology, which at windy locations, is economically competitive to conventional power generation technologies. This and growing global environmental concerns have led governments to encourage and plan for wind energy development, a typical aim being 10% of electricity...... consumption. The successful operation of the three major power systems of Cape Verde, with a total wind energy penetration of about 15% since December 1994, demonstrates that power systems can be operated with high penetration of wind energy by adding simple control and monitoring systems only. Thorough...... analyses conclude that expanding to even above 15% wind energy penetration in the Cape Verde power systems is economical. Worldwide, numerous locations with favorable wind conditions and power systems similar to the Capeverdean provide good opportunities for installing wind farms and achieving high wind...

  18. High-energy capacitance electrostatic micromotors (United States)

    Baginsky, I. L.; Kostsov, E. G.


    The design and parameters of a new electrostatic micromotor with high energy output are described. The motor is created by means of microelectronic technology. Its operation is based on the electromechanic energy conversion during the electrostatic rolling of the metallic films (petals) on the ferroelectric film surface. The mathematical simulation of the main characteristics of the rolling process is carried out. The experimentally measured parameters of the petal step micromotors are shown. The motor operation and its efficiency are investigated.

  19. High energy collisions of nuclei: experiments

    International Nuclear Information System (INIS)

    Heckman, H.H.


    Heavy-ion nuclear reactions with projectile energies up to 2.1 GeV/A are reviewed. The concept of ''rapidity'' is elucidated, and the reactions discussed are divided into sections dealing with target fragmentation, projectile fragmentation, and the intermediate region, with emphasis on the production of light nuclei in high-energy heavy-ion collisions. Target fragmentation experiments using nuclear emulsion and AgCl visual track detectors are also summarized. 18 figures

  20. High energy cosmic rays: sources and fluxes

    Energy Technology Data Exchange (ETDEWEB)

    Stanev, Todor; Gaisser, Thomas K.; Tilav, Serap


    We discuss the production of a unique energy spectrum of the high energy cosmic rays detected with air showers by shifting the energy estimates of different detectors. After such a spectrum is generated we fit the spectrum with three or four populations of cosmic rays that might be accelerated at different cosmic ray sources. We also present the chemical composition that the fits of the spectrum generates and discuss some new data sets presented this summer at the ICRC in Rio de Janeiro that may require new global fits.

  1. Hardon cross sections at ultra high energies

    International Nuclear Information System (INIS)

    Yodh, G.B.


    A review of results on total hadronic cross sections at ultra high energies obtained from a study of longitudinal development of cosmic ray air showers is given. The experimental observations show that proton-air inelastic cross section increases from 275 mb to over 500 mb as the collision energy in the center of mass increases from 20 GeV to 20 TeV. The proton-air inelastic cross section, obtained from cosmic ray data at √s = 30 TeV, is compared with calculations using various different models for the energy variation of the parameters of the elementary proton-proton interaction. Three conclusions are derived

  2. High Energy Density Sciences with High Power Lasers at SACLA (United States)

    Kodama, Ryosuke


    One of the interesting topics on high energy density sciences with high power lasers is creation of extremely high pressures in material. The pressures of more than 0.1 TPa are the energy density corresponding to the chemical bonding energy, resulting in expectation of dramatic changes in the chemical reactions. At pressures of more than TPa, most of material would be melted on the shock Hugoniot curve. However, if the temperature is less than 1eV or lower than a melting point at pressures of more than TPa, novel solid states of matter must be created through a pressured phase transition. One of the interesting materials must be carbon. At pressures of more than TPa, the diamond structure changes to BC and cubic at more than 3TPa. To create such novel states of matter, several kinds of isentropic-like compression techniques are being developed with high power lasers. To explore the ``Tera-Pascal Science,'' now we have a new tool which is an x-ray free electron laser as well as high power lasers. The XFEL will clear the details of the HED states and also efficiently create hot dense matter. We have started a new project on high energy density sciences using an XFEL (SACLA) in Japan, which is a HERMES (High Energy density Revolution of Matter in Extreme States) project.

  3. High-energy hadron-hadron collisions

    International Nuclear Information System (INIS)

    Yang, C.N.


    While high energy collision experiments yield a wealth of complicated patterns, there are a few general and very striking features that stand out. Because of the universality of these features, and because of the dominating influence they have on high energy phenomena, it is the authors opinion that a physical picture of high energy collisions must address itself first of all to these features before going into specific details. In this short talk these general and striking features are stated and a physical picture developed in the last few years to specifically accommodate these features is described. The picture was originally discussed for elastic scattering. But it leads naturally, indeed inevitably as they shall discuss, to conclusions about inelastic processes, resulting in an idea called the hypothesis of limiting fragmentation

  4. Experimental and theoretical high energy physics research

    International Nuclear Information System (INIS)


    Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e + e - analysis, bar P decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the φ factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K L 0 → π 0 γγ and π 0 ν bar ν, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R ampersand D

  5. The HESP (High Energy Solar Physics) project (United States)

    Kai, K.


    A project for space observations of solar flares for the coming solar maximum phase is briefly described. The main objective is to make a comprehensive study of high energy phenomena of flares through simultaneous imagings in both hard and soft X-rays. The project will be performed with collaboration from US scientists. The HESP (High Energy Solar Physics) WG of ISAS (Institute of Space and Astronautical Sciences) has extensively discussed future aspects of space observations of high energy phenomena of solar flares based on successful results of the Hinotori mission, and proposed a comprehensive research program for the next solar maximum, called the HESP (SOLAR-A) project. The objective of the HESP project is to make a comprehensive study of both high energy phenomena of flares and quiet structures including pre-flare states, which have been left uncovered by SMM and Hinotori. For such a study simultaneous imagings with better resolutions in space and time in a wide range of energy will be extremely important.

  6. Elementary particle physics and high energy phenomena

    International Nuclear Information System (INIS)

    Barker, A.R.; Cumalat, J.P.; De Alwis, S.P.; DeGrand, T.A.; Ford, W.T.; Mahanthappa, K.T.; Nauenberg, U.; Rankin, P.; Smith, J.G.


    Experimental and theoretical high-energy physics programs at the University of Colorado are reported. Areas of concentration include the following: study of the properties of the Z 0 with the SLD detector; fixed-target K-decay experiments; the R ampersand D program for the muon system: the SDC detector; high-energy photoproduction of states containing heavy quarks; electron--positron physics with the CLEO II detector at CESR; lattice QCD; and spin models and dynamically triangulated random surfaces. 24 figs., 2 tabs., 117 refs

  7. High energy physics computing in Japan

    International Nuclear Information System (INIS)

    Watase, Yoshiyuki


    A brief overview of the computing provision for high energy physics in Japan is presented. Most of the computing power for high energy physics is concentrated in KEK. Here there are two large scale systems: one providing a general computing service including vector processing and the other dedicated to TRISTAN experiments. Each university group has a smaller sized mainframe or VAX system to facilitate both their local computing needs and the remote use of the KEK computers through a network. The large computer system for the TRISTAN experiments is described. An overview of a prospective future large facility is also given. (orig.)

  8. A method to measure the γ-ray content in VHE cosmic ray showers

    International Nuclear Information System (INIS)

    Cresti, M.; Peruzzo, L.; Pesci, A.; Saggion, A.; Sartori, G.; Angelini, F.; Bedeschi, F.; Bellazzini, R.; Bertolucci, E.; Chiarelli, G.; Mariotti, M.; Massai, M.M.; Menzione, A.; Smith, D.A.; Stefanini, A.; Zetti, F.; Scribano, A.; Bartoli, B.; Budinich, M.; Liello, F.; Milotti, E.; Biral, A.R.P.; Chinellato, J.A.; Turtelli, A.; Luksys, M.


    An experimental technique is presented to determine the effectiveness of methods to tag photon initiated air showers and reject hadron initiated ones. The technique is based on the rate reduction in the Moon direction. With a photon energy threshold below or equal to 1 TeV, with an angular resolution of a few mrad and being insensitive to visible light, the proposed CLUE detector allows a wide and original physics program. In particular the direct measurement of the fraction of primary photons in the continuum of the cosmic ray flux is feasible with adequate statistics in a few months of data taking. (orig.)

  9. Progress in high-energy laser technology

    International Nuclear Information System (INIS)

    Miyanaga, Noriaki; Kitagawa, Yoneyoshi; Nakatsuka, Masahiro; Kanabe, Tadashi; Okuda, Isao


    The technological development of high-energy lasers is one of the key issues in laser fusion research. This paper reviews several technologies on the Nd:glass laser and KrF excimer laser that are being used in the current laser fusion experiments and related plasma experiments. Based on the GEKKO laser technology, a new high-energy Nd: glass laser system, which can deliver energy from 10 kJ (boad-band operation) to 20 kJ (narrow-band operation), is under construction. The key topics in KrF laser development are improved efficiency and repetitive operation, which aim at the development of a laser driven for fusion reactor. Ultra-intense-laser technology is also very important for fast ignition research. The key technology for obtaining the petawatt output with high beam quality is reviewed. Regarding the uniform laser irradiation required for high-density compression, the beam-smoothing methods on the GEKKO XII laser are reviewed. Finally, we discuss the present status of MJ-class lasers throughout the world, and summarize by presenting the feasibility of various applications of the high-energy lasers to a wide range of scientific and technological fields. (author)

  10. High Tc superconducting energy storage systems

    Energy Technology Data Exchange (ETDEWEB)

    Werfel, Frank [Adelwitz Technologiezentrum GmbH (ATZ), Arzberg-Adelwitz (Germany)


    Electric energy is basic to heat and light our homes, to power our businesses and to transport people and goods. Powerful storage techniques like SMES, Flywheel, Super Capacitor, and Redox - Flow batteries are needed to increase the overall efficiency, stability and quality of electrical grids. High-Tc superconductors (HTS) possess superior physical and technical properties and can contribute in reducing the dissipation and losses in electric machines as motors and generators, in electric grids and transportation. The renewable energy sources as solar, wind energy and biomass will require energy storage systems even more as a key technology. We survey the physics and the technology status of superconducting flywheel energy storage (FESS) and magnetic energy storage systems (SMES) for their potential of large-scale commercialization. We report about a 10 kWh / 250 kW flywheel with magnetic stabilization of the rotor. The progress of HTS conductor science and technological engineering are basic for larger SMES developments. The performance of superconducting storage systems is reviewed and compared. We conclude that a broad range of intensive research and development in energy storage is urgently needed to produce technological options that can allow both climate stabilization and economic development.

  11. Baryon number violation in high energy collisions

    International Nuclear Information System (INIS)

    Farrar, G.R.; Meng, R.


    We study the phenomenology of baryon number violation induced by electroweak instantons. We find that if the naive-instanton amplitudes were valid for arbitrarily high energies, the event rate at the SSC would be a few per hour, with a typical event consisting of 3 'primary' antileptons and 7 'primary' antiquark jets, accompanied by ≅ 85 electroweak gauge bosons, having a sharp threshold in the total sub-energy at about 17 TeV. We describe how to establish their electroweak-instanton-induced origin. The naive instanton approximation is known to overestimate the rate for these processes, so this work focusses attention on the need for more accurate calculations, and for a calculational method which is appropriate when the energy of the initial particles is above the sphaleron energy. (orig.)

  12. Application of nanotechnologies in high energy physics

    International Nuclear Information System (INIS)

    Angelucci, R.; Corticelli, F.; Cuffiani, M.; Dallavalle, G.M.; Malferraxi, L.; Montanari, A.; Montanari, C.; Odorici, F.; Rizzoli, R.; Summonte, C.


    In the past, the progressive reduction of electronics integration scale has allowed high energy physics experiments to build particle detectors with a high number of sensitive channels and high spatial granularity, down to the micron scale. Nowadays, the increasing effort towards nanoelectronics and progresses in various fields of nanotechnologies, suggests that the time for nanodetectors is not far to come. As an example of possible application of nanotechnologies in HEP, we present results on fabrication of nanochannel matrices in anodic porous alumina as a template for preparing an array of carbon nanotubes, which we believe can be a promising building block in developing particle detectors with high spatial resolution

  13. 22nd DAE High Energy Physics Symposium

    CERN Document Server


    These proceedings gather invited and contributed talks presented at the XXII DAE-BRNS High Energy Physics (HEP) Symposium, which was held at the University of Delhi, India, on 12–16 December 2016. The contributions cover a variety of topics in particle physics, astroparticle physics, cosmology and related areas from both experimental and theoretical perspectives, namely (1) Neutrino Physics, (2) Standard Model Physics (including Electroweak, Flavour Physics), (3) Beyond Standard Model Physics, (4) Heavy Ion Physics & QCD (Quantum Chromodynamics), (5) Particle Astrophysics & Cosmology, (6) Future Experiments and Detector Development, (7) Formal Theory, and (8) Societal Applications: Medical Physics, Imaging, etc. The DAE-BRNS High Energy Physics Symposium, widely considered to be one of the leading symposiums in the field of Elementary Particle Physics, is held every other year in India and supported by the Board of Research in Nuclear Sciences (BRNS), Department of Atomic Energy (DAE), India. As man...

  14. Photodisintegration of the deuteron at high energy

    International Nuclear Information System (INIS)

    Holt, R.J.


    Measurements of the angular distribution for the γd→+pn reaction were performed at SLAC for photon energies between 0.7 and 1.8 GeV (experiment NE8) and between 1.6 and 4.4. GeV (experiment NE17). The final results for experiment NE8 will be presented, but only preliminary results for NE17 will be discussed. The data at θ cm = 90 degrees appear to follow the constituent counting rules. The angular distribution at high photon energies exhibit large values of the cross section at forward angles. There is evidence that the cross section may also be large at backward angles and high energies

  15. High energy excitations in itinerant ferromagnets

    International Nuclear Information System (INIS)

    Prange, R.E.


    Itinerant magnets, those whose electrons move throughout the crystal, are described by band theory. Single particle excitations offer confirmation of band theory, but their description requires important corrections. The energetics of magnetism in iron and nickel is also described in band theory but requires complex bands. Magnetism above the critical temperature and the location of the critical temperature offer discriminants between the two major models of magnetism at high temperature and can be addressed by high energy excitations

  16. Charged current weak interactions at high energy

    International Nuclear Information System (INIS)

    Cline, D.


    We review high energy neutrino and antineutrino charged current interactions. An overview of the experimental data is given, including a discussion of the experimental status of the y anomaly. Locality tests, μ-e universality and charge symmetry invariance tests are discussed. Charm production is discussed. The experimental status of trimuon events and possible phenomenological models for these events are presented. (orig.) [de

  17. High energy electron multibeam diffraction and imaging

    International Nuclear Information System (INIS)

    Bourret, Alain.


    The different theories of dynamical scattering of electrons are firstly reviewed with special reference to their basis and the validity of the different approximations. Then after a short description of the different experimental set ups, structural analysis and the investigation of the optical potential by means of high energy electrons will be surveyed

  18. Nuclear emulsion and high-energy physics

    International Nuclear Information System (INIS)

    Sun Hancheng; Zhang Donghai


    The history of the development of nuclear emulsion and its applications in high-energy physics, from the discovery of pion to the discovery of tau neutrino, are briefly reviewed in this paper. A new stage of development of nuclear-emulsion technique is discussed

  19. High energy spin isospin modes in nuclei

    International Nuclear Information System (INIS)

    Chanfray, G.; Ericson, M.


    The high energy response of nuclei to a spin-isospin excitation is investigated. We show the existence of a strong contrast between the spin transverse and spin longitudinal responses. The second one undergoes a shadow effect in the Δ region and displays the occurrence of the pionic branch

  20. Theoretical and experimental high energy physics

    International Nuclear Information System (INIS)

    Walsh, T.; Ruddick, K.


    This report discusses the following topics: The Soudan enterprise; study of strange quarks at Fermilab; direct photons at Fermilab; the Brookhaven programs; AMY and CLEO: studies of e + e - annihilations; cosmic ray studies with the DO muon chamber; progress report on HEP computer upgrade; muon triggering and reconstruction at SSC; and, theoretical high energy physics

  1. Studies of high energy phenomena using muons

    International Nuclear Information System (INIS)

    Hedin, D.; Kaplan, D.; Green, J.


    The NIU high energy physics group has three main efforts. The first is the D0 experiment at the Fermilab proton-antiproton collider, with major emphasis on its muon system. The second is the involvement of a portion of the group in Fermilab Experiment 789. Finally, members of the group participate in the SDC collaboration at the SSC

  2. PC database for high energy preprint collections

    International Nuclear Information System (INIS)

    Haymaker, R.


    We describe a microcomputer database used by the high energy group to keep track of preprints in our collection. It is used as a supplement to the SLAC-SPIRES database to retrieve preprints on hand. This was designed as a low overhead system for a small group

  3. Indiana University High Energy Physics, Task A

    International Nuclear Information System (INIS)

    Brabson, B.; Crittenden, R.; Dzierba, A.; Hanson, G.; Martin, H.; Marshall, T.; Mir, R.; Mouthuy, T.; Ogren, H.; Rust, D.; Teige, S.; Zieminska, D.; Zieminski, A.


    This report discusses research in High Energy Physics under the following experiments: Meson spectroscopy at BNL; dimuon production at FNAL; the DO collider experiment at FNAL; the Mark II experiment at SLC and PEP; the OPAL experiment at CERN; and the superconducting supercollider

  4. High energy electron irradiation of flowable materials

    International Nuclear Information System (INIS)

    Offermann, B.P.


    In order to efficiently irradiate a flowable material with high energy electrons, a hollow body is disposed in a container for the material and the material is caused to flow in the form of a thin layer across a surface of the body from or to the interior of the container while the material flowing across the body surface is irradiated. (U.S.)

  5. Trends in experimental high-energy physics

    International Nuclear Information System (INIS)

    Sanford, T.W.L.


    Data from a scan of papers in Physical Review Letters and Physical Review are used to demonstrate that American high-energy physicists show a pattern of accelerator and instrumentation usage characteristic of that expected from the logistic-substitution model of Marchetti and of Fischer and Pry

  6. High energy radiation from neutron stars

    International Nuclear Information System (INIS)

    Ruderman, M.


    Topics covered include young rapidly spinning pulsars; static gaps in outer magnetospheres; dynamic gaps in pulsar outer magnetospheres; pulse structure of energetic radiation sustained by outer gap pair production; outer gap radiation, Crab pulsar; outer gap radiation, the Vela pulsar; radioemission; and high energy radiation during the accretion spin-up of older neutron stars. 26 refs., 10 figs

  7. Indiana University High Energy Physics, Task A

    Energy Technology Data Exchange (ETDEWEB)

    Brabson, B.; Crittenden, R.; Dzierba, A.; Hanson, G.; Martin, H.; Marshall, T.; Mir, R.; Mouthuy, T.; Ogren, H.; Rust, D.; Teige, S.; Zieminska, D.; Zieminski, A.


    This report discusses research in High Energy Physics under the following experiments: Meson spectroscopy at BNL; dimuon production at FNAL; the DO collider experiment at FNAL; the Mark II experiment at SLC and PEP; the OPAL experiment at CERN; and the superconducting supercollider.

  8. Synthesis and Characterization of High Energy Polymers. (United States)


    and characterization of new high energy elastomers. IV. References 1. J.C.W. Chien, T. Kohara , C. P. Lillya, T. Sarubbi, B.-H. Su and R. S. Miller, J...Catalyzed Nitromercuration of Diene Polymers, J.C.W. Chien, T. Kohara , C. P. Lillya, T. Sarubbi, B.-H. Su, and R. S. Miller, J. Polm.. Sci. Polym. Chem. Ed

  9. Perspective in high energy physics instrumentation

    International Nuclear Information System (INIS)

    Rossi, L.


    The discovery potential of the next generation of particle accelerators, and in particular of the large hadron collider (LHC), can only be fully exploited by very sophisticated particle detectors. The basics of detectors for momentum and energy measurement is here presented together with a recollection of recent developments which are relevant for use at high luminosity accelerators

  10. High energy hadron-nucleus scattering

    International Nuclear Information System (INIS)

    Koplik, J.; Mueller, A.H.


    Theoretical expectations for hadron-nucleus scattering at high energy if the basic hadron-hadron interaction is due to Regge poles and cuts arising in multiperipheral or soft field theory models are described. Experiments at Fermilab may provide a critical test of such models

  11. Theoretical and experimental high energy physics

    International Nuclear Information System (INIS)

    Gasiorowicz, S.; Ruddick, K.


    This report discusses experimental and theoretical work in High Energy Physics. Some topics discussed are: quantum field theory; supersymmetry; cosmology; superstring model; relic photinos; inflationary universe; dark matter; standard model; supernovae; semileptonic decay; quantum Langevin equation; underground neutrino detection at Soudan; strange quark systems; cosmic ray detection; superconducting super collider detectors; and studies of direct photon production

  12. Prizes reward high-energy physics

    CERN Multimedia


    The European Physical Society (EPS) has recognized four individuals and a collaboration for their work on charge-parity (CP) violation, gamma-ray astronomy, cosmology and outreach activities. Heinrich Wahl, formerly of CERN, and the NA31 collaboration share the 2005 High Energy and Particle Physics Prize for their work on CP violation at CERN (½ page)

  13. Astrophysics, cosmology and high energy physics

    International Nuclear Information System (INIS)

    Rees, M.J.


    A brief survey is given of some topics in astrophysics and cosmology, with special emphasis on the inter-relation between the properties of the early Universe and recent ideas in high energy physics, and on simple order-of-magnitude arguments showing how the scales and dimensions of cosmic phenomena are related to basic physical constants. (orig.)

  14. Heavy ion fragmentation in high energy

    International Nuclear Information System (INIS)

    Nemes, M.C.


    A review is made on the theoretical aspects of heavy ion collisions at high energies. A comparison with several experimental data obtained in a large variety of experiments is present. An emphasis is given on the basis of Glauber's theory of scattering. (L.C.) [pt

  15. SU(5) at very high energies

    International Nuclear Information System (INIS)

    Hueffel, H.


    By exhibiting the relationship between the full SU(5) theory in the unitary gauge and the underlying Higgs-Goldstone system in the t'Hooft-Feynman gauge the high energy limits of amplitudes (involving gauge and Higgs bosons) can be calculated easily. As an application tree unitarity bounds on Higgs parameters and masses are discussed. (Author)

  16. Status of (US) High Energy Physics Networking

    International Nuclear Information System (INIS)

    Montgomery, H.E.


    The current status of Networking to and between computers used by the High Energy Physics community is discussed. Particular attention is given to developments over the last year and to future prospects. Comparison between the current status and that of two years ago indicates that considerable strides have been made but that much remains to be done to achieve an acceptable level of functionality

  17. UNIX at high energy physics Laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Silverman, Alan


    With more and more high energy physics Laboratories ''downsizing'' from large central proprietary mainframe computers towards distributed networks, usually involving UNIX operating systems, the need was expressed at the 1991 Computers in HEP (CHEP) Conference to create a group to consider the implications of this trend and perhaps work towards some common solutions to ease the transition for HEP users worldwide.

  18. Studies in theorectical high energy particles physics

    International Nuclear Information System (INIS)

    Aratyn, H.; Keung, Wai-Yee; Panigrahi, P.; Sukhatme, U.


    This paper discusses the research being done at the University of Illinois in theoretical high energy physics. Some areas discussed are string models, collider physics, symmetries in gauge theories, sigma model, radiative decay of mesons, supersymmetry, superconducting, and hydroproduction of charm

  19. Saving energy via high-efficiency fans. (United States)

    Heine, Thomas


    Thomas Heine, sales and market manager for EC Upgrades, the retrofit arm of global provider of air movement solutions, ebm-papst A&NZ, discusses the retrofitting of high-efficiency fans to existing HVAC equipment to 'drastically reduce energy consumption'.

  20. Activities in nuclear and high energy physics

    Energy Technology Data Exchange (ETDEWEB)


    High energy and nuclear physics research concerning bubble chamber investigations, European hybrid system ACCMOR, WA 18, PETRA, PEP, VA 4, SING, LENA, LEP 3 and DELPHI experiments is summarized. Experiments with electron beams, and in pions and muons physics, and radiochemistry are reported on.

  1. Resume: networking in high energy physics

    International Nuclear Information System (INIS)

    Hutton, J.S.


    Networking in High Energy Physics covers communications inside the experiment and internationally. Inside the experiment the need for agreed 'codes of practice' is now accepted. Within Europe it is accepted that a common infrastructure based on the use of the ISO OSI protocols should be used. In the USA a community initiative has been proposed. The background to these approaches is discussed. (author)

  2. Microphysics, cosmology, and high energy astrophysics

    International Nuclear Information System (INIS)

    Hoyle, F.


    The discussion of microphysics, cosmology, and high energy astrophysics includes particle motion in an electromagnetic field, conformal transformations, conformally invariant theory of gravitation, particle orbits, Friedman models with k = 0, +-1, the history and present status of steady-state cosmology, and the nature of mass. (U.S.)

  3. High-Energy Physics: Exit America?

    CERN Multimedia

    Seife, Charles


    Budget cuts and cancellations threaten to end U.S. exploration of the particle frontier. Fermilab's Tevatron, due to shut down around 200, could be the last large particle accelerator in the United States; the Large Hadron Collider in Geneva should ensure European dominance of high-energy physics (3 pages)

  4. A Gas Calorimeter for High-Energy Experiment and Study of High-Energy Cascade Shower

    Energy Technology Data Exchange (ETDEWEB)

    Miyata, Hitoshi [Univ. of Tsukuba (Japan)


    High energy behavior of the electromagnetic cascade shower has been studied. high energy showers were created by electron and hadron beams with energies between 25 GeV and 150 GeV at Fermi National Accelerator Laboratory. The showers were observed by a shower detector consisting of multi-layer of lead plates and proportional chambers. The experimental results were analyzed with special emphasis on the fluctuation problem of the electromagnetic cascade shower.

  5. Portable high energy gamma ray imagers

    International Nuclear Information System (INIS)

    Guru, S.V.; Squillante, M.R.


    To satisfy the needs of high energy gamma ray imagers for industrial nuclear imaging applications, three high energy gamma cameras are presented. The RMD-Pinhole camera uses a lead pinhole collimator and a segmented BGO detector viewed by a 3 in. square position sensitive photomultiplier tube (PSPMT). This pinhole gamma camera displayed an energy resolution of 25.0% FWHM at the center of the camera at 662 keV and an angular resolution of 6.2 FWHM at 412 keV. The fixed multiple hole collimated camera (FMCC), used a multiple hole collimator and a continuous slab of NaI(Tl) detector viewed by the same PSPMT. The FMCC displayed an energy resolution of 12.4% FWHM at 662 keV at the center of the camera and an angular resolution of 6.0 FWHM at 412 keV. The rotating multiple hole collimated camera (RMCC) used a 180 antisymmetric rotation modulation collimator and CsI(Tl) detectors coupled to PIN silicon photodiodes. The RMCC displayed an energy resolution of 7.1% FWHM at 662 keV and an angular resolution of 4.0 FWHM at 810 keV. The performance of these imagers is discussed in this paper. (orig.)

