Markkinointisuunnitelma, URHOtv Oy

OpenAIRE

Pesonen, Matti

2012-01-01

Opinnäytetyön tarkoituksena on paneutua suomalaiseen maksu-tv markkinaan ja kilpailutilanteeseen jonka jälkeen laatia yritykselle vuoden 2012 markkinointisuunnitelma. URHOtv Oy on suurin kotimaiseen urheiluun keskittyä maksu-tv kanava. URHOtv:llä on noin 300 000 asiakasta. Opinnäytetyön pohjana on käytetty Jobberin markkinointisuunnitelman tekoprosessin teoriaa hiukan mukailtuna URHOtv:n tarpeisiin. Markkinointisuunnitelman tueksi opinnäytetyössä tutkitaan URHOtv:n tilaa analyysie...

RFID- TEKNIIKAN MAHDOLLISTAMAT TYÖAIKASÄÄSTÖT HUONEKALUTEOLLISUUDESSA : - CASE INCAP FURNITURE OY

OpenAIRE

Taskinen, Jarkko

2009-01-01

Opinnäytetyön tarkoituksena oli selvittää RFID- tekniikan eli radiotaajuudella toimivan etätunnistamisen mahdollistamia työaikasäästöjä huonekaluteollisuudessa. Toimeksiantaja oli Incap Furniture Oy. Incap Furniture Oy on yksi suurimmista mäntyhuonekalusopimusvalmistajista maailmassa. Pääasiakas on Ikea. Incap Furniture Oy on aloittanut projektin, jonka tarkoitus on tutkia RFID- tekniikan mahdollisuuksia ja hyötyjä tehtaiden toiminnassa. Opinnäytetyö oli osa projektia. Opinnäyt...

Digitaalisen markkinointiviestinnän mahdollisuudet : Case Kelloliike EA Lahti Oy

OpenAIRE

Harmaala, Tiina

2011-01-01

TIIVISTELMÄ Harmaala, Tiina. 2011. Digitaalisen markkinointiviestinnän mahdollisuudet – Case Kelloliike EA Lahti Oy. Opinnäytetyö. Kemi-Tornion ammattikorkeakoulu. Kaupan ja kulttuurin toimiala. Sivuja 62. Opinnäytetyön tavoitteena on Kelloliike EA Lahti Oy:n digitaalisen markkinointiviestinnän suunnittelu. Tutkimuksessa tarkastelen digitaalista markkinointiviestintää integroidun markkinointiviestinnän näkökulmasta. Tutkimuksen tarkoituksena on selvittää toimeksiantajalle sen markkino...

Adidas Suomi Oy: Brändikuvan rakentaminen markkinoinnin keinoin

OpenAIRE

Leinonen, Miira

2015-01-01

Tämä opinnäytetyö tehtiin toimeksiantona Adidas Suomi Oy:lle syksyllä 2014. Opinnäytetyön tavoitteena oli selvittää muotialan mielipidevaikuttajien mielikuvat Adidaksesta ja sen merkittävimmistä kilpailijoista. Vertailtaviksi brändeiksi valittiin kuusi tärkeintä kilpailijaa, jotka ovat Converse, Karhu, New Balance, Nike, Puma ja Reebok. Opinnäytetyön toimeksiantaja Adidas Suomi Oy on osa kansainvälistä Adidas Group konsernia. Yritys on yksi maailman tunnetuimmista urheilumerkeistä ja toim...

SIEVIN JALKINE OY:N AVAINASIAKKAIDEN KÄSITYKSIÄ YRITYKSEN TOIMINNASTA

OpenAIRE

Haapakoski, Sanna

2014-01-01

Opinnäytetyön toimeksiantaja on Sievin Jalkine Oy. Yritys on Pohjoismaiden johtava turva- ja ammattijalkineiden valmistaja. Opinnäytetyön tavoitteena oli selvittää, kuinka tyytyväisiä avainasiakkaat ovat Sievin Jalkine Oy:n toimintaan ja miten toimintaa voidaan kehittää asiakkaiden hyväksi. Opinnäytetyössä selvitettiin, miten tyytyväisiä avainasiakkaat ovat tuotetarjontaan, palvelujen tarjontaan, markkinointiviestintään, asiakaspalveluun ja henkilöstöön. Opinnäytetyön tietoperustassa...

Commensurability oscillations in NdBa2Cu3Oy single crystals

Indian Academy of Sciences (India)

gated by angular dependent magnetization in very pure twinned and twin-free NdBa2 Cu3 Oy single ... The layered structure and the c-axis coherence length, ξc ≈ 4 ˚A, smaller than the lattice ... The high quality of both crystals is demonstrated by ... Commensurability oscillations in NdBa2Cu3Oy single crystals. 2. 3. 4. 5. 6.

Tilinpäätösanalyysi : case Ilmatuote Oy

OpenAIRE

Luotola, Elina

2014-01-01

Opinnäytetyön tavoitteena oli saada selville Ilmatuote Oy:n taloudellinen tilanne tarkastellen tilinpäätösinformaatiota vuosien 2009-2012 väliseltä ajanjaksolta. Ilmatuote Oy:n erikoisalana on jo yli 40 vuoden ajan ollut talotekniikkajärjestelmien asennus, urakointi- ja huoltotoiminta. Tarkoituksena oli tehdä tilinpäätösanalyysi yhtiön tilinpäätöksistä ja selvittää, millä tasolla yritys taloudellisesti on ja mihin suuntaan yrityksen taloudellinen tila on kehittynyt. Teoreettisessa osassa t...

Taloushallintoprosessien kehittäminen Iisalmen Putkiasennus Oy:ssä

OpenAIRE

Juntunen, Tiia

2015-01-01

Tämä opinnäytetyö käsittelee taloushallintoprosessien kehittämistä Iisalmen Putkiasennus Oy:ssä. Kehittämistyötä päädyttiin rajaamaan keskittyen myynti- ja ostolaskuprosessien kehittämiseen, koska niissä oli havaittu olevan eniten kehitettävää. Iisalmen Putkiasennus Oy on LVI-alalla työskentelevä perheyritys, joka on ollut toiminnassa jo yli 35 vuotta. Yritys sijaitsee Iisalmessa ja työllistää noin 50 henkilöä. Tässä opinnäytetyössä taloushallintoprosessien kehittäminen alkoi tilanteesta...

OpenOffice.org -toimisto-ohjelmiston soveltuvuus Sastamalan Tukipalvelu Oy:lle : selvitys

OpenAIRE

Ojanen, Olli-Veikko

2009-01-01

Tässä opinnäytetyössä selvitettiin OpenOffice.org toimisto-ohjelmiston soveltuvuutta Sastamalan Tukipalvelu Oy:lle, joka huolehtii osakkaittensa tieto-, talous- ja henkilöstöhallinnon palveluista. Sastamalan Tukipalvelu Oy:n osakkaina ovat Kiikoisten, Lavian ja Punkalaitumen kunnat, Sastamalan kaupunki, Sastamalan perusturvakuntayhtymä sekä Sastamalan koulutuskuntayhtymä. Selvityksen tavoitteena oli tuoda esille OpenOffice.org -toimisto-ohjelmistoon siirtymisen hyötyjä, joi...

Low Biotoxicity of Mars Analog Soils Suggests that the Surface of Mars May be Habitable for Terrestrial Microorganisms

Science.gov (United States)

Schuerger, A. C.; Ming, Douglas W.; Golden, D. C.

2012-01-01

Recent studies on the interactive effects of hypobaria, low temperatures, and CO2-enriched anoxic atmospheres on the growth of 37 species of mesophilic bacteria identified 14 potential biocidal agents that might affect microbial survival and growth on the martian surface. Biocidal or inhibitory factors include (not in priority): (1) solar UV irradiation, (2) low pressure, (3) extreme desiccating conditions, (4) extreme diurnal temperature fluctuations, (5) solar particle events, (6) galactic cosmic rays, (7) UV-glow discharge from blowing dust, (8) solar UV-induced volatile oxidants [e.g., O2(-), O(-), H2O2, O3], (9) globally distributed oxidizing soils, (10) extremely high salts levels [e.g., MgCl2, NaCl, FeSO4, and MgSO4] in surficial soils at some sites on Mars, (11) high concentrations of heavy metals in martian soils, (12) likely acidic conditions in martian fines, (13) high CO2 concentrations in the global atmosphere, and (14) perchlorate-rich soils. Despite these extreme conditions several studies have demonstrated that dormant spores or vegetative cells of terrestrial microorganisms can survive simulated martian conditions as long as they are protected from UV irradiation. What has not been explored in depth are the effects of potential biotoxic geochemical components of the martian regolith on the survival and growth of microorganisms. The primary objectives of the research included: (1) prepare and characterize Mars analog soils amended with potential biotoxic levels of sulfates, salts, acidifying minerals, etc.; and (2) use the simulants to conduct biotoxicity assays to determine if terrestrial microorganisms from spacecraft can survive direct exposure to the analog soils.

Markkinointisuunnitelma sosiaalista mediaa hyödyntäen : Case Branda Oy

OpenAIRE

Hämeenniemi, Henna-Riika

2016-01-01

Tämän opinnäytetyön tarkoituksena oli tehdä markkinointisuunnitelma toimintaansa aloittelevalle yritykselle nimeltä Branda Oy. Branda Oy perusti vuoden 2015 alussa verkkokaupan, jonka kautta se myy naisten urheiluvaatteita suomalaisille kuluttajille. Opinnäytetyön tavoitteena oli antaa yritykselle välineet markkinoida itseään sosiaalisessa mediassa parhaalla mahdollisella tavalla. Työ toteutettiin kahdessa vaiheessa, josta ensimmäisessä toteutettiin itse markkinointisuunnitelma Branda O...

Jatkuvan koulutuksen antama tuki myyntityölle : Case: Systemair Oy

OpenAIRE

Mattila, Jeremias

2017-01-01

Opinnäytetyössä pyritään selvittämään, kokevatko myyjät koulutuksen edistävän heidän itse-varmuuttaan työtä kohden tai kokevatko he koulutuksen antaman tuen jollain muulla tavalla? Tulokset perustuvat laadulliseen Systemair Oy:n myyntihenkilöstön teemahaastatteluun. Kaikki tulokset ovat siis subjektiivisia Systemair Oy:n toimialaa ja sisäistä yrityskulttuuria kos-kien. Sovellettavuus muihin yrityksiin ja toimialoihin vaatii uuden tutkimuksen, mutta työ voi antaa osviittaa siihen, millaiset ja...

Situated Word Learning: Words of the Year (WsOY) and Social Studies Inquiry

Science.gov (United States)

Heafner, Tina L.; Triplett, Nicholas; Handler, Laura; Massey, Dixie

2018-01-01

Current events influence public interest and drive Internet word searches. For over a decade, linguists and dictionary publishers have analyzed big data from Internet word searches to designate "Words of the Year" (WsOY). In this study, we examine how WsOY can foster critical digital literacy and illuminate essential aspects of inquiry…

RESEARCH ON THE EFFECTIVENESS OF ADVERTISING CHANNELS AT VIITAMAA CARAVAN OY

OpenAIRE

Huumonen, Anna-Sofia

2012-01-01

The topic of this study is the effectiveness of advertising channels.The topic was chosen by the request of Viitamaa Caravan Oy. The company wants this study to give more information about the effectiveness of different advertising channels in their own advertising. Viitamaa Caravan Oy also wanted some insight into the fact how much money in the budget should be reserved for each channel. The research problem can be defined as: Which of the advertising channels already used in Viitamaa Carav...

Afrikkaviikko Antell Catering Oy:ssä

OpenAIRE

Bask, Tiina

2011-01-01

Ruokapalvelualalla erilaisten teemaviikkojen toteuttaminen on keino tarjota asiakkaille ainutkertaisia elämyksiä ja tuoda vaihtelua normaaliin arkiruokailuun. Tämän opinnäytetyön tavoitteena oli suunnitella Afrikka-aiheinen teemaviikko Antell Catering Oy:n lounasravintoloihin. Afrikka-teeman mukaisesti suunniteltiin vakioruokaohjeet yhden viikon lounasvaihtoehdoiksi sekä markkinointimateriaali somistuksineen. Opinnäytetyö on toiminnallinen työ, jossa Afrikka-viikon lounasruokaohjeet mu...

Customer Satisfaction in Internal Customer Service : Case: Abloy Oy Internal Customer Service

OpenAIRE

Turunen, Susanna

2011-01-01

ABSTRACT Turunen, Susanna Marita 2011. Customer Satisfaction in Internal Customer Service. Case: Abloy Oy Internal Customer Service. Master’s thesis. Kemi-Tornio University of Applied Sciences. Business and Culture. Pages 73. Appendix 1. This thesis discusses and studies service quality and customer satisfaction in internal customer service. The main objective is to find out what the service quality level in the internal customer service at Abloy Oy is and whether there exists a diffe...

B2B-uutiskirjeen visuaalisen ilmeen kehitys — Case Tamtron Solutions Oy

OpenAIRE

Salo, Sari

2014-01-01

Opinnäytetyön tarkoituksena oli kehittää Tamtron Solutions Oy:n uutiskirjeelle uusi visuaalinen ilme. Yrityksen lähettämästä uutiskirjeestä yritysasiakkaille puhutaan B2B-uutiskirjeenä. Tamtron Solutions Oy halusi B2B-uutiskirjeen avulla tehostaa markkinointia, kasvattaa myyntiä ja luoda uusia asiakassuhteita. Yritys halusi toteuttaa markkinointikampanjan B2B-uutiskirjeen muodossa rakennusalan yrityksille. Yritys valitsi kampanjan kohderyhmäksi rakennusalan yritykset, koska lakimuutos rakennu...