  6. High energy hadron-hadron collisions

    International Nuclear Information System (INIS)

    Chou, T.T.


    Results of a study on high energy collision with the geometrical model are summarized in three parts: (i) the elastic hadron-hadron collision, (ii) the inelastic hadron-hadron collision, and (iii) the e + e - annihilation. The geometrical description of high-energy elastic scattering developed earlier is still in general agreement with experiments at the CERN-S bar ppS energies. A simple one-parameter expression for the blackness of bar pp system has been proposed recently which describes very well all existing data from ISR to S bar ppS energies. The geometrical description has also been extended to include processes of fragmentation and diffraction dissociation and other phenomena. In the past five years, a unified physical picture for multiparticle emission in hadron-hadron and e + e - collisions was developed. It focuses on the idea of the wide range of values for the total angular momentum in hadron-hadron collisions. An extension of this consideration yields a theory for the momentum distribution of the outgoing particles which agrees with bar pp and e + e - collision experiments. The results and conclusions of this theory have been extrapolated to higher energies and yielded many predictions which can be experimentally tested. 37 refs

  7. Non-critical strings at high energy

    CERN Document Server

    Aoki, Kenichiro; Aoki, Kenichiro; Hoker, Eric D'


    We consider scattering amplitudes in non-critical string theory of $N$ external states in the limit where the energy of all external states is large compared to the string tension. We argue that the amplitudes are naturally complex analytic in the matter central charge $c$ and we propose to define the amplitudes for arbitrary value of $c$ by analytic continuation. We show that the high energy limit is dominated by a saddle point that can be mapped onto an equilibrium electro-static energy configuration of an assembly of $N$ pointlike (Minkowskian) charges, together with a density of charges arising from the Liouville field. We argue that the Liouville charges accumulate on segments of curves, and produce quadratic branch cuts on the worldsheet. The electro-statics problem is solved for string tree level in terms of hyper-elliptic integrals and is given explicitly for 3- and 4-point functions. We show that the high energy limit should behave in a string-like fashion with exponential dependence on the energy sc...

  8. Automatic Energy Schemes for High Performance Applications

    Energy Technology Data Exchange (ETDEWEB)

    Sundriyal, Vaibhav [Iowa State Univ., Ames, IA (United States)


    Although high-performance computing traditionally focuses on the efficient execution of large-scale applications, both energy and power have become critical concerns when approaching exascale. Drastic increases in the power consumption of supercomputers affect significantly their operating costs and failure rates. In modern microprocessor architectures, equipped with dynamic voltage and frequency scaling (DVFS) and CPU clock modulation (throttling), the power consumption may be controlled in software. Additionally, network interconnect, such as Infiniband, may be exploited to maximize energy savings while the application performance loss and frequency switching overheads must be carefully balanced. This work first studies two important collective communication operations, all-to-all and allgather and proposes energy saving strategies on the per-call basis. Next, it targets point-to-point communications to group them into phases and apply frequency scaling to them to save energy by exploiting the architectural and communication stalls. Finally, it proposes an automatic runtime system which combines both collective and point-to-point communications into phases, and applies throttling to them apart from DVFS to maximize energy savings. The experimental results are presented for NAS parallel benchmark problems as well as for the realistic parallel electronic structure calculations performed by the widely used quantum chemistry package GAMESS. Close to the maximum energy savings were obtained with a substantially low performance loss on the given platform.

  9. Very High Energy Neutron Scattering from Hydrogen

    International Nuclear Information System (INIS)

    Cowley, R A; Stock, C; Bennington, S M; Taylor, J; Gidopoulos, N I


    The neutron scattering from hydrogen in polythene has been measured with the direct time-of flight spectrometer, MARI, at the ISIS facility of the Rutherford Appleton Laboratory with incident neutron energies between 0.5 eV and 600 eV. The results of experiments using the spectrometer, VESUVIO, have given intensities from hydrogen containing materials that were about 60% of the intensity expected from hydrogen. Since VESUVIO is the only instrument in the world that routinely operates with incident neutron energies in the eV range we have chosen to measure the scattering from hydrogen at high incident neutron energies with a different type of instrument. The MARI, direct time-of-flight, instrument was chosen for the experiment and we have studied the scattering for several different incident neutron energies. We have learnt how to subtract the gamma ray background, how to calibrate the incident energy and how to convert the spectra to an energy plot . The intensity of the hydrogen scattering was independent of the scattering angle for scattering angles from about 5 degrees up to 70 degrees for at least 3 different incident neutron energies between 20 eV and 100 eV. When the data was put on an absolute scale, by measuring the scattering from 5 metal foils with known thicknesses under the same conditions we found that the absolute intensity of the scattering from the hydrogen was in agreement with that expected to an accuracy of ± 5.0% over a wide range of wave-vector transfers between 1 and 250 A -1 . These measurements show that it is possible to measure the neutron scattering with incident neutron energies up to at least 100 eV with a direct geometry time-of-flight spectrometer and that the results are in agreement with conventional scattering theory.

  10. Chemistry of high-energy materials

    Energy Technology Data Exchange (ETDEWEB)

    Klapoetke, Thomas M. [Ludwig-Maximilians-Univ., Muenchen (Germany). Dept. of Chemistry; Maryland Univ., College Park, MD (US). Center of Energetic Concepts Development (CECD)


    The graduate-level textbook Chemistry of High-Energy Materials provides an introduction to and an overview of primary and secondary (high) explosives as well as propellant charges, rocket propellants and pyrotechnics. After a brief historical overview, the main classes of energetic materials are discussed systematically. Thermodynamic aspects, as far as relevant to energetic materials, are discussed, as well as modern computational approaches to predict performance and sensitivity parameters. The most important performance criteria such as detonation velocity, detonation pressure and heat of explosion, as well as the relevant sensitivity parameters suc as impact and friction sensitivity and electrostatic discharge sensitivity are explored in detail. Modern aspects of chemical synthesis including lead-free primary explosives and high-nitrogen compounds are also included in this book together with a discussion of high-energy materials for future defense needs. The most important goal of this book, based on a lecture course which has now been held at LMU Munich for over 12 years, is to increase knowledge and know-how in the synthesis and safe handling of high-energy materials. Society needs now as much as ever advanced explosives, propellant charges, rocket propellants and pyrotechnics to meet the demands in defense and engineering. This book is first and foremost aimed at advanced students in chemistry, engineering and materials sciences. However, it is also intended to provide a good introduction to the chemistry of energetic materials and chemical defense technology for scientists in the defense industry and government-run defense organizations. (orig.)

  11. Intermediate/high energy nuclear physics

    International Nuclear Information System (INIS)

    Vary, J.P.


    Progress during the last year is reviewed under the following topics: relativistic hadron--nucleus and nucleus--nucleus collisions (heavy meson production, photon production and fragmentation functions--direct photon production with the QCM and photon fragmentation functions, Cronin efffect and multiple scattering, effective nuclear parton distributions); solving quantum field theories in nonperturbative regime; light-front dynamics and high-spin states (soft form factor of the pion and nucleon for transverse and longitudinal momentum transfers, light front spinors for high-spin objects); high-energy spin physics; relativistic wave equations, quarkonia, and e + e - resonances; associated production of Higgs boson at collider energies, and microscopic nuclear many-body theory and reactions. 135 refs

  12. Radiation monitoring in high energy research facility

    International Nuclear Information System (INIS)

    Miyajima, Mitsuhiro


    In High Energy Physics Research Laboratory, construction of high energy proton accelerator is in progress. The accelerator is a cascaded machine comprising Cockcroft type (50 keV), linac (20 MeV), booster synchrotron (500 MeV), and synchrotron (8-12 GeV). Its proton beam intensity is 1x10 13 photons/pulse, and acceleration is carried out at the rate of every 2 minutes. The essential problems of radiation control in high energy accelerators are those of various radiations generated secondarily by proton beam and a number of induced radiations simultaneously originated with such secondary particles. In the Laboratory, controlled areas are divided into color-coded four regions, red, orange, yellow and green, based on each dose-rate. BF 3 counters covered with thick paraffin are used as neutron detectors, and side-window GM tubes, NaI (Tl) scintillators and ionization chambers as γ-detectors. In red region, however, ionization chambers are applied to induced radiation detection, and neutrons are not monitored. NIM standards are adopted for the circuits of all above monitors considering easy maintenance, economy and interchangeability. Notwithstanding the above described systems, these monitors are not sufficient to complete the measurement of whole radiations over wide energy region radiated from the accelerators. Hence separate radiation field measurement is required periodically. An example of the monitoring systems in National Accelerator Laboratory (U.S.) is referred at the last section. (Wakatsuki, Y.)

  13. Proposal for a High Energy Nuclear Database

    International Nuclear Information System (INIS)

    Brown, David A.; Vogt, Ramona


    We propose to develop a high-energy heavy-ion experimental database and make it accessible to the scientific community through an on-line interface. This database will be searchable and cross-indexed with relevant publications, including published detector descriptions. Since this database will be a community resource, it requires the high-energy nuclear physics community's financial and manpower support. This database should eventually contain all published data from Bevalac and AGS to RHIC to CERN-LHC energies, proton-proton to nucleus-nucleus collisions as well as other relevant systems, and all measured observables. Such a database would have tremendous scientific payoff as it makes systematic studies easier and allows simpler benchmarking of theoretical models to a broad range of old and new experiments. Furthermore, there is a growing need for compilations of high-energy nuclear data for applications including stockpile stewardship, technology development for inertial confinement fusion and target and source development for upcoming facilities such as the Next Linear Collider. To enhance the utility of this database, we propose periodically performing evaluations of the data and summarizing the results in topical reviews

  14. Rare earth magnets with high energy products

    International Nuclear Information System (INIS)

    Hirosawa, S.; Kaneko, Y.


    High energy-products exceeding 430 kj/m 3 (54 MGOe) have been realized on anisotropic permanent magnets based on the Nd 2 Fe 14 B phase, recently. To produce extremely high-energy-product permanent magnets, special processes have been designed in order to realize the minimum oxygen content, the maximum volume fraction of the hard magnetic Nd 2 Fe 14 B phase, the highest orientation of the easy axis of magnetization, and small and homogeneous crystalline grain sizes in the finished magnets. For the powder metallurgical process, special techniques such as low-oxygen fine powder processing and magnetic alignment using pulsed magnetic fields have been developed. It has been shown that a good control of both homogeneity of distribution of constituent phases and the narrowness of the size distribution in the starting powder have great influences on the magnetic energy products. It is emphasized that the recently developed techniques are applicable in a large-scale production, meaning that extremely high-energy-product magnets are available on commercial basis. (orig.)

  15. High-Energy Beam Transport system

    International Nuclear Information System (INIS)

    Melson, K.E.; Farrell, J.A.; Liska, D.J.


    The High-Energy Beam Transport (HEBT) system for the Fusion Materials Irradiation Test (FMIT) Facility is to be installed at the Hanford Engineering Development Laboratory (HEDL) at Richland, Washington. The linear accelerator must transport a large emittance, high-current, high-power, continuous-duty deuteron beam with a large energy spread either to a lithium target or a beam stop. A periodic quadrupole and bending-magnet system provides the beam transport and focusing on target with small beam aberrations. A special rf cavity distributes the energy in the beam so that the Bragg Peak is distributed within the lithium target. Operation of the rf control system, the Energy Dispersion Cavity (EDC), and the beam transport magnets is tested on the beam stop during accelerator turn-on. Characterizing the beam will require extensions of beam diagnostic techniques and noninterceptive sensors. Provisions are being made in the facility for suspending the transport system from overhead supports using a cluster system to simplify maintenance and alignment techniques

  16. A high-energy nuclear database proposal

    International Nuclear Information System (INIS)

    Brown, D.A.; Vogt, R.; UC Davis, CA


    We propose to develop a high-energy heavy-ion experimental database and make it accessible to the scientific community through an on-line interface. This database will be searchable and cross-indexed with relevant publications, including published detector descriptions. Since this database will be a community resource, it requires the high-energy nuclear physics community's financial and manpower support. This database should eventually contain all published data from the Bevalac, AGS and SPS to RHIC and LHC energies, proton-proton to nucleus-nucleus collisions as well as other relevant systems, and all measured observables. Such a database would have tremendous scientific payoff as it makes systematic studies easier and allows simpler benchmarking of theoretical models to a broad range of old and new experiments. Furthermore, there is a growing need for compilations of high-energy nuclear data for applications including stockpile stewardship, technology development for inertial confinement fusion and target and source development for upcoming facilities such as the Next Linear Collider. To enhance the utility of this database, we propose periodically performing evaluations of the data and summarizing the results in topical reviews. (author)

  17. Proposal for a High Energy Nuclear Database

    International Nuclear Information System (INIS)

    Brown, D A; Vogt, R


    The authors propose to develop a high-energy heavy-ion experimental database and make it accessible to the scientific community through an on-line interface. This database will be searchable and cross-indexed with relevant publications, including published detector descriptions. Since this database will be a community resource, it requires the high-energy nuclear physics community's financial and manpower support. This database should eventually contain all published data from Bevalac, AGS and SPS to RHIC and CERN-LHC energies, proton-proton to nucleus-nucleus collisions as well as other relevant systems, and all measured observables. Such a database would have tremendous scientific payoff as it makes systematic studies easier and allows simpler benchmarking of theoretical models to a broad range of old and new experiments. Furthermore, there is a growing need for compilations of high-energy nuclear data for applications including stockpile stewardship, technology development for inertial confinement fusion and target and source development for upcoming facilities such as the Next Linear Collider. To enhance the utility of this database, they propose periodically performing evaluations of the data and summarizing the results in topical reviews

  18. Experimental microdosimetry in high energy radiation fields

    International Nuclear Information System (INIS)

    Spurny, F.; Bednar, J.; Vlcek, B.; Bottollier-Depois, J.-F.; Molokanov, A.G.


    To determine microdosimetric characteristics in the beams and fields of high energy panicles with the goal, also, to compare the classical method of experimental microdosimetry, a tissue equivalent low pressure proportional counter (TEPC) with the linear energy transfer (LET) spectrometer based on a chemically etched polyallyldiglycolcarbonate as a track etched detector (TED). To test the use of TED LET spectrometer in the conditions, where the use or TEPC is not possible (high energy charged particle beams at high dose rates). The results obtained with the TEPC NAUSICAA were used in this work to compare them with other data. This TEPC measures directly the linear energy in the interval between 0.15 and 1500 keV/μm in tissue, the low gas pressure (propan based TE mixture) permits to simulate a tissue element of about 3 μm. It can be used in the fields with instantaneous dose equivalent rates between 1 μSv/hour and 1 mSv/ hour. TED LET spectrometer developed to determine LET spectra between 10 and 700 keV/μm in tissue. Primarily, track-to-bulk etch rate ratios are determined through the track parameters measurements, the spectra of these ratios are convened to LET spectra using the calibration curve established by means of heavy charge panicles. The critical volume of thi spectrometer is supposed to be a few nm. There is no limit of use for the dose rate, the background tracks limit the lowest threshold to about 1 mSv, the overlapping of tracks (the highest one) to 100 mSv. Both experimental microdosimetry methods have been used in on board aircraft radiation fields, in on-Earth high energy radiation reference fields, and in the beams of protons with energies up to 300 MeV (Dubna, Moscow, Loma Linda). First, it should be emphasized, that in all high energy radiation fields studied, we concentrated our analysis on the region, where both methods overlap, i.e. between 10 and 1000 keV/μm in tissue. It should be also stressed, that the events observed in this region

  19. Ionization of atoms by high energy photons

    International Nuclear Information System (INIS)

    Amusia, M.Y.; Ioffe, A.F.


    Photoionization of atoms by high energy photons is considered. It is emphasized that in this frequency region the cross section and other characteristics of the process are strongly effected by electron shell polarization and rearrangement effects, including that due to inner vacancy Auger decay. In the effects of nuclear structure could be important and noticeable, i.e. of virtual or real excitation of the nucleus degrees of freedom and of the Quantum Electrodynamics vacuum. Ionization accompanied by secondary photon emission (Compton ionization) is analyzed in the considered domain of energies

  20. High energy photons production in nuclear reactions

    International Nuclear Information System (INIS)

    Nifenecker, H.; Pinston, J.A.


    Hard photon production, in nucleus-nucleus collisions, were studied at beam energies between 10 and 125 MeV. The main characteristics of the photon emission are deduced. They suggest that the neutron-proton collisions in the early stage of the reaction are the main source of high energy gamma-rays. An overview of the theoretical approaches is given and compared with experimental results. Theoretical attempts to include the contribution of charged pion exchange currents to photon production, in calculations of proton-nucleus-gamma and nucleus-nucleus-gamma reactions, showed suitable fitting with experimental data

  1. Models of high energy nuclear collisions

    International Nuclear Information System (INIS)

    Glendenning, N.K.


    The discussion covers nuclear collisions at relativistic energies including classes of high energy nucleus--nucleus collisions, and the kinetics of a central collision; and the asymptotic hadron spectrum including known and unknown hadrons, the relevance of the spectrum and the means of its study, thermodynamics of hadronic matter, examples of hadronic spectra, the temperature, composition of the initial fireball and its expansion, isoergic expansion with no pre-freezeout radiation, isentropic expansion of the fireball, the quasi-dynamical expansion, and finally antinuclei, hypernuclei, and the quark phase. 28 references

  2. Indirect searches of dark matter, and the galactic center at very high energy with H.E.S.S

    International Nuclear Information System (INIS)

    Viana, Aion


    H.E.S.S. (High Energy Stereoscopic System) is an array of four identical imaging atmospheric Cherenkov telescopes, designed to observe very high energy γ-rays (E > 100 GeV). The observation of such γ-rays plays a crucial role in the understanding of extreme non-thermal phenomena in the Universe. These γ-rays can be used for instance to search for annihilations of dark matter particles in dense environments of the Universe. This thesis presents a series of data analysis and phenomenological studies on two main subject of the γ-ray astronomy: the indirect searches of dark matter, and the study of the Galactic Center region. The indirect dark matter searches focus on the study of two classes of targets: dwarf galaxies and galaxy clusters. A detailed study of the H.E.S.S. observations towards the Sculptor and Carina dwarf galaxies, and towards the Fornax galaxy cluster are presented. In the absence, of a significant signal coming from these object, constraints on the annihilation cross section of dark matter particle candidates are derived. Particular consideration is given to different processes from particle physics and astrophysics which might give rise to additional contributions to the signal expected from a dark matter particle annihilation, such as the Sommerfeld effect and dark matter halo substructures. The current H.E.S.S. dark matter constraints towards the Sagittarius are updated in light of recent realistic dark matter halo models. A prospect on the sensitivity of the future generation of Cherenkov telescopes, i.e. CTA (Cherenkov Telescope Array), for the detection of a dark matter annihilation signal and conventional γ-ray emissions are also given. The second subject of this thesis provides a detailed analysis of the VHE γ-ray data from the Galactic Center region observed by H.E.S.S. This was possible thanks to the deep exposure of this region, achieved by the H.E.S.S. experiment throughout the 2004-2011 period. The analysis and spectral

  3. High temperature underground thermal energy storage system for solar energy (United States)

    Collins, R. E.


    The activities feasibility of high temperature underground thermal storage of energy was investigated. Results indicate that salt cavern storage of hot oil is both technically and economically feasible as a method of storing huge quantities of heat at relatively low cost. One particular system identified utilizes a gravel filled cavern leached within a salt dome. Thermal losses are shown to be less than one percent of cyclically transferred heat. A system like this having a 40 MW sub t transfer rate capability and over eight hours of storage capacity is shown to cost about $13.50 per KWh sub t.

  4. First high energy hydrogen cluster beams

    International Nuclear Information System (INIS)

    Gaillard, M.J.; Genre, R.; Hadinger, G.; Martin, J.


    The hydrogen cluster accelerator of the Institut de Physique Nucleaire de Lyon (IPN Lyon) has been upgraded by adding a Variable Energy Post-accelerator of RFQ type (VERFQ). This operation has been performed in the frame of a collaboration between KfK Karlsruhe, IAP Frankfurt and IPN Lyon. The facility has been designed to deliver beams of mass selected Hn + clusters, n chosen between 3 and 49, in the energy range 65-100 keV/u. For the first time, hydrogen clusters have been accelerated at energies as high as 2 MeV. This facility opens new fields for experiments which will greatly benefit from a velocity range never available until now for such exotic projectiles. (author) 13 refs.; 1 fig

  5. Production processes at extremely high energies

    CERN Document Server

    Gastmans, R; Wu, Tai Tsun


    The production processes are identified that contribute to the rise of the total cross section in proton-proton scattering at extremely high energies, s->~. At such energies, the scattering can be described by a black disk (completely absorptive) with a radius expanding logarithmically with energy surrounded by a gray fringe (partially absorptive). For the leading term of (lns)^2 in the increasing total cross section, the gray fringe is neglected, and geometrical optics is generalized to production processes. It is known that half of the rise in the total cross section is due to elastic scattering. The other half is found to originate from the production of jets with relatively small momenta in the center-of-mass system.

  6. Energy harvesting in high voltage measuring techniques

    International Nuclear Information System (INIS)

    Żyłka, Pawel; Doliński, Marcin


    The paper discusses selected problems related to application of energy harvesting (that is, generating electricity from surplus energy present in the environment) to supply autonomous ultra-low-power measurement systems applicable in high voltage engineering. As a practical example of such implementation a laboratory model of a remote temperature sensor is presented, which is self-powered by heat generated in a current-carrying busbar in HV- switchgear. Presented system exploits a thermoelectric harvester based on a passively cooled Peltier module supplying micro-power low-voltage dc-dc converter driving energy-efficient temperature sensor, microcontroller and a fibre-optic transmitter. Performance of the model in laboratory simulated conditions are presented and discussed. (paper)

  7. PASOTRON high-energy microwave source (United States)

    Goebel, Dan M.; Schumacher, Robert W.; Butler, Jennifer M.; Hyman, Jay, Jr.; Santoru, Joseph; Watkins, Ron M.; Harvey, Robin J.; Dolezal, Franklin A.; Eisenhart, Robert L.; Schneider, Authur J.


    A unique, high-energy microwave source, called PASOTRON (Plasma-Assisted Slow-wave Oscillator), has been developed. The PASOTRON utilizes a long-pulse E-gun and plasma- filled slow-wave structure (SWS) to produce high-energy pulses from a simple, lightweight device that utilizes no externally produced magnetic fields. Long pulses are obtained from a novel E-gun that employs a low-pressure glow discharge to provide a stable, high current- density electron source. The electron accelerator consists of a high-perveance, multi-aperture array. The E-beam is operated in the ion-focused regime where the plasma filling the SWS space-charge neutralizes the beam, and the self-pinch force compresses the beamlets and increases the beam current density. A scale-model PASOTRON, operating as a backward- wave oscillator in C-band with a 100-kV E-beam, has produced output powers in the 3 to 5 MW range and pulse lengths of over 100 microsecond(s) ec, corresponding to an integrated energy per pulse of up to 500 J. The E-beam to microwave-radiation power conversion efficiency is about 20%.

  8. Search for very high energy gamma-ray emission from the peculiar radio galaxy IC 310 with TACTIC during 2012 to 2015 (United States)

    Ghosal, B.; Singh, K. K.; Yadav, K. K.; Tickoo, A. K.; Rannot, R. C.; Chandra, P.; Kothari, M.; Gaur, K. K.; Goyal, H. C.; Goyal, A.; Kumar, N.; Marandi, P.; Chanchalani, K.; Agarwal, N. K.; Dhar, V. K.; Koul, M. K.; Koul, R.; Venugopal, K.; Bhat, C. K.; Chouhan, N.; Borwankar, C.; Kaul, S. R.; Bhatt, H.; Agarwal, A.; Gupta, A. C.


    Non-blazar active galactic nuclei like radio galaxies have emerged as a new class of γ-ray sources in the sky. Observations of very high energy (VHE) γ-rays from radio galaxies with misaligned jets offer a unique tool to understand the physical processes involved in these type of objects. In this work, we present the results of our observations of the nearby peculiar radio galaxy IC 310 (z = 0.0189) with TACTIC telescope for nearly 95.5 hours from 03 December, 2012 to 19 January, 2015 (MJD 56265 - 57041). Detailed analysis of the data reveals absence of a statistically significant γ-ray signal from the source direction (both on the overall period and on yearly basis). Our results suggest that the source was possibly in a low-TeV emission state (below the TACTIC sensitivity level) during the above mentioned observation period and the resulting 3σ upper limit on the integral flux above 850 GeV has been estimated to be 4.99 ×10-12phcm-2s-1 (23% of the Crab Nebula flux). Analysis of the contemporaneous data collected by Fermi-LAT in the 30 - 300 GeV energy range, also indicate the absence of a statistically significant γ-ray signal, therefore 2σ upper limit on the integral flux above 30 GeV has been estimated on yearly basis. We also report the results from dedicated optical observations in B, V and R bands from ARIES observatory carried out from December, 2014 to March, 2015.