Ilmanpuhdistimen tuotekehitys : case: Mecastep Oy

OpenAIRE

Arasola, Aku

2015-01-01

Tämän opinnäytetyön tarkoituksena oli olla osana tuotekehitysprojektia, joka koskee Mecastep Oy:n ilmanpuhdistin innovaatiota. Kehitystä vaativia kohtia olivat komponenttien valinta ja mekaniikan saaminen toimivaksi. Edelläkävijän innovaatiosta tekee se, että samanlaista tuotetta ei ole vielä olemassa. Mekaniikan mallintaminen tapahtui 3D-ohjelmalla nimeltä KeyCreator. Ilmanpuhdistin tullaan sijoittamaan keittiön jätekaappiin. Puhdistuksella tässä tapauksessa tarkoitetaan epäpuhtaan ilman...

The effect of CO2 on the plasma remediation of NxOy

Science.gov (United States)

Gentile, Ann C.; Kushner, Mark J.

1996-04-01

Plasma remediation is being investigated for the removal of oxides of nitrogen (NxOy) from atmospheric pressure gas streams. In previous works we have investigated the plasma remediation of NxOy from N2/O2/H2O mixtures using repetitively pulsed dielectric barrier discharges. As combustion effluents contain large percentages of CO2, in this paper we discuss the consequences of CO2 in the gas mixture on the efficiency of remediation and on the end products. We find that there is a small increase in the efficiency of total NxOy remediation (molecules/eV) with increasing CO2 fraction, however the efficiency of NO remediation alone generally decreases with increasing CO2. This differential is more pronounced at low energy deposition per pulse. More remediation occurs through the reduction channel with increasing CO2 while less NO2 and HNOx are produced through the oxidation channel. CO is produced by electron impact of CO2 though negligible amounts of cyanides are generated.

Entering market in St. Petersburg, Russia– Kärävä Oy

OpenAIRE

Tsirkunov, Aleksandr

2013-01-01

The company commissioning this thesis is Kärävä Oy. This company was founded in 1988 and since then they focus on producing timber of different quality and size. Their clients are wholesalers of timber and wood products, along with sauna manufacturers. Produced products are used for interior finishing in commercial and public areas. More-over, Kärävä Oy is also producing interior materials for saunas. Main purpose for this thesis is to analyse if entering Russian market will be profitable...

Equilibrium Structures and Absorption Spectra for SixOy Molecular Clusters using Density Functional Theory

Science.gov (United States)

2017-05-05

Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6390--17-9724 Equilibrium Structures and Absorption Spectra for SixOy Molecular Clusters...TELEPHONE NUMBER (include area code) b. ABSTRACT c. THIS PAGE 18. NUMBER OF PAGES 17. LIMITATION OF ABSTRACT Equilibrium Structures and Absorption...and electronic excited-state absorption spectra for eqilibrium structures of SixOy molecular clusters using density function theory (DFT) and time

Online video marketing plan for a product launch : Case company: Altal Oy

OpenAIRE

Ngo, Quan

2015-01-01

This bachelor’s thesis aims to create a detailed guideline for using marketing videos in various online channels for Altal Oy. The commissioning company, Altal Oy is a Finn-ish start-up founded by three employees in 2014. It operates in the smart home tech-nology sector. The thesis topic is based on the current needs of the company to pro-mote for the launch of its brand new products in the Finnish market. A real project of making a promotion video is conducted and reported in parallel with t...

Markkinointiviestintäsuunnitelma: Charlotta-Production Oy

OpenAIRE

Wikman, Carita

2015-01-01

Tämän opinnäytetyön tarkoituksena on luoda markkinointiviestintäsuunnitelma hollolalaiselle askartelutukulle ja vähittäismyymälälle Charlotta-Production Oy:lle. Suunnitelman tavoitteena on aktivoida etenkin vanhoja yritysasiakkaita, mutta myös yksityisasiakkaita, sekä tavoittaa uusia potentiaalisia asiakkaita erityisesti digitaalisiin markkinointikeinoihin painostaen. Opinnäytetyö jakaantuu teoreettiseen ja empiiriseen osuuteen. Teoriaosuudessa käsitellään markkinointiviestintää kokonaisu...

Viestintäsuunnitelma : Lippupalvelu Oy

OpenAIRE

Olin, Noora

2015-01-01

Tämän opinnäytetyön tavoitteena oli rakentaa viestintäsuunnitelma Lippupalvelu Oy:lle. Viestintäsuunnitelma alkaa ajallisesti siitä hetkestä, kun asiakas ostaa lipun verkkokaupasta, ja päättyy tapahtuman jälkimarkkinointiin. Tähän ajanjaksoon liittyvä uusi viestintäprosessi otettiin käyttöön vuoden 2015 aikana, mutta sitä haluttiin vielä kehittää eteenpäin. Tutkimuksessa selvitettiin tapahtumajärjestäjien mielipiteitä ja kehitysehdotuksia viestintäprosessista. Tavoitteena oli aikaansaada tark...

Salon Patarouva Oy : kertomus lounasravintolan perustamisesta

OpenAIRE

Aronen, Miina

2011-01-01

Salon Patarouva Oy on Salossa Meriniityn teollisuusalueella toimiva lounasravintola. Yrityksen perustaminen ja toiminnan alkuunsaattaminen oli lähtökohta tämän toiminnallisen opinnäytetyön tekemiseen. Omat lähtökohdat yrittäjäksi ryhtymiseen olivat vahva ammattitaito ja kokemus suurkeittiöympäristöistä. Vuokrasimme toimitilat ja ostimme uudet laitteet. Yrityslainan saimme Finnverasta ja pankista. Lainopillisia ja muita neuvoja saimme Yrityssalosta. Salon Pararouvan liikeidea on palvella...

Turvajalkineiden vaikutus jalkaterveyteen Suur-Savon Sähkötyö Oy:ssä

OpenAIRE

Pulkkinen, Riikka; Tossavainen, Inka; Ryynänen, Elina

2014-01-01

Opinnäytetyön tarkoituksena oli selvittää, millaisia vaikutuksia turvajalkineilla voi olla jalkaterveyteen, minkälaisia jalkaongelmia turvajalkineiden käyttö voi aiheuttaa, voivatko työntekijät itse vaikuttaa turvajalkineiden hankintaan ja millainen on turvajalkineiden hankintaprosessi Suur-Savon Sähkötyö Oy:ssä. Opinnäytetyömme toimeksiantaja oli Suur-Savon Sähkötyö Oy. Tutkimusmenetelmänä käytettiin pääasiassa kvantitatiivista tutkimusta ja aineisto kerättiin puolistrukturoidulla kysely...

Influence of calcium on transport properties, band spectrum and superconductivity of YBa2Cu3O(y) and YBa(1.5)La(0.5)Cu3O(y)

Science.gov (United States)

Gasumyants, V. E.; Vladimirskaya, E. V.; Patrina, I. B.

1995-01-01

The comparative investigation of transport phenomena in Y(1-x)Ca(x)Ba2Cu3O(y) (0 is less than x is less than 0.25; 6.96 is greater than y is greater than 6.87 and 6.73 is less than x is less than 6.53); Y(1-x)Ca(x)Ba(1.5)La(0.5)Cu3O(y) (0 is less than x is less than 0.5; 7.12 is greater than y is greater than 6.96) and YBa(2-x)La(x)Cu3O(y) (0 is less than x is less than 0.5; 6.95 is less than y is less than 7.21) systems have been carried out. The temperature dependencies of resistivity and thermopower have been measured. It was found that the S(T) dependencies take some additional features with Ca content increase. The results obtained have been analyzed on the basis of the phenomenological theory of electron transport in the case of the narrow conductive band. The main parameters of the band spectrum (the band filling with electrons degree and the total effective band width) have been determined. The dependencies of these from contents of substituting elements are discussed. Analyzing the results obtained simultaneously with the tendencies in oxygen content and critical temperature change we have confirmed the conclusion that the oxygen sublattice disordering has a determinant effect on band structure parameters and superconductive properties of YBa2Cu3O(y). The results obtained suggest that Ca gives rise to some peculiarities in band spectrum of this compound.

Pienpanimon tuotekehitys : Mathildedalin Panimo Oy

OpenAIRE

Lilja, Henri

2014-01-01

Tässä opinnäytetyössä selvitettiin, minkälaisia asioita Mathildedalin Panimo Oy:n tulee tuotekehityksessään ottaa huomioon. Opinnäytetyön kirjallisuusosa käsittelee oluen määritelmää ja historiaa, valmistusprosessia pienpanimossa, sekä lainsäädäntöä ja myyntikanavia. Työn teoreettisena pohjana on käytetty Business Model Canvas -nimistä liiketoiminnan suunnittelutyökalua, joka toimii tuotekehityksen tukena. Verotus, tiukka lainsäädäntö ja kiristyvä kilpailu ovat pienpanimon toiminnan suuri...

Hoivia Oy:n ruokapalvelujen asiakaskunnan laajentaminen

OpenAIRE

Sipilä, Satu

2014-01-01

Tämä opinnäytetyö syntyi Hoivia Oy:n tarpeesta markkinoida omia ruokapalveluitaan talon ulkopuolisille ja samalla kehittää lounasravintola Ludvigin palveluliiketoimintaa. Keskusteluissa toimitusjohtajan kanssa päätettiin selvityksen kohderyhmäksi ottaa kokonaisia palveluyksiköitä eikä yksittäisiä henkilöitä. Markkinatutkimukseen haluttiin mukaan kehitysvammaisten asuntoloita, päivätoimintayksiköitä, yksityisiä vanhainkoteja ja palvelutaloja sekä päiväkoteja. Ludvigissa on resursseja valmistaa...

Balanced scorecard:Case ConnectedDay Oy

OpenAIRE

Alatalo, Teija

2009-01-01

Markkinoiden kasvaminen ja jatkuvasti koveneva kilpailu ovat luoneet yrityksille paineita tulevaisuuden kilpailukyvyn ylläpitämiselle, mikä edellyttää yrityksiltä uudenlaisia työkaluja liiketoiminnan seuraamiselle. Tämän opinnäytetyön aiheena oli soveltaa yritysmaailmassa yleisesti käytettyä seurantajärjestelmää, balanced scorecardia case –yrityksenä käytetyn ConnectedDay Oy:n liiketoimintaan. Robert Kaplan ja David Norton suunnittelivat 1990 –luvun alussa balanced scorecard -mallin eli tasap...

Ohjelmapalveluiden tuotekortit Lahti Travel Oy:n kokouspalveluhakemistoon

OpenAIRE

Lahti, Kirsi; Lehtola, Senni

2010-01-01

Tämä toiminnallinen opinnäytetyö käsittelee matkailun ohjelmapalveluiden markkinointia ja tuotteistamista. Opinnäytetyön tuloksena syntyi ohjelmapalveluiden tuotekortteja toimeksiantajan uudistetuille Internet-sivuille. Toimeksiantajana on Lahti Travel Oy, ja työn produkti eli tuotekortit ovat osa toimeksiantajan Internet-sivujen uudistusta. Tuotekortit sijoittuvat Internet-sivuilla kokouspalveluiden palveluhakemistoon ja siellä tarkemmin oheispalveluiden osioon. Työssä on toiminnallisen työn...

Internetmarkkinoinnin mahdollisuudet : case NaNi Group Oy

OpenAIRE

Arvonen, Johanna

2014-01-01

Tämän opinnäytetyön tarkoituksena oli tutkia internetmarkkinoinnin mahdollisuuksia kolmessa internetpalvelussa pienten koirien vaatteita valmistavalle NaNi Group Oy:lle. Opinnäytetyö toimii hyödyllisenä oppaana toimeksiantajan internetmarkkinoinnin suunnittelussa. Lisäksi opinnäytetyössä arvioidaan toimeksiantajan Facebookissa ja YouTubessa suorittamaa mainontaa. Kampanjoiden tulosten arviointi ja vertailu antavat suuntaa sille, miten kampanjoita kannattaa toteuttaa tulevaisuudessa. Opinn...

Customer Orientation vs. Customer Orientation Perception : Case J & J Lakkapää Oy Tornio

OpenAIRE

Angeria, Heli

2011-01-01

Heli, Angeria 2011. Customer Orientation vs. Customer Orientation Perception. Case: J & J Lakkapää Oy Tornio. Kemi-Tornio University of Applied Sciences. Business and Culture. Pages 51. Appendices 5. The objective of this thesis is to study customer orientation with the help of a widely adapted Selling-Orientation-Customer Orientation (SOCO) scale, in order to find out what is the extent to which J & J Lakkapää Oy Tornio and its consumer customers agree or disagree about the company’s cus...

Solidification and Biotoxicity Assessment of Thermally Treated Municipal Solid Waste Incineration (MSWI) Fly Ash.