  9. High energy multi-cycle terahertz generation

    International Nuclear Information System (INIS)

    Ahr, Frederike Beate


    Development of compact electron accelerators and free-electron lasers requires novel acceleration schemes at shorter driving wavelengths. The Axsis project seeks to develop terahertz based electron acceleration as well as the high energy terahertz sources required. This thesis explores the methods and optical material required for the generation of highenergy multi-cycle terahertz pulses. Two experimental concepts to generate high energy terahertz radiation are presented. In addition the theoretical background and the optical properties of pertinent optical materials in the terahertz range are discussed. Investigations of the materials are performed with a terahertz time domain spectrometer and a Fourier transform infrared spectrometer. The nonlinear optical crystal lithium niobate as well as other crystals suitable for the terahertz generation and in addition polymers and other radiation attenuators are characterized in the range from 0.2 to 1 THz. The theory describing the generation of narrowband terahertz radiation is evaluated. The experimental setups to generate terahertz radiation and to characterize its properties are described. The specific crystals - periodically poled lithium niobate (PPLN) - used in the experiments to generate the multi-cycle terahertz radiation are examined to determine e.g. the poling period. The first experimental concept splits the ultra fast, broadband pump pulses into a pulse train in order to pump the PPLN at a higher fluence while increasing the damage limit. The measurements confirm that a pulse train of ultra short, broadband pump pulses increases not only the terahertz energy but also the energy conversion efficiency. The second experimental concept utilizes chirped and delayed infrared laser pulses. This pulse format makes it possible to pump the crystal with high energy pulses resulting in high energy terahertz radiation. The concept is optimized to reach energies up to 127 μJ exceeding the existing results of narrowband

  10. High energy multi-cycle terahertz generation

    Energy Technology Data Exchange (ETDEWEB)

    Ahr, Frederike Beate


    Development of compact electron accelerators and free-electron lasers requires novel acceleration schemes at shorter driving wavelengths. The Axsis project seeks to develop terahertz based electron acceleration as well as the high energy terahertz sources required. This thesis explores the methods and optical material required for the generation of highenergy multi-cycle terahertz pulses. Two experimental concepts to generate high energy terahertz radiation are presented. In addition the theoretical background and the optical properties of pertinent optical materials in the terahertz range are discussed. Investigations of the materials are performed with a terahertz time domain spectrometer and a Fourier transform infrared spectrometer. The nonlinear optical crystal lithium niobate as well as other crystals suitable for the terahertz generation and in addition polymers and other radiation attenuators are characterized in the range from 0.2 to 1 THz. The theory describing the generation of narrowband terahertz radiation is evaluated. The experimental setups to generate terahertz radiation and to characterize its properties are described. The specific crystals - periodically poled lithium niobate (PPLN) - used in the experiments to generate the multi-cycle terahertz radiation are examined to determine e.g. the poling period. The first experimental concept splits the ultra fast, broadband pump pulses into a pulse train in order to pump the PPLN at a higher fluence while increasing the damage limit. The measurements confirm that a pulse train of ultra short, broadband pump pulses increases not only the terahertz energy but also the energy conversion efficiency. The second experimental concept utilizes chirped and delayed infrared laser pulses. This pulse format makes it possible to pump the crystal with high energy pulses resulting in high energy terahertz radiation. The concept is optimized to reach energies up to 127 μJ exceeding the existing results of narrowband

  11. Shielding for high energy, high intensity electron accelerator installation

    International Nuclear Information System (INIS)

    Warawas, C.; Chongkum, S.


    The utilization of electron accelerators (eBA) is gradually increased in Thailand. For instance, a 30-40 MeV eBA are used for tumor and cancer therapy in the hospitals, and a high current eBA in for gemstone colonization. In the near future, an application of eBA in industries will be grown up in a few directions, e.g., flue gases treatment from the coal fire-power plants, plastic processing, rubber vulcanization and food preservation. It is the major roles of Office of Atomic Energy for Peace (OAEP) to promote the peaceful uses of nuclear energy and to regulate the public safety and protection of the environment. By taking into account of radiation safety aspect, high energy electrons are not only harmful to human bodies, but the radioactive nuclides can be occurred. This report presents a literature review by following the National Committee on Radiation Protection and Measurements (NCRP) report No.31. This reviews for parametric calculation and shielding design of the high energy (up to 100 MeV), high intensity electron accelerator installation

  12. The evolution of high energy accelerators

    International Nuclear Information System (INIS)

    Courant, E.D.


    Accelerators have been devised and built for two reasons: In the first place, by physicists who needed high energy particles in order to have a means to explore the interactions between particles that probe the fundamental elementary forces of nature. And conversely, sometimes accelerator builders produce new machines for higher energy than ever before just because it can be done, and then challenge potential users to make new discoveries with the new means at hand. These two approaches or motivations have gone hand in hand. This lecture traces how high energy particle accelerators have grown from tools used for esoteric small-scale experiments to the gigantic projects of today. So far all the really high-energy machines built and planned in the world--except the SLC--have been ring accelerators and storage rings using the strong-focusing method. But this method has not removed the energy limit, it has only pushed it higher. It would seem unlikely that one can go beyond the Large Hadron Collider (LHC)--but in fact a workshop was held in Sicily in November 1991, concerned with the question of extrapolating to 100 TeV. Other acceleration and beam-forming methods are now being discussed--collective fields, laser acceleration, wake-field accelerators etc., all aimed primarily at making linear colliders possible and more attractive than with present radiofrequency methods. So far it is not entirely clear which of these schemes will dominate particle physics in the future--maybe something that has not been thought of as yet

  13. [Experimental and theoretical high energy physics

    International Nuclear Information System (INIS)

    Boulware, D.


    We are carrying out a research program in high energy experimental particle physics. Studies of high energy hadronic interactions and leptoproduction processes continue using several experimental techniques. Progress has been made on the study of multiparticle production processes in nuclei. Ultra-high energy cosmic ray nucleus-nucleus interactions have been investigated by the Japanese American Cosmic Emulsion Experiment (JACEE) using balloon-borne emulsion chamber detectors. In the area of particle astrophysics, our studies of cosmic ray nuclear interactions have enabled us to make the world's most accurate determination of the composition of the cosmic rays above 10 13 eV. We have the only detector that can observe interaction vertices and identify particles at energies up to 10--15 eV. Our observations are getting close to placing limits on the acceleration mechanisms postulated for pulsars in which the spin and magnetic moment axes are at different angles. In June, 1989 approval was given by NASA for our participation in the Space Station program. The SCINATT experiment will make use of emulsion chamber detectors, similar to the planned JACEE hybrid balloon flight detectors. These detectors will permit precise determination of secondary particle charges, momenta and rapidities, and the accumulation of data will be at least a factor of 10 to 100 greater than in balloon experiments. Emulsion chamber techniques are also employed in an experiment using accelerator heavy ion beams at CERN and Brookhaven National Laboratory to investigate particle production processes in central collisions of nuclei in the energy range 15--200A GeV. Our study of hadroproduction in lepton interactions is continuing with approval of another 8 months run for deep inelastic muon scattering experiment E665 at Fermilab

  14. [Studies of high energy phenomena using muons

    International Nuclear Information System (INIS)

    Albanese, R.C.


    This report covers the activities of the NIU high energy physics group as supported by DOE contract AC02-87ER40368 during the period from March--December of 1990. Our group has two primary efforts. The first is the D0 experiment at the Fermilab proton-antiproton collider, with major emphasis on its muon system. The second is the involvement of a portion of the group in Fermilab Experiments 772 and 789. Finally, we are also participating in the design of detectors for the SSC. A more detailed description of the work of the NIU high energy physics group may be found in the narrative accompanying our contract renewal proposal

  15. [Studies of high energy phenomena using muons

    International Nuclear Information System (INIS)


    This report covers the activities of the NIU high energy physics group as supported by DOE contract AC02-87ER40368 during the period from March through December of 1990. Our group has two primary efforts. The first is the D0 experiment at the Fermilab proton-antiproton collider, with major emphasis on its muon system. The second is the involvement of a portion of the group in Fermilab Experiments 772 and 789. Finally, we are also participating in the design of detectors for the SSC. A more detailed description of the work of the NIU high energy physics group may be found in the narrative accompanying our contract renewal proposal

  16. Studies of high energy phenomena using muons

    International Nuclear Information System (INIS)

    Hedin, D.; Kaplan, D.; Green, J.


    This report covers the activities of the NIU high energy physics group as supported by DOE contact AC02-87ER40368 during the period from March of 1989 to February of 1990. Our group has two primary efforts. The first is the D0 experiment at the Fermilab proton-antiproton collider, with major emphasis on its muon system. The second is the involvement of a precision study of the A-dependence of massive muon-pion production and a study of low-multiplicity decay modes of charm. We are also participating in the design of detectors for the SSC. Finally, a minor effort is being given to analyzing data from Fermilab of particles with lifetime between 10 -12 and 10 -13 seconds. A more detailed description of the work of the NIU high energy physics group can be found in the narrative accompanying our grant renewal proposal. 10 refs

  17. Prospects of High Energy Laboratory Astrophysics

    International Nuclear Information System (INIS)

    Ng, Johnny S.T.; SLAC


    Ultra high energy cosmic rays (UHECR) have been observed but their sources and production mechanisms are yet to be understood. We envision a laboratory astrophysics program that will contribute to the understanding of cosmic accelerators with efforts to: (1) test and calibrate UHECR observational techniques, and (2) elucidate the underlying physics of cosmic acceleration through laboratory experiments and computer simulations. Innovative experiments belonging to the first category have already been done at the SLAC FFTB. Results on air fluorescence yields from the FLASH experiment are reviewed. Proposed future accelerator facilities can provided unprecedented high-energy-densities in a regime relevant to cosmic acceleration studies and accessible in a terrestrial environment for the first time. We review recent simulation studies of nonlinear plasma dynamics that could give rise to cosmic acceleration, and discuss prospects for experimental investigation of the underlying mechanisms

  18. Compilation of current high energy physics experiments

    International Nuclear Information System (INIS)


    This compilation of current high-energy physics experiments is a collaborative effort of the Berkeley Particle Data Group, the SLAC library, and the nine participating laboratories: Argonne (ANL), Brookhaven (BNL), CERN, DESY, Fermilab (FNAL), KEK, Rutherford (RHEL), Serpukhov (SERP), and SLAC. Nominally, the compilation includes summaries of all high-energy physics experiments at the above laboratories that were approved (and not subsequently withdrawn) before about June 1978, and had not completed taking of data by 1 January 1975. The experimental summaries are supplemented with three indexes to the compilation, several vocabulary lists giving names or abbreviations used, and a short summary of the beams at each of the laboratories (except Rutherford). The summaries themselves are included on microfiche

  19. A Parton Shower for High Energy Jets

    CERN Document Server

    Andersen, Jeppe R; Smillie, Jennifer M


    We present a method to match the multi-parton states generated by the High Energy Jets Monte Carlo with parton showers generated by the Ariadne program using the colour dipole model. The High Energy Jets program already includes a full resummation of soft divergences. Hence, in the matching it is important that the corresponding divergences in the parton shower are subtracted, keeping only the collinear parts. We present a novel, shower-independent method for achieving this, enabling us to generate fully exclusive and hadronized events with multiple hard jets, in hadronic collisions. We discuss in detail the arising description of the soft, collinear and hard regions by examples in pure QCD jet-production.

  20. Bell inequalities in high energy physics

    International Nuclear Information System (INIS)

    Ding Yibing; Li Junli; Qiao Congfeng


    We review in this paper the research status on testing the completeness of Quantum mechanics in High Energy Physics, especially on the Bell Inequalities. We briefly introduce the basic idea of Einstein, Podolsky, and Rosen paradox and the results obtained in photon experiments. In the content of testing the Bell inequalities in high energy physics, the early attempts of using spin correlations in particle decays and later on the mixing of neutral mesons used to form the quasi-spin entangled states are covered. The related experimental results in K 0 and B 0 systems are presented and discussed. We introduce the new scheme, which is based on the non-maximally entangled state and proposed to implement in φ factory, in testing the Local Hidden Variable Theory. And, we also discuss about the possibility of realising it to the tau charm factory. (authors)

  1. Origin of the universe and high energy

    International Nuclear Information System (INIS)

    Montoya Z, M.


    In this book it is briefly exposed what it is done in the world in relation with the high energy physics. Also, it is presented a brief historical description of the earth evolution, the universe and physics in general. This book counts with eight chapters. The first chapter deals with the relationship of man with science. The second chapter speaks about the origin of universe. The third chapter comments about the stars and galaxies formation. The fourth chapter treats how the scientists and researchers continue to studying the subnuclear world. The fifth chapter deals with subjects and models of nuclear physics. In the sixth chapter it is described the function of the particles accelerator. The seventh chapter comments about the multidisciplinary aspects of the research of elementary particles. Finally, the eighth chapter deals with the advances of high energy physics in the andean region of Latin America. (author)

  2. New Prospects in High Energy Astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Blandford, Roger; /KIPAC, Menlo Park


    Recent discoveries using TeV, X-ray and radio telescopes as well as Ultra High Energy Cosmic Ray arrays are leading to new insights into longstanding puzzles in high energy astrophysics. Many of these insights come from combining observations throughout the electromagnetic and other spectra as well as evidence assembled from different types of source to propose general principles. Issues discussed in this general overview include methods of accelerating relativistic particles, and amplifying magnetic field, the dynamics of relativistic outflows and the nature of the prime movers that power them. Observational approaches to distinguishing hadronic, leptonic and electromagnetic outflows and emission mechanisms are discussed along with probes of the velocity field and the confinement mechanisms. Observations with GLAST promise to be very prescriptive for addressing these problems.

  3. High energy materials. Propellants, explosives and pyrotechnics

    Energy Technology Data Exchange (ETDEWEB)

    Agrawal, Jai Prakash


    Authored by an insider with over 40 years of high energy materials (HEMs) experience in academia, industry and defence organizations, this handbook and ready reference covers all important HEMs from the 1950s to the present with their respective properties and intended purposes. Written at an attainable level for professionals, engineers and technicians alike, the book provides a comprehensive view of the current status and suggests further directions for research and development. An introductory chapter on the chemical and thermodynamic basics allows the reader to become acquainted with the fundamental features of explosives, before moving on to the important safety aspects in processing, handling, transportation and storage of high energy materials. With its collation of results and formulation strategies hitherto scattered in the literature, this should be on the shelf of every HEM researcher and developer. (orig.)

  4. Very high energy gamma-ray astronomy

    International Nuclear Information System (INIS)

    Weekes, T.C.


    Current interest in gamma-ray astronomy at energies above 100 GeV comes from the identification of Cygnus X-3 and other X-ray binaries as sources. In addition there are reports of emission from radio pulsars and a variety of other objects. The statistical significance of many of the observations is not high and many reported effects await confirmation, but there are a sufficient number of independent reports that very high energy gamma-ray astronomy must now be considered to have an observational basis. The observations are summarized with particular emphasis on those reported since 1980. The techniques used - the detection of small air showers using the secondary photons and particles at ground level - are unusual and are described. Future prospects for the field are discussed in relation to new ground-based experiments, satellite gamma-ray studies and proposed neutrino astronomy experiments. (orig.) With 296 refs

  5. Unparticles: Scales and high energy probes

    International Nuclear Information System (INIS)

    Bander, Myron; Feng, Jonathan L.; Rajaraman, Arvind; Shirman, Yuri


    Unparticles from hidden conformal sectors provide qualitatively new possibilities for physics beyond the standard model. In the theoretical framework of minimal models, we clarify the relation between energy scales entering various phenomenological analyses. We show that these relations always counteract the effective field theory intuition that higher dimension operators are more highly suppressed, and that the requirement of a significant conformal window places strong constraints on possible unparticle signals. With these considerations in mind, we examine some of the most robust and sensitive probes and explore novel effects of unparticles on gauge coupling evolution and fermion production at high energy colliders. These constraints are presented both as bounds on four-fermion interaction scales and as constraints on the fundamental parameter space of minimal models

  6. High Energy Vibration for Gas Piping (United States)

    Lee, Gary Y. H.; Chan, K. B.; Lee, Aylwin Y. S.; Jia, ShengXiang


    In September 2016, a gas compressor in offshore Sarawak has its rotor changed out. Prior to this change-out, pipe vibration study was carried-out by the project team to evaluate any potential high energy pipe vibration problems at the compressor’s existing relief valve downstream pipes due to process condition changes after rotor change out. This paper covers high frequency acoustic excitation (HFAE) vibration also known as acoustic induced vibration (AIV) study and discusses detailed methodologies as a companion to the Energy Institute Guidelines for the avoidance of vibration induced fatigue failure, which is a common industry practice to assess and mitigate for AIV induced fatigue failure. Such detailed theoretical studies can help to minimize or totally avoid physical pipe modification, leading to reduce offshore plant shutdown days to plant shutdowns only being required to accommodate gas compressor upgrades, reducing cost without compromising process safety.

  7. Maximal Entanglement in High Energy Physics

    Directory of Open Access Journals (Sweden)

    Alba Cervera-Lierta, José I. Latorre, Juan Rojo, Luca Rottoli


    Full Text Available We analyze how maximal entanglement is generated at the fundamental level in QED by studying correlations between helicity states in tree-level scattering processes at high energy. We demonstrate that two mechanisms for the generation of maximal entanglement are at work: i $s$-channel processes where the virtual photon carries equal overlaps of the helicities of the final state particles, and ii the indistinguishable superposition between $t$- and $u$-channels. We then study whether requiring maximal entanglement constrains the coupling structure of QED and the weak interactions. In the case of photon-electron interactions unconstrained by gauge symmetry, we show how this requirement allows reproducing QED. For $Z$-mediated weak scattering, the maximal entanglement principle leads to non-trivial predictions for the value of the weak mixing angle $\\theta_W$. Our results are a first step towards understanding the connections between maximal entanglement and the fundamental symmetries of high-energy physics.

  8. High-energy ion implantation of materials

    International Nuclear Information System (INIS)

    Williams, J.M.


    High-energy ion implantation is an extremely flexible type of surface treatment technique, in that it offers the possibility of treating almost any type of target material or product with ions of almost any chemical species, or combinations of chemical species. In addition, ion implantations can be combined with variations in temperature during or after ion implantation. As a result, the possibility of approaching a wide variety of surface-related materials science problems exists with ion implantation. This paper will outline factors pertinent to application of high-energy ion implantation to surface engineering problems. This factors include fundamental advantages and limitations, economic considerations, present and future equipment, and aspects of materials science

  9. ANTARES: A High Energy Neutrino Undersea Telescope

    International Nuclear Information System (INIS)

    Hernandez, J.J.


    Neutrinos can reveal a brand new Universe at high energies. The ANTARES collaboration, formed in 1996, works towards the building and deployment of a neutrino telescope. This detector could observe and study high energy astrophysical sources such as X-ray binary systems, young supernova remnants or Active Galactic Nuclei and help to discover or set exclusion limits on some of the elementary particles and objects that have been put forward as candidates to fill the Universe (WIMPS, neutralinos, topological defects, Q-balls, etc.). A neutrino telescope will certainly open a new observational window and can shed light on the most energetic phenomena of the Universe. A review of the progress made by the ANTARES collaboration to achieve this goal is presented. (author)

  10. Power Supplies for High Energy Particle Accelerators (United States)

    Dey, Pranab Kumar


    The on-going research and the development projects with Large Hadron Collider at CERN, Geneva, Switzerland has generated enormous enthusiasm and interest amongst all to know about the ultimate findings on `God's Particle'. This paper has made an attempt to unfold the power supply requirements and the methodology adopted to provide the stringent demand of such high energy particle accelerators during the initial stages of the search for the ultimate particles. An attempt has also been made to highlight the present status on the requirement of power supplies in some high energy accelerators with a view that, precautionary measures can be drawn during design and development from earlier experience which will be of help for the proposed third generation synchrotron to be installed in India at a huge cost.

  11. High energy physics at UC Riverside

    International Nuclear Information System (INIS)


    This report discusses progress made for the following two tasks: experimental high energy physics, Task A, and theoretical high energy physics, Task B. Task A1 covers hadron collider physics. Information for Task A1 includes: personnel/talks/publications; D0: proton-antiproton interactions at 2 TeV; SDC: proton-proton interactions at 40 TeV; computing facilities; equipment needs; and budget notes. The physics program of Task A2 has been the systematic study of leptons and hadrons. Information covered for Task A2 includes: personnel/talks/publications; OPAL at LEP; OPAL at LEP200; CMS at LHC; the RD5 experiment; LSND at LAMPF; and budget notes. The research activities of the Theory Group are briefly discussed and a list of completed or published papers for this period is given

  12. Highly Compressed Ion Beams for High Energy Density Science

    CERN Document Server

    Friedman, Alex; Briggs, Richard J; Callahan, Debra; Caporaso, George; Celata, C M; Davidson, Ronald C; Faltens, Andy; Grant-Logan, B; Grisham, Larry; Grote, D P; Henestroza, Enrique; Kaganovich, Igor D; Lee, Edward; Lee, Richard; Leitner, Matthaeus; Nelson, Scott D; Olson, Craig; Penn, Gregory; Reginato, Lou; Renk, Tim; Rose, David; Sessler, Andrew M; Staples, John W; Tabak, Max; Thoma, Carsten H; Waldron, William; Welch, Dale; Wurtele, Jonathan; Yu, Simon


    The Heavy Ion Fusion Virtual National Laboratory (HIF-VNL) is developing the intense ion beams needed to drive matter to the High Energy Density (HED) regimes required for Inertial Fusion Energy (IFE) and other applications. An interim goal is a facility for Warm Dense Matter (WDM) studies, wherein a target is heated volumetrically without being shocked, so that well-defined states of matter at 1 to 10 eV are generated within a diagnosable region. In the approach we are pursuing, low to medium mass ions with energies just above the Bragg peak are directed onto thin target "foils," which may in fact be foams or "steel wool" with mean densities 1% to 100% of solid. This approach complements that being pursued at GSI, wherein high-energy ion beams deposit a small fraction of their energy in a cylindrical target. We present the requirements for warm dense matter experiments, and describe suitable accelerator concepts, including novel broadband traveling wave pulse-line, drift-tube linac, RF, and single-gap approa...

  13. High-Energy Compton Scattering Light Sources

    CERN Document Server

    Hartemann, Fred V; Barty, C; Crane, John; Gibson, David J; Hartouni, E P; Tremaine, Aaron M


    No monochromatic, high-brightness, tunable light sources currently exist above 100 keV. Important applications that would benefit from such new hard x-ray sources include: nuclear resonance fluorescence spectroscopy, time-resolved positron annihilation spectroscopy, and MeV flash radiography. The peak brightness of Compton scattering light sources is derived for head-on collisions and found to scale with the electron beam brightness and the drive laser pulse energy. This gamma 2

  14. Applications of SSNTD's in high energy physics

    International Nuclear Information System (INIS)

    Otterlund, I.


    Different applications of the emulsion technique in high energy physics are given. Investigations of heavy ion and proton-nucleus reactions with the conventional emulsion technique are presented together with a short interpretation of recent results. Methods of using nuclear emulsion with embedded targets will be discussed. Emulsion stacks in hybrid systems with electronic tagging suggest a new and interesting application of the emulsion technique. (Auth.)

  15. High-energy accelerators in medicine

    CERN Document Server

    Mandrillon, Pierre


    The treatment of tumours with charged particles, ranging from protons to "light ions" ( Carbon, Oxygen, Neon) has many advantages, but up to now has been little used because of the absence of facilities. After the successful pioneering work carried out with accelerators built for physics research, machines dedicated to this new radiotherapy are planned or already in construction. The rationale for this new radiotherapy, the high energy accelerators and the beam delivery systems are presented in these two lectures.

  16. An experimental high energy physics program

    International Nuclear Information System (INIS)

    Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.


    The theoretical and experimental high energy physics program is reviewed, including particle detectors. Topics discussed include τ and B physics, gamma-ray astronomy, neutrino oscillations in matter with three flavors applied to solar and supernova neutrinos, effective field theories, a possible fifth force, the dynamics of hadrons and superstrings, mathematics of grand unified theories, chiral symmetry breaking, physics at the Fermilab collider, and development of the TOPAZ detector

  17. Perspectives in high energy nuclear collisions

    International Nuclear Information System (INIS)

    Rafelski, J.


    This report gives an overview of some aspects of hadronic physics relevant for the conception of a research facility devoted to the study of high energy nuclear collisions. Several concepts to be studied in nuclear collisions are selected, with emphasis placed on the properties and nature of the quark-gluon plasma, the formation of the plasma state in the central region and its anticipated lifetime, and the observability, through strangeness content of this new form of nuclear matter. (orig.)

  18. Particle physics experiments at high energy colliders

    International Nuclear Information System (INIS)

    Hauptman, John


    Written by one of the detector developers for the International Linear Collider, this is the first textbook for graduate students dedicated to the complexities and the simplicities of high energy collider detectors. It is intended as a specialized reference for a standard course in particle physics, and as a principal text for a special topics course focused on large collider experiments. Equally useful as a general guide for physicists designing big detectors. (orig.)

  19. UNIX at high energy physics Laboratories

    International Nuclear Information System (INIS)

    Silverman, Alan


    With more and more high energy physics Laboratories ''downsizing'' from large central proprietary mainframe computers towards distributed networks, usually involving UNIX operating systems, the need was expressed at the 1991 Computers in HEP (CHEP) Conference to create a group to consider the implications of this trend and perhaps work towards some common solutions to ease the transition for HEP users worldwide

  20. High energy transients: The millisecond domain (United States)

    Rao, A. R.


    The search for high energy transients in the millisecond domain has come to the focus in recent times due to the detection of gravitational wave events and the identification of fast radio bursts as cosmological sources. Here we highlight the sensitivity limitations in the currently operating hard X-ray telescopes and give some details of the search for millisecond events in the AstroSat CZT Imager data.

  1. Quark model and high energy collisions

    International Nuclear Information System (INIS)

    Nyiri, J.; Kobrinsky, M.N.


    The aim of the present review is to show that the additive quark model describes well not only the static features of hadrons but also the interaction processes at high energies. Considerations of the hadron-hadron and hadron-nucleus interactions and of the hadron production in multiparticle production processes suggest serious arguments in favour of the nucleus-like hadron structure and show the possibility to apply the rules of quark statistics to the description of the secondary particle production. (author)

  2. Introduction to high energy cosmic ray physics

    International Nuclear Information System (INIS)

    Battistoni, G.; Grillo, A.F.


    After a few general qualitative considerations about the characteristics of primary cosmic rays arriving at the top of atmosphere, the fundamental concepts on their propagation and acceleration are discussed. The experimental situation, both from direct and indirect experiments, is presented, followed by a discussion on some concepts on hadronic interactions at high energy which are applied in a simplified and analytical model to the production of secondary particles in atmosphere

  3. High energy irradiation of bacterial membrane vesicles

    International Nuclear Information System (INIS)

    De La Rosa, M.A.M.


    The interactions of membrane components and two well-defined transport systems in the E. coli ML 308-225 membrane vesicles with 60 Co gamma radiation were investigated. The results presented show that gamma radiation can monitor membrane components and functions of varying radiosensitivities. The possible application of high-energy radiation as a physical probe of membrane structure and functions is indeed promising

  4. Computer simulation of high energy displacement cascades

    International Nuclear Information System (INIS)

    Heinisch, H.L.