Science.gov (United States)

Gong, Bing; Deng, Yi; Yang, Yuanyi; Tan, Swee Ngin; Liu, Qianni; Yang, Weizhong

2017-06-10

In the present work, thermal treatment was used to stabilize municipal solid waste incineration (MSWI) fly ash, which was considered hazardous waste. Toxicity characteristic leaching procedure (TCLP) results indicated that, after the thermal process, the leaching concentrations of Pb, Cu, and Zn decreased from 8.08 to 0.16 mg/L, 0.12 to 0.017 mg/L and 0.39 to 0.1 mg/L, respectively, which well met the limits in GB5085.3-2007 and GB16689-2008. Thermal treatment showed a negative effect on the leachability of Cr with concentrations increasing from 0.1 to 1.28 mg/L; nevertheless, it was still under the limitations. XRD analysis suggested that, after thermal treatments, CaO was newly generated. CaO was a main contribution to higher Cr leaching concentrations owing to the formation of Cr (VI)-compounds such as CaCrO₄. SEM/EDS tests revealed that particle adhesion, agglomeration, and grain growth happened during the thermal process and thus diminished the leachability of Pb, Cu, and Zn, but these processes had no significant influence on the leaching of Cr. A microbial assay demonstrated that all thermally treated samples yet possessed strong bactericidal activity according to optical density (OD) test results. Among all samples, the OD value of raw fly ash (RFA) was lowest followed by FA700-10, FA900-10, and FA1100-10 in an increasing order, which indicated that the sequence of the biotoxicity for these samples was RFA > FA700-10 > FA900-10 > FA1100-10. This preliminary study indicated that, apart from TCLP criteria, the biotoxicity assessment was indispensable for evaluating the effect of thermal treatment for MSWI fly ash.

Laadun parantaminen jalkinetuotannossa : case: Reima Oy

OpenAIRE

Huurre, Helena

2014-01-01

Tämä opinnäytetyö käsittelee laatua ja laadun kehittämisen työkaluja yrityksissä. Opinnäytetyön tarkoituksena oli tehdä kotimaiselle lastenvaatevalmistajalle, Reima Oy:lle, laatukäsikirja jalkinetuotantoa varten sekä laatukäsikirjaan sisältyvä laatuvaatimustaulukko, mistä jalkineiden laadulliset vaatimukset on löydettävissä. Laatukäsikirjan tavoitteena oli yhdistää Reiman jalkineen tuotekehitysprosessin kuvaus ja yleiset jalkinevaatimukset koko tuotantoprosessin ajalta yhtenäiseksi dokume...

Effects of UV irradiation on humic acid removal by ozonation, Fenton and Fe0/air treatment: THMFP and biotoxicity evaluation

International Nuclear Information System (INIS)

Wei, Ming-Chi; Wang, Kai-sung; Hsiao, Tung-En; Lin, I.-Chen; Wu, Hui-Ju; Wu, Yuh-Luan; Liu, Pey-Horng; Chang, Shih-Hsien

2011-01-01

Highlights: → Fe 0 /air rapidly and effectively removed HA within 9 min and its COD, biotoxicity and THMFP were low. → THMFP of ozonation-treated solution was much higher than those of Fenton-treated and Fe 0 /air-treated solutions. → UV irradiation during ozonation and Fenton oxidation enhanced HA removal, but did not reduce the THMFP of the treated solutions. → Fe 0 /air treatment with UV irradiation obviously increased the THMFP of the treated solution. → The relationship between biotoxicity and chloroform in the chlorinated solution was insignificant. - Abstract: Effects of UV irradiation on humic acid (HA) removal by Fe 0 /air, ozonation and Fenton oxidation were investigated. The trihalomethane forming potential (THMFP) and toxicity of treated solutions were also evaluated. The experimental conditions were ozone of 21 mg min -1 , H 2 O 2 of 8 x 10 -4 M, Fe 0 of 20 g L -1 , air flow of 5 L min -1 , and UVC of 9 W. Results indicated that Fe 0 /air rapidly removed HA color (>99%) and COD (90%) within 9 min. 51-81% of color and 43-50% of COD were removed by ozonation and Fenton oxidation after 60 min. Both UV enhanced ozone and Fenton oxidation removed HA, but the Fe 0 /air process did not. Spectrum results showed all processes effectively diminished UV-vis spectra, except for ozonation. The THMFP of Fe 0 /air-treated solution (114 μg L -1 ) was much lower than those of Fenton- (226 μg L -1 ) and ozonation-treated solutions (499 μg L -1 ). Fe 0 /air with UV irradiation obviously increased the THMFP of treated solution (502 μg L -1 ). The toxicity results obtained from Vibrio fischeri light inhibition test indicated that the toxicity of Fe 0 /air-treated solution (5%) was much lower than that of ozonation- (33%) and Fenton-treated solutions (31%). Chlorination increased the solution toxicity. The correlation between biotoxicity and chloroform in the chlorinated solution was insignificant.

Determination of interstitial oxygen atom position in U2N3+xOy by near edge structure study

Science.gov (United States)

Jiang, A. K.; Zhao, Y. W.; Long, Z.; Hu, Y.; Wang, X. F.; Yang, R. L.; Bao, H. L.; Zeng, R. G.; Liu, K. Z.

2018-06-01

The determination of interstitial oxygen atom site in U2N3+xOy film could facilitate the understanding of the oxidation mechanism of α-U2N3 and the effect of U2N3+xOy on anti-oxidation. By comparing the similarities and variances between N K edge and O K edge electron energy loss spectra (EELS) for oxidized α-U2N3 and UO2, the present work looks at the local structure of nitrogen and oxygen atoms in U2N3+xOy film, identifying the most possible position of interstitial O atom.

Sosiaalisen median markkinoinnin vuosikello Weecos Oy:lle

OpenAIRE

Heinämäki, Lotta; Huuskonen, Leena

2015-01-01

Opinnäytetyön tarkoitus oli luoda kokonaisvaltainen ja selkeä suunnitelma Weecos Oy:n markkinointitoimenpiteille valituissa sosiaalisen median kanavissa. Weecos on vuonna 2012 perustettu ekologisia yrityksiä yhteen keräävä verkkokauppa-alusta. Pienestä koostaan johtuen se ei ole pystynyt toteuttamaan sosiaalisen median markkinointia toivomallaan tavalla ja markkinoinnin suunnittelu ja toteutus on ollut epäsäännöllistä. Markkinointisuunnitelman tavoitteena oli helpottaa yrityksen markkinoi...

Ion-Molecule Reaction of Gas-Phase Chromium Oxyanions: CrxOyHz- + H2O

International Nuclear Information System (INIS)

Gianotto, Anita Kay; Hodges, Brittany DM; Benson, Michael Timothy; Harrington, Peter Boves; Appelhans, Anthony David; Olson, John Eric; Groenewold, Gary Steven

2003-01-01

Chromium oxyanions having the general formula CrxOyHz- play a key role in many industrial, environmental, and analytical processes, which motivated investigations of their intrinsic reactivity. Reactions with water are perhaps the most significant, and were studied by generating CrxOyHz- in the gas phase using a quadrupole ion trap secondary ion mass spectrometer. Of the ions in the Cr1OyHz envelope (y = 2, 3, 4; z = 0, 1), only CrO2- was observed to react with H2O, producing the hydrated CrO3H2- at a slow rate (∼0.07% of the ion-molecule collision constant at 310 K). CrO3-, CrO4-, and CrO4H- were unreactive. In contrast, Cr2O4-, Cr2O5-, and Cr2O5H2- displayed a considerable tendency to react with H2O. Cr2O4- underwent sequential reactions with H2O, initially producing Cr2O5H2- at a rate that was ∼7% efficient. Cr2O5H2- then reacted with a second H2O by addition to form Cr2O6H4- (1.8% efficient) and by OH abstraction to form Cr2O6H3- (0.6% efficient). The reactions of Cr2O5- were similar to those of Cr2O5H2-: Cr2O5- underwent addition to form Cr2O6H2- (3% efficient) and OH abstraction to form Cr2O6H- (<1% efficient). By comparison, Cr2O6- was unreactive with H2O, and in fact, no further H2O addition could be observed for any of the Cr2O6Hz- anions. Hartree-Fock ab initio calculations showed that reactive CrxOyHz- species underwent nucleophilic attack by the incoming H2O molecules, which produced an initially formed adduct in which the water O was bound to a Cr center. The experimental and computational studies suggested that Cr2OyHz- species that have bi- or tricoordinated Cr centers are susceptible to attack by H2O; however, when the metal becomes tetracoordinate, reactivity stops. For the Cr2OyHz- anions the lowest energy structures all contained rhombic Cr2O2 rings with pendant O atoms and/or OH groups. The initially formed [Cr2Oy- + H2O] adducts underwent H rearrangement to a gem O atom to produce stable dihydroxy structures. The calculations indicated that

Tuotannon layoutin suunnittelu Flinkenberg OY:lle

OpenAIRE

Puotiniemi, Olli

2013-01-01

Opinnäytetyön aiheena on layoutsuunnittelu Flinkenberg Oy:lle. Yrityksen on tarkoitus tulevaisuudessa hankkia uusi työstökone nykyisiin toimitiloihin. Siitä seurasi tarve saada uusi layoutsuunnitelma tuotantohallista vanhan tilalle. Myös vanha layout kaipasi päivitystä. Opinnäytetyössä on pyritty soveltamaan jo olemassa olevaa teoriaa ja käytäntöä layoutsuunnittelussa. Teoriaa oli tarjolla paljon, ja olikin tärkeää osata perehtyä vain olennaiseen. Siihen tässäkin tutkimuksessa on pyritty....

M Road Oy: Arvo-ja laatudokumentti

OpenAIRE

Röynä, Mira

2017-01-01

Opinnäytetyön aiheena on yrityksen arvot ja laatutekijät. Opinnäytetyön tutkimuksellinen näkökulma syntyy konstruktiivisesta tutkimuksesta sekä kyselystä ja tiimityöskentelystä. Työssä tutustutaan tarkasti arvojen ja laatutekijöiden teoriaan, joiden pohjalta analysoidaan työntekijäkyselyn ja tiimityöskentelyn tuloksia. Työn tavoitteena on saada yhdistettyä franchaising-yritys M Road Oy:n arvot koko M Room –ketjun arvoja vastaavaksi, sekä parantaa yrityksen tuottamaa laatua. Toimeksiantaja...

High-speed photometry of the eclipsing dwarf nova OY Carinae

Science.gov (United States)

Cook, M. C.

1985-01-01

High-speed photometry of the eclipsing dwarf nova OY Car in the quiescent state is presented. OY Car becomes highly reddened during eclipse, with minimum flux colours inconsistent with optically thick emission in the U and B bandpasses. Mass ratios in the range 6.5 to 12 are required to reconcile the eclipse structure with theoretical gas stream trajectories. Primary eclipse timings reveal a significant decrease in the orbital period and the duration of primary eclipse indicates the presence of a luminous ring about the white dwarf. The hotspot eclipse reveals a hotspot which is elongated along the rim of the accretion disc, with optical emission being non-uniformly distributed along the rim. The location of the hotspot in the accretion disc implies a disc radius larger than that of an inviscid disc, with variation in the position of the hotspot being consistent with a fixed stream trajectory.

Transpro Oy:n koulutustenhallintajärjestelmä

OpenAIRE

Pöntinen, Mika

2011-01-01

Opinnäytetyössä toteutetaan koulutustenhallintajärjestelmä tuusulalaiselle Transpro Oy:lle, joka on kuljettajien ammattipätevyyskoulutuksiin erikoistunut yritys. Järjestelmän tehtävänä on tarjota työkalu, jolla voidaan hallita tietoja koulutustapahtumista, koulutustapahtumiin osallistuvista oppilaista, kouluttajista ja asiakkaista. Järjestelmä on toteutettu WWW-sovelluksena. Pääohjelmointikieli on PHP ja järjestelmän dynaamiset toiminnot on toteutettu JavaScript-kielellä. Sivuston haku j...

Selvitys kulttuuriyrityksen laajentumis- mahdollisuuksista. Saiffa Oy:n tapaus

OpenAIRE

Sirviö, Jussi

2013-01-01

Opinnäytetyö selvittää kulttuuriyrityksen laajentumismahdollisuuksia. Teoreettinen viitekehys on franchisingtoimintamalli, mutta selvitys on avoin myös muille toimivaksi osoittuville malleille. Opinnäytetyö on tapaustutkimus katutanssikeskus Saiffa – Flow Mo Dance Schoolille, jota johtaa Saiffa oy. Vuonna 2010 perustettu Saiffa on helsinkiläinen tanssikoulu, joka on erikoistunut katutanssilajeihin, kuten breakdance, popping locking ja hip hop. Sen toimialaan kuuluu tanssiopetuksen lis...

Miesten muodin verkkokauppakonsepti : case: FRENN Company Oy

OpenAIRE

Hautaniemi, Tapio

2015-01-01

Tämä opinnäytetyö käsittelee miesten muodin verkkokaupan perustamista ja kehittämistä. Työ on tehty toimeksiantona vuoden 2013 syksyllä lanseeratulle suomalaisella miesten vaatemerkille Frenn Company Oy:lle. Opinnäytetyön aihe valikoitui toimeksiantajan toiveiden pohjalta sekä omasta mielenkiinnostani ja kokemuksestani aiheeseen. Työn tavoitteena on selvittää, millainen on kansainvälinen miesten muodin verkkokauppa ja miten alan muut toimijat ovat verkkokauppansa toteuttaneet. Opinnäytet...

KOKEMUKSET ASIAKKUUKSIEN JOHTAMISESTA : Case: Buildercom Oy partneriasiakkaat

OpenAIRE

Porkka, Elina

2013-01-01

Tässä opinnäytetyössä tutkittiin, miten Buildercom Oy:n partneritason asiakkaat olivat kokeneet heihin kohdistetun asiakkuuden hoitomallin. Tavoitteena oli tutkia, miten asiakkaat oli tällä hetkellä jaettu erilaisiin ryhmiin, millaista lisäarvoa hoitomallilla on mahdollisesti kyetty asiakkaille tuottamaan, ja mitkä tekijät ovat vaikuttaneet asiakkaiden kokemusten laatuun. Tutkimus toteutettiin kokonaisuudessaan kevään 2012 ja kevään 2013 välisenä aikana. Tutkimus suoritettiin, koska toimeksia...

Markkinointiviestintäsuunnitelma Case: MK Kivipiha Oy

OpenAIRE

Ruohomaa, Sami

2011-01-01

Tämän opinnäytetyön tarkoituksena on ollut markkinointiviestintäsuunnitelman laatiminen MK Kivipiha Oy:lle. Opinnäytetyö toteutettiin projektityönä, jonka lisäksi benchmarkkaus osiossa hyödynnettiin kvalitatiivista eli laadullista analyysiä. Lähtökohtana pidettiin suunnitelman realistisuutta ja käytännön toteuttamisen mahdollisuutta. Opinnäytetyö rakentuu kahdesta eri osiosta: teoreettisesta viitekehyksestä sekä empiirisestä osuudesta. Teoriana käytettiin katsausta perinteisen markkinointivie...

Vähittäismyymälän markkinoinnin kehittäminen : case Mattomies Oy

OpenAIRE

Hellstén, Maren

2015-01-01

Opinnäytetyön tavoitteena oli löytää toimeksiantajana toimineelle Mattomies Oy Ruohola & Ruoholalle konkreettisia keinoja yrityksen vähittäismyymälän markkinoinnin kehittämiseksi. Teoriaosassa käytiin läpi 4P-mallin mukaiset markkinoinnin kilpailukeinot. Toteutusosassa analysoitiin Mattomies Oy Ruohola & Ruoholan myymälän nykytilaa, myymälän merkitystä liiketoiminnalle sekä koottiin myymälälle markkinointimix, jossa annettiin konkreettisia ehdotuksia markkinoinnin kehittämiseksi. Ehdo...

Työohjeistus Perälän Turve Oy

OpenAIRE

Haukka, Arto

2014-01-01

Perälän Turve Oy:n uusille työntekijöille laadittu työohjeistus ja siitä raportointi. Työhön kuuluu kaksi osaa, word-raportti sekä powerpoint-työohjeistuskansio. Powerpoint-tiedosto upotettuna tiedostona alkuperäisessä word-tiedostossa.

Asiakkuudenhallinnan avulla lisäarvoa asiakkaalle ja lisämyyntiä yritykselle : case Naaantalin Matkailu Oy

OpenAIRE

Korpiranta, Mirka

2012-01-01

Tässä opinnäytetyössä on selvitetty, miten Naantalin Matkailu Oy voi asiakkuudenhallinnan avulla luoda lisäarvoa asiakkaille ja tuottaa lisänmyyntiä yritykselle. Lisäksi on selvitetty, miten Winres-matkatoimistojärjestelmää voidaan hyödyntää asiakkuudenhallinnassa tavoitteiden saavuttamiseksi. Vertailukohteina käytettiin muita matkailutoimistoja, jotka muistuttavat Naantalin Matkailu Oy:tä ja Naantalia kohteena. Opinnäytetyön vertailukartoitus toteutettiin kyselynä, jonka tarkoituksena oli...

Työterveys- ja työturvallisuusjohtamisjärjestelmä : Case Tapojärvi Oy

OpenAIRE

Honkanen, Päivi

2011-01-01

Honkanen, Päivi. 2011. Työterveys- ja työturvallisuusjohtamisjärjestelmä. Case Tapo-järvi Oy. Opinnäytetyö. Kemi-Tornion ammattikorkeakoulu. Kaupan ja kulttuurin toimiala. Sivuja 33. Tämän opinnäytetyön tavoitteena on selvittää Tapojärvi Oy:n työterveys- ja työturvalli-suusjohtamisjärjestelmän nykytilaa ja arvioida kuinka se vastaa standardin OHSAS 18001:2007 vaatimuksia. Opinnäytetyö koostuu teoriaosuudesta ja empiirisestä tutkimuksesta. Teoriaosassa käsit-telen turvallisuusjohtamis...

Hissihuollon kehittäminen ThyssenKrupp hissit Oy

OpenAIRE

Nieminen, Jani

2013-01-01

Insinöörityössä kartoitettiin ThyssenKrupp Hissit Oy:n kunnossapidon tämänhetkinen toi-mintamalli ja sen pohjalta laadittiin kunnossapidon kehityssuunnitelman runko. Thyssen-Krupp Hissien huoltotoiminta on kasvanut voimakkaasti muutamassa vuodessa pienestä helposti johdettavasta yksiköstä usean henkilön johtamaksi organisaatioksi. Haastattelujen, vikatilastojen ja oman kokemukseni avulla päädyin siihen, että nykyinen hissien kunnossapito perustuu voimakkaasti korjaavaan kunnossapitoon ja ...

Characteristics of NixFe1−xOy Electrocatalyst on Hematite as Photoanode for Solar Hydrogen Production

Directory of Open Access Journals (Sweden)

Chih-Ping Yen

2017-11-01

Full Text Available The use of hematite as the photoanode for photoelectrochemical hydrogen production by solar energy has been actively studied due to its abundance, stability, and adequate optical properties. Deposition of an electrocatalyst overlayer on the hematite may increase kinetics and lower the onset potential for water splitting. NixFe1−xOy is one of the most effective electrocatalysts reported for this purpose. However, the condition and results of the previous reports vary significantly, and a comprehensive model for NixFe1−xOy/hematite is lacking. Here, we report a simple and novel chemical bath deposition method for depositing low-onset-potential NixFe1−xOy electrocatalyst on hematite. With a Ni percentage of 80% and an immersion time of 2 min, the as-prepared NixFe1−xOy overlayer raised the photovoltage from 0.2 V to 0.7 V, leading to a cathodic shift of the onset potential by 400 mV, while maintaining the same level of current density. The dependence of the electrochemical and photoelectrochemical characteristics of the photoanode on the condition of the electrocatalyst was studied systematically and explained based on energy level diagrams and kinetics.

Social Media Marketing : CASE: OY SUOMEN LYYRA AB

OpenAIRE

Eriksson, Irene

2012-01-01

This bachelor thesis was commissioned by Oy Suomen Lyyra Ab, the largest student online media and student card producer for higher education students in Finland. The the-sis objective was to understanding the current social media situation and activity among the students of higher education in Finland, the social media networks that the case company currently uses as well as understanding how to use these networks for successful marketing activities. The quantitative research was conducted in...

Integrated Brand Promotion – Advertisement for STADIUM OY

OpenAIRE

Mai, Tung

2014-01-01

This project-based thesis is an advertisement for Stadium Oy. In 23 years of leading marketing department, Stadium’s marketing manager had to say this is a pioneer time when Stadium’s outsources an advertising project to an external individual resource. The project, therefore, consists a number of business partners so that professional quality is guaranteed to deliver. STADIUM’s advertising strategy stays committed to the company’s business model and its mission. This directly affec...

Henkilöstötilinpäätös Yritys Oy

OpenAIRE

Turunen, Tytti

2011-01-01

Tämän opinnäytetyön aiheena oli Yritys Oy:n henkilöstötilinpäätös vuodelta 2009. Henkilöstötilinpäätös jaetaan kahteen osaan, henkilöstötuloslaskelmaan ja henkilöstökertomukseen. Tavoitteena oli laatia Yritys Oy:lle henkilöstötilinpäätöksestä malli, jota yritys voi käyttää ja hyödyntää tulevaisuudessa henkilöstötilinpäätöstä laatiessa. Tavoitteena oli myös antaa kehittämisehdotuksia, minkälaista tietoa kannattaa kerätä seuraavia henkilöstötilinpäätöksiä varten. Henkilöstötilinpäätöksen tavoit...

The biotoxicity of hydroxyapatite nanoparticles to the plant growth.

Science.gov (United States)

Jiang, Hao; Liu, Jin-Ku; Wang, Jian-Dong; Lu, Yi; Zhang, Min; Yang, Xiao-Hong; Hong, Dan-Jing

2014-04-15

In the present study, hydroxyapatite (HAP) nanoparticles of different particle sizes with high crystallinity and similiar structure were prepared by hydrothermal method. The crystal structure and particle size were characterized by X-ray diffraction pattern (XRD), transmission electron microscopy (TEM) and Fourier transform infrared (FT-IR) spectroscopy. Mung bean sprouts were first used as experimental models. Instead of by MTT assay, the cytoxicity of HAP nanoparticles were proved and evaluated by measuring the hypocotyle length of mung bean sprouts in the culture media. The result showed that the inhibition effect to the growth of mung bean sprouts enhanced when HAP nanoparticles existed. Culture media of HAP nanoparticles with different concentrations and particle sizes was prepared to investigate the level of inhibition effect to the growth of mung bean sprouts. The result found that hypocotyl length of mung bean sprouts were the shortest cultured in 5mg/mL culture media in which the HAP nanoparticles were prepared by hydrothermal method for 24h. It was concluded the inhibition effect depended on the amount of intracellular HAP nanoparticles. The nanostructure and Ca(2+) concentration were considered as the main factors to cause cell apoptosis which was the reason of inhibition. The study provided a preliminary perspective about biotoxicity of HAP nanomaterials to the plant growth. Copyright © 2014 Elsevier B.V. All rights reserved.

Sisäisen viestinnän kehittäminen osana parempia kampanjatoteutuksia : Case: Nike Finland Oy

OpenAIRE

Kankkunen, Eeva

2014-01-01

Tämä opinnäytetyö tehtiin Nike Finland Oy:lle, ja sen aiheena oli sisäisen viestinnän kehittäminen osana parempia kampanjatoteutuksia. Nike Finland Oy on maailman tunnetuimman urheilubrändin Niken Suomen organisaatio, ja tällä hetkellä se on toisena vastaavien tuotteiden valmistajana Suomen markkinoilla. Yritys tunnetaan niin Suomessa kuin maailmallakin kuuluisasta ja uniikista Niken logosta, ja sloganista ”Just do it”. Koska yritys on aina enemmän kuin pelkästään sen hyvä yritysimag...

Hierarchical α-MnO2 nanowires@Ni1-x Mnx Oy nanoflakes core-shell nanostructures for supercapacitors.

Science.gov (United States)

Wang, Hsin-Yi; Xiao, Fang-Xing; Yu, Le; Liu, Bin; Lou, Xiong Wen David

2014-08-13

A facile two-step solution-phase method has been developed for the preparation of hierarchical α-MnO2 nanowires@Ni1-x Mnx Oy nanoflakes core-shell nanostructures. Ultralong α-MnO2 nanowires were synthesized by a hydrothermal method in the first step. Subsequently, Ni1-x Mnx Oy nanoflakes were grown on α-MnO2 nanowires to form core-shell nanostructures using chemical bath deposition followed by thermal annealing. Both solution-phase methods can be easily scaled up for mass production. We have evaluated their application in supercapacitors. The ultralong one-dimensional (1D) α-MnO2 nanowires in hierarchical core-shell nanostructures offer a stable and efficient backbone for charge transport; while the two-dimensional (2D) Ni1-x Mnx Oy nanoflakes on α-MnO2 nanowires provide high accessible surface to ions in the electrolyte. These beneficial features enable the electrode with high capacitance and reliable stability. The capacitance of the core-shell α-MnO2 @Ni1-x Mnx Oy nanostructures (x = 0.75) is as high as 657 F g(-1) at a current density of 250 mA g(-1) , and stable charging-discharging cycling over 1000 times at a current density of 2000 mA g(-1) has been realized. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Creating strategic brand management manual : Case: Tukikallio Oy

OpenAIRE

Vepsäläinen, Sini

2010-01-01

The purpose of this Thesis was to create a Strategic Brand Management Manual for the use of a new company called Tukikallio Oy. The manual was composed of the elements that the company wanted to include in it. A qualitative research method was used in collecting information. The theoretical part of the thesis includes theories about brand building. Brand identity tells what the brand really is with its positive and negative sides, image reflects on what kind of things the consumer associa...

Distribution strategy: : A case study of Plantui Oy

OpenAIRE

Korpinen, Sakari; Siltala, Roope

2015-01-01

Distribution strategy: A case study of Plantui Oy Year 2015 Pages 57 Plantui is a Finnish start-up company focusing on enabling customers to grow plants at home. Plantui operates in the field of design and food tech. Plantui’s product offering consists of the Smart Garden, a device in which the plants are grown. Another product which Plantui offers to its customers is the plant capsules from which the plants are grown, with the help of the Smart Garden device. Plantui’s selling propos...

RFID-tunnisteiden havaitseminen liikkuvasta ajoneuvosta : case: Fidera Oy

OpenAIRE

Artukka, Riku

2016-01-01

Tämän opinnäytetyön tarkoituksena on testata ja dokumentoida suoritettuja RFID- ajoneuvomittauksia eli ajoneuvojen ja henkilöiden automaattista tunnistusta hyödyntämällä RFID-tunnisteita. Opinnäytetyö on tehty toimeksiantona Fidera Oy:lle. Yrityksellä on jo käytössä automaattinen henkilötunnistusjärjestelmä, tarve olikin soveltaa samaa tekniikkaa ajoneuvojen ja niiden sisällä olevien henkilöiden tunnistukseen. Opinnäytetyön tavoitteena on luoda kuva RFID-tekniikan perusteista ja toimia s...