    A methodology developed for modeling many aspects of high energy displacement cascades with molecular level computer simulations is reviewed. The initial damage state is modeled in the binary collision approximation (using the MARLOWE computer code), and the subsequent disposition of the defects within a cascade is modeled with a Monte Carlo annealing simulation (the ALSOME code). There are few adjustable parameters, and none are set to physically unreasonable values. The basic configurations of the simulated high energy cascades in copper, i.e., the number, size and shape of damage regions, compare well with observations, as do the measured numbers of residual defects and the fractions of freely migrating defects. The success of these simulations is somewhat remarkable, given the relatively simple models of defects and their interactions that are employed. The reason for this success is that the behavior of the defects is very strongly influenced by their initial spatial distributions, which the binary collision approximation adequately models. The MARLOWE/ALSOME system, with input from molecular dynamics and experiments, provides a framework for investigating the influence of high energy cascades on microstructure evolution. (author)

  5. Hadron interactions at high energy in QCD

    International Nuclear Information System (INIS)

    Levin, E.M.; Ryskin, M.G.


    Well known the typical hadronic interactions at high energy are soft processes occurring at large distances where the mysterious confinement forces should be essential. Due to this fact, discussing these processes at first sight the authors are to use and really use some models that incorporate their educated guess about the confinement and utilize the QCD degrees of freedom. But really these models use the QCD terminology rather than the explicit form of the QCD interaction. Up to now the multiparticle dynamics had been the dynamics of reggeons with some detailization coming from their hypothesis about confinement. It is the Reggeon Calculus or the reggeon phenomenology that allows them to describe the main properties of exclusive and inclusive reactions at high energy in agreement with experiment. This paper discusses this problem at this Symposium in many details. However, such pure phenomenological understanding cannot satisfy all of us at the moment. The authors would like to understand the multiparticle production and other soft processes at high energy in more microscopic way using directly the form of the QCD Lagrangian

  6. High energy behaviour of nonabelian gauge theories

    International Nuclear Information System (INIS)

    Bartels, J.


    The high energy behavior (in the Regge limit) of nonabelian gauge theories is reviewed. After a general remark concerning the question to what extent the Regge limit can be approached within perturbation theory, we first review the reggeization of elementary particles within nonabelian gauge theories. Then the derivation of a unitary high energy description of a massive (= spontaneously broken) nonabelian gauge model is described, which results in a complete reggeon calculus. There is strong evidence that the zero mass limit of this reggeon calculus exists, thus giving rise to the hope that the Regge behavior in pure Yang-Mills theories (QCD) can be reached in this way. In the final part of these lectures two possible strategies for solving this reggeon calculus (both for the massive and the massless case) are outlined. One of them leads to a geometrical picture in which the distribution of the wee partons obeys a diffusion law. The other one makes contact with reggeon field theory and predicts that QCD in the high energy limit is described by critical reggeon field theory. (orig.)

  7. High-energy proton scattering on nuclei

    CERN Document Server

    Klovning, A; Schlüpmann, K


    High-energy proton scattering on Be, C, Cu and Pb targets is studied using a single-arm spectrometer. The projectile momenta were 19 and 24 GeV/c, the square of the four-momentum transfer varied from t=0.1 to t =4.4 GeV/sup 2/. Momentum distributions of scattered protons are recorded in the high-momentum range. An application of multiple- scattering theory yielded agreement of calculation and experimental results to within a +or-30% uncertainty of the former. (15 refs).

  8. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.


    The Whipple Observatory High Resolution Camera will be used in a vigorous program of observations to search for new sources of very-high-energy gamma rays. In addition, a search for antimatter using the moon-earth system as an ion spectrometer will be begun. The first phase of GRANITE, the new 37-element 11-m camera, will be concluded with first light scheduled for September, 1991. The two cameras will operate in support of the Gamma Ray Observatory mission in the winter of 1991/2

  9. Quantum Phenomena in High Energy Density Plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Murnane, Margaret [Univ. of Colorado, Boulder, CO (United States); Kapteyn, Henry [Univ. of Colorado, Boulder, CO (United States)


    The possibility of implementing efficient (phase matched) HHG upconversion of deep- UV lasers in multiply-ionized plasmas, with potentially unprecedented conversion efficiency is a fascinating prospect. HHG results from the extreme nonlinear response of matter to intense laser light:high harmonics are radiated as a result of a quantum coherent electron recollision process that occurs during laser field ionization of an atom. Under current support from this grant in work published in Science in 2015, we discovered a new regime of bright HHG in highly-ionized plasmas driven by intense UV lasers, that generates bright harmonics to photon energies >280eV

  10. Embolism of high energy firearm projectile

    Directory of Open Access Journals (Sweden)

    Jaime Álvarez Soler


    Full Text Available The embolism of a projectile is very rare and out of the normal context, so the cor-oner in front of a wound projectile firearm must make a very judicious and careful analysis to recover the projectile and/or its fragments. This case presents evidence how modern military high-velocity weapons have a high kinetic energy which is transferred to body tissues, so including their fragments and parts of the projectile can cause serious injury and embolism, requiring a great effort scientific and in-terdisciplinary to give technical support to justice.

  11. High energy radiation in cancer treatment

    Energy Technology Data Exchange (ETDEWEB)



    Certain basic recommendations on the use of supervoltage radiation and radioisotope teletherapy in the treatment of malignant growths have been made by an expert study group which met in Vienna in August this y ear. The group, convened jointly by the International Atomic Energy Agency and the World Health Organization, was composed of 20 radiotherapists and radiation physicists from 12 countries. High energy radiation, used in the treatment of malignant tumours, can be either in the form of gamma- or X-rays or in the form of beams of accelerated electrons. The source of radiation is kept at a certain distance from the patient. The study group was agreed on the value of supervoltage radiotherapy, including gamma-ray and high voltage x-ray therapy as well as electron beam therapy. The required gamma radiation can be obtained from large sources of radioactive materials like cobalt 60 or caesium 137, while electron beams are produced by high voltage accelerators. The experts considered the sources in four broad categories: large supervoltage units, intermediate units, small isotope units and units of electron beams or very high energy x-rays. Each group of source was described including its usage. The experts made it clear that while supervoltage radiation should be a part of an organized radiotherapy department, the radiation facilities at any particular establishment should not be of the supervoltage type alone. The high energy facilities could be fruitfully used only when there was a background of general radiotherapy. The group emphasized that supervoltage radiotherapy, in common with other forms of radiotherapy, should be conducted only by adequately trained and qualified personnel, including radiation physicists, and specified the training and qualifications required of such personnel. It was felt that specialized training was one of the main requirements at the present stage and the training programmes of IAEA and WHO should be utilized extensively for this

  12. High energy radiation in cancer treatment

    International Nuclear Information System (INIS)


    Certain basic recommendations on the use of supervoltage radiation and radioisotope teletherapy in the treatment of malignant growths have been made by an expert study group which met in Vienna in August this y ear. The group, convened jointly by the International Atomic Energy Agency and the World Health Organization, was composed of 20 radiotherapists and radiation physicists from 12 countries. High energy radiation, used in the treatment of malignant tumours, can be either in the form of gamma- or X-rays or in the form of beams of accelerated electrons. The source of radiation is kept at a certain distance from the patient. The study group was agreed on the value of supervoltage radiotherapy, including gamma-ray and high voltage x-ray therapy as well as electron beam therapy. The required gamma radiation can be obtained from large sources of radioactive materials like cobalt 60 or caesium 137, while electron beams are produced by high voltage accelerators. The experts considered the sources in four broad categories: large supervoltage units, intermediate units, small isotope units and units of electron beams or very high energy x-rays. Each group of source was described including its usage. The experts made it clear that while supervoltage radiation should be a part of an organized radiotherapy department, the radiation facilities at any particular establishment should not be of the supervoltage type alone. The high energy facilities could be fruitfully used only when there was a background of general radiotherapy. The group emphasized that supervoltage radiotherapy, in common with other forms of radiotherapy, should be conducted only by adequately trained and qualified personnel, including radiation physicists, and specified the training and qualifications required of such personnel. It was felt that specialized training was one of the main requirements at the present stage and the training programmes of IAEA and WHO should be utilized extensively for this

  13. 76 FR 53119 - High Energy Physics Advisory Panel (United States)


    ... DEPARTMENT OF ENERGY High Energy Physics Advisory Panel AGENCY: Department of Energy. ACTION... hereby given that the High Energy Physics Advisory Panel will be renewed for a two-year period, beginning...-range planning and priorities in the national High Energy Physics program. Additionally, the renewal of...

  14. Prospects for high energy heavy ion accelerators

    International Nuclear Information System (INIS)

    Leemann, C.


    The acceleration of heavy ions to relativistic energies (T greater than or equal to 1 GeV/amu) at the beam intensities required for fundamental research falls clearly in the domain of synchrotons. Up to date, such beams have been obtained from machines originally designed as proton acccelerators by means of modified RF-programs, improved vacuum and, most importantly, altered or entirely new injector systems. Similarly, for the future, substantial changes in synchrotron design itself are not foreseen, but rather the judicious application and development of presently known principles and technologies and a choice of parameters optimized with respect to the peculiarities of heavy ions. The low charge to mass ratio, q/A, of very heavy ions demands that superconducting magnets be considered in the interest of the highest energies for a given machine size. Injector brightness will continue to be of highest importance, and although space charge effects such as tune shifts will be increased by a factor q 2 /A compared with protons, advances in linac current and brightness, rather than substantially higher energies are required to best utilize a given synchrotron acceptance. However, high yeilds of fully stripped, very heavy ions demand energies of a few hundred MeV/amu, thus indicating the need for a booster synchrotron, although for entirely different reasons than in proton facilities. Finally, should we consider colliding beams, the high charge of heavy ions will impose severe current limitations and put high demands on system design with regard to such quantities as e.g., wall impedances or the ion induced gas desorption rate, and advanced concepts such as low β insertions with suppressed dispersion and very small crossing angles will be essential to the achievement of useful luminosities

  15. Topics in calorimetry for high energy physics

    International Nuclear Information System (INIS)

    Hollebeek, R.


    These lectures focus on a series of topics now of interest or which have been of interest to designes of calorimeters in the past few years. The examples concentrate on calorimeters from DESY because its focus this year is on e-P physics, and on CDF and SDC because they are best known to the author. Calorimeters are, broadly speaking, devices to measure the total energy of particles. In general, no one device will be optimal for all types of particles. The two broadest classes of calorimeters in high energy physics are the electromagnetic calorimeters used primarily for photons and electrons, and the hadronic calorimeters used for most charged mesons and baryons. Most operate by absorbing and thereby measuring a significant amount of the incoming particles energy directly. Some particles may require special devices for their interactions and observation. Modern calorimeters are characterized by energy and position resolution, and cost and size. Calorimeter cost is often a trade-off between performance desired and money available. The optimum cost will require a careful choice of materials, reduction of the overall size of the detector, elimination of labor intensive construction techniques, and careful consideration of the cost of calibration systems. Since at least some of these requirements which optimize cost and resolution are contradictory, the ideal calorimeter in seldom what one ends up building

  16. Theory Summary: Very High Energy Cosmic Rays

    Directory of Open Access Journals (Sweden)

    Sarkar Subir


    Full Text Available This is a summary of ISVHECRI 2012 from a theorist’s perspective. A hundred years after their discovery, there is renewed interest in very high energy cosmic raysand their interactions which can provide unique information on new physics well beyond the Standard Model if only we knew how to unambiguously decipher the experimental data. While the observational situation has improved dramatically on the past decade with regard to both improved statistics and better understood systematics, the long standing questions regarding the origin of cosmic rays remain only partially answered, while further questions have been raised by new data. A recent development discussed at this Symposium is the advent of forward physics data from several experiments at the LHC, which have broadly vindicated the air shower simulation Monte Carlos currently in use and reduced their uncertainties further. Nevertheless there is still a major extrapolation required to interpret the highest energy air showers observed which appear to be undergoing a puzzling change in their elemental composition, even casting doubt on whether the much vaunted GZK cutoff has indeedbeen observed. The situation is further compounded by the apparent disagreement between Auger and Telescope Array data. A crucial diagnostic will be provided by the detection of the accompanying ultra-high energy cosmic neutrinos — two intriguing events have recently been recorded by IceCube.

  17. Perspectives on future high energy physics

    International Nuclear Information System (INIS)

    Samios, N.P.


    The author states two general ways in which one must proceed in an attempt to forecast the future of high energy physics. The first is to utilize the state of knowledge in the field and thereby provide theoretical and experimental guidance on future directions. The second approach is technical, namely, how well can one do in going to higher energies with present techniques or new accelerator principles. He concludes that the future strategy is straightforward. The present accelerator facilities must be upgraded and run to produce exciting and forefront research. At the same time, the theoretical tools should be sharpened both extrapolating from lower energies (100 GeV) to high (multi TeV) and vice versa. The US should be involved in the LHC, both in the accelerator and experimental areas. There should be an extensive R and D program on accelerators for a multi-TeV capability, emphasizing e + e - and μ + μ - colliders. Finally, the international cooperative activities should be strengthened and maintained

  18. Perspectives on future high energy physics

    Energy Technology Data Exchange (ETDEWEB)

    Samios, N.P.


    The author states two general ways in which one must proceed in an attempt to forecast the future of high energy physics. The first is to utilize the state of knowledge in the field and thereby provide theoretical and experimental guidance on future directions. The second approach is technical, namely, how well can one do in going to higher energies with present techniques or new accelerator principles. He concludes that the future strategy is straightforward. The present accelerator facilities must be upgraded and run to produce exciting and forefront research. At the same time, the theoretical tools should be sharpened both extrapolating from lower energies (100 GeV) to high (multi TeV) and vice versa. The US should be involved in the LHC, both in the accelerator and experimental areas. There should be an extensive R and D program on accelerators for a multi-TeV capability, emphasizing e{sup +}e{sup {minus}} and {mu}{sup +}{mu}{sup {minus}} colliders. Finally, the international cooperative activities should be strengthened and maintained.

  19. High energy neutrino astronomy and its telescopes

    International Nuclear Information System (INIS)

    Halzen, F.


    Doing astronomy with photons of energies in excess of a GeV has turned out to be extremely challenging. Efforts are underway to develop instruments that may push astronomy to wavelengths smaller than 10 -14 cm by mapping the sky using high energy neutrinos instead. Neutrino astronomy, born with the identification of thermonuclear fusion in the sun and the particle processes controlling the fate of a nearby supernova, will reach outside the galaxy and make measurements relevant to cosmology. The field is immersed in technology in the domains of particle physics to which many of its research goals are intellectually connected. To mind come the search for neutrino mass, cold dark matter (supersymmetric particles?) and the monopoles of the Standard Model. While a variety of collaborations are pioneering complementary methods by building telescopes with effective area in excess of 0.01 km 2 , we show here that the natural scale of a high energy neutrino telescope is 1 km 2 . With several thousand optical modules and a price tag unlikely to exceed 100 million dollars, the scope of a kilometer-scale instrument is similar to that of experiments presently being commissioned such as the SNO neutrino observatory in Canada and the Superkamiokande experiment in Japan

  20. Prompt High Energy Dipole γ Emission

    International Nuclear Information System (INIS)

    Corsi, A.; Giaz, A; Bracco, A.


    The study of the collective properties of a nuclear system is a powerful tool to understand the structure which lies inside the nucleus. A successful technique which has been used in this field is the measurement of the γ-decay of the highly collective Giant Dipole Resonance (GDR). In fact, GDR can be used as a probe for the internal structure of hot nuclei and, in addition, constitutes a clock for the thermalization process. Using the fusion-evaporation reaction, it has been recently possible to study (i) the yield of the high-energy γ-ray emission of the Dynamical Dipole which takes place during the fusion process and (ii) the degree of isospin mixing at high temperature in the decay of 80 Zr. In the first case it is important to stress the fact that the predictions of the theoretical models might differ depending on the type of nuclear equation of state (EOS) and on the N-N in-medium cross-section used in the calculations while, in the second physics case, the data are relative to the heaviest N = Z nucleus which has been possible to populate in the I = 0 channel using fusion-evaporation reaction. Both experiments were performed at the Laboratori Nazionali di Legnaro using the HECTOR-GARFIELD array. The high-energy γ-rays were measured in coincidence with light charged particles and fusion-evaporation residues. (author)

  1. Extreme Transients in the High Energy Universe (United States)

    Kouveliotou, Chryssa


    The High Energy Universe is rich in diverse populations of objects spanning the entire cosmological (time)scale, from our own present-day Milky Way to the re-ionization epoch. Several of these are associated with extreme conditions irreproducible in laboratories on Earth. Their study thus sheds light on the behavior of matter under extreme conditions, such as super-strong magnetic fields (in excess of 10^14 G), high gravitational potentials (e.g., Super Massive Black Holes), very energetic collimated explosions resulting in relativistic jet flows (e.g., Gamma Ray Bursts, exceeding 10^53 ergs). In the last thirty years, my work has been mostly focused on two apparently different but potentially linked populations of such transients: magnetars (highly magnetized neutron stars) and Gamma Ray Bursts (strongly beamed emission from relativistic jets), two populations that constitute unique astrophysical laboratories, while also giving us the tools to probe matter conditions in the Universe to redshifts beyond z=10, when the first stars and galaxies were assembled. I did not make this journey alone I have either led or participated in several international collaborations studying these phenomena in multi-wavelength observations; solitary perfection is not sufficient anymore in the world of High Energy Astrophysics. I will describe this journey, present crucial observational breakthroughs, discuss key results and muse on the future of this field.

  2. GRID computing for experimental high energy physics

    International Nuclear Information System (INIS)

    Moloney, G.R.; Martin, L.; Seviour, E.; Taylor, G.N.; Moorhead, G.F.


    Full text: The Large Hadron Collider (LHC), to be completed at the CERN laboratory in 2006, will generate 11 petabytes of data per year. The processing of this large data stream requires a large, distributed computing infrastructure. A recent innovation in high performance distributed computing, the GRID, has been identified as an important tool in data analysis for the LHC. GRID computing has actual and potential application in many fields which require computationally intensive analysis of large, shared data sets. The Australian experimental High Energy Physics community has formed partnerships with the High Performance Computing community to establish a GRID node at the University of Melbourne. Through Australian membership of the ATLAS experiment at the LHC, Australian researchers have an opportunity to be involved in the European DataGRID project. This presentation will include an introduction to the GRID, and it's application to experimental High Energy Physics. We will present the results of our studies, including participation in the first LHC data challenge

  3. Grid Computing in High Energy Physics

    International Nuclear Information System (INIS)

    Avery, Paul


    Over the next two decades, major high energy physics (HEP) experiments, particularly at the Large Hadron Collider, will face unprecedented challenges to achieving their scientific potential. These challenges arise primarily from the rapidly increasing size and complexity of HEP datasets that will be collected and the enormous computational, storage and networking resources that will be deployed by global collaborations in order to process, distribute and analyze them.Coupling such vast information technology resources to globally distributed collaborations of several thousand physicists requires extremely capable computing infrastructures supporting several key areas: (1) computing (providing sufficient computational and storage resources for all processing, simulation and analysis tasks undertaken by the collaborations); (2) networking (deploying high speed networks to transport data quickly between institutions around the world); (3) software (supporting simple and transparent access to data and software resources, regardless of location); (4) collaboration (providing tools that allow members full and fair access to all collaboration resources and enable distributed teams to work effectively, irrespective of location); and (5) education, training and outreach (providing resources and mechanisms for training students and for communicating important information to the public).It is believed that computing infrastructures based on Data Grids and optical networks can meet these challenges and can offer data intensive enterprises in high energy physics and elsewhere a comprehensive, scalable framework for collaboration and resource sharing. A number of Data Grid projects have been underway since 1999. Interestingly, the most exciting and far ranging of these projects are led by collaborations of high energy physicists, computer scientists and scientists from other disciplines in support of experiments with massive, near-term data needs. I review progress in this

  4. Foldable, High Energy Density Lithium Ion Batteries (United States)

    Suresh, Shravan

    Lithium Ion Batteries (LIBs) have become ubiquitous owing to its low cost, high energy density and, power density. Due to these advantages, LIBs have garnered a lot of attention as the primary energy storage devices in consumer electronics and electric vehicles. Recent advances in the consumer electronics research and, the drive to reduce greenhouse gases have created a demand for a shape conformable, high energy density batteries. This thesis focuses on the aforementioned two aspects of LIBs: (a) shape conformability (b) energy density and provides potential solutions to enhance them. This thesis is divided into two parts viz. (i) achieving foldability in batteries and, (ii) improving its energy density. Conventional LIBs are not shape conformable due to two limitations viz. inelasticity of metallic foils, and delamination of the active materials while bending. In the first part of the thesis (in Chapter 3), this problem is solved by replacing metallic current collector with Carbon Nanotube Macrofilms (CNMs). CNMs are superelastic films comprising of porous interconnected nanotube network. Using Molecular Dynamics (MD) simulation, we found that in the presence of an interconnected nanotube network CNMs can be fully folded. This is because the resultant stress due to bending and, the effective bending angle at the interface is reduced due to the network of nanotubes. Hence, unlike an isolated nanotube (which ruptures beyond 120 degrees of bending), a network of nanotubes can be completely folded. Thus, by replacing metallic current collector foils with CNMs, the flexibility limitation of a conventional LIB can be transcended. The second part of this thesis focusses on enhancing the energy density of LIBs. Two strategies adopted to achieve this goal are (a) removing the dead weight of the batteries, and (b) incorporating high energy density electrode materials. By incorporating CNMs, the weight of the batteries was reduced by 5-10 times due to low mass loading of

  5. Detecting ultra high energy neutrinos with LOFAR

    International Nuclear Information System (INIS)

    Mevius, M.; Buitink, S.; Falcke, H.; Hörandel, J.; James, C.W.; McFadden, R.; Scholten, O.; Singh, K.; Stappers, B.; Veen, S. ter


    The NuMoon project aims to detect signals of Ultra High Energy (UHE) Cosmic Rays with radio telescopes on Earth using the Lunar Cherenkov technique at low frequencies (∼150MHz). The advantage of using low frequencies is the much larger effective detecting volume, with as trade-off the cut-off in sensitivity at lower energies. A first upper limit on the UHE neutrino flux from data of the Westerbork Radio Telescope (WSRT) has been published, while a second experiment, using the new LOFAR telescope, is in preparation. The advantages of LOFAR over WSRT are the larger collecting area, the better pointing accuracy and the use of ring buffers, which allow the implementation of a sophisticated self-trigger algorithm. The expected sensitivity of LOFAR reaches flux limits within the range of some theoretical production models.

  6. Angular correlations and high energy evolution

    International Nuclear Information System (INIS)

    Kovner, Alex; Lublinsky, Michael


    We address the question of to what extent JIMWLK evolution is capable of taking into account angular correlations in a high energy hadronic wave function. Our conclusion is that angular (and indeed other) correlations in the wave function cannot be reliably calculated without taking into account Pomeron loops in the evolution. As an example we study numerically the energy evolution of angular correlations between dipole scattering amplitudes in the framework of the large N c approximation to JIMWLK evolution (the 'projectile dipole model'). Target correlations are introduced via averaging over an (isotropic) ensemble of anisotropic initial conditions. We find that correlations disappear very quickly with rapidity even inside the saturation radius. This is in accordance with our physical picture of JIMWLK evolution. The actual correlations inside the saturation radius in the target QCD wave function, on the other hand, should remain sizable at any rapidity.

  7. QCD and high-energy nuclear collisions

    CERN Multimedia

    CERN. Geneva


    Six years ago, Relativistic Heavy Ion Collider at Brookhaven started colliding heavy nuclei at record center-of-mass energies of up to 200 GeV/nucleon. Very soon, the Large Hadron Collider at CERN will push the energy of the ions to an astounding 5 TeV/nucleon. What can be learnt from the experiments at these machines? What do we know about the physics of super--dense matter already? I will argue that heavy ion accelerators bring us to the new frontiers of physical knowledge by creating strong color fields and very high densities of partons, at which qualitatively new phenomena emerge. I will also discuss the cross-disciplinary implications for cosmology, astrophysics, and connections to condensed matter physics.

  8. Experimental Facilities at the High Energy Frontier

    CERN Document Server

    Jenni, P.


    The main theme of the lectures covered the experimental work at hadron colliders, with a clear focus on the Large Hadron Collider (LHC) and on the roadmap that led finally to the discovery of the Higgs boson. The lectures were not a systematic course on machine and detector technologies, but rather tried to give a physics-motivated overview of many experimental aspects that were all relevant for making the discovery. The actual lectures covered a much broader scope than what is documented here in this write- up. The successful concepts for the experiments at the LHC have benefitted from the experience gained with previous generations of detectors at lower- energy machines. The lectures included also an outlook to the future experimental programme at the LHC, with its machine and experiments upgrades, as well as a short discussion of possible facilities at the high energy frontier beyond LHC.

  9. University of Oklahoma - High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    Skubic, Patrick L. [University of Oklahoma


    The High Energy Physics program at the University of Oklahoma, Pat Skubic, Principal Investigator, is attempting to understand nature at the deepest level using the most advanced experimental and theoretical tools. The four experimental faculty, Brad Abbott, Phil Gutierrez, Pat Skubic, and Mike Strauss, together with post-doctoral associates and graduate students, are finishing their work as part of the D0 collaboration at Fermilab, and increasingly focusing their investigations at the Large Hadron Collidor (LHC) as part of the ATLAS Collaboration. Work at the LHC has become even more exciting with the recent discovery by ATLAS and the other collaboration, CMS, of the long-sought Higgs boson, which plays a key role in generating masses for the elementary constituents of matter. Work of the OUHEP group has been in the three areas of hardware, software, and analysis. Now that the Higgs boson has been discovered, completing the Standard Model of fundamental physics, new efforts will focus on finding hints of physics beyond the standard model, such as supersymmetry. The OUHEP theory group (Kim Milton, PI) also consists of four faculty members, Howie Baer, Chung Kao, Kim Milton, and Yun Wang, and associated students and postdocs. They are involved in understanding fundamental issues in formulating theories of the microworld, and in proposing models that carry us past the Standard Model, which is an incomplete description of nature. They therefore work in close concert with their experimental colleagues. One also can study fundamental physics by looking at the large scale structure of the universe; in particular the ``dark energy'' that seems to be causing the universe to expand at an accelerating rate, effectively makes up about 3/4 of the energy in the universe, and yet is totally unidentified. Dark energy and dark matter, which together account for nearly all of the energy in the universe, are an important probe of fundamental physics at the very shortest

  10. Semiconductor high-energy radiation scintillation detector

    International Nuclear Information System (INIS)

    Kastalsky, A.; Luryi, S.; Spivak, B.