Mainonnan huomioarvotutkimus. Case Nelipyörä Oy

OpenAIRE

Survonen, Juha

2013-01-01

Tämä opinnäytetyö käsittelee mainontaa markkinointiviestinnän keinona. Toimeksiantajana tällä opinnäytetyöllä on Hämeenlinnassa ja Hyvinkäällä toimiva autoliike, Nelipyörä Oy. Opinnäytetyön tarkoituksena on antaa toimeksiantajalle tietoa heidän mainontansa huomioarvoista käytettyjen mainosmedioiden osalta. Opinnäytetyön teoriaosuus koostuu markkinointiviestinnästä sekä mainonnasta. Markkinointiviestinnän osuus keskittyy markkinointiviestinnän suunnitteluun sekä tavoitteisiin. Mainonnan os...

Mazda kiintotyövaiheiden perustaminen : Delta Auto Oy

OpenAIRE

Schreck, Ville

2012-01-01

Täyden palvelun autoliikeketju Delta Auto myy ja huoltaa Kia-, Mitsubishi- ja Mazda-merkkisiä autoja paikkakuntakohtaisesti kahdessakymmenessäviidessä toimipisteessä. Opinnäytetyön tarkoituksena oli tehdä toimiva ratkaisu Mazdan työvaiheiden sekä työpakettien myyntiin Automaster-ohjelmistoon. Työvaiheet sekä ohjeajat tulevat käyttöön kaikkiin Delta Auton toimipisteisiin ympäri Suomea. Työn lähdemateriaalin sain Inchcape Motor Finland Oy:ltä, joka toimii Suomessa Mazdan maahantuojana. Tarve tä...

Insta Trust Oy:n tuottamien kriisiharjoitusten kehittäminen

OpenAIRE

Väinölä, Marko

2016-01-01

Insta Trust Oy toteuttaa asiakkaidensa kanssa kymmeniä kriisiharjoituksia vuosittain. Kriisiharjoitusten avulla pyritään kehittämään harjoittelevien tahojen kriisijohtamisen ja kriisiviestinnän osaamista, tunnistamaan kehittämistä vaativia toimintamalleja ja ohjeita sekä lisäämään organisaation avainhenkilöiden motivaatiota ja tietoisuutta kriisijohtamisesta ja ennakoivaa turvallisuustyötä kohtaan. Kriisiharjoitusten kehittämisessä on osattava kuunnella asiakkaiden tarpeita ja pysyttävä mukan...

Selvitys HR House Oy:n vuokratyöntekijöiden työtyytyväisyydestä

OpenAIRE

Kaskela, Leeni

2011-01-01

Opinnäytetyön tarkoituksena oli selvittää HR House Oy:n palveluksessa olevien vuokratyöntekijöiden työtyytyväisyyteen vaikuttavia asioita. Opinnäytetyö on laadullinen tutkielma, jossa käytän tutkimusmenetelmänä teemahaastattelua. Tutkimuskysymykseni selvittävät, mitkä asiat vaikuttavat työntekijöiden työ- tyytyväisyyteen ja mitä he kertovat työtyytyväisyyteen vaikuttavista tekijöistä. Toimeksianto opinnäytetyön tekemiseen on tullut HR House Oy Henkilöstöpalveluilta. Tavoitteena oli löytää kei...

Graphene/TiO2/ZSM-5 composites synthesized by mixture design were used for photocatalytic degradation of oxytetracycline under visible light: Mechanism and biotoxicity

Science.gov (United States)

Hu, Xin-Yan; Zhou, Kefu; Chen, Bor-Yann; Chang, Chang-Tang

2016-01-01

This first-attempt study revealed mixture design of experiments to obtain the most promising composites of TiO2 loaded on zeolite and graphene for maximal photocatalytic degradation of oxytetracycline (OTC). The optimal weight ratio of graphene, titanium dioxide (TiO2), and zeolite was 1:8:1 determined via experimental design of simplex lattice mixture. The composite material was characterized by XRD, UV-vis, TEM and EDS analysis. The findings showed the composite material had a higher stability and a stronger absorption of the visible light. In addition, it was uniformly dispersed with promising adsorption characteristics. OTC was used as model toxicant to evaluate the photodegradation efficiency of the GTZ (1:8:1). At optimal operating conditions (i.e., pH 7 and 25 °C), complete degradation (ca. 100%) was achieved in 180 min. The biotoxicity of the degraded intermediates of OTC on cell growth of Escherichia coli DH5α were also assayed. After 180 min photocatalytic treatment, OTC solution treated by GTZ (1:8:1) showed insignificant biotoxicity to receptor DH5α cells. Furthermore, EDTA (hole scavengers) and t-BuOH (radical scavengers) were used to detect the main active oxidative species in the system. The results showed that the holes are the main oxidation species in the photocatalytic process.

Kanta-asiakasohjelman kehittäminen : case Crocs Stores Oy

OpenAIRE

Manninen, Mirka

2014-01-01

Kanta-asiakkuuden tavoitteena on molemminpuolinen arvon tuottaminen asiakkaan ja yrityksen välillä. Tämän tutkimuksen tavoitteena on selvittää, millainen kanta-asiakasohjelma olisi toimeksiantajayrityksen kannalta toimivin. Tutkimus on tapaus- eli case -tutkimus, jonka toimeksiantaja on Crocs Stores Oy. Toimeksiantajalla on tällä hetkellä käytössään kanta-asiakasohjelma, joka ei palvele yrityksen tarpeita. Paremman kanta-asiakasohjelman kehittämisen lisäksi tavoitteina on selvittää asiakkaide...

Sosiaalisen median merkitys mikroyrityksille - Case: TallFits Oy

OpenAIRE

Nousiainen, Ari; Koskivuori, Timo

2011-01-01

Tämän opinnäytetyön aiheena on sosiaalinen media mikroyritysten näkökulmasta. Työssä käsi-tellään sosiaalista mediaa ja markkinoinnissa tapahtunutta muutosta sekä niitä toimintatapoja, joita interaktiivinen mediaympäristö yrityksille ja sen asiakkaille tarjoaa. Työn tavoitteena on tuottaa tietoa sosiaalisen median hyödyistä ja haasteista mikroyrityksille ja lisätä koh-deyrityksemme TallFits Oy:n myyntiä ja löydettävyyttä. Tavoitteiden saavuttamiseksi opinnäytetyömme tarkoituksena oli tehd...

Kankaan tuotekehittäminen erikoisolosuhteisiin K&H Annala Oy:lle

OpenAIRE

Koski, Marjo

2017-01-01

Opinnäytetyö tehtiin yhteistyössä Suomen ainoan huonekalukankaita valmistavan yrityksen K&H Annala Oy:n kanssa. Työn aiheena oli suunnitella ja tuotteistaa kangasmallisto erikoisolosuhteisiin innovatiivisesta, Italiassa valmistettavasta Flyer-langasta. Projektin lähtökohtana oli opinnäytetyöntekijän kasvava kiinnostuneisuus kudottuja tekstiilejä kohtaan ja kankaan suunnitteluprosessin vieminen teollisen tuotannon puolelle. Projektissa tähdättiin uudentyyppiseen kankaaseen ilmeen ja materiaali...

Period changes of cataclysmic variables below the period gap: V2051 Oph, OY Car and Z Cha

Science.gov (United States)

Pilarčík, L.; Wolf, M.; Zasche, P.; Vraštil, J.

2018-04-01

We present our results of a long-term monitoring of cataclysmic variable stars (CVs). About 40 new eclipses were measured for the three southern SU UMa-type eclipsing CVs: V2051 Oph, OY Car and Z Cha. Based on the current O - C diagrams we confirmed earlier findings that V2051 Oph and OY Car present cyclic changes of their orbital periods lasting 25 and 29 years, respectively. In case of Z Cha we propose the light-time effect caused probably by a presence of the third component orbiting the eclipsing CV with the period of 43.5 years. The minimal mass of this companion results about 15 MJup.

Managing Customer Relationships in the Social Media : Case: Diamo oy

OpenAIRE

Laakso, Heidi

2013-01-01

The purpose of this study was to increase the amount of new likes of Diamo Oy in the social media network site Facebook, eventually aiming for the creation of new customer relationships, increased visibility of the company and into strictly increasing purchasing of their products. The theoretical part of the study consists of the role of content production in the social media field and customer relationship management, of which particularly customer acquisition and retention are discussed mor...

Isothermal Kinetics of Diesel Soot Oxidation over La0.7K0.3ZnOy Catalysts

Directory of Open Access Journals (Sweden)

Ram Prasad

2014-10-01

Full Text Available This paper describes the kinetics of catalytic oxidation of diesel soot with air under isothermal conditions (320-350 oC. Isothermal kinetics data were collected in a mini-semi-batch reactor. Experiments were performed over the best selected catalyst composition La0.7K0.3ZnOy prepared by sol-gel method. Characterization of the catalyst by XRD and FTIR confirmed that La1-xKxZnOy did not exhibit perovskite phase but formed mixed metal oxides. 110 mg of the catalyst-soot mixture in tight contact (10:1 ratio was taken in order to determine the kinetic model, activation energy and Arrhenius constant of the oxidation reaction under the high air flow rate assuming pseudo first order reaction. The activation energy and Arrhenius constant were found to be 138 kJ/mol and 6.46x1010 min-1, respectively. © 2014 BCREC UNDIP. All rights reservedReceived: 26th April 2014; Revised: 27th May 2014; Accepted: 28th June 2014How to Cite: Prasad, R., Kumar, A., Mishra, A. (2014. Isothermal Kinetics of Diesel Soot Oxidation over La0.7K0.3ZnOy Catalysts. Bulletin of Chemical Reaction Engineering & Catalysis, 9(3: 192-200. (doi: 10.9767/bcrec.9.3.6773.192-200Permalink/DOI: http://dx.doi.org/10.9767/bcrec.9.3.6773.192-200

Valmistalokauppa : Toimintatapa ja omavalvonnan kehitystarpeet Muurametalot Oy:ssä

OpenAIRE

Kantola, Jussi

2012-01-01

Valmistalokauppa on kehittynyt paljon viimeisten vuosien aikana. Taloja valmistavia yrityksiä on perustettu runsaasti ja valmistalojen kysyntä on kasvanut. Työn tarkoituksena oli päivittää Muurametalot Oy:n omavalvontajärjestelmä vastaamaan paremmin tämän päivän tarpeita. Tavoitteena oli muokata omavalvonnassa käytettävät tarkastuspöytäkirjat nykypäivän asetusten tasolle. Ideaalitilanne olisi, että jokainen työntekijä osallistuu omavalvonnan käyttöön. Järjestelmän periaatteena on tarjota ...

Yritys X Oy:n myyntijohtolankojen hallintaprosessin kehittäminen

OpenAIRE

Jokinen, Mika

2014-01-01

Tässä kehittämistehtävässä tutkittiin miten Yritys X Oy:n myyntijohtolankojen hallintaprosessia voidaan kehittää niin, että se tuottaisi enemmän ja laadukkaampia myyntijohtolankoja myynnin käsiteltäväksi. Yritys X on kansainvälisiä logistiikkapalveluja tuottava yritys ja myyntijohtolankojen avulla voidaan hankkia uusia asiakkaita ja lisämyyntiä. Tutkimuksen lähtöaineisto kerättiin kyselytutkimuksella kuljettajilta ja ajojärjestelijöiltä. Kehittämistyön tueksi aineistoa kerättiin myös myy...

Todellista asiakasarvoa luomassa – myynnistä arvomyyntiin : case Mediamaisteri Oy

OpenAIRE

Brander, Heli

2017-01-01

Tämän opinnäytetyön tavoite oli case-yritys Mediamaisteri Oy:n B2B-myyntiprosessin kehittäminen. Tarkoitus oli hyödyntää palvelumuotoilua lisäämään asiakasymmärrystä ja tukemaan asiakkaiden kokeman arvon muodostumista sekä positiivisten asiakaskokemusten syntymistä myyntiprosessin alkuvaiheen asiakaskohtaamisissa. Lisäksi tarkoitus oli kiteyttää empiirisen aineiston pohjalta saatu tieto asiakasprofiileiksi, joita voidaan hyödyntää asiakaslähtöisten ratkaisujen suunnittelussa heti asiakkuuden ...

Toimintolaskennan soveltaminen : Case Hyvönen Yhtiöt Oy

OpenAIRE

Hyvönen, Krista

2014-01-01

Tässä opinnäytetyössä kehitetään toimeksiantajayrityksenä toimivalle Hyvönen Yhtiöt Oy:lle toimintolaskentaa hyödyntävä kustannuslaskentamalli. Tehdyn kehitystyön tavoitteena on luoda kohdeyritykselle täysin uudenlainen kustannuslaskentamalli, joka näyttää kustannukset uudesta näkökulmasta erilaisen ryhmittelyn ansiosta sekä selvittää toimintolaskennan soveltuvuutta yrityksen palvelukohtaisten kustannusten laskemiseen. Tutkimustehtävänä on selvittää, miten toimintolaskentaa voidaan soveltaa H...