    We propose a new scintillation-type detector in which high-energy radiation generates electron-hole pairs in a direct-gap semiconductor material that subsequently recombine producing infrared light to be registered by a photo-detector. The key issue is how to make the semiconductor essentially transparent to its own infrared light, so that photons generated deep inside the semiconductor could reach its surface without tangible attenuation. We discuss two ways to accomplish this, one based on doping the semiconductor with shallow impurities of one polarity type, preferably donors, the other by heterostructure bandgap engineering. The proposed semiconductor scintillator combines the best properties of currently existing radiation detectors and can be used for both simple radiation monitoring, like a Geiger counter, and for high-resolution spectrography of the high-energy radiation. An important advantage of the proposed detector is its fast response time, about 1 ns, essentially limited only by the recombination time of minority carriers. Notably, the fast response comes without any degradation in brightness. When the scintillator is implemented in a qualified semiconductor material (such as InP or GaAs), the photo-detector and associated circuits can be epitaxially integrated on the scintillator slab and the structure can be stacked-up to achieve virtually any desired absorption capability

  11. Tibiofibula Transposition in High-Energy Fractures

    Directory of Open Access Journals (Sweden)

    Peter R. Loughenbury


    Full Text Available We report two cases of failed attempts at closed reduction of high-energy tibial fractures with an associated fibula fracture. The first case was a 39-year-old male involved in high-speed motorbike collision, while the second was a 14-year-old male who injured his leg following a fall of three metres. Emergency medical services at the scenes of the accidents reported a 90-degree valgus deformity of the injured limb and both limbs were realigned on scene and stabilized. Adequate alignment of the tibia could not be achieved by manipulation under sedation or anaesthesia. Open reduction and exposure of the fracture sites revealed that the distal fibula fragment was “transposed” and entrapped in the medulla of the proximal tibial fragment. Reduction required simulation of the mechanism of injury in order to disengage the fragments and allow reduction. Tibiofibula transposition is a rare complication of high-energy lower limb fractures which has not previously been reported and may prevent adequate closed reduction. Impaction of the distal fibula within the tibial medulla occurs as the limb is realigned by paramedic staff before transfer to hospital. We recommend that when this complication is identified the patient is transferred to the operating room for open reduction and stabilization of the fracture.

  12. European School of High-Energy Physics

    CERN Document Server


    The European School of High-Energy Physics is intended to give young experimental physicists an introduction to the theoretical aspects of recent advances in elementary particle physics. These proceedings contain lectures notes on field theory and the Standard Model, quantum chromodynamics, flavour physics and CP violation, experimental aspects of CP violation in K and B decays, relativistic heavy-ion physics, and the scientific programme of the Joint Institute for Nuclear Research. These core scientific topics are complemented by a lecture about the physics of ski jumping.

  13. [Studies of high energy phenomena using muons

    International Nuclear Information System (INIS)


    This report covers the activities of the NIU high energy physics group as supported by DOE contract FG02-91ER40641 during the period from March 1991 to December 1991. Our group has three main efforts. The first is the D0 experiment at the Fermilab proton-antiproton collider, with major emphasis on its muon system. The second is the involvement of a portion of the group in Fermilab Experiment 789. Finally, we are also members of the SDC collaboration at the SSC


    Energy Technology Data Exchange (ETDEWEB)

    Rutherfoord, John P. [University of Arizona; Johns, Kenneth A. [University of Arizona; Shupe, Michael A. [University of Arizona; Cheu, Elliott C. [University of Arizona; Varnes, Erich W. [University of Arizona; Dienes, Keith [University of Arizona; Su, Shufang [University of Arizona; Toussaint, William Doug [University of Arizona; Sarcevic, Ina [University of Arizona


    The High Energy Physics Group at the University of Arizona has conducted forefront research in elementary particle physics. Our theorists have developed new ideas in lattice QCD, SUSY phenomenology, string theory phenomenology, extra spatial dimensions, dark matter, and neutrino astrophysics. The experimentalists produced significant physics results on the ATLAS experiment at CERN's Large Hadron Collider and on the D0 experiment at the Fermilab Tevatron. In addition, the experimentalists were leaders in detector development and construction, and on service roles in these experiments.

  15. Channeling and dechanneling at high energy

    International Nuclear Information System (INIS)

    Carrigan, R.A. Jr.


    The possibility of using channeling as a tool for high energy particle physics has now been extensively investigated. Bent crystals have been used as an accelerator extraction element and for particle deflection. Applications as accelerating devices have been discussed but appear remote. The major advantage in using a bent crystal rather than a magnet is the large deflection that can be achieved in a short length. The major disadvantage is the low transmission. A good understanding of dechanneling is important for applications. 43 refs., 1 fig., 3 tabs

  16. [Experimental and theoretical high energy physics program

    Energy Technology Data Exchange (ETDEWEB)

    Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.


    Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac{endash}Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e{sup +}e{sup {minus}} collisions at CERN; {bar p}{endash}p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab. (RWR)

  17. Radiographic imaging system for high energy radiation

    International Nuclear Information System (INIS)


    A radiographic imaging system for high energy radiation is described utilizing a detector of such radiation and a mask having regions relatively transparent to such radiation and interspersed among regions relatively opaque to such radiation. A relative motion is imparted between the mask and the detector, the detector providing a time varying signal in response to the incident radiation and in response to the relative motion. The time varying signal provides, with the aid of a decoder, an image of a source of such radiation

  18. Studies in theoretical high energy particle physics

    International Nuclear Information System (INIS)

    Aratyn, H.; Brekke, L.; Keung, Wai-Yee; Sukhatme, U.


    Theoretical work on the following topics is briefly summarized: symmetry structure of conformal affine Toda model and KP hierarchy; solitons in the affine Toda and conformal affine Toda models; classical r-matrices and Poisson bracket structures on infinite-dimensional groups; R-matrix formulation of KP hierarchies and their gauge equivalence; statistics of particles and solitons; charge quantization in the presence of an Alice string; knotting and linking of nonabelian flux; electric dipole moments; neutrino physics in gauge theories; CP violation in the high energy colliders; supersymmetric quantum mechanics; parton structure functions in nuclei; dual parton model. 38 refs

  19. Studies of high energy phenomena using muons

    International Nuclear Information System (INIS)

    Hedin, D.; Kaplan, D.; Green, J.


    This report covers the activities of the NIU high energy physics group as supported by DOE contract AC02-87ER40368 during the period from July of 1990 to June of 1991 and from February to March 1992. Our group has three main efforts which will be discussed in this paper. The first is the D0 experiment at the Fermilab proton-antiproton collider, with major emphasis on its muon system. The second is the involvement of a portion of the group in Fermilab Experiment 789 which involved detection of meson decays. Finally, we discuss our work with the SDC collaboration at the SSC

  20. High energy ion implantation for IC processing

    International Nuclear Information System (INIS)

    Oosterhoff, S.


    In this thesis the results of fundamental research on high energy ion implantation in silicon are presented and discussed. The implantations have been carried out with the 500 kV HVEE ion implantation machine, that was acquired in 1981 by the IC technology and Electronics group at Twente University of Technology. The damage and anneal behaviour of 1 MeV boron implantations to a dose of 10 13 /cm 2 have been investigated as a function of anneal temperature by sheet resistance, Hall and noise measurements. (Auth.)

  1. Photomask specifications for high energy physics detectors

    CERN Document Server

    Pindo, M


    Planar technologies used for radiation detector fabrication imply an extensive use of photomasks whose characteristics are critical in determining final detector performance. Compatibly with their manufacturing process, photomasks must satisfy the application-specific requirements dictated both by wafer manufacturers and detector final users. The design and realization of microstrip and pixel detectors, widely used in high energy physics experiments, ask for intensive scientific effort, advanced technology and important economical investments. Photomask specification definition is one of the fundamental steps to optimize detector fabrication processes and fulfill experimental requirements at the most appropriate cost.

  2. Siberian Snakes in high-energy accelerators

    International Nuclear Information System (INIS)

    Mane, S R; Shatunov, Yu M; Yokoya, K


    We review modern techniques to accelerate spin-polarized beams to high energy and to preserve their polarization in storage rings. Crucial to the success of such work is the use of so-called Siberian Snakes. We explain these devices and the reason for their necessity. Closely related to Snakes is the concept of 'spin rotators'. The designs and merits of several types of Snakes and spin rotators are examined. Theoretical work with Snakes and spin rotators, and experimental results from several storage rings, are reviewed, including the so-called Snake resonances. (topical review)

  3. GEM applications outside high energy physics

    CERN Document Server

    Duarte Pinto, Serge


    From its invention in 1997, the Gas Electron Multiplier has been applied in nuclear and high energy physics experiments. Over time however, other applications have also exploited the favorable properties of GEMs. The use of GEMs in these applications will be explained in principle and practice. This paper reviews applications in research, beam instrumentation and homeland security. The detectors described measure neutral radiations such as photons, x-rays, gamma rays and neutrons, as well as all kinds of charged radiation. This paper provides an overview of the still expanding range of possibilities of this versatile detector concept.

  4. Superconductivity in high energy particle accelerators

    International Nuclear Information System (INIS)

    Schmueser, P.


    The basics of superconductivity are outlined with special emphasis on the features which are relevant for the application in magnets and radio frequency cavities for high energy particle accelerators. The special properties of superconducting accelerator magnets are described in detail: design principles, magnetic field calculations, magnetic forces, quench performance, persistent magnetization currents and eddy currents. The design principles and basic properties of superconducting cavities are explained as well as the observed performance limitations and the countermeasures. The ongoing research efforts towards maximum accelerating fields are addressed and the coupling of radio frequency power to the particle beam is treated. (orig.)

  5. Future high energy colliders. Formal report

    International Nuclear Information System (INIS)

    Parsa, Z.


    This Report includes copies of transparencies and notes from the presentations made at the Symposium on Future High Energy Colliders, October 21-25, 1996 at the Institute for Theoretical Physics, University of California, Santa Barbara California, that was made available by the authors. Editing, reduction and changes to the authors contributions were made only to fulfill the printing and publication requirements. We would like to take this opportunity and thank the speakers for their informative presentations and for providing copies of their transparencies and notes for inclusion in this Report

  6. Very high energy gamma-ray astronomy

    International Nuclear Information System (INIS)

    Weekes, T.C.


    It is apparent that very high gamma-ray astronomy, at the very end of the electromagnetic spectrum, is just at the threshold of becoming an important channel of astronomical information. The author discusses how, to fully develop, it requires telescopes with improved minimum flux sensitivity; development of techniques that characterize the nature of the primary; more overlapping observations to remove any question of the reality of the detected phenomenon; more consistency in the application of statistics among experimenters and more openness about methods used; development of models that will predict the phenomenon to be expected rather than explain what has been observed; and more accurate calibrations to determine absolute fluxes and energies

  7. Radiographic imaging system for high energy radiation

    International Nuclear Information System (INIS)

    Barrett, H.H.


    A radiographic imaging system for high energy radiation utilizing a detector of such radiation and a mask having regions relatively transparent to such radiation interspersed among regions relatively opaque to such radiation is described. A relative motion is imparted between the mask and the detector, the detector providing a time varying signal in response to the incident radiation and in response to the relative motion. The time varying signal provides, with the aid of a decoder, an image of a source of such radiation

  8. High energy approximations in quantum field theory

    International Nuclear Information System (INIS)

    Orzalesi, C.A.


    New theoretical methods in hadron physics based on a high-energy perturbation theory are discussed. The approximated solutions to quantum field theory obtained by this method appear to be sufficiently simple and rich in structure to encourage hadron dynamics studies. Operator eikonal form for field - theoretic Green's functions is derived and discussion is held on how the eikonal perturbation theory is to be renormalized. This method is extended to massive quantum electrodynamics of scalar charged bosons. Possible developments and applications of this theory are given [pt

  9. Particle identification methods in High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    Va' Vra, J.


    This paper deals with two major particle identification methods: dE/dx and Cherenkov detection. In the first method, the authors systematically compare existing dE/dx data with various predictions available in the literature, such as the Particle Data group recommendation, and judge the overall consistency. To my knowledge, such comparison was not done yet in a published form for the gaseous detectors used in High-Energy physics. As far as the second method, there are two major Cherenkov light detection techniques: the threshold and the Ring imaging methods. The authors discuss the recent trend in these techniques.

  10. Improvements in high energy computed tomography

    International Nuclear Information System (INIS)

    Burstein, P.; Krieger, A.; Annis, M.


    In computerized axial tomography employed with large relatively dense objects such as a solid fuel rocket engine, using high energy x-rays, such as a 15 MeV source, a collimator is employed with an acceptance angle substantially less than 1 0 , in a preferred embodiment 7 minutes of a degree. In a preferred embodiment, the collimator may be located between the object and the detector, although in other embodiments, a pre-collimator may also be used, that is between the x-ray source and the object being illuminated. (author)

  11. Predictions of High Energy Experimental Results

    Directory of Open Access Journals (Sweden)

    Comay E.


    Full Text Available Eight predictions of high energy experimental results are presented. The predictions contain the $Sigma ^+$ charge radius and results of two kinds of experiments using energetic pionic beams. In addition, predictions of the failure to find the following objects are presented: glueballs, pentaquarks, Strange Quark Matter, magnetic monopoles searched by their direct interaction with charges and the Higgs boson. The first seven predictions rely on the Regular Charge-Monopole Theory and the last one relies on mathematical inconsistencies of the Higgs Lagrangian density.

  12. High energy multi-gluon exchange amplitudes

    International Nuclear Information System (INIS)

    Jaroszewicz, T.


    We examine perturbative high energy n-gluon exchange amplitudes calculated in the Coulomb gauge. If n exceeds the minimum required by the t-channel quantum numbers, such amplitudes are non-leading in lns. We derive a closed system of coupled integral equations for the corresponding two-particle n-gluon vertices, obtained by summing the leading powers of ln(N μ psup(μ)), where psup(μ) is the incident momentum and Nsup(μ) the gauge-defining vector. Our equations are infra-red finite, provided the external particles are colour singlets. (author)

  13. Weak interactions at high energies. [Lectures, review

    Energy Technology Data Exchange (ETDEWEB)

    Ellis, J.


    Review lectures are presented on the phenomenological implications of the modern spontaneously broken gauge theories of the weak and electromagnetic interactions, and some observations are made about which high energy experiments probe what aspects of gauge theories. Basic quantum chromodynamics phenomenology is covered including momentum dependent effective quark distributions, the transverse momentum cutoff, search for gluons as sources of hadron jets, the status and prospects for the spectroscopy of fundamental fermions and how fermions may be used to probe aspects of the weak and electromagnetic gauge theory, studies of intermediate vector bosons, and miscellaneous possibilities suggested by gauge theories from the Higgs bosons to speculations about proton decay. 187 references. (JFP)

  14. High energy model for irregular absorbing particles

    International Nuclear Information System (INIS)

    Chiappetta, Pierre.


    In the framework of a high energy formulation of relativistic quantum scattering a model is presented which describes the scattering functions and polarization of irregular absorbing particles, whose dimensions are greater than the incident wavelength. More precisely in the forward direction an amplitude parametrization of eikonal type is defined which generalizes the usual diffraction theory, and in the backward direction a reflective model is used including a shadow function. The model predictions are in good agreement with the scattering measurements off irregular compact and fluffy particles performed by Zerull, Giese and Weiss (1977)

  15. Advanced Analysis Methods in High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    Pushpalatha C. Bhat


    During the coming decade, high energy physics experiments at the Fermilab Tevatron and around the globe will use very sophisticated equipment to record unprecedented amounts of data in the hope of making major discoveries that may unravel some of Nature's deepest mysteries. The discovery of the Higgs boson and signals of new physics may be around the corner. The use of advanced analysis techniques will be crucial in achieving these goals. The author discusses some of the novel methods of analysis that could prove to be particularly valuable for finding evidence of any new physics, for improving precision measurements and for exploring parameter spaces of theoretical models.

  16. Data Preservation in High Energy Physics

    CERN Document Server

    Mount, Richard; Le Diberder, Francois; Dubois-Felsmann, Gregory; Neal, Homer; Bellis, Matt; Boehnlein, Amber; Votava, Margaret; White, Vicky; Wolbers, Stephen; Konigsberg, Jacobo; Roser, Robert; Snider, Rick; Lucchesi, Donatella; Denisov, Dmitri; Soldner-Rembold, Stefan; Li, Qizhong; Varnes, Erich; Jonckheere, Alan; Gasthuber, Martin; Gülzow, Volker; Kemp, Yves; Ozerov, Dmitri; Diaconu, Cristinel; South, David; Lobodzinski, Bogdan; Olsson, Jan; Haas, Tobias; Wrona, Krzysztof; Szuba, Janusz; Schnell, Gunar; Sasaki, Takashi; Katayama, Nobu; Hernandez, Fabio; Mele, Salvatore; Holzner, Andre; Hemmer, Frederic; Schroeder, Matthias; Barring, Olof; Brun, Rene; Maggi, Marcello; Igo-Kemenes, Peter; Van Wezel, Jos; Heiss, Andreas; Chen, Gang; Wang, Yifang; Asner, David; Riley, Daniel; Corney, David; Gordon, John


    Data from high-energy physics (HEP) experiments are collected with significant financial and human effort and are mostly unique. At the same time, HEP has no coherent strategy for data preservation and re-use. An inter-experimental Study Group on HEP data preservation and long-term analysis was convened at the end of 2008 and held two workshops, at DESY (January 2009) and SLAC (May 2009). This document is an intermediate report to the International Committee for Future Accelerators (ICFA) of the reflections of this Study Group.

  17. [Experimental and theoretical high energy physics program

    International Nuclear Information System (INIS)

    Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.


    Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac endash Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e + e - collisions at CERN; bar p endash p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab

  18. Predicting Induced Radioactivity at High Energy Accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Fasso, Alberto


    Radioactive nuclides are produced at high-energy electron accelerators by different kinds of particle interactions with accelerator components and shielding structures. Radioactivity can also be induced in air, cooling fluids, soil and groundwater. The physical reactions involved include spallations due to the hadronic component of electromagnetic showers, photonuclear reactions by intermediate energy photons and low-energy neutron capture. Although the amount of induced radioactivity is less important than that of proton accelerators by about two orders of magnitude, reliable methods to predict induced radioactivity distributions are essential in order to assess the environmental impact of a facility and to plan its decommissioning. Conventional techniques used so far are reviewed, and a new integrated approach is presented, based on an extension of methods used at proton accelerators and on the unique capability of the FLUKA Monte Carlo code to handle the whole joint electromagnetic and hadronic cascade, scoring residual nuclei produced by all relevant particles. The radiation aspects related to the operation of superconducting RF cavities are also addressed.

  19. Balance Function in High-Energy Collisions

    International Nuclear Information System (INIS)

    Tawfik, A.; Shalaby, Asmaa G.


    Aspects and implications of the balance functions (BF) in high-energy physics are reviewed. The various calculations and measurements depending on different quantities, for example, system size, collisions centrality, and beam energy, are discussed. First, the different definitions including advantages and even short-comings are highlighted. It is found that BF, which are mainly presented in terms of relative rapidity, and relative azimuthal and invariant relative momentum, are sensitive to the interaction centrality but not to the beam energy and can be used in estimating the hadronization time and the hadron-quark phase transition. Furthermore, the quark chemistry can be determined. The chemical evolution of the new-state-of-matter, the quark-gluon plasma, and its temporal-spatial evolution, femtoscopy of two-particle correlations, are accessible. The production time of positive-negative pair of charges can be determined from the widths of BF. Due to the reduction in the diffusion time, narrowed widths refer to delayed hadronization. It is concluded that BF are powerful tools characterizing hadron-quark phase transition and estimating some essential properties

  20. TPCs in high-energy astronomical polarimetry

    International Nuclear Information System (INIS)

    Black, J K


    High-energy astrophysics has yet to exploit the unique and important information that polarimetry could provide, largely due to the limited sensitivity of previously available polarimeters. In recent years, numerous efforts have been initiated to develop instruments with the sensitivity required for astronomical polarimetry over the 100 eV to 10 GeV band. Time projection chambers (TPCs), with their high-resolution event imaging capability, are an integral part of some of these efforts. After a brief overview of current astronomical polarimeter development efforts, the role of TPCs will be described in more detail. These include TPCs as photoelectric X-ray polarimeters and TPCs as components of polarizationsensitive Compton and pair-production telescopes

  1. Grid computing in high energy physics

    CERN Document Server

    Avery, P


    Over the next two decades, major high energy physics (HEP) experiments, particularly at the Large Hadron Collider, will face unprecedented challenges to achieving their scientific potential. These challenges arise primarily from the rapidly increasing size and complexity of HEP datasets that will be collected and the enormous computational, storage and networking resources that will be deployed by global collaborations in order to process, distribute and analyze them. Coupling such vast information technology resources to globally distributed collaborations of several thousand physicists requires extremely capable computing infrastructures supporting several key areas: (1) computing (providing sufficient computational and storage resources for all processing, simulation and analysis tasks undertaken by the collaborations); (2) networking (deploying high speed networks to transport data quickly between institutions around the world); (3) software (supporting simple and transparent access to data and software r...

  2. Database applications in high energy physics

    International Nuclear Information System (INIS)

    Jeffery, K.G.


    High Energy physicists were using computers to process and store their data early in the history of computing. They addressed problems of memory management, job control, job generation, data standards, file conventions, multiple simultaneous usage, tape file handling and data management earlier than, or at the same time as, the manufacturers of computing equipment. The HEP community have their own suites of programs for these functions, and are now turning their attention to the possibility of replacing some of the functional components of their 'homebrew' systems with more widely used software and/or hardware. High on the 'shopping list' for replacement is data management. ECFA Working Group 11 has been working on this problem. This paper reviews the characteristics of existing HEP systems and existing database systems and discusses the way forward. (orig.)

  3. Laser beams in high energy physics

    International Nuclear Information System (INIS)

    Milburn, R.H.


    Back-scattered ruby laser light from energetic electrons has facilitated a family of bubble chamber experiments in the interactions of highly polarized and quasi-monochromatic photons up to 10 GeV with 4π acceptance at the 100 to 200 event/μb level. Further studies of this sort demand the use of high-repetition-rate track chambers. To exploit the polarization and energetic purity intrinsic to the back-scattered beam one must achieve nearly two orders of magnitude increase in the average input optical power, and preferably also higher quantum energies. Prospects for this technique and its applications given modern laser capabilities and new accelerator developments are discussed

  4. High energy gravitational scattering: a numerical study

    CERN Document Server

    Marchesini, Giuseppe


    The S-matrix in gravitational high energy scattering is computed from the region of large impact parameters b down to the regime where classical gravitational collapse is expected to occur. By solving the equation of an effective action introduced by Amati, Ciafaloni and Veneziano we find that the perturbative expansion around the leading eikonal result diverges at a critical value signalling the onset of a new regime. We then discuss the main features of our explicitly unitary S-matrix down to the Schwarzschild's radius R=2G s^(1/2), where it diverges at a critical value b ~ 2.22 R of the impact parameter. The nature of the singularity is studied with particular attention to the scaling behaviour of various observables at the transition. The numerical approach is validated by reproducing the known exact solution in the axially symmetric case to high accuracy.

  5. Statistical learning in high energy and astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, J.


    This thesis studies the performance of statistical learning methods in high energy and astrophysics where they have become a standard tool in physics analysis. They are used to perform complex classification or regression by intelligent pattern recognition. This kind of artificial intelligence is achieved by the principle ''learning from examples'': The examples describe the relationship between detector events and their classification. The application of statistical learning methods is either motivated by the lack of knowledge about this relationship or by tight time restrictions. In the first case learning from examples is the only possibility since no theory is available which would allow to build an algorithm in the classical way. In the second case a classical algorithm exists but is too slow to cope with the time restrictions. It is therefore replaced by a pattern recognition machine which implements a fast statistical learning method. But even in applications where some kind of classical algorithm had done a good job, statistical learning methods convinced by their remarkable performance. This thesis gives an introduction to statistical learning methods and how they are applied correctly in physics analysis. Their flexibility and high performance will be discussed by showing intriguing results from high energy and astrophysics. These include the development of highly efficient triggers, powerful purification of event samples and exact reconstruction of hidden event parameters. The presented studies also show typical problems in the application of statistical learning methods. They should be only second choice in all cases where an algorithm based on prior knowledge exists. Some examples in physics analyses are found where these methods are not used in the right way leading either to wrong predictions or bad performance. Physicists also often hesitate to profit from these methods because they fear that statistical learning methods cannot

  6. Statistical learning in high energy and astrophysics

    International Nuclear Information System (INIS)

    Zimmermann, J.


    This thesis studies the performance of statistical learning methods in high energy and astrophysics where they have become a standard tool in physics analysis. They are used to perform complex classification or regression by intelligent pattern recognition. This kind of artificial intelligence is achieved by the principle ''learning from examples'': The examples describe the relationship between detector events and their classification. The application of statistical learning methods is either motivated by the lack of knowledge about this relationship or by tight time restrictions. In the first case learning from examples is the only possibility since no theory is available which would allow to build an algorithm in the classical way. In the second case a classical algorithm exists but is too slow to cope with the time restrictions. It is therefore replaced by a pattern recognition machine which implements a fast statistical learning method. But even in applications where some kind of classical algorithm had done a good job, statistical learning methods convinced by their remarkable performance. This thesis gives an introduction to statistical learning methods and how they are applied correctly in physics analysis. Their flexibility and high performance will be discussed by showing intriguing results from high energy and astrophysics. These include the development of highly efficient triggers, powerful purification of event samples and exact reconstruction of hidden event parameters. The presented studies also show typical problems in the application of statistical learning methods. They should be only second choice in all cases where an algorithm based on prior knowledge exists. Some examples in physics analyses are found where these methods are not used in the right way leading either to wrong predictions or bad performance. Physicists also often hesitate to profit from these methods because they fear that statistical learning methods cannot be controlled in a

  7. Polarized beams in high energy storage rings

    Energy Technology Data Exchange (ETDEWEB)

    Montague, B W [European Organization for Nuclear Research, Geneva (Switzerland)


    In recent years there has been a considerable advance in understanding the spin motion of particles in storage rings and accelerators. The survey presented here outlines the early historical development in this field, describes the basic ideas governing the kinetics of polarized particles in electromagnetic fields and shows how these have evolved into the current description of polarized beam behaviour. Orbital motion of particles influences their spin precession, and depolarization of a beam can result from excitation of spin resonances by orbit errors and oscillations. Electrons and positrons are additionally influenced by the quantized character of synchrotron radiation, which not only provides a polarizing mechanism but also enhances depolarizing effects. Progress in the theoretical formulation of these phenomena has clarified the details of the physical processes and suggested improved methods of compensating spin resonances. Full use of polarized beams for high-energy physics with storage rings requires spin rotators to produce longitudinal polarization in the interaction regions. Variants of these schemes, dubbed Siberian snakes, provide a curious precession topology which can substantially reduce depolarization in the high-energy range. Efficient polarimetry is an essential requirement for implementing polarized beams, whose utility for physics can be enhanced by various methods of spin manipulation.

  8. Grid computing in high-energy physics

    International Nuclear Information System (INIS)

    Bischof, R.; Kuhn, D.; Kneringer, E.


    Full text: The future high energy physics experiments are characterized by an enormous amount of data delivered by the large detectors presently under construction e.g. at the Large Hadron Collider and by a large number of scientists (several thousands) requiring simultaneous access to the resulting experimental data. Since it seems unrealistic to provide the necessary computing and storage resources at one single place, (e.g. CERN), the concept of grid computing i.e. the use of distributed resources, will be chosen. The DataGrid project (under the leadership of CERN) develops, based on the Globus toolkit, the software necessary for computation and analysis of shared large-scale databases in a grid structure. The high energy physics group Innsbruck participates with several resources in the DataGrid test bed. In this presentation our experience as grid users and resource provider is summarized. In cooperation with the local IT-center (ZID) we installed a flexible grid system which uses PCs (at the moment 162) in student's labs during nights, weekends and holidays, which is especially used to compare different systems (local resource managers, other grid software e.g. from the Nordugrid project) and to supply a test bed for the future Austrian Grid (AGrid). (author)

  9. Cyberinfrastructure for high energy physics in Korea

    International Nuclear Information System (INIS)

    Cho, Kihyeon; Kim, Hyunwoo; Jeung, Minho


    We introduce the hierarchy of cyberinfrastructure which consists of infrastructure (supercomputing and networks), Grid, e-Science, community and physics from bottom layer to top layer. KISTI is the national headquarter of supercomputer, network, Grid and e-Science in Korea. Therefore, KISTI is the best place to for high energy physicists to use cyberinfrastructure. We explain this concept on the CDF and the ALICE experiments. In the meantime, the goal of e-Science is to study high energy physics anytime and anywhere even if we are not on-site of accelerator laboratories. The components are data production, data processing and data analysis. The data production is to take both on-line and off-line shifts remotely. The data processing is to run jobs anytime, anywhere using Grid farms. The data analysis is to work together to publish papers using collaborative environment such as EVO (Enabling Virtual Organization) system. We also present the global community activities of FKPPL (France-Korea Particle Physics Laboratory) and physics as top layer.

  10. Supersimplicity: a Remarkable High Energy SUSY Property

    International Nuclear Information System (INIS)

    Gounaris, G.J.; Renard, F.M.


    It is known that for any 2-to-2 process in MSSM, only the helicity conserving (HC) amplitudes survive asymptotically. Studying many such processes, at the 1-loop Electroweak (EW) order, it is found that their high energy HC amplitudes are determined by just three forms: a log-squared function of the ratio of two of the (s, t, u) variables, to which a π 2 is added; and two Sudakov-like ln- and ln 2 -terms accompanied by respective mass-dependent constants. Apart from a possible additional residual constant (which is also discussed), these HC amplitudes, may be expressed as linear combinations of the above three forms, with coefficients being rational functions of the (s, t, u) variables. This 1-loop property, called supersimplicity, is of course claimed for the 2-to-2 processes considered; but no violating examples are known at present. For ug → dW, supersimplicity is found to be a very good approximation at LHC energies, provided the SUSY scale is not too high. SM processes are also discussed, and their differences are explored. (authors)

  11. High Energy Physics (HEP) benchmark program

    International Nuclear Information System (INIS)

    Yasu, Yoshiji; Ichii, Shingo; Yashiro, Shigeo; Hirayama, Hideo; Kokufuda, Akihiro; Suzuki, Eishin.


    High Energy Physics (HEP) benchmark programs are indispensable tools to select suitable computer for HEP application system. Industry standard benchmark programs can not be used for this kind of particular selection. The CERN and the SSC benchmark suite are famous HEP benchmark programs for this purpose. The CERN suite includes event reconstruction and event generator programs, while the SSC one includes event generators. In this paper, we found that the results from these two suites are not consistent. And, the result from the industry benchmark does not agree with either of these two. Besides, we describe comparison of benchmark results using EGS4 Monte Carlo simulation program with ones from two HEP benchmark suites. Then, we found that the result from EGS4 in not consistent with the two ones. The industry standard of SPECmark values on various computer systems are not consistent with the EGS4 results either. Because of these inconsistencies, we point out the necessity of a standardization of HEP benchmark suites. Also, EGS4 benchmark suite should be developed for users of applications such as medical science, nuclear power plant, nuclear physics and high energy physics. (author)

  12. High energy physics at Brookhaven National Laboratory

    International Nuclear Information System (INIS)

    Samios, N.P.


    The high energy plans at BNL are centered around the AGS and ISABELLE, or a variant thereof. At present the AGS is maintaining a strong and varied program. This last year a total of 4 x 10 19 protons were delivered on target in a period of approximately 20 weeks. Physics interest is very strong, half of the submitted proposals are rejected (thereby maintaining high quality experiments) and the program is full over the next two years. The future colliding beam facility will utilize the AGS as an injector and will be a dedicated facility. It will have six intersection regions, run > 10 7 sec/year, and explore a new domain of energy and luminosity. Common to all the considered alternatives is a large aperture proton ring. These possible choices involve pp, ep, and heavy ion variants. The long term philosophy is to run the AGS as much as possible, continuously to upgrade it in performance and reliability, and then to phase it down as the new collider begins operation

  13. Colloquia on High Energy Physics: IFAE 2012

    International Nuclear Information System (INIS)

    Barion, L.; Bozzi, C.; Fioravanti, E.; Pagliara, G; Ricci, B.


    The 2012 edition of the 'Incontri di Fisica delle Alte Energie' (IFAE2012) was held at the Aula Magna del Rettorato of the Ferrara University from April 11th to 13th. The Conference was attended by more than 150 participants, with about 75 presentations and 35 posters covering the most recent advances in High Energy Physics, Astroparticle and Neutrino Physics, Heavy Ions and Detection Techniques. Only plenary sessions were held, giving young researchers the opportunity to present their work to a large audience, either with talks or posters, which were on permanent display during the entire conference. The scientific program was organized in 7 sessions: 1-Standard Model and beyond; 2-QCD; 3-Heavy Flavour; 4-Heavy Ions; 5-Astro particles; 6-Neutrino Physics; 7-New Technologies. Introductory, state-of-the art talks, opened the Conference and each session. More detailed talks followed, stimulating lively discussions and interactions between the speakers and the participants. Three talks and two posters by young researchers (Matteo Biassoni, Roberta Cardinale, Stefano Perazzini, Federica Primavera and Laura Zotti) were selected for their high quality and awarded a prize money. It would not have been possible to held this conference without the support of INFN Sezione di Ferrara, Universita' di Ferrara and the generous contributions of Hamamatsu, Caen, National Instruments and AdvanSiD, whom we gratefully acknowledge.

  14. Sampling calorimeters in high energy physics

    International Nuclear Information System (INIS)

    Gordon, H.A.; Smith, S.D.


    At our current understanding of elementary particle physics, the fundamental constituents are the photon, quarks, gluons and leptons with a few highly forecasted heavy bosons. Calorimeters are essential for detecting all of these particles. Quarks and gluons fragment into many particles - at high energies, so many particles that one may not want to measure each one separately. This group of both charged and neutral particles can only be measured by calorimeters. The energy of an electron needs to be measured by a calorimeter and muon identification is enhanced by the recognition of a minimum ionizing particle passing through the calorimeter. Sampling calorimeters - those instruments in which part of the shower is sampled in an active medium sandwiched between absorbing layers - are reviewed. What follows is a very cursory overview of some fundamental aspects of sampling calorimeters. First, the properties of shower development are described for both the electromagnetic and hadronic cases. Then, examples of various readout schemes are discussed. Finally, some currently promising new ideas in calorimetry are described. 21 references

  15. High energy nuclear collisions: theory review

    International Nuclear Information System (INIS)

    Fries, Rainer J.


    Full text: High Energy Nuclear Collisions are studied at the Relativistic Heavy Ion Collider (RHIC) and, starting next year, also at the Large Hadron Collider (LHC) to study the formation and properties of quark gluon plasma (QGP). This effort is driven by the prediction that above a certain critical temperature quarks and gluons are deconfined. For the past ten years of running RHIC has performed marvelously. Data from RHIC has answered many initial questions, but it has also provided new, more challenging problems to understand the nature of quark gluon plasma and the dynamics of heavy ion collisions. In this talk I review some of the basic concepts of high energy nuclear collisions and quark gluon plasma formation. We also discuss some of the novel and open questions that we are faced with. We discuss recent predictions on properties of hot quantum chromodynamics, emerging signatures for the color glass condensate, the fascinating idea of local P and CP violation in QCD, as well as ongoing research on hard probes and electromagnetic signatures

  16. Constraints on a Proton Synchrotron Origin of VHE Gamma Rays from the Extended Jet of AP Librae

    Energy Technology Data Exchange (ETDEWEB)

    Basumallick, Partha Pratim; Gupta, Nayantara, E-mail: [Raman Research Institute, C. V. Raman Avenue, Sadashivanagar, Bangalore 560080 (India)


    The multiwavelength photon spectrum from the BL Lac object AP Librae extends from radio to TeV gamma rays. The X-ray to very high-energy gamma-ray emission from the extended jet of this source has been modeled with inverse Compton (IC) scattering of relativistic electrons off the cosmic microwave background (CMB) photons. The IC/CMB model requires the kpc-scale extended jet to be highly collimated with a bulk Lorentz factor close to 10. Here we discuss the possibility of a proton synchrotron origin of X-rays and gamma rays from the extended jet with a bulk Lorentz factor of 3. This scenario requires an extreme proton energy of 3.98 × 10{sup 21} eV and a high magnetic field of 1 mG of the extended jet with jet power ∼5 × 10{sup 48} erg s{sup −1} in particles and the magnetic field (which is more than 100 times the Eddington luminosity of AP Librae) to explain the very high-energy gamma-ray emission. Moreover, we have shown that X-ray emission from the extended jets of 3C 273 and PKS 0637-752 could be possible by proton synchrotron emission with jet power comparable to the Eddington luminosities.

  17. High yield of low-energy pions from a high-energy primary proton beam

    International Nuclear Information System (INIS)

    Bertin, A.; Capponi, S.; De Castro, S.


    This paper presents the results of the first measurement on the yield of pions with momentum smaller than 220 MeV/c, produced by a 300 GeV/c proton beam. The measurements, performed at the CERN super proton synchrotron using tungsten production targets of different lengths, are discussed referring to the possibility of extending to high-energy laboratories the access to fundamental research involving low-energy pions and muons

  18. 78 FR 50405 - High Energy Physics Advisory Panel (United States)


    ... DEPARTMENT OF ENERGY High Energy Physics Advisory Panel AGENCY: Office of Science, Department of..., General Services Administration, notice is hereby given that the High Energy Physics Advisory Panel will... Sciences Directorate (NSF), on long-range planning and priorities in the national high-energy physics...

  19. The Advanced Telescope for High Energy Astrophysics (United States)

    Guainazzi, Matteo


    Athena (the Advanced Telescope for High Energy Astrophysics) is a next generation X-ray observatory currently under study by ESA for launch in 2028. Athena is designed to address the Hot and Energetic Universe science theme, which addresses two key questions: 1) How did ordinary matter evolve into the large scale structures we see today? 2) How do black holes grow and shape the Universe. To address these topics Athena employs an innovative X-ray telescope based on Silicon Pore Optics technology to deliver extremely light weight and high throughput, while retaining excellent angular resolution. The mirror can be adjusted to focus onto one of two focal place instruments: the X-ray Integral Field Unit (X-IFU) which provides spatially-resolved, high resolution spectroscopy, and the Wide Field Imager (WFI) which provides spectral imaging over a large field of view, as well as high time resolution and count rate tolerance. Athena is currently in Phase A and the study status will be reviewed, along with the scientific motivations behind the mission.

  20. UPR/Mayaguez High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    Mendez, Hector [Univ. of Puerto Rico, Mayaguez (Puerto Rico)


    This year the University of Puerto Rico at Mayaguez (UPRM) High Energy Physics (HEP) group continued with the ongoing research program outlined in the grant proposal. The program is centered on the Compact Muon Solenoid (CMS) experiment at the proton-proton (pp) collisions at the Large Hadron Collider (LHC) at CERN in Geneva, Switzerland. The main research focus is on data analysis and on the preparation for the High Luminosity (HL) LHC or experiment detector upgrade. The physics data analysis included Higgs Doublet Search and measurement of the (1) Λ0b branching fraction, (2) B meson mass, and (3) hyperon θ-b lifetime. The detector upgrade included work on the preparations for the Forward Pixel (FPIX) detector Silicon Sensor Testing in a production run at Fermilab. In addition, the group has taken responsibilities on the Software Release through our former research associate Dr. Eric Brownson who acted until last December as a Level Two Offline Manager for the CMS Upgrade. In support of the CMS data analysis activities carried out locally, the UPRM group has built and maintains an excellent Tier3 analysis center in Mayaguez. This allowed us to analyze large data samples and to continue the development of algorithms for the upgrade tracking robustness we started several years ago, and we plan to resume in the near future. This project involves computer simulation of the radiation damage to be suffered at the higher luminosities of the upgraded LHC. This year we continued to serve as a source of outstanding students for the field of high energy physics. Three of our graduate students finished their MS work in May, 2014, Their theses research were on data analysis of heavy quark b-physics. All of them are currently enrolled at Ph.D. physics program across the nation. One of them (Hector Moreno) at New Mexico University (Hector Moreno), one at University of New Hampshire (Sandra Santiesteban) and one at University of

  1. New High-Energy Nanofiber Anode Materials

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xiangwu [North Carolina State Univ., Raleigh, NC (United States); Fedkiw, Peter [North Carolina State Univ., Raleigh, NC (United States); Khan, Saad [North Carolina State Univ., Raleigh, NC (United States); Huang, Alex [North Carolina State Univ., Raleigh, NC (United States); Fan, Jiang [North Carolina State Univ., Raleigh, NC (United States)


    The overall goal of the proposed work was to use electrospinning technology to integrate dissimilar materials (lithium alloy and carbon) into novel composite nanofiber anodes, which simultaneously had high energy density, reduced cost, and improved abuse tolerance. The nanofiber structure allowed the anodes to withstand repeated cycles of expansion and contraction. These composite nanofibers were electrospun into nonwoven fabrics with thickness of 50 μm or more, and then directly used as anodes in a lithium-ion battery. This eliminated the presence of non-active materials (e.g., conducting carbon black and polymer binder) and resulted in high energy and power densities. The nonwoven anode structure also provided a large electrode-electrolyte interface and, hence, high rate capacity and good lowtemperature performance capability. Following are detailed objectives for three proposed project periods. During the first six months: Obtain anodes capable of initial specific capacities of 650 mAh/g and achieve ~50 full charge/discharge cycles in small laboratory scale cells (50 to 100 mAh) at the 1C rate with less than 20 percent capacity fade; In the middle of project period: Assemble, cycle, and evaluate 18650 cells using proposed anode materials, and demonstrate practical and useful cycle life (750 cycles of ~70% state of charge swing with less than 20% capacity fade) in 18650 cells with at least twice improvement in the specific capacity than that of conventional graphite electrodes; At the end of project period: Deliver 18650 cells containing proposed anode materials, and achieve specific capacities greater than 1200 mAh/g and cycle life longer than 5000 cycles of ~70% state of charge swing with less than 20% capacity fade.

  2. Perspectives on High-Energy-Density Physics (United States)

    Drake, R. Paul


    Much of 21st century plasma physics will involve work to produce, understand, control, and exploit very non-traditional plasmas. High-energy density (HED) plasmas are often examples, variously involving strong Coulomb interactions and few particles per Debeye sphere, dominant radiation effects, strongly relativistic effects, or strongly quantum-mechanical behavior. Indeed, these and other modern plasma systems often fall outside the early standard theoretical definitions of ``plasma''. This presentation will focus on two types of HED plasmas that exhibit non-traditional behavior. Our first example will be the plasmas produced by extremely strong shock waves. Shock waves are present across the entire realm of plasma densities, often in space or astrophysical contexts. HED shock waves (at pressures > 1 Mbar) enable studies in many areas, from equations of state to hydrodynamics to radiation hydrodynamics. We will specifically consider strongly radiative shocks, in which the radiative energy fluxes are comparable to the mechanical energy fluxes that drive the shocks. Modern HED facilities can produce such shocks, which are also present in dense, energetic, astrophysical systems such as supernovae. These shocks are also excellent targets for advanced simulations due to their range of spatial scales and complex radiation transport. Our second example will be relativistic plasmas. In general, these vary from plasmas containing relativistic particle beams, produced for some decades in the laboratory, to the relativistic thermal plasmas present for example in pulsar winds. Laboratory HED relativistic plasmas to date have been those produced by laser beams of irradiance ˜ 10^18 to 10^22 W/cm^2 or by accelerator-produced HED electron beams. These have applications ranging from generation of intense x-rays to production of proton beams for radiation therapy to acceleration of electrons. Here we will focus on electron acceleration, a spectacular recent success and a rare

  3. UPR/Mayaguez High Energy Physics

    International Nuclear Information System (INIS)

    Lopez, Angel M.


    For the period of sixteen years covered by this report (June 1, 1997 - July 31, 2013) the High Energy Physics Group at the University of Puerto Rico's Mayaguez Campus (UPRM) carried out an extensive research program that included major experiments at Fermi National Accelerator Laboratory (Fermilab), the Cornell Electron-positron Collider and CERN. In particular, these were E831 (FOCUS) at Fermilab, CLEOc at Cornell and the Compact Muon Solenoid (CMS) at the Large Hadron Collider (LHC) at CERN. The group's history is one of successful execution and growth. Beginning with one faculty researcher in 1985, it eventually included four faculty researchers, one post-doctoral research associate, two undergraduates and as many as six graduate students at one time working on one of the experiments that discovered the Higgs boson. Some of this expansion was due to the group's leveraging of funds from the Department of Energy's core grant to attract funds from National Science Foundation programs not targeted to high energy physics. Besides the group's research productivity, its other major contribution was the training of a large number of MS students who later went on to successful technical careers in industry as well as academia including many who obtained PhD degrees at US universities. In an attempt to document this history, this final report gives a general description of the Group's work prior to June 1, 2010, the starting date for the last grant renewal period. Much more detail can, of course, be found in the annual reports submitted up to that date. The work during the last grant period is discussed in detail in a separate section. To summarize the group's scientific accomplishments, one can point to the results of the experiments. Both FOCUS and CLEOc were designed to carry out precise measurements of processes involving the heavy quarks, charm and bottom. Heavy quarks are particularly interesting because, due to their mass

  4. Transverse microanalysis of high energy Ion implants

    Energy Technology Data Exchange (ETDEWEB)

    Dooley, S P; Jamieson, D N; Nugent, K W; Prawer, S [Melbourne Univ., Parkville, VIC (Australia). School of Physics


    High energy ion implants in semiconductor materials have been analyzed by Channeling Contrast Microscopy (CCM) perpendicular to the implant direction, allowing imaging of the entire ion track. The damage produced by Channeled and Random 1.4 MeV H{sup +} implants into the edge of a <100> type IIa diamond wafer were analyzed by channeling into the face of the crystal. The results showed negligible damage in the surface region of the implants, and swelling induced misalignment at the end of range of the implants. Channeled 1.4 MeV H{sup +} implants in diamond had a range only 9% deeper than Random implants, which could be accounted for by dechanneling of the beam. The channeling of H{sup +}{sub 2} ions has been previously found to be identical to that of protons of half energy, however the current experiment has shown a 1% increase in {chi}{sub min} for H{sup +}{sub 2} in diamond compared to H{sup +} at 1,2 MeV per proton. This is due to repulsion between protons within the same channel. 5 refs., 2 figs.

  5. Transverse microanalysis of high energy Ion implants

    Energy Technology Data Exchange (ETDEWEB)

    Dooley, S.P.; Jamieson, D.N.; Nugent, K.W.; Prawer, S. [Melbourne Univ., Parkville, VIC (Australia). School of Physics


    High energy ion implants in semiconductor materials have been analyzed by Channeling Contrast Microscopy (CCM) perpendicular to the implant direction, allowing imaging of the entire ion track. The damage produced by Channeled and Random 1.4 MeV H{sup +} implants into the edge of a <100> type IIa diamond wafer were analyzed by channeling into the face of the crystal. The results showed negligible damage in the surface region of the implants, and swelling induced misalignment at the end of range of the implants. Channeled 1.4 MeV H{sup +} implants in diamond had a range only 9% deeper than Random implants, which could be accounted for by dechanneling of the beam. The channeling of H{sup +}{sub 2} ions has been previously found to be identical to that of protons of half energy, however the current experiment has shown a 1% increase in {chi}{sub min} for H{sup +}{sub 2} in diamond compared to H{sup +} at 1,2 MeV per proton. This is due to repulsion between protons within the same channel. 5 refs., 2 figs.

  6. Energy storage via high temperature superconductivity (SMES)

    Energy Technology Data Exchange (ETDEWEB)

    Mikkonen, R. [Tampere Univ. of Technology (Finland)


    The technology concerning high temperature superconductors (HTS) is matured to enabling different kind of prototype applications including SMES. Nowadays when speaking about HTS systems, attention is focused on the operating temperature of 20-30 K, where the critical current and flux density are fairly close to 4.2 K values. In addition by defining the ratio of the energy content of a novel HTS magnetic system and the required power to keep the system at the desired temperature, the optimum settles to the above mentioned temperature range. In the frame of these viewpoints a 5 kJ HTS SMES system has been designed and tested at Tampere University of Technology with a coil manufactured by American Superconductor (AMSC). The HTS magnet has inside and outside diameters of 252 mm and 317 mm, respectively and axial length of 66 mm. It operates at 160 A and carries a total of 160 kA-turns to store the required amount of energy. The effective magnetic inductance is 0.4 H and the peak axial field is 1.7 T. The magnet is cooled to the operating temperature of 20 K with a two stage Gifford-McMahon type cryocooler with a cooling power of 60 W at 77 K and 8 W at 20 K. The magnetic system has been demonstrated to compensate a short term loss of power of a sensitive consumer

  7. Hadron production in high energy muon scattering

    International Nuclear Information System (INIS)

    Hicks, R.G.


    An experiment was performed to study muon-proton scattering at an incident energy of 225 GeV and a total effective flux of 4.3 x 10 10 muons. This experiment is able to detect charged particles in coincidence with the scattered muon in the forward hemisphere, and results are reported for the neutral strange particles K/sub s/ 0 and Λ 0 decaying into two charged particles. Within experimental limits the masses and lifetimes of these particles are consistent with previous measurements. The distribution of hadrons produced in muon scattering was determined, measuring momentum components parallel and transverse to the virtual photon direction, and these distributions are compared to other high energy experiments involving the scattering of pions, protons, and neutrinos from protons. Structure functions for hadron production and particle ratios are calculated. No azimuthal dependence is observed, and lambda production does not appear to be polarized. The physical significance of the results is discussed within the frame-work of the quark-proton model

  8. Hadron production in high energy muon scattering

    International Nuclear Information System (INIS)

    Hicks, R.G.


    An experiment was performed to study muon-proton scattering at an incident energy of 225 GeV and a total effective flux of 4.3 x 10 10 muons. This experiment is able to detect charged particles in coincidence with the scattered muon in the forward hemisphere, and results are reported for the neutral strange particles K/sub s/ 0 and Λ 0 decaying into two charged particles. Within experimental limits the masses and lifetimes of these particles are consistent with previous measurements. The distribution of hadrons produced in muon scattering is determined, measuring momentum components parallel and transverse to the virtual photon direction, and these distributions are compared to other high energy experiments involving the scattering of pions, protons, and neutrinos from protons. Structure functions for hadron production and particle ratios are calculated. No azimuthal dependence is observed, and lambda production does not appear to be polarized. The physical significance of the results is discussed within the framework of the quark-parton model. 29 references

  9. Energy Efficient Graphene Based High Performance Capacitors. (United States)

    Bae, Joonwon; Kwon, Oh Seok; Lee, Chang-Soo


    Graphene (GRP) is an interesting class of nano-structured electronic materials for various cutting-edge applications. To date, extensive research activities have been performed on the investigation of diverse properties of GRP. The incorporation of this elegant material can be very lucrative in terms of practical applications in energy storage/conversion systems. Among various those systems, high performance electrochemical capacitors (ECs) have become popular due to the recent need for energy efficient and portable devices. Therefore, in this article, the application of GRP for capacitors is described succinctly. In particular, a concise summary on the previous research activities regarding GRP based capacitors is also covered extensively. It was revealed that a lot of secondary materials such as polymers and metal oxides have been introduced to improve the performance. Also, diverse devices have been combined with capacitors for better use. More importantly, recent patents related to the preparation and application of GRP based capacitors are also introduced briefly. This article can provide essential information for future study. Copyright© Bentham Science Publishers; For any queries, please email at

  10. Weakly supervised classification in high energy physics

    International Nuclear Information System (INIS)

    Dery, Lucio Mwinmaarong; Nachman, Benjamin; Rubbo, Francesco; Schwartzman, Ariel


    As machine learning algorithms become increasingly sophisticated to exploit subtle features of the data, they often become more dependent on simulations. This paper presents a new approach called weakly supervised classification in which class proportions are the only input into the machine learning algorithm. Using one of the most challenging binary classification tasks in high energy physics — quark versus gluon tagging — we show that weakly supervised classification can match the performance of fully supervised algorithms. Furthermore, by design, the new algorithm is insensitive to any mis-modeling of discriminating features in the data by the simulation. Weakly supervised classification is a general procedure that can be applied to a wide variety of learning problems to boost performance and robustness when detailed simulations are not reliable or not available.

  11. Sanitation methods using high energy electron beams

    International Nuclear Information System (INIS)

    Levaillant, C.; Gallien, C.L.