Electronic structure and fine structural features of the air-grown UNxOy on nitrogen-rich uranium nitride

Science.gov (United States)

Long, Zhong; Zeng, Rongguang; Hu, Yin; Liu, Jing; Wang, Wenyuan; Zhao, Yawen; Luo, Zhipeng; Bai, Bin; Wang, Xiaofang; Liu, Kezhao

2018-06-01

Oxide formation on surface of nitrogen-rich uranium nitride film/particles was investigated using X-ray photoelectron spectroscopy (XPS), auger electron spectroscopy (AES), aberration-corrected transmission electron microscopy (TEM), and high-angle annular dark-field scanning transmission electron microscopy (HAADF-STEM) coupled with electron energy-loss spectroscopy (EELS). XPS and AES studies indicated that the oxidized layer on UN2-x film is ternary compound uranium oxynitride (UNxOy) in 5-10 nm thickness. TEM/HAADF-STEM and EELS studies revealed the UNxOy crystallizes in the FCC CaF2-type structure with the lattice parameter close to the CaF2-type UN2-x matrix. The work can provide further information to the oxidation mechanism of uranium nitride.

Toimenpide-ehdotuksia sosiaaliseen mediaan : case: Sony Music Entertainment Finland Oy

OpenAIRE

Marttila, Noora

2016-01-01

Tämä opinnäytetyö toteutettiin toimeksiantona Sony Music Entertainment Finland Oy levy-yhtiölle. Toimeksiantaja on kansainvälinen yritys joka on yksi Suomen suurimmista levy-yhtiöistä. Yritys käyttää sosiaalista mediaa osana digitaalista markkinointiaan. Sitä käytetään erityisesti artistien sekä julkaisujen tunnettuuden lisäämiseen. Sosiaalinen media on kasvava markkinoinnin keino, joka oikein hyödynnettynä voi johtaa hyviin lopputuloksiin. Tämän työn tarkoituksena on antaa yrityksell...

Synthesis of vanadium oxides 5 wt.%VO2–MxOy by sol–gel process ...

Indian Academy of Sciences (India)

Experimental results indicated that the VO2–SiO2 catalysts .... crucible, which was supported by the beam of a balance in the oven. ... Epoxidation of cyclohexene on VO2–Mx Oy (M = Si, Al, Ti). 1189 ... tially amorphous nature of silica.

Markkinointi murroksessa: Mistä on toimiva Facebook-markkinointi tehty? : Case: Infokone Oy

OpenAIRE

Korhonen, Taneli

2010-01-01

Opinnäytetyön tavoitteena oli kartoittaa Facebook-markkinoinnin toimivia käytänteitä B2B-yritykselle. Tutkimuksessa saatuja tuloksia on tarkoitus käyttää apuna toimeksiantaja Infokone Oy:n Facebook-strategian suunnittelussa. Käytetty tutkimusote oli kvalitatiivinen eli laadullinen tutkimus ja tutkimusmenetelmä teemahaastattelu. Tutkimukseen haastateltiin syys–lokakuussa 2010 kolmea B2B-yrityksen edustajaa, jotka olivat olleet mukana toteuttamassa edustamansa yrityksen Facebook-markkinoint...

Kanta-asiakkuuksien hankinta paikallisessa yö-kerhossa, Case: Giggling Marlin Oy

OpenAIRE

Ylärakkola, Emmi

2016-01-01

Tämän opinnäytetyön tarkoituksena oli saada käsitys siitä, saadaanko työssä toteutettujen keinojen avulla uusia kanta-asiakkaita ja aiempia kanta-asiakkaita uusimaan jäsenyytensä paikallisessa yökerhossa. Työn toimeksiantaja oli Giggling Marlin Oy, joka kuuluu Night People Group -ravintolayhtiöön. Giggling Marlin sijaitsee Lappeenrannan keskustassa ja on perustettu alkukeväällä 2006. Toiminnallisena osana suunniteltiin ja toteutettiin mainosmateriaalia kampanja-ajankohdalle sekä valmisteltiin...

A visible and infrared study of the eclipsing dwarf nova OY Carinae

International Nuclear Information System (INIS)

Berriman, G.

1984-01-01

This paper presents four visible light curves of the highly inclined, short-period cataclysmic binary star OY Carinae in quiescence. These light curves show that the red dwarf eclipses both its white dwarf companion and the accretion disc and hotspot, which originate from material transferred from the red dwarf to the white dwarf. The consequences of the findings are discussed in the light of current ideas about the evolution of cataclysmic variable stars. (author)

Content Marketing Plan for Logistics Company : Case: NetLogistic JVM Oy

OpenAIRE

Riabochkina, Elizaveta

2017-01-01

This project aim is to create a Content Marketing Strategy for a Finnish logistics company. The aim of the thesis is to develop an action plan that will help the commissioning company increase sales and gain new customers. The commissioner for the study is NetLogistic JVM Oy. The Company specializes in handling trade of transit and export shipments to Russia and CIS-countries via Finland. The company does not have huge resources to run large campaign, but is looking for ways to reach new...

Eclipse studies of the dwarf nova Oy Carinae in quiescence

International Nuclear Information System (INIS)

Wood, J.H.; Horne, K.; Berriman, G.; Wade, R.A.

1989-01-01

High-speed photometry of OY Car have been obtained which cover 20 eclipses in white light and seven eclipses in UBR. The results show the red dwarf to have a mass of 0.070 + or - 0.002 solar masses and a radius of 0.127 + or - 0.002 solar radii, and the white dwarf to have a temperature of several thousand degrees below 15,000 K. The bright spot is found to have a compact 15,000-K core and a tail that extends along the rim but does not penetrate far into the disk. 31 refs

Establishing a pricing structure for software products : Case study: Viope Solutions Oy

OpenAIRE

Nguyen, Tram

2013-01-01

This thesis is a case study that explores how to establish a pricing structure for software products. The objective is to provide a guideline to establish a pricing structure for Viope Solutions Oy. A new pricing structure is crucial for the company due to recent changes in its business such as internationalisation and new product launches. The literature review introduces five attributes of a pricing structure. They are the unit definition, price determination, price segmentation, versio...

Synthesis and photoluminescence properties of CaSixOy:Tb3+ phosphors prepared using solution-combustion method

CSIR Research Space (South Africa)

Dejene, FB

2011-07-01

Full Text Available Effect of Tb3+ ion concentrations on the structural and persistence luminescence properties of CaSixOy:Tb3+ crystals were evaluated using powders grown by the solution combustion technique. The XRD study indicates the change of phase from CaSiO3...

5S-MENETELMÄN KÄYTTÖÖNOTTO: LUVATA PORI OY

OpenAIRE

Rantanen, Suvi

2015-01-01

Opinnäytetyön aiheena oli 5S-menetelmän käyttöönotto Luvata Pori Oy:n tuotannos-sa. Tutkimuksen lähtökohtana ja ongelmana oli siisteyden ja järjestyksen puute. Ta-voitteena oli aikaansaada valittuun pilottikohteeseen toimivat, siistit ja turvalliset tuotantotilat sekä luoda järjestelmä, jonka avulla ylläpidetään saavutettu taso. Lisäksi tavoiteltiin hukan poistamista ja Luvatan Lean toimintatavan syventämistä. Projekti toteutettiin toimintatutkimuksena syksyn 2015 aikana. Tutkimuksen teor...

The development of Facebook marketing utilizing Content marketing. Case: Pirjon Pakari Oy.

OpenAIRE

Lehtikangas, Pauliina

2015-01-01

The purpose of this thesis was to learn how to improve Pirjon Pakari Oy’s brand visibility and overall visibility on Facebook. This was done by trying to add value to the end customer by producing interesting and engaging posts to Pirjon Pakari Oy’s Facebook page. This case study utilized theory from content marketing in attempts to improve the marketing of “Pirjon” Facebook page and therefore a Facebook content marketing strategy was created for Pirjon Pakari Oy. This strategy was implemente...

Entering Chinese market for Finnish fashion jewellery company : case: Ninja Finland Oy

OpenAIRE

Wang, Yujue

2014-01-01

As one of the fastest-growing economies in the world, China is expected to become the largest fashion market in the world in a few years. As a result, more and more foreign companies have entered the Chinese market and the market has been more competitive than ever. This requires any fashion company to adopt a strategic development plan when entering the Chinese market. Ninja Finland Oy is a fashion jewellery company which offers a wide range of fashion jewellery and accessories. The comp...

Tuotteiden ohjeistaminen osana hankintatoimintaa ja tuotetiedonhallintaa : case: Seppälä Oy

OpenAIRE

Heikkonen, Veera

2010-01-01

Tuoteohjeistusten tekeminen on arkipäivää suomalaisissa vaatetusalan yrityksissä. Tuotteiden hankinta ulkomailta on yleistynyt huomattavasti, joka taas on tehnyt tuoteohjeistuksista tärkeitä työkaluja yrityksen toiminnassa. Tuoteohjeistusten avulla suunnittelijan ideat ja ajatukset toteutetaan oikeaksi tuotteeksi. Tämän opinnäytetyön tarkoitus oli kehittää Seppälä Oy:lle yhtenäinen tuoteohjeis-tuspohja, joka on selkeä ja toimiva. Projektin lähtökohtainen tarkoitus on, että Seppälä voi hy...

Structural and superconducting properties of YBa2Cu3-xMxOy (M=Ag, Al

Directory of Open Access Journals (Sweden)

S Falahati

2009-08-01

Full Text Available   Samples of YBa2Cu3-xAgxOy with x=0, 0.1, 0.15, 0.2, 0.3 and samples of YBa2Cu3-xAlxOy with x=0, 0.01, 0.02, 0.03 and 0.045 are prepared by the sol-gel method. Structural and superconducting properties of samples are studied by electrical resistivity (R-T, X-ray diffraction (XRD and scanning electron microscopy (SEM. All the samples show transition to superconducting state and the transition temperatures of the samples increased with increasing Ag doping up to x=0.15. R-T measurements show a small decrease of TC (zero with increasing Al doping up to x=0.02, and followed by a faster decrease with increasing doping concentration. YBCO grains are better linked with increasing Ag doping. So, Ag has positive effects in superconducting properties of YBCO. The crystal structure of samples was refined by MAUD. These results show tha, Ag is substituted for Cu(1 in YBCO. According to these analysis, we introduce x=0.15 as the optimum value for doping concentration .

Electronic states of SiO2-MxOy (MxOy=P205, TiO2 and ZrO2) glasses

Energy Technology Data Exchange (ETDEWEB)

Kowada, Y [Hyogo Univ. of Teacher Education, Hyogo (Japan); Adachi, H [Kyoto Univ. (Japan). Faculty of Engineering; Minami, T [Univ. of Osaka Prefecture, Osaka (Japan). Faculty of Engineering

1993-12-01

Using the sol-gel method the surface of metal and glass substrates can be modified. For example, stainless steel sheets coated with the SiO2-ZrO2 glass films have higher resistance to corrosion and oxidation. The coating films contain high concentration of alkali ions diffusing from the glass substrates. It suggests that the sodium ions are trapped strongly within the coating films and are blocked to further diffuse to the surface. This behavior must be associated with the chemical bonding around the sodium ions in the SiO2-TiO2 and SiO2-ZrO2 films. For better understanding of the chemical bonding in the glasses, the electronic states of the SiO2-MxOy glasses were calculated by means of the DV-Xa cluster method. In this paper, the calculation method is explained, the results are discussed and the conclusion is stated. 17 refs., 6 figs.

Digitaalinen markkinointi pk-yrityksessä inbound-markkinoinnin keinoin CASE: Customer Intelligence Finland Oy

OpenAIRE

Lassila, Anna-Sofia

2016-01-01

Tämän opinnäytetyön tarkoituksena oli tutkia kuinka digitaalista markkinointia kannattaa tehdä inbound-markkinoinnin keinoin. Tutkimuksen ensisijaisena tavoitteena oli löytää tehokkaimmat keinot inbound-markkinoinnin toteuttamiseen. Toisena tavoitteena oli antaa tuloksiin pohjautuen suosituksia digitaalisen markkinoinnin jatkotoimenpiteistä inbound-metodia hyödyntäen. Tämän opinnäytetyön toimeksiantajana toimi Customer Intelligence Finland Oy (CIFI). Tämän opinnäytetyön tutkimusmenetelmän...

Corporate Social Responsibility: A Case Study of BSCI Implementation at Best Friend Group Oy

OpenAIRE

Qi, Yuan

2012-01-01

With the current polarized debate over CSR issues worldwide, ever increasing number of companies believe that incorporating ethical values into the business operation is an attractive option to upgrade the brand value, maintain the competitive advantage and cater for the social demand of various stakeholders. Business Social Compliance Initiative, a division of FTA, serves as a platform to assist companies in achieving the goal. The study was commissioned by Best Friend Group Oy, a medium...

A/B Testing in Improving Conversion on a Website : Case: Sanoma Entertainment Oy

OpenAIRE

Arento, Thomas

2010-01-01

The purpose of this thesis is to study marketing possibilities of improved conversion rates on websites. The study was made for Sanoma Entertainment Oy’s Gaming & Online unit. The main objective was to explore A/B testing as a tool to improve conversion rates by increasing click-through rates. The secondary objective was to test Google Website Optimizer as an A/B testing tool in comparison to current methods of A/B testing in Sanoma Entertainment Oy. The results of this study will be used as ...