    Short recycling of waste water and the use of liquid or dehydrated sludge as natural manure for agriculture or animal supplement feed is of great economical and ecological interest. It implies strong biological and chemical disinfection. Ionizing radiations produced by radioactive elements or linear accelerators can be used as a complement of conventional methods in the treatment of liquid and solid waste. An experiment conducted with high-energy electron-beam linear accelerators is presented. Degradation of undesirable metabolites in water occurs for a dose of 50 kRad. Undesirable seeds present in sludge are destroyed with a 200 kRad dose. A 300 kRad dose is sufficient for parasitic and bacterial disinfection (DL 90). Destruction of polio virus (DL 90) is obtained for 400 kRad. Higher doses (1000 to 2000 kRad) produce mineralization of toxic organic mercury, reduce some chemical toxic pollutants present in sludge and improve flocculation. (author)

  12. High-energy evolution to three loops (United States)

    Caron-Huot, Simon; Herranen, Matti


    The Balitsky-Kovchegov equation describes the high-energy growth of gauge theory scattering amplitudes as well as nonlinear saturation effects which stop it. We obtain the three-loop corrections to the equation in planar N = 4 super Yang-Mills theory. Our method exploits a recently established equivalence with the physics of soft wide-angle radiation, so-called non-global logarithms, and thus yields at the same time the threeloop evolution equation for non-global logarithms. As a by-product of our analysis, we develop a Lorentz-covariant method to subtract infrared and collinear divergences in crosssection calculations in the planar limit. We compare our result in the linear regime with a recent prediction for the so-called Pomeron trajectory, and compare its collinear limit with predictions from the spectrum of twist-two operators.

  13. High energy nucleus-nucleus collisions

    International Nuclear Information System (INIS)

    Bhalla, K.B.


    An attempt is made to explain nucleus-nucleus collisions based on nuclear emulsion experiments. Peripheral and central collisions are described in detail. Assuming the fireball model, the concepts of geometry, kinematics and thermodynamics in this model are discussed. Projectile and target fragmentations are studied. The advantages of using nuclear emulsions as detectors, are mentioned. Proton-nucleus collisions and nucleus-nucleus collisions are compared. Interactions, of projectiles such as Ca, B and C on targets such as Pb, Ag, Br etc. at very high energies (approximately 300 to 1700 Gev) are listed. A comparison of the near multiplicities in these interactions is given. A generalized explanation is given on the processes involved in these interactions. (A.K.)

  14. High energy hadron-nucleus collision

    International Nuclear Information System (INIS)

    Takagi, Fujio


    This is a lecture note concerning high energy hadron-nucleus collision. The lecture gives the inelastic total cross section and the Glanber approximate multiple scattering formula at first. The mechanism of nuclear spallation is described in a cylindrical image. The multiplicity, the one particle distribution and the time-space structure of particle production are discussed. Various models are presented. The attenuation of forward particles and the structure of hadrons are discussed for each model. The atomic number (A) dependence of the production of large transverse momentum particles and jet, and the A dependence of charged multiplicity are presented. The backward production of particles and many body correlation are discussed. Lepton pair production and the initial interaction of constituents, collective interaction, multi quark state and phase transition are described. (Kato, T.)

  15. Charm decays and high energy photoproduction

    International Nuclear Information System (INIS)


    The activities during the first nine months of the three-year grant period have concentrated on the development of computer resources both hardware and software as well as the design of a muon detector for Fermilab Experiment E831. An important related activity has been a successful search of funds to complement the resources provided by this grant and permit the involvement of additional personnel as well as a much-better leveraged impact of the funds provided. Grant funds were the main providers of a new computer system which is dedicated to the High Energy Physics group at Mayaguez. This system can be considered a minimum configuration to carry out the simulation and analysis loads of E831. The bulk of the software development has been directed at developing a Monte Carlo simulation for E831 in particular the E831 muon detector

  16. Dipoles for High-Energy LHC

    CERN Document Server

    Todesco, E; De Rijk, G; Rossi, L


    For the High Energy LHC, a study of a 33 TeV center of mass collider in the LHC tunnel, main dipoles of 20 T operational field are needed. In this paper we first review the conceptual design based on block coil proposed in the Malta workshop, addressing the issues related to coil fabrication and assembly. We then propose successive simplifications of this design, associating a cost estimate of the conductor. We then analyse a block layout for a 15 T magnet. Finally, we consider two layouts based on the D20 and HD2 short models built by LBL. A first analysis of the aspects related to protection of these challenging magnets is given.

  17. High energy backscattering analysis using RUMP

    International Nuclear Information System (INIS)

    Doolittle, L.R.


    A backscattering analysis program such as RUMP fundamentally requires two reference sets of data in order to accomplish anything useful: stopping powers and scattering cross sections. Users of original versions of RUMP had to be satisfied with polynomial stopping powers geared for 1 to 3 MeV, and purely Rutherford scattering cross sections. As people increasingly turn to high beam energies to solve difficult materials analysis problems, RUMP has evolved greater flexibility for its reference data. It now allows data files to be loaded describing different stopping powers and arbitrary scattering cross sections. Auxiliary programs have been written to generate the reference data files, either from a theory or from measured reference data. Descriptions are given of both the underlying physics and the operational details of the software

  18. Entanglement and decoherence in high energy physics

    International Nuclear Information System (INIS)

    Bertlmann, R.


    Full text: The phenomenon of entanglement occurs in very heavy quantum systems of particle physics. We find analogies but also differences to the entangled spin-1/2 or photon systems. In particular we discuss the features of entangled 'strangeness', the K-meson system, where a Bell inequality exists which has a remarkable connection to CP (charge conjugation and parity) and its violation. Stability of entangled quantum states is studied by allowing the system to interact with an environment. We consider possible decoherence of entangled 'beauty', the B-meson system, produced at the particle colliders at very high energies (10 GeV). Finally, we discuss a criterion for detecting entangled/separable states, a generalized Bell inequality and entanglement witness. We illustrate its geometric features by the two-spin example Alice and Bob. (author)

  19. Nonextensive statistical mechanics and high energy physics

    Directory of Open Access Journals (Sweden)

    Tsallis Constantino


    Full Text Available The use of the celebrated Boltzmann-Gibbs entropy and statistical mechanics is justified for ergodic-like systems. In contrast, complex systems typically require more powerful theories. We will provide a brief introduction to nonadditive entropies (characterized by indices like q, which, in the q → 1 limit, recovers the standard Boltzmann-Gibbs entropy and associated nonextensive statistical mechanics. We then present somerecent applications to systems such as high-energy collisions, black holes and others. In addition to that, we clarify and illustrate the neat distinction that exists between Lévy distributions and q-exponential ones, a point which occasionally causes some confusion in the literature, very particularly in the LHC literature

  20. Polarized targets in high energy physics

    International Nuclear Information System (INIS)

    Cates, G.D. Jr.


    Various approaches are discussed for producing polarized nuclear targets for high energy physics experiments. As a unifying theme, examples are drawn from experiments to measure spin dependent structure functions of nucleons in deep inelastic scattering. This single physics goal has, over roughly two decades, been a driving force in advances in target technology. Actual or planned approaches have included solid targets polarized by dynamic nuclear polarization (DNP), several types of internal targets for use in storage rings, and gaseous 3 He targets polarized by spin-exchange optical pumping. This last approach is the type of target adopted for SLAC E-142, an experiment to measure the spin structure function of the neutron, and is described in detail

  1. Polarized targets in high energy physics

    Energy Technology Data Exchange (ETDEWEB)

    Cates, G.D. Jr. [Princeton Univ., NJ (United States)


    Various approaches are discussed for producing polarized nuclear targets for high energy physics experiments. As a unifying theme, examples are drawn from experiments to measure spin dependent structure functions of nucleons in deep inelastic scattering. This single physics goal has, over roughly two decades, been a driving force in advances in target technology. Actual or planned approaches have included solid targets polarized by dynamic nuclear polarization (DNP), several types of internal targets for use in storage rings, and gaseous {sup 3}He targets polarized by spin-exchange optical pumping. This last approach is the type of target adopted for SLAC E-142, an experiment to measure the spin structure function of the neutron, and is described in detail.

  2. Weakly supervised classification in high energy physics

    Energy Technology Data Exchange (ETDEWEB)

    Dery, Lucio Mwinmaarong [Physics Department, Stanford University,Stanford, CA, 94305 (United States); Nachman, Benjamin [Physics Division, Lawrence Berkeley National Laboratory,1 Cyclotron Rd, Berkeley, CA, 94720 (United States); Rubbo, Francesco; Schwartzman, Ariel [SLAC National Accelerator Laboratory, Stanford University,2575 Sand Hill Rd, Menlo Park, CA, 94025 (United States)


    As machine learning algorithms become increasingly sophisticated to exploit subtle features of the data, they often become more dependent on simulations. This paper presents a new approach called weakly supervised classification in which class proportions are the only input into the machine learning algorithm. Using one of the most challenging binary classification tasks in high energy physics — quark versus gluon tagging — we show that weakly supervised classification can match the performance of fully supervised algorithms. Furthermore, by design, the new algorithm is insensitive to any mis-modeling of discriminating features in the data by the simulation. Weakly supervised classification is a general procedure that can be applied to a wide variety of learning problems to boost performance and robustness when detailed simulations are not reliable or not available.

  3. Diamond detectors for high energy physics experiments (United States)

    Bäni, L.; Alexopoulos, A.; Artuso, M.; Bachmair, F.; Bartosik, M.; Beacham, J.; Beck, H.; Bellini, V.; Belyaev, V.; Bentele, B.; Berdermann, E.; Bergonzo, P.; Bes, A.; Brom, J.-M.; Bruzzi, M.; Cerv, M.; Chiodini, G.; Chren, D.; Cindro, V.; Claus, G.; Collot, J.; Cumalat, J.; Dabrowski, A.; D'Alessandro, R.; Dauvergne, D.; de Boer, W.; Dorfer, C.; Dünser, M.; Eremin, V.; Eusebi, R.; Forcolin, G.; Forneris, J.; Frais-Kölbl, H.; Gallin-Martel, L.; Gallin-Martel, M. L.; Gan, K. K.; Gastal, M.; Giroletti, C.; Goffe, M.; Goldstein, J.; Golubev, A.; Gorišek, A.; Grigoriev, E.; Grosse-Knetter, J.; Grummer, A.; Gui, B.; Guthoff, M.; Haughton, I.; Hiti, B.; Hits, D.; Hoeferkamp, M.; Hofmann, T.; Hosslet, J.; Hostachy, J.-Y.; Hügging, F.; Hutton, C.; Jansen, H.; Janssen, J.; Kagan, H.; Kanxheri, K.; Kasieczka, G.; Kass, R.; Kassel, F.; Kis, M.; Konovalov, V.; Kramberger, G.; Kuleshov, S.; Lacoste, A.; Lagomarsino, S.; Lo Giudice, A.; Lukosi, E.; Maazouzi, C.; Mandic, I.; Mathieu, C.; Menichelli, M.; Mikuž, M.; Morozzi, A.; Moss, J.; Mountain, R.; Murphy, S.; Muškinja, M.; Oh, A.; Oliviero, P.; Passeri, D.; Pernegger, H.; Perrino, R.; Picollo, F.; Pomorski, M.; Potenza, R.; Quadt, A.; Re, A.; Reichmann, M.; Riley, G.; Roe, S.; Sanz, D.; Scaringella, M.; Schaefer, D.; Schmidt, C. J.; Schnetzer, S.; Sciortino, S.; Scorzoni, A.; Seidel, S.; Servoli, L.; Smith, S.; Sopko, B.; Sopko, V.; Spagnolo, S.; Spanier, S.; Stenson, K.; Stone, R.; Sutera, C.; Tannenwald, B.; Taylor, A.; Traeger, M.; Tromson, D.; Trischuk, W.; Tuve, C.; Uplegger, L.; Velthuis, J.; Venturi, N.; Vittone, E.; Wagner, S.; Wallny, R.; Wang, J. C.; Weingarten, J.; Weiss, C.; Wengler, T.; Wermes, N.; Yamouni, M.; Zavrtanik, M.


    Beam test results of the radiation tolerance study of chemical vapour deposition (CVD) diamond against different particle species and energies is presented. We also present beam test results on the independence of signal size on incident particle rate in charged particle detectors based on un-irradiated and irradiated poly-crystalline CVD diamond over a range of particle fluxes from 2 kHz/cm2 to 10 MHz/cm2. The pulse height of the sensors was measured with readout electronics with a peaking time of 6 ns. In addition functionality of poly-crystalline CVD diamond 3D devices was demonstrated in beam tests and 3D diamond detectors are shown to be a promising technology for applications in future high luminosity experiments.

  4. Review of high energy heavy ion experiments

    International Nuclear Information System (INIS)

    Miake, Yasuo


    It has been proposed that in high energy heavy ion collisions a physical conditions similar to the early stage of the Universe can be established in the laboratory. New phase of matter expected to be created is called the quark gluon plasma (QGP). Based on the motivation to create the QGP in the laboratory, heavy ion beams have been accelerated at AGS of Brookhaven National Laboratory and also at CERN-SPS. Several interesting features of the data have been reported, among which are: the suppression of J/ψ production in Pb+Pb collisions, the enhancement of low mass lepton pairs, and the collective behavior of hadron production. These features are reviewed under the key words of Deconfinement, Chiral Restoration and Collectivity in the lecture. (author)

  5. High energy photon emission from wakefields

    Energy Technology Data Exchange (ETDEWEB)

    Farinella, D. M., E-mail:; Lau, C. K.; Taimourzadeh, S.; Hwang, Y.; Abazajian, K.; Canac, N.; Taborek, P.; Tajima, T. [Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Zhang, X. M., E-mail: [Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Shanghai Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, Shanghai 201800 (China); Koga, J. K., E-mail: [Kansai Photon Science Institute, Japan Atomic Energy Agency (JAEA), Kizugawa, Kyoto 619-0215 (Japan); Ebisuzaki, T., E-mail: [RIKEN, Wako, Saitama 351-0198 (Japan)


    Experimental evidence has accumulated to indicate that wakefield acceleration (WFA) accompanies intense and sometimes coherent emission of radiation such as from betatron radiation. The investigation of this issue has additional impetus nowadays because we are learning (1) there is an additional acceleration process of the ponderomotive acceleration; (2) WFA may become relevant in much higher density regimes; (3) WFA has been proposed as the mechanism for extreme high energy cosmic ray acceleration and gamma ray bursts for active galactic nuclei. These require us to closely examine the radiative mechanisms in WFA anew. We report studies of radiation from wakefield (self-injected betatron) and ponderomotive (laser field) mechanisms in scalings of the frequency and intensity of the driver, as well as the plasma density.

  6. High energy ion microbeams and their applications

    International Nuclear Information System (INIS)

    Bakhru, H.; Nickles, E.; Haberl, A.; Morris, W.G.


    In recent years there has been rapid growth for the development of equipment for forming a focussed beam (0.5 - 2μm) with high energy ions. The State University of New York at Albany ion scanning microprobe has been used for several applications especially in the fields of materials and biological studies. Rutherford backscattering spectroscopy (RBS) and particle-induced x-ray emission (PIXE) analysis have been performed on microelectronic circuits with a spatial resolution of approximately 2 μm. Studies on films of superconductors (YBa CuO) will be presented. Applications of microbeams for the biological studies and analytical techniques will be presented. Current and future role of microbeams and their limitations will be discussed. (author)

  7. Networking for high energy physics in Japan

    International Nuclear Information System (INIS)

    Karita, Yukio; Abe, Fumio; Hirose, Hitoshi; Goto, Hiroyuki; Ogasawara, Ryusuke; Yuasa, Fukuko; Banno, Yoshiaki; Yasu, Yoshiji


    The computer network for high energy physics in Japan has grown over the last five or six years and is still expanding. Its original purpose was to provide the collaborators in universities access to the computing resources in KEK. Adding to the remote login from terminals, VAXs or Fujitsu computers located in universities have been connected to KEK's computers by DECnet or FNA (Fujitsu's SNA) and have formed the ''Japanese HEPnet''. Since the link between LBL and KEK was established in June 1987, the Japanese HEPnet is combined with the American HEPnet and is an indispensable tool for international collaboration. The current communication media for Japanese HEPnet, leased lines and public X.25, are being replaced by Gakujo-net (Monbusho's inter-university private X.25 network). DECnet, FNA, IP and Ethernet-bridge will run on Gakujo-net for the Japanese HEPnet. (orig.)

  8. Microfluidic Scintillation Detectors for High Energy Physics

    CERN Document Server

    Maoddi, Pietro; Mapelli, Alessandro

    This thesis deals with the development and study of microfluidic scintillation detectors, a technology of recent introduction for the detection of high energy particles. Most of the interest for such devices comes from the use of a liquid scintillator, which entails the possibility of changing the active material in the detector, leading to increased radiation resistance. A first part of the thesis focuses on the work performed in terms of design and modelling studies of novel prototype devices, hinting to new possibilities and applications. In this framework, the simulations performed to validate selected designs and the main technological choices made in view of their fabrication are addressed. The second part of this thesis deals with the microfabrication of several prototype devices. Two different materials were studied for the manufacturing of microfluidic scintillation detectors, namely the SU-8 photosensitive epoxy and monocrystalline silicon. For what concerns the former, an original fabrication appro...

  9. MINAC, portable high energy radiographic inspection system

    International Nuclear Information System (INIS)

    Lapides, M.E.; Schonberg, R.


    MINAC, a portable, high energy radiographic source (1) was recognized as a desired inspection device for nuclear generation plants during EPRI-sponsored studies of the late 1970s and rapidly transitioned from proof-of-principle (1978-1980) to field-proven hardware (1981-present date). The equipment has completed its second generation of configuration development (SHRINKAC), that has recently been used in the field for detection of pipe cracks. Important auxiliaries for image data processing and real-time, thick section radiography have been demonstrated in both laboratory and field situations. Finally, a 6 MeV accelerator alternate is in bench test. These significant developments have, and are expected to continue to upgrade the utility of radiographic inspection in power plant practice. This paper describes the development and experience with this modular system during the last three years

  10. Partons and their applications at high energies

    International Nuclear Information System (INIS)

    Drell, Sidney D.; Yan, Tung-Mow


    We discuss Feynman's parton model for deep inelastic weak or electromagnetic processes as an application of the impulse approximation to elementary particle interactions. The special features and conditions permitting this application are elaborated upon in some detail including the dependence of the parton model and the impulse treatment on an appropriate choice of coordinate frames and the role of the very soft or wee partons. Application of the parton model is made to the calculation of the cross section for massive lepton pair production in very high energy hadron-hadron collisions and compared with experiment. The conjectured role of light cone singularities in describing this and the other deep inelastic amplitudes is also discussed. (c) 2000 Academic Press, Inc

  11. Superconducting magnets for high energy storage rings

    International Nuclear Information System (INIS)

    Sampson, W.B.


    Superconducting dipole and quadrupole magnets were developed for the proton-proton intersecting storage accelerator ISABELLE. Full size prototypes of both kinds of magnets were constructed and successfully tested. The coils are fabricated from a single layer of wide braided superconductor and employ a low temperature iron core. This method of construction leads to two significant performance advantages; little or no training, and the ability of the coil to absorb its total magnetic stored energy without damage. A high pressure (15 atm) helium gas system is used for cooling. Measurements of the random field errors are compared with the expected field distribution. Three magnets (two dipoles and one quadrupole) were assembled into a segment of the accelerator ring structure (half cell). The performance of this magnet array, which is coupled in series both electrically and cryogenically, is also summarized

  12. High Energy Antimatter Telescope (HEAT) Balloon Experiment (United States)

    Beatty, J. J.


    This grant supported our work on the High Energy Antimatter Telescope(HEAT) balloon experiment. The HEAT payload is designed to perform a series of experiments focusing on the cosmic ray positron, electron, and antiprotons. Thus far two flights of the HEAT -e+/- configuration have taken place. During the period of this grant major accomplishments included the following: (1) Publication of the first results of the 1994 HEAT-e+/- flight in Physical Review Letters; (2) Successful reflight of the HEAT-e+/- payload from Lynn Lake in August 1995; (3) Repair and refurbishment of the elements of the HEAT payload damaged during the landing following the 1995 flight; and (4) Upgrade of the ground support equipment for future flights of the HEAT payload.

  13. High Energy Astronomy Observatory (HEAO)-2 (United States)


    This artist's concept depicts the High Energy Astronomy Observatory (HEAO)-2 in orbit. The HEAO-2, the first imaging and largest x-ray telescope built to date, was capable of producing actual photographs of x-ray objects. Shortly after launch, the HEAO-2 was nicknamed the Einstein Observatory by its scientific experimenters in honor of the centernial of the birth of Albert Einstein, whose concepts of relativity and gravitation have influenced much of modern astrophysics, particularly x-ray astronomy. The HEAO-2, designed and developed by TRW, Inc. under the project management of the Marshall Space Flight Center, was launched aboard an Atlas/Centaur launch vehicle on November 13, 1978. The HEAO-2 was originally identified as HEAO-B but the designation was changed once the spacecraft achieved orbit.

  14. Energy efficiency indicators for high electric-load buildings

    Energy Technology Data Exchange (ETDEWEB)

    Aebischer, Bernard; Balmer, Markus A.; Kinney, Satkartar; Le Strat, Pascale; Shibata, Yoshiaki; Varone, Frederic


    Energy per unit of floor area is not an adequate indicator for energy efficiency in high electric-load buildings. For two activities, restaurants and computer centres, alternative indicators for energy efficiency are discussed.

  15. Virtual photon interactions in high energy QCD

    International Nuclear Information System (INIS)

    Gieseke, S.


    We study the interactions of virtual photons in the high energy limit of quantum chromodynamics (QCD). The subject is discussed in terms of two closely linked applications: the calculation of the total cross section for γ * γ * -scattering and the description of DIS in the colour dipole model. We calculate virtual corrections in α s to the process γ * q → (qq)q and the tree level process γ * q → (qqg)q in the high energy limit. From this calculation we obtain one-loop corrections to the effective γ * -reggeon-qq-vertex in the helicity basis of the virtual photon and the qq-pair. The loop integrals for the virtual corrections have been performed and expressed in dimensional regularization in terms of logarithms and dilogarithms. We have convoluted the virtual one-loop matrix elements with tree level matrix elements and expressed the integrals over the phase space of the qq-pair explicitly in terms of a set of standard integrals. The real corrections have been calculated and, in case of the longitudinal polarization, expressed in factorized form. From these calculations, the impact factor of virtual photons will be determined, allowing for a first prediction of the total cross section for γ * γ * -scattering in the next-to-leading-log s approximation. The calculations in this thesis extend the photon wave function picture in the colour dipole model to next-to-leading order. For this purpose, the real corrections with a qqg final state are analyzed in transverse configuration space and interpreted as a first higher Fock component of the photon wave function. In addition, the matrix elements that have been calculated in this thesis are needed for the calculation of jet cross sections. (orig.)

  16. Physics of intense, high energy radiation effects.

    Energy Technology Data Exchange (ETDEWEB)

    Hjalmarson, Harold Paul; Hartman, E. Frederick; Magyar, Rudolph J.; Crozier, Paul Stewart


    This document summarizes the work done in our three-year LDRD project titled 'Physics of Intense, High Energy Radiation Effects.' This LDRD is focused on electrical effects of ionizing radiation at high dose-rates. One major thrust throughout the project has been the radiation-induced conductivity (RIC) produced by the ionizing radiation. Another important consideration has been the electrical effect of dose-enhanced radiation. This transient effect can produce an electromagnetic pulse (EMP). The unifying theme of the project has been the dielectric function. This quantity contains much of the physics covered in this project. For example, the work on transient electrical effects in radiation-induced conductivity (RIC) has been a key focus for the work on the EMP effects. This physics in contained in the dielectric function, which can also be expressed as a conductivity. The transient defects created during a radiation event are also contained, in principle. The energy loss lead the hot electrons and holes is given by the stopping power of ionizing radiation. This information is given by the inverse dielectric function. Finally, the short time atomistic phenomena caused by ionizing radiation can also be considered to be contained within the dielectric function. During the LDRD, meetings about the work were held every week. These discussions involved theorists, experimentalists and engineers. These discussions branched out into the work done in other projects. For example, the work on EMP effects had influence on another project focused on such phenomena in gases. Furthermore, the physics of radiation detectors and radiation dosimeters was often discussed, and these discussions had impact on related projects. Some LDRD-related documents are now stored on a sharepoint site ( In the remainder of this document the work is described in catergories but there is much overlap between the atomistic

  17. Physics of intense, high energy radiation effects

    International Nuclear Information System (INIS)

    Hjalmarson, Harold Paul; Hartman, E. Frederick; Magyar, Rudolph J.; Crozier, Paul Stewart


    This document summarizes the work done in our three-year LDRD project titled 'Physics of Intense, High Energy Radiation Effects.' This LDRD is focused on electrical effects of ionizing radiation at high dose-rates. One major thrust throughout the project has been the radiation-induced conductivity (RIC) produced by the ionizing radiation. Another important consideration has been the electrical effect of dose-enhanced radiation. This transient effect can produce an electromagnetic pulse (EMP). The unifying theme of the project has been the dielectric function. This quantity contains much of the physics covered in this project. For example, the work on transient electrical effects in radiation-induced conductivity (RIC) has been a key focus for the work on the EMP effects. This physics in contained in the dielectric function, which can also be expressed as a conductivity. The transient defects created during a radiation event are also contained, in principle. The energy loss lead the hot electrons and holes is given by the stopping power of ionizing radiation. This information is given by the inverse dielectric function. Finally, the short time atomistic phenomena caused by ionizing radiation can also be considered to be contained within the dielectric function. During the LDRD, meetings about the work were held every week. These discussions involved theorists, experimentalists and engineers. These discussions branched out into the work done in other projects. For example, the work on EMP effects had influence on another project focused on such phenomena in gases. Furthermore, the physics of radiation detectors and radiation dosimeters was often discussed, and these discussions had impact on related projects. Some LDRD-related documents are now stored on a sharepoint site ( In the remainder of this document the work is described in catergories but there is much overlap between the atomistic calculations, the

  18. High Energy Colliders and Hidden Sectors (United States)

    Dror, Asaf Jeff

    This thesis explores two dominant frontiers of theoretical physics, high energy colliders and hidden sectors. The Large Hadron Collider (LHC) is just starting to reach its maximum operational capabilities. However, already with the current data, large classes of models are being put under significant pressure. It is crucial to understand whether the (thus far) null results are a consequence of a lack of solution to the hierarchy problem around the weak scale or requires expanding the search strategy employed at the LHC. It is the duty of the current generation of physicists to design new searches to ensure that no stone is left unturned. To this end, we study the sensitivity of the LHC to the couplings in the Standard Model top sector. We find it can significantly improve the measurements on ZtRtR coupling by a novel search strategy, making use of an implied unitarity violation in such models. Analogously, we show that other couplings in the top sector can also be measured with the same technique. Furthermore, we critically analyze a set of anomalies in the LHC data and how they may appear from consistent UV completions. We also propose a technique to measure lifetimes of new colored particles with non-trivial spin. While the high energy frontier will continue to take data, it is likely the only collider of its kind for the next couple decades. On the other hand, low-energy experiments have a promising future with many new proposed experiments to probe the existence of particles well below the weak scale but with small couplings to the Standard Model. In this work we survey the different possibilities, focusingon the constraints as well as possible new hidden sector dynamics. In particular, we show that vector portals which couple to an anomalous current, e.g., baryon number, are significantly constrained from flavor changing meson decays and rare Z decays. Furthermore, we present a new mechanism for dark matter freezeout which depletes the dark sector through an

  19. Networking for High Energy and Nuclear Physics (United States)

    Newman, Harvey B.


    This report gives an overview of the status and outlook for the world's research networks and major international links used by the high energy physics and other scientific communities, network technology advances on which our community depends and in which we have an increasingly important role, and the problem of the Digital Divide, which is a primary focus of ICFA's Standing Committee on Inter-regional Connectivity (SCIC). Wide area networks of sufficient, and rapidly increasing end-to-end capability are vital for every phase of high energy physicists' work. Our bandwidth usage, and the typical capacity of the major national backbones and intercontinental links used by our field have progressed by a factor of more than 1000 over the past decade, and the outlook is for a similar increase over the next decade. This striking exponential growth trend, outstripping the growth rates in other areas of information technology, has continued in the past year, with many of the major national, continental and transoceanic networks supporting research and education progressing from a 10 Gigabits/sec (Gbps) backbone to multiple 10 Gbps links in their core. This is complemented by the use of point-to-point "light paths" to support the most demanding applications, including high energy physics, in a growing list of cases. As we approach the era of LHC physics, the growing need to access and transport Terabyte-scale and later 10 to 100 Terabyte datasets among more than 100 "Tier1" and "Tier2" centers at universities and laboratories spread throughout the world has brought the key role of networks, and the ongoing need for their development, sharply into focus. Bandwidth itself on an increasing scale is not enough. Realizing the scientific wealth of the LHC and our other major scientific programs depends crucially on our ability to use the bandwidth efficiently and reliably, with reliable high rates of data throughput, and effectively, where many parallel large-scale data

  20. UPR/Mayaguez High Energy Physics

    Energy Technology Data Exchange (ETDEWEB)

    López, Angel M. [Univ. of Puerto Rico, Mayaguez (Puerto Rico)


    For the period of sixteen years covered by this report (June 1, 1997 - July 31, 2013) the High Energy Physics Group at the University of Puerto Rico’s Mayaguez Campus (UPRM) carried out an extensive research program that included major experiments at Fermi National Accelerator Laboratory (Fermilab), the Cornell Electron-positron Collider and CERN. In particular, these were E831 (FOCUS) at Fermilab, CLEOc at Cornell and the Compact Muon Solenoid (CMS) at the Large Hadron Collider (LHC) at CERN. The group’s history is one of successful execution and growth. Beginning with one faculty researcher in 1985, it eventually included four faculty researchers, one post-doctoral research associate, two undergraduates and as many as six graduate students at one time working on one of the experiments that discovered the Higgs boson. Some of this expansion was due to the group’s leveraging of funds from the Department of Energy’s core grant to attract funds from National Science Foundation programs not targeted to high energy physics. Besides the group’s research productivity, its other major contribution was the training of a large number of MS students who later went on to successful technical careers in industry as well as academia including many who obtained PhD degrees at US universities. In an attempt to document this history, this final report gives a general description of the Group’s work prior to June 1, 2010, the starting date for the last grant renewal period. Much more detail can, of course, be found in the annual reports submitted up to that date. The work during the last grant period is discussed in detail in a separate section. To summarize the group’s scientific accomplishments, one can point to the results of the experiments. Both FOCUS and CLEOc were designed to carry out precise measurements of processes involving the heavy quarks, charm and bottom. Heavy quarks are particularly interesting because, due to their mass, theoretical calculations

  1. Emulsion polymerization with high energy radiation

    International Nuclear Information System (INIS)

    Stannett, V.T.; Stahel, E.P.


    High energy radiation, particularly that of cobalt-60 or caesium-137 gamma-rays, provides in principle an ideal initiator for emulsion polymerization. The high free radical yields from the radiolysis of the aqueous phase combined with the high kinetic chain lengths associated with emulsion polymerization lead to a highly effective utilization of the radiation. There are other important advantages compared with the use of chemical initiators such as potassium persulfate. These are outlined in the chapter, together with some attendant disadvantages. Radiation-induced initiation is temperature independent, and low temperature polymerizations can be conducted with ease. Monomers that mainly terminate their growing chains by chain transfer to monomer give higher molecular weights at lower temperatures. Industrially, vinyl acetate is an important example of such a monomer, and it has been studied using radiation initiation. Both laboratory and pilot plant studies have been carried out and reported. The results are summarized in this chapter. Styrene is the classical example of a material that under a number of conditions closely obeys the so-called ideal Smith-Ewart kinetics. It has been found that under similar conditions but substituting radiation for potassium persulfate as the initiator, ideal kinetics were closely followed. Most of the conventional and some non-standard vinyl and diene monomers have been studied to some extent with radiation-initiated polymerizations in emulsion. To conserve space however, this chapter presents and discusses the results obtained only with styrene and vinyl acetate, both in laboratory and pilot plant investigations. Other monomers and special situations are referenced either directly or to the other available reviews. (orig.)

  2. Very high pulse-energy accelerators

    International Nuclear Information System (INIS)

    Ramirez, J.J.


    The dominant trend in the development of pulsed power accelerator technology over the last decade has been towards higher power and shorter pulse widths. Limitations in high voltage, high current switch performance, and in power flow through vacuum insulator housings led to the development of highly modular designs. This modular approach requires precise synchronization of the various modules and efficient methods of combining the power from these modules to drive a common load. The need to drive very low impedance loads led to effective ways to combine these modules in parallel. The Particle Beam Fusion Accelerator I (PBFA I) and Saturn are representative of these designs. Hermes III represent a new approach towards the efficient generation of higher voltages. It is designed to drive a 22-MV, 730-kA, 40-ns electron beam diode and combines conventional, modular pulsed power technology with linear induction accelerator concepts. High-power induction accelerator cavities are combined with voltage addition along a MITL to generate the desired output. This design differs from a conventional linac in that the voltages are added by the MITL flow rather than by a drifting beam that gains kinetic energy at each stage. This design is a major extrapolation of previous state-of-the-art technology represented by the injector module of the Advanced Test Accelerator and has proven to be efficient and reliable. The design and performance of Hermes III are presented together with a discussion of the application of this technology to the light ion beam inertial confinement fusion program. 18 refs., 9 figs

  3. Energy dependence of ulrathin LiF-dosemeters for high energy electrons and high energy X-radiation

    International Nuclear Information System (INIS)

    Kupfer, T.


    The energy dependence of ultrathin LiF-dosemeters for high energy electrons (5-40 MeV) and high energy X-radiation (6 MV, 42 MV) is experimentally determined. The experimental values are compared to values calculted earlier by other authors. The influence of the thickness of the dosemeters have been considered by comparison of experimental values for 0.03 mm thick dosemeters and theoretical values for 0.13 mm and 0.38 mm thick ones. Also different commersially available dosemeters have been compared by experiments. It is difficult to draw any other conclutions about the energy dependence than that the variation of the relative responce is within +- 3 percent (2S). However the results seems to be sulficient for clinical applications

  4. Energy dependence of opaqueness for pp collisions at high energies

    CERN Document Server

    Chou, T T


    Opaqueness of pp collisions is evaluated at three CERN-ISR energies. Comparisons with predictions of the factorisable eikonal models and the scaling hypothesis are made. It appears that results are in favour of the factorisable models. (20 refs).

  5. Modular, Reconfigurable, High-Energy Technology Development (United States)

    Carrington, Connie; Howell, Joe


    The Modular, Reconfigurable High-Energy (MRHE) Technology Demonstrator project was to have been a series of ground-based demonstrations to mature critical technologies needed for in-space assembly of a highpower high-voltage modular spacecraft in low Earth orbit, enabling the development of future modular solar-powered exploration cargo-transport vehicles and infrastructure. MRHE was a project in the High Energy Space Systems (HESS) Program, within NASA's Exploration Systems Research and Technology (ESR&T) Program. NASA participants included Marshall Space Flight Center (MSFC), the Jet Propulsion Laboratory (JPL), and Glenn Research Center (GRC). Contractor participants were the Boeing Phantom Works in Huntsville, AL, Lockheed Martin Advanced Technology Center in Palo Alto, CA, ENTECH, Inc. in Keller, TX, and the University of AL Huntsville (UAH). MRHE's technical objectives were to mature: (a) lightweight, efficient, high-voltage, radiation-resistant solar power generation (SPG) technologies; (b) innovative, lightweight, efficient thermal management systems; (c) efficient, 100kW-class, high-voltage power delivery systems from an SPG to an electric thruster system; (d) autonomous rendezvous and docking technology for in-space assembly of modular, reconfigurable spacecraft; (e) robotic assembly of modular space systems; and (f) modular, reconfigurable distributed avionics technologies. Maturation of these technologies was to be implemented through a series of increasingly-inclusive laboratory demonstrations that would have integrated and demonstrated two systems-of-systems: (a) the autonomous rendezvous and docking of modular spacecraft with deployable structures, robotic assembly, reconfiguration both during assembly and (b) the development and integration of an advanced thermal heat pipe and a high-voltage power delivery system with a representative lightweight high-voltage SPG array. In addition, an integrated simulation testbed would have been developed

  6. 75 FR 17701 - High Energy Physics Advisory Panel (United States)


    ... DEPARTMENT OF ENERGY High Energy Physics Advisory Panel AGENCY: Department of Energy, Office of... Physics Advisory Panel (HEPAP). Federal Advisory Committee Act (Pub. L. 92-463, 86 Stat. 770) requires... Energy Physics Advisory Panel; U.S. Department of Energy; SC-25/ Germantown Building, 1000 Independence...

  7. Pattern recognition in high energy physics

    International Nuclear Information System (INIS)

    Tenner, A.G.


    In high energy physics experiments tracks of elementary particles are recorded by different types of equipment. Coordinates of points of these tracks have to be measured for the geometrical reconstruction and the further analysis of the observed events. Pattern recognition methods may facilitate the detection of tracks or whole events and the separation of relevant from non-relevant information. They may also serve for the automation of measurement. Generally, all work is done by digital computation. In a bubble chamber tracks appear as strings of vapour bubbles that can be recorded photographically. Two methods of pattern recognition are discussed. The flying spot digitizer encodes the pattern on the photograph into point coordinates in the memory of a computer. The computer carries out the pattern recognition procedure entirely on the basis of the stored information. Cathode ray instruments scan the photograph by means of a computer steered optical device. Data acquisition from the film is performed in a feedback loop of the computation. In electronic experimental equipment tracks are defined by the spacial distribution of hits of counters (wire counters, scintillation counters, spark chambers). Pattern recognition is generally performed in various stages both by on-line and off-line equipment. Problems in the data handling arise both from the great abundance of data and from the time limits imposed on the on-line computation by high measuring rates. The on-line computation is carried out by hardwired logic, small computers, and to an increasing extent by microprocessors. (Auth.)

  8. An experimental high energy physics program

    International Nuclear Information System (INIS)

    Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.


    The CLEO detector accumulated, (∼480,000 B-mesons) the world's largest sample of B decays, before being shutdown in May 1988 for the installation of CLEO II. This data sample came from 335 pb -1 accumulated at the Υ(4S). The Cornell Electron Storage Ring set new luminosity records, reaching 3.5 pb -1 in a single day. These data are being intensively analyzed and 21 papers were given at the Baltimore APS meeting. Among the highlights are: confirmation of B 0 bar B 0 mixing; discovery of the charm-strange baryon Ξ c 0 ; limits on b → u decay; and non-observation of B → p bar pπ(π), which was reported by the ARGUS collaboration. The construction of CLEO II is proceeding on schedule. The new 1.5 T superconducting magnet has passed all tests and all of the detector elements have been installed. This includes a 7800 CsI crystals electromagnetic shower calorimeter. The data from the Gamma Ray Astrophysics experiment show a significant signal for high energy gamma ray emission from Cygnus X-3 and also confirm the previously reported anomalous period from Her X-1. Meanwhile, the old 6 mirror telescope has been refitted with 26 high resolution mirrors and improved fast electronics. GRANDE, the next generation detector based on the water Cherenkov technique, has been formally proposed to HEPAP. The detector will search for neutrino emission in the southern hemisphere and gamma radiation in the northern hemisphere

  9. AMODS and High Energy Density Sciences

    International Nuclear Information System (INIS)

    Rhee, Y.-J.


    Following a brief introduction to the Lab for Quantum Optics (LFQO) in KAERI, which has been devoted to the research on atomic spectroscopy for more than 20 years with precision measurement of atomic parameters such as isotope shift, hyperfine structures, autoionization levels and so on as well as with theoretical analysis of atomic systems by developing relativistic calculation methodologies for laser propagation and population dynamics, electron impact ionization, radiative transitions of high Z materials, etc for the application to isotope separation, the AMODS (Atomic Molecular and Optical Database Systems) which was established in 1997 and has been a member of International Data Center Network of IAEA since then is explained by giving an information on the data sources and internal structure of the compilation of AMODS. Since AMODS was explained in detail during last DCN meeting, just a brief introduction is given this time. Then more specific research themes carried out in LFQO in conjunction with A+M data are discussed, including (1) electron impact ionization processes of W, Mo, Be, C, etc, (2) spectra of highly charged ions of W, Xe, and Si, (3) dielectronic recombination process of Fe ion. Also given are the talk about research activities about the simulations of high energy density experiments such as those performed at (1) GEKKO laser facility (Japan) for X-ray photoionization of low temperature Si plasma, which can explain the unsolved arguments on the X-ray spectra of black holes and/or neutron stars, (2) VULCAN laser facility (UK) for two dimensional compression of cylindrical target and investigation of hot electron transport in the compressed target plasma to understand the fast ignition process of laser fusion, (3) LULI laser facility (France) and TITAN laser facility (USA) for one dimensional compression of aluminum targets with different laser energies, and (4) PALS facility (Czech Republic) for 'Laser Induced Cavity Pressure Acceleration' to

  10. Report of the Subpanel on High Energy Physics Manpower of the High Energy Physics Advisory Panel

    International Nuclear Information System (INIS)


    A report of a study by a Subpanel which was appointed by the High Energy Physics Advisory Panel (HEPAP) to examine the production in recent years of new researchers in high energy physics and the rate at which they have moved into short term and permanent positions in the field. The Subpanel made use of the 1973 and 1975 ERDA Census data, statistics collected by others, as well as a number of surveys conducted by the Subpanel itself. Even though many uncertainties and gaps exist in the available data, several important points are presented. (1) New Ph.D. production in high energy physics has decreased in recent years even more rapidly than in physics as a whole. (2) New Ph.D.'s in experimental and theoretical high energy physics have been produced for many years in roughly equal numbers in spite of the fact that employment in the field at all levels shows a ratio of experiment-to-theory approaching two-to-one. (3) A very large fraction of the approximately 1700 Ph.D.'s in high energy physics (employed at 78 universities and 5 national laboratories) hold tenured positions (383 theorists and 640 experimentalists). (4) The age distribution of those in the tenured ranks reveals that the number of retirements will be extremely small during the next decade but will then start to have a significant impact on the opportunities for those who are seeking careers in the field. (5) Promotions to tenure at the universities during the 4 year interval AY72/73-AY76/77 have averaged about 10 per year in experiment and 10 per year in theory

  11. [Intermediate/high energy nuclear physics

    International Nuclear Information System (INIS)


    We have continued to develop a theoretical framework for the quark and gluon structure of nuclei. Our approach features a successful phenomenological model, the quark cluster model (QCM), and an ambitious program in the non-perturbative solution of quantum field theories. The effort in quantum field theory provides theoretical results to test or replace assumed ingredients of the QCM. By the explicit example of a scalar field theory in 2D we have solved the long-standing problem of how to treat the dynamics of the vacuum in light-front quantization. We now propose to solve the same problem for simple Fermion field theories in 2D such as the Gross-Neveu model. We propose in subsequent years to address QCD in low dimensionality with the purpose of extracting non-perturbative predictions for quark and gluon amplitudes in few baryon systems. Simultaneously with this new effort we will continue to develop extensions and applications of the QCM. We propose to continue predicting phenomena to be observed in high energy particle-nucleus collisions that reflect the rearrangement of quarks and gluons in nuclei. We have completed our analysis of the SLAC E101 and E133 experiments on Deuterium to elucidate the degree to which a six-quark cluster contribution is admissable in the Bjorken x > 1 data. We have completed our development of a parameterized thermal liquid drop model for light nuclei. In addition we have completed a set of predictions for the formation of a ''nuclear stratosphere'' in nuclei created by intermediate energy heavy ion interactions. These results motivate a new investigation of the temperature dependence of the ion-ion potential with particular emphasis on the thermal dependence of the barrier height and radius. We have also shown that a consistent treatment of relativistic effects is important for a theoretical description of the elastic magnetic form factor of 17 O. 85 refs

  12. Department of High Energy Physics: Overview

    International Nuclear Information System (INIS)

    Nassalski, J.


    Full text: The main activity of our Department is experimental high energy physics with accelerators. Experiments are carried using large facilities: - at CERN, the European Laboratory for Particle Physics in Geneva, - at Celsius Storage Ring in Uppsala and - in DESY laboratory in Hamburg, where several groups of physicists from our Department are members of international collaborations. They are listed below together with the main physics interests: At CERN - Delphi at LEP - tests of the Standard Model, b-quark physics, SUSY search, - NA48 - CP-violation in K 0 decays, rare decays, - SMC - spin dependent nucleon structure function, the Bjorken sum, - NA49 and WA98 - heavy ion physics. At CELSIUS - WASA - threshold production of light mesons, rare meson decays. At DESY - ZEUS - proton and photon structure functions, diffractive production. In most of these experiments our Department also contributed to the instrumentation of detectors and is presently involved in data collection, detector supervision and in data analysis. At the same time the Department is also involved in preparation of new experiments: - CMS (Compact Muon Solenoid) and ALICE at the LHC (Large Hadron Collider) at CERN, - COMPASS (Compact Muon and Proton Apparatus for Structure and Spectroscopy) at the SPS at CERN, - WASA-Promice - an upgrade of the present detector at Celsius, - hyperfragment experiment at JINR, Dubna. The department has small workshop which was recently involved in an upgrade of the WASA detector. In our Department there are also two physicists working on the phenomenology of a quark-gluon plasma and on the low energy hadron-hadron interactions. Physicist from our Department collaborate with the Department of the Experimental Physics of Warsaw University. They are also involved in teaching and in supervision of diploma students. There is a group of 9 PhD students. (author)

  13. Energy costs and society: the high price of future energy

    Energy Technology Data Exchange (ETDEWEB)

    Appleby, A J


    Society will not be able to afford nonfossil fuel energy in the future without a major restructuring of industrial activity, involving a complete rethinking of the basis of our present social and economic establishment. This restructuring must be combined with the evident necessity of policies of population restriction and controls in the form of international allocation of the dwindling supply of raw materials, including fossil (and, in future, nonfossil) primary energy. Only by such means, and by adopting a very low-growth future, can some moderate degree of standard of living be expected to be perpetuated for at least a few generations in the industrialized countries, especially in the case of those that are major energy importers at present. This type of future will also be of more help to the third world than one involving the now impossible ideal of a spiraling energy growth rate. The society which, on an optimistic view, will emerge toward the end of the fossil fuel era, will be supplied with abundant, though efficiently applied, energy, and will survive with natural products and by economizing its recylced mineral resources. The approach to this goal will require political leadership, serious education of the public, and a real population policy, all on a world-wide scale. (Conclusions)

  14. Can Low Energy Electrons Affect High Energy Physics Accelerators?

    International Nuclear Information System (INIS)

    Cimino, Roberto


    The properties of the electrons participating in the build up of an electron cloud (EC) inside the beam-pipe have become an increasingly important issue for present and future accelerators whose performance may be limited by this effect. The EC formation and evolution are determined by the wall-surface properties of the accelerator vacuum chamber. Thus, the accurate modeling of these surface properties is an indispensible input to simulation codes aimed at the correct prediction of build-up thresholds, electron-induced instability or EC heat load. In this letter, we present the results of surface measurements performed on a prototype of the beam screen adopted for the Large Hadron Collider (LHC), which presently is under construction at CERN. We have measured the total secondary electron yield (SEY) as well as the related energy distribution curves (EDC) of the secondary electrons as a function of incident electron energy. Attention has been paid, for the first time in this context, to the probability at which low-energy electrons (<∼ 20 eV) impacting on the wall create secondaries or are elastically reflected. It is shown that the ratio of reflected to true-secondary electrons increases for decreasing energy and that the SEY approaches unity in the limit of zero primary electron energy

  15. Conference summary on new trends in high-energy physics

    International Nuclear Information System (INIS)

    Terazawa, H.


    Concluding remarks on over forty papers contributed to the International Conference on New Trends in High-Energy Physics, Yalta, Crimea, Ukraine, September 22 - 29, 2001 are presented. Also presented are some comments on future prospects in high energy physics

  16. Interpreting New Data from the High Energy Frontier

    Energy Technology Data Exchange (ETDEWEB)

    Thaler, Jesse [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)


    This is the final technical report for DOE grant DE-SC0006389, "Interpreting New Data from the High Energy Frontier", describing research accomplishments by the PI in the field of theoretical high energy physics.

  17. Energy efficiency of high-rise buildings (United States)

    Zhigulina, Anna Yu.; Ponomarenko, Alla M.


    The article is devoted to analysis of tendencies and advanced technologies in the field of energy supply and energy efficiency of tall buildings, to the history of the emergence of the concept of "efficiency" and its current interpretation. Also the article show the difference of evaluation criteria of the leading rating systems LEED and BREEAM. Authors reviewed the latest technologies applied in the construction of energy efficient buildings. Methodological approach to the design of tall buildings taking into account energy efficiency needs to include the primary energy saving; to seek the possibility of production and accumulation of alternative electric energy by converting energy from the sun and wind with the help of special technical devices; the application of regenerative technologies.

  18. Conversion of zero point energy into high-energy photons

    Energy Technology Data Exchange (ETDEWEB)

    Ivlev, B. I. [Universidad Autonoma de San Luis Potosi, Instituto de Fisica, Av. Manuel Nava No. 6, Zona Universitaria, 78290 San Luis Potosi, SLP (Mexico)


    An unusual phenomenon, observed in experiments is studied. X-ray laser bursts of keV energy are emitted from a metal where long-living states, resulting in population inversion, are totally unexpected. Anomalous electron-photon states are revealed to be formed inside the metal. These states are associated with narrow, 10{sup -11} cm, potential well created by the local reduction of zero point electromagnetic energy. In contrast to analogous van der Waals potential well, leading to attraction of two hydrogen atoms, the depth of the anomalous well is on the order of 1 MeV. The states in that well are long-living which results in population inversion and subsequent laser generation observed. The X-ray emission, occurring in transitions to lower levels, is due to the conversion of zero point electromagnetic energy. (Author)

  19. [Intermediate/high energy nuclear physics

    International Nuclear Information System (INIS)


    We have continued to develop a theoretical framework for the quark and gluon structure of nuclei. Our approach features a successful phenomenological model, the quark cluster model (QCM), and an ambitious program in the non-perturbative solution of quantum field theories. We have solved a non-trivial model field theory in the strong coupling regime using a discretized light front quantization (DLFQ) scheme. The method we developed expands upon the method of Pauli and Brodsky by incorporating a dynamical treatment of the vacuum. This is a major result since we have shown directly that the light-cone vacuum is not structureless as has been traditionally claimed by some particle theorists. We have thus succeeded in elucidating the consequences of spontaneous symmetry breaking in light-cone quantization. We now propose to address QCD in low dimensionality with the purpose of extracting non-perturbative predictions for quark and gluon amplitudes in few baryon systems. Simultaneously with this new effort we will continue to develop extensions and applications of the QCM. We propose to continue predicting phenomena to be observed in high energy particle-nucleus collisions that reflect the rearrangement of quarks and gluons in nuclei. We will complete our analysis of the SLAC NE3 data to explicate the degree to which they confirm the QCM prediction of ''steps'' in the ratio of nuclear structure functions when Bjorken x exceeds unity. In another effort, we will perform a search for narrow resonances in electron-positron interactions high in the continuum using the Bethe-Salpeter equation. We have completed our development of microscopic effective Hamiltonians for nuclear structure which include the explicit treatment of delta resonances. These effective Hamiltonians were successfully used in constrained mean field calculations evaluating conditions for nuclei to undergo a transition from nucleon matter to delta matter. 73 refs

  20. Data Preservation in High Energy Physics

    International Nuclear Information System (INIS)

    Mount, Richard; Brooks, Travis; Le Diberder, Francois; Dubois-Felsmann, Gregory; Neal, Homer; Bellis, Matt; Boehnlein, Amber; Votava, Margaret; White, Vicky; Wolbers, Stephen; Konigsberg, Jacobo; Roser, Robert; Snider, Rick; Lucchesi, Donatella; Denisov, Dmitri; Soldner-Rembold, Stefan; Li, Qizhong; Varnes, Erich; Jonckheere, Alan; Gasthuber, Martin; Gulzow, Volker


    Data from high-energy physics (HEP) experiments are collected with significant financial and human effort and are mostly unique. At the same time, HEP has no coherent strategy for data preservation and re-use. An inter-experimental Study Group on HEP data preservation and long-term analysis was convened at the end of 2008 and held two workshops, at DESY (January 2009) and SLAC (May 2009). This document is an intermediate report to the International Committee for Future Accelerators (ICFA) of the reflections of this Study Group. Large data sets accumulated during many years of detector operation at particle accelerators are the heritage of experimental HEP. These data sets offer unique opportunities for future scientific studies, sometimes long after the shut-down of the actual experiments: new theoretical input; new experimental results and analysis techniques; the quest for high-sensitivity combined analyses; the necessity of cross checks. In many cases, HEP data sets are unique; they cannot and most likely will not be superseded by data from newer generations of experiments. Once lost, or in an unusable state, HEP data samples cannot be reasonably recovered. The cost of conserving this heritage through a collaborative, target-oriented long-term data preservation program would be small, compared to the costs of past experimental projects or to the efforts to re-do experiments. However, this cost is not negligible, especially for collaborations close or past their end-date. The preservation of HEP data would provide today's collaborations with a secure way to complete their data analysis and enable them to seize new scientific opportunities in the coming years. The HEP community will benefit from preserved data samples through reanalysis, combination, education and outreach. Funding agencies would receive more scientific return, and a positive image, from their initial investment leading to the production and the first analysis of preserved data.