Inhalable desert dust, urban emissions, and potentially biotoxic metals in urban Saharan-Sahelian air

Science.gov (United States)

Garrison, Virginia H.; Majewski, Michael S.; Konde, Lassana; Wolf, Ruth E.; Otto, Richard D.; Tsuneoka, Yutaka

2014-01-01

Saharan dust incursions and particulates emitted from human activities degrade air quality throughout West Africa, especially in the rapidly expanding urban centers in the region. Particulate matter (PM) that can be inhaled is strongly associated with increased incidence of and mortality from cardiovascular and respiratory diseases and cancer. Air samples collected in the capital of a Saharan–Sahelian country (Bamako, Mali) between September 2012 and July 2013 were found to contain inhalable PM concentrations that exceeded World Health Organization (WHO) and US Environmental Protection Agency (USEPA) PM2.5 and PM10 24-h limits 58 – 98% of days and European Union (EU) PM10 24-h limit 98% of days. Mean concentrations were 1.2-to-4.5 fold greater than existing limits. Inhalable PM was enriched in transition metals, known to produce reactive oxygen species and initiate the inflammatory response, and other potentially bioactive and biotoxic metals/metalloids. Eroded mineral dust composed the bulk of inhalable PM, whereas most enriched metals/metalloids were likely emitted from oil combustion, biomass burning, refuse incineration, vehicle traffic, and mining activities. Human exposure to inhalable PM and associated metals/metalloids over 24-h was estimated. The findings indicate that inhalable PM in the Sahara–Sahel region may present a threat to human health, especially in urban areas with greater inhalable PM and transition metal exposure.

5S-menetelmän käyttöönotto Case: Planmeca Oy

OpenAIRE

Velic, Adel

2014-01-01

Opinnäytetyön tavoitteena on tutkia Planmeca Oy:n panoraamaröntgentuotannossa syksyllä 2012 toteutetun 5S-projektin onnistuneisuutta. Työ kattaa sekä 5S-periaatteiden mukaisesti suunniteltujen ja toteutettujen panoraamaröntgentuotannon Elko-, Pystytys 1 -, Pystytys 2 - sekä Potilastuki- ja skannausmekanismitiimin työpisteiden että projektin toteutustavan onnistuneisuuden mittaamisen. Tutkimusmenetelmänä käytetään Elko-, Pystytys 1 -, Pystytys 2 - sekä Potilastuki- ja skannausmekanismitiim...

Assessing demand for physical objects among marketing agencies : market research for Alphaform RPI Oy

OpenAIRE

Popova, Oxana

2012-01-01

The market for 3D printing services is projected to grow significantly. A service provider of 3D printing and rapid prototyping services, Alphaform RPI Oy recognizes that there are numerous growth opportunities that can be exploited. A market research was initiated by the case company to look for any emerging trends to use physical objects. The study was focused on exploring marketing agencies and their vision on 3D printing and rapid prototyping services. Theoretical framework was built ...

Neste Oy starts the production of extra high viscosity index lubricating oil in Porvoo

International Nuclear Information System (INIS)

Kilander, H.

1997-01-01

Neste Oy is starting the manufacture of basic oil, used in advanced motor lubricants, in Finland. The plant will start the manufacture of the EHVI (Extra High Viscosity) by the end of 1997. The EHVI basic oil is a synthetic-like oil product, suitable for manufacture of high-quality lubricants. In the beginning the production of the basic oil will be about 50 000 tons/a. The investment costs of the plants are 180 million FIM

Markkinoinnin kehittäminen, Verkkomarkkinointi ja sosiaalinen media : JA-KI Muutto Oy

OpenAIRE

Kahanpää, Timo

2015-01-01

Tämän opinnäytetyön tavoitteena oli kehittää ja tehostaa helsinkiläisen muuttoalan yrityksen JA-KI Muutto Oy:n markkinointia verkossa ja siellä nimenomaan sosiaalisessa mediassa. Työn tavoitteena oli löytää ja tuoda esille keinoja ja kehittämisehdotuksia, joiden avulla markkinointia verkossa voitaisiin tehostaa entisestään. Opinnäytetyö tehtiin kehittämistehtävänä ja se jakautuu kahteen osaan: teoriaosaan ja kehittämisosaan. Teoriaosiossa käydään läpi eri lähteiden kautta ensin markkinoin...

Effects of Ni-5%RExOy Composite Additives on Electrochemical Hydrogen Storage Performances of Mg2Ni

Directory of Open Access Journals (Sweden)

ZHANG Guo-fang

2017-11-01

Full Text Available The Ni-5%RExOy (CeO2, La2O3, Eu2O3 as composite additives, Mg2Ni-Ni-5%RExOy composites were prepared by the ball milling method. The effects of different additives on the structure, morphology, electrochemistry and kinetic properties of Mg2Ni alloy were studied systematically. The results show that composite additives can improve the proportion of amorphous and nanocrystalline structure of Mg2Ni alloy. The particle size is homogeneous but the agglomeration is observed in the sample with Ni-5%CeO2 additives. The composites with additives show higher maximum discharge capacity and better cycle stabilities. All of these three kinds of composite additives can improve the kinetic properties of the composites effectively, including optimizing the charge-transfer ability, the reversibility of the electrochemical reaction on the alloy surface, and enhancing the diffusion coefficients of H atoms in the bulk of alloy. Among these three kinds of additives, Ni-5%CeO2 additive shows the best catalysis effect on promoting the kinetic properties of the composites.

Enhanced thermoelectric properties of nano SiC dispersed Bi2Sr2Co2Oy Ceramics

Science.gov (United States)

Hu, Qiujun; Wang, Kunlun; Zhang, Yingjiu; Li, Xinjian; Song, Hongzhang

2018-04-01

The thermoelectric properties of Bi2Sr2Co2Oy + x wt% nano SiC (x = 0.00, 0.025, 0.05, 0.1, 0.2, and 0.3) prepared by the solid-state reaction method were investigated from 300 K to 923 K. The resistivity can be reduced effectively by adding a small amount of SiC nano particles, which is attributed to the increase of the carrier concentration. At the same time, the Seebeck coefficients can be improved effectively due to the energy filtering effect that low energy carriers are strongly dispersed at the interface between the SiC nano particles and the matrix. The decrease of thermal conductivity is due to the increase of the scattering ability of the phonons by the SiC nanoparticles distributed at the boundary of the matrix. As a result, the Bi2Sr2Co2Oy + x wt% SiC composites exhibit better thermoelectric properties. The maximum ZT value 0.24 is obtained when x = 0.05 at 923 K. Compared with the sample without SiC nano particles, the ZT value is increased by about 59.7%.

Ostotoiminnan laadunvarmistus ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä

OpenAIRE

Hiltunen, Jarmo

2012-01-01

Opinnäytetyön aiheena oli ostotoiminnan laadunvarmistuksen ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä. Työssä on perehdytty erityisesti niihin ostotoiminnan laadun kehittämisen haasteisiin mitkä liittyvät alihankintaostamisen osa-alueeseen. Opinnäytetyön päätavoitteena oli luoda työkaluja hankinnan laadun jatkuvan parantamisen avuksi. Lisäksi tavoitteena oli perehtyä hankintojen mittaamisen teoriaan. Opinnäytetyön tutkimusmenetelmänä on käytetty käytännön tietoa ostam...

Ympäristöjärjestelmän rakentaminen : Case: Inno Interior Oy

OpenAIRE

Pirinen, Liisa

2009-01-01

Tavoitteena oli rakentaa huonekalualalla toimivalle Inno Interior Oy:lle, joka valmistuttaa tuotteet alihankkijoilla, sertifiointikelpoinen ympäristönhallintajärjestelmä. Yrityksellä ei ollut ympäristösertifikaattia. Asiakkaat vaativat yritykseltä ympäristöasioiden hoitamisen tason osoittamista. Ympäristöhallintajärjestelmän rakentaminen ja sertifiointi oli sopivin ratkaisu ongelmaan. Ympäristöjärjestelmän rakentamisen lähtökohtana olivat toiminnan aiheuttamat ympäristö-vaikutukset ja...

Internationalization Strategies for Multinational Companies (MNCs) : In the case of KWH Mirka Oy to Ethiopia

OpenAIRE

Yigzaw, Tamirat

2015-01-01

This thesis is done for the fulfilment of Masters of Business Administration (MBA) degree program in Business Management and Entrepreneurship at Häme University of Applied Sciences (HAMK). The main focus of the study is internationalization of companies to a new market as a development task for the company. The commissioner of the thesis is Mirka Oy, a Finnish multinational company. The purpose of the thesis was to study factors that should be considered in internationalization strategies...

Inter- and intragranular properties of bismuth calcium strontium copper oxide (Bi2CaSr2Cu2Oy) superconductors

NARCIS (Netherlands)

Emmen, J.H.P.M.; Brabers, V.A.M.; Steen, van der C.; Dalderop, J.H.J.; Lenczowski, S.K.J.; Jonge, de W.J.M.

1989-01-01

The granular behaviour of sintered bulk Bi2CaSr2Cu2Oy superconductor is investigated by resistivity and ¿ac measurements. The observed temperature and magnetic field dependence is discussed within the framework of a granular model. The frequency dependence of the intragranular losses leads to a flux

Instrumentation of the model in scaled 1:10 to prototype of the AquaBuOY wave energy converter

DEFF Research Database (Denmark)

Margheritini, Lucia; Frigaard, Peter

The objective of this report is to provide guidelines for the instrumentation of a model in scale 1:10 to prototype of the AquaBuOY wave energy converter. The model will be located in Nissum Bredning area: this is an important waterway already used by Aalborg University for real sea tests of wave...... energy converters....

Changes in the components and biotoxicity of dissolved organic matter in a municipal wastewater reclamation reverse osmosis system.

Science.gov (United States)

Sun, Ying-Xue; Hu, Hong-Ying; Shi, Chun-Zhen; Yang, Zhe; Tang, Fang

2016-09-01

The characteristics of dissolved organic matter (DOM) and the biotoxicity of these components were investigated in a municipal wastewater reclamation reverse osmosis (mWRRO) system with a microfiltration (MF) pretreatment unit. The MF pretreatment step had little effect on the levels of dissolved organic carbon (DOC) in the secondary effluent, but the addition of chlorine before MF promoted the formation of organics with anti-estrogenic activity. The distribution of excitation emission matrix (EEM) fluorescence constituents exhibited obvious discrepancies between the secondary effluent and the reverse osmosis (RO) concentrate. Using size exclusion chromatography, DOM with low molecular weights of approximately 1.2 and 0.98 kDa was newly formed during the mWRRO. The normalized genotoxicity and anti-estrogenic activity of the RO concentrate were 32.1 ± 10.2 μg4-NQO/mgDOC and 0.36 ± 0.08 mgTAM/mgDOC, respectively, and these values were clearly higher than those of the secondary effluent and MF permeate. The florescence volume of Regions I and II in the EEM spectrum could be suggested as a surrogate for assessing the genotoxicity and anti-estrogenic activity of the RO concentrate.

Teollisuuden Voima Oy - Industrial Power Company Ltd. Local information activity

Energy Technology Data Exchange (ETDEWEB)

Engros, Taina [Department of Information, TVO, Olkiluoto FIN-27160 (Finland)

1989-07-01

There are two nuclear power producers in Finland - the state-owned power company Imatran Voima Oy which operates two 440 MW Soviet-made PWR units in southern Finland, east of Helsinki and the Teollisuuden Voima Oy - Industrial Power Company Ltd, or TVO, owned by Finnish industrial companies. TVO operates two 710 MW ABB ATOM BWR units producing about one fifth of the country's electricity consumption. Operating experiences are extremely good from all Finnish nuclear power plants. The Finns' attitude towards nuclear power has changed into a positive direction in recent times. This can probably be noted as an international trend now that the Chernobyl accident is becoming an incident of the past. The Finnish citizens and politicians are facing two questions; first, what is their attitude towards nuclear power as a source of energy, in other words, do they approve of the plants currently in operation. The second question is how they stand on the building of new plants. It is probably another universal phenomenon that the attitudes of people living in the vicinity of nuclear power plants are less critical than the attitudes of those living farther away. This does not, by any means, result in local information activity being easier or less important than nationwide information activity. On the contrary, local decision-makers, local media and inhabitants are those who can, and through whom we can, influence also wider circles. The Nuclear Energy Act, which became effective in Finland last year, defines that the final decision on whether nuclear power plants can be built inside a municipality, is made at local level. As far as TVO is concerned one factor making local information activity easier is the small size of the locality. The difficulty TVO has to face is the people's suspicion of information activity. All information is considered propaganda, regardless of its form, and only negative news are considered information. Also, a large proportion of people are passive

Teollisuuden Voima Oy - Industrial Power Company Ltd. Local information activity

International Nuclear Information System (INIS)

Engros, Taina

1989-01-01

There are two nuclear power producers in Finland - the state-owned power company Imatran Voima Oy which operates two 440 MW Soviet-made PWR units in southern Finland, east of Helsinki and the Teollisuuden Voima Oy - Industrial Power Company Ltd, or TVO, owned by Finnish industrial companies. TVO operates two 710 MW ABB ATOM BWR units producing about one fifth of the country's electricity consumption. Operating experiences are extremely good from all Finnish nuclear power plants. The Finns' attitude towards nuclear power has changed into a positive direction in recent times. This can probably be noted as an international trend now that the Chernobyl accident is becoming an incident of the past. The Finnish citizens and politicians are facing two questions; first, what is their attitude towards nuclear power as a source of energy, in other words, do they approve of the plants currently in operation. The second question is how they stand on the building of new plants. It is probably another universal phenomenon that the attitudes of people living in the vicinity of nuclear power plants are less critical than the attitudes of those living farther away. This does not, by any means, result in local information activity being easier or less important than nationwide information activity. On the contrary, local decision-makers, local media and inhabitants are those who can, and through whom we can, influence also wider circles. The Nuclear Energy Act, which became effective in Finland last year, defines that the final decision on whether nuclear power plants can be built inside a municipality, is made at local level. As far as TVO is concerned one factor making local information activity easier is the small size of the locality. The difficulty TVO has to face is the people's suspicion of information activity. All information is considered propaganda, regardless of its form, and only negative news are considered information. Also, a large proportion of people are passive

Array-level stability enhancement of 50 nm AlxOy ReRAM

Science.gov (United States)

Iwasaki, Tomoko Ogura; Ning, Sheyang; Yamazawa, Hiroki; Takeuchi, Ken

2015-12-01

ReRAM's low voltage and low current programmability are attractive features to solve the scaling issues of conventional floating gate Flash. However, read instability in ReRAM is a critical issue, due to random telegraph noise (RTN), sensitivity to disturb and retention. In this work, the array-level characteristics of read stability in 50 nm AlxOy ReRAM are investigated and a circuit technique to improve stability is proposed and evaluated. First, in order to quantitatively assess memory cell stability, a method of stability characterization is defined. Next, based on this methodology, a proposal to improve read stability, called ;stability check loop; is evaluated. The stability check loop is a stability verification procedure, by which, instability improvement of 7×, and read error rate improvement of 40% are obtained.

Biotoxic efficacy of two horticultural plants against infestation of Sitophilus oryzae on stored maize

Directory of Open Access Journals (Sweden)

Mercy Olayinka ONI

2016-06-01

Full Text Available Since botanicals still remained the most promising tool that could obviate the use of chemical insecticides, this study investigated the biotoxic effect of Acacia auriculiformis and Acalypha goddsefiana powder and oil against Sitophilus oryzae. The powder of the plants were tested at 0.0g (control, 0.1, 0.2, 0.4, 0.6, 0.8, 1.0 and 2.0g dosages while their extracts were prepared at 1, 2, 3, 4 and 5% concentrations per 20g of maize seeds. Solvent control was also prepared for the oil extracts bioassay. Mortality, adult emergence, % inhibition rate and % weight loss were observed. LD50 and LC50 of the powders and oils of the two botanicals were calculated at 48 hours of application. The powders of both plants achieved complete weevil mortality within 72h of application at 2.0g and their effect was significantly (p<0.05 different from other dosages except 1.0g dosage. Also, the extracts of both plant achieved 100% insect mortality within 48h hours of application at 5%. However the powder and oil of A. auriculiformis appeared more effective than that of A. goddsefiana in term of mortality as reflected by their lethal dosage and concentration. However, A. goddsefiana powder and extract appeared more effective than that of A. auriculiformis in term of protectability as they greatly reduced the emergence of the adult weevil and their ability to cause weight loss of the maize grains. Only the higher dosages and concentrations of the plants were able to achieve 100% inhibition rate.

Lasten ulkovaatteiden kevät-kesämalliston seinäesillepano-ohje : case: Reima Oy

OpenAIRE

Järvenoja, Annika

2014-01-01

Opinnäytetyö tehtiin Reima Oy:lle. Työn tavoitteena oli kerätä asiakkaiden mielipiteitä lasten ulkovaatteiden seinäesillepanoista. Tutkimuksen pohjalta tehtiin seinäesillepano-ohje kevät-kesämallistolle. Reiman omat myymälät sijaitsevat pääosin Kiinassa, Suomessa ja Venäjällä. Kevät-kesämalliston tuotteiden vaihtelevuus välikausivaatteista ohuisiin aurinkosuojavaatteisiin koettiin myymälässä haasteelliseksi. Tavoitteena on tutkia lisäksi, mistä maiden kulttuurien eroavaisuudet johtuvat, ja mi...

HENKILÖSTÖVUOKRAUSPALVELUN SÄHKÖISEN MARKKINOINTIVIESTINNÄN KEHITTÄMINEN : Case Nordic JobCentre Oy

OpenAIRE

Salmela, Heli

2016-01-01

Vuokratyön käyttö on ollut kasvussa jo pitkään. Erityisesti rakennus- ja teollisuusaloilla vuokratyön käyttö on hyvin yleistä, vaikka edelleen toimialan maine on joiltain osin negatiivinen. Kilpailu on kuitenkin kovaa, ja erityisesti Etelä-Suomen alueella vuokratyöfirmoja on syntynyt viime vuosikymmenen aikana runsaasti. Opinnäytetyöni on sähköisen markkinointiviestinnän kehitystehtävä, jonka toimeksiantajana on oululaislähtöinen henkilöstövuokrausyritys Nordic JobCentre Oy. Kehitystehtäv...

A visible and infrared study of the eclipsing dwarf nova Oy Carinae

International Nuclear Information System (INIS)

Berriman, G.

1984-01-01

This paper presents three simultaneous visible (V) and infrared (J,H,K) light curves of the eclipsing dwarf nova binary system OY Carinae in quiescence. The infrared light curves show a secondary minimum, not seen in the visible, which is the ellipsoidal variations of the red dwarf and its eclipse by the accretion disc surrounding the white dwarf companion. The red star, an M dwarf, supplies between 30 and 60 per cent of the total light at J,H and K. This requires that the system is between 100 and 300 pc away. The infrared continuum of the accretion disc around the white dwarf companion comes largely from the optically thin gas giving rise to the emission lines seen in the visible and ultraviolet. (author)

Maa-analyysi liiketoiminnallisesta näkökulmasta tukemassa kansainvälistymisstrategiaa : Case: SuperApp Oy, Yhdysvallat

OpenAIRE

Laiho, Tea

2016-01-01

Tämä opinnäytetyö toteutettiin toimeksiantona lahtelaisen KIBS-palveluja eli osaamisintensiivisiä liike-elämän palveluja tarjoavan SuperApp Oy:n käyttöön. Tutkimuksen tavoitteena oli kartoittaa kohdemaan potentiaali kansainvälisen liiketoiminnan ja palveluyrityksen näkökulmasta. Tarkoituksena oli antaa case-yritykselle työkaluja ja avaimia, sen laajentaessa liiketoimintaansa tulevaisuudessa ulkomaille, erityisesti Yhdysvaltoihin. Tämä tutkimus käsittelee osaa kansainvälistymisstrategiaa varte...

Graphene/TiO_2/ZSM-5 composites synthesized by mixture design were used for photocatalytic degradation of oxytetracycline under visible light: Mechanism and biotoxicity

International Nuclear Information System (INIS)

Hu, Xin-Yan; Zhou, Kefu; Chen, Bor-Yann; Chang, Chang-Tang

2016-01-01

Graphical abstract: The mechanism of OTC degradation can be described as follows. At first, the OTC molecule was adsorbed onto the surface of GTZ material. The conduction band electron (e"−) and valence band holes (h"+) are generated when aqueous GTZ suspension is irradiated with visible light. The generation of (e"−/h+) pair leading to the formation of reactive oxygen species. The ·OH radical and ·O_2"− can oxidize OTC molecular, resulting in the degradation and mineralization of the organics. - Highlights: • Determine optimal composites of graphene, TiO_2, and zeolite for maximal photodegradation efficiency via triangular mixture design. • Unravel most promising composites for high stability and absorptive capabilities for photocatalytic degradation. • Disclose time-series profiles of toxicity of advanced oxidation processes (AOPs) treatment of wastewater. • Propose plausible routes of mechanism of photocatalytical degradation of OTC. - Abstract: This first-attempt study revealed mixture design of experiments to obtain the most promising composites of TiO_2 loaded on zeolite and graphene for maximal photocatalytic degradation of oxytetracycline (OTC). The optimal weight ratio of graphene, titanium dioxide (TiO_2), and zeolite was 1:8:1 determined via experimental design of simplex lattice mixture. The composite material was characterized by XRD, UV–vis, TEM and EDS analysis. The findings showed the composite material had a higher stability and a stronger absorption of the visible light. In addition, it was uniformly dispersed with promising adsorption characteristics. OTC was used as model toxicant to evaluate the photodegradation efficiency of the GTZ (1:8:1). At optimal operating conditions (i.e., pH 7 and 25 °C), complete degradation (ca. 100%) was achieved in 180 min. The biotoxicity of the degraded intermediates of OTC on cell growth of Escherichia coli DH5α were also assayed. After 180 min photocatalytic treatment, OTC solution treated

Yrittäjyyden myytit ja möröt : case: Yritystakomo Oy, Oulu

OpenAIRE

Merentie, Elisa

2012-01-01

Tämän tutkimuksen tarkoituksena on selvittää mitkä yrittäjyyden myytit ja möröt vaikuttavat aloittavan yrittäjän uskallukseen aloittaa yrittäjänä. Ilmiötä tarkastelin tapausyrityksen, Yritystakomo Oy:n kautta. Ovatko vuosia kestäneet yrittäjyyden myytit, uskomukset aiheellisia ja sovellettavissa tämän päivän aloittelevan yrittäjän ajatusmaailmaan? Aihe on valittu, koska yrittäjyydestä ja sen edistämisestä puhutaan paljon, myös sen helppoudesta, mutta siitä huolimatta yrittäjyysidea jää usein...

Pienyrityksen B2B-myyntiprosessi Venäjän markkinoilla: Case Perfect Getaway Oy

OpenAIRE

Prokkola, Joni

2014-01-01

Opinnäytetyön tavoitteena oli luoda Perfect Getaway Oy:lle B2B myyntiprosessi suoramyyntiä varten Venäjän markkinoille. Yritys on luksuselämyksiä tarjoava matkailualan yritys, jonka pääkohderyhmänä ovat suomalaiset sekä venäläiset yksityis- ja yritysasiakkaat. Tavoitteena oli selvittää miten kylmäsoittoja voitaisiin käyttää hyväksi suoramyynnissä. Toimeksiantajana toimi yrityksen toimitusjohtaja. Opinnäytetyön kirjoittaja on myös työsuhteessa kyseiseen yritykseen. Tuotoksena toimisivat kaksi ...

ABB Oy Motors and Generators -yksikön energiansyöttöjen erotus- ja lukitusohjeet

OpenAIRE

Chi, Henri

2017-01-01

Tämä insinöörityö toteutettiin Quant Finland Oy:lle, joka vastaa Helsingin Pitäjänmäen ABB Motors and Generators -tehtaan kunnossapidosta. Insinöörityön tavoitteena oli luoda energiansyöttöjen lukitus- ja erotusohjeet tehtaan koneistoille, laitteille ja järjestelmille. Tehtaalla on isoja koneita ja laitteita, jonka erotus- ja lukitustoimenpiteitä kaikki eivät osaa. Näin ollen on haluttu mahdollistaa turvallinen työskentely tarjoamalla selkeät erotus- ja lukitusohjeet. ABB Motors and Gene...

Massaräätälöityjen tuotteiden prosessin hallinta ja konfigurointi : Selvitystyö yritykselle Kera Group Oy

OpenAIRE

Saares, Sanna

2017-01-01

Opinnäytetyön aiheena oli selvittää, mikä ohjelmistokokonaisuus soveltuisi parhaiten terassituotteiden suunnittelun ja myynnin tueksi. Opinnäytetyö tehtiin Orimattilassa sijaitsevalle muovi- ja lasituotteisiin erikoistuneelle Kera Group Oy:lle. Tuotealueena olivat lasitetut valmisterassit, joita toimitetaan pientalojen yhteyteen. Vaikka valmiita terassityyppejä on rajattu määrä, joudutaan suurin osa tuotteista suunnittelemaan ja valmistamaan yksilöllisesti. Uuden tuotteen suunnittelu on ...

Franchising - liiketoiminnan käynnistämiseen vaadittavat toimenpiteet ja haasteet organisaatiossa : case: Touring Cars Finland Oy

OpenAIRE

Aaltonen, Suvi

2013-01-01

Tämän opinnäytetyön tavoitteena oli selvittää franchise-liiketoiminnan käynnistämiseen liittyviä toimenpiteitä ja haasteita organisaatiossa. Opinnäytetyön teoriaosuus selvittää niitä asioita, joita franchise-antajan ja –ottajan on huomioitava franchise-liiketoimintaa aloittaessaan. Case-yrityksenä on suomalainen Touring Cars Finland Oy. Case-yritys siirtyy käyttämään franchise-liiketoimintamallia vuosien 2013–2018 aikana yrityksen kaikissa toimipisteissä Suomessa ja ulkomailla. Touring Ca...

Graphene/TiO{sub 2}/ZSM-5 composites synthesized by mixture design were used for photocatalytic degradation of oxytetracycline under visible light: Mechanism and biotoxicity

Energy Technology Data Exchange (ETDEWEB)

Hu, Xin-Yan; Zhou, Kefu [College of the Environment and Ecology, Xiamen University, Xiamen (China); Chen, Bor-Yann, E-mail: boryannchen@yahoo.com.tw [Department of Chemical and Materials Engineering, National I-Lan University, Ilan, Taiwan (China); Chang, Chang-Tang, E-mail: ctchang73222@gmail.com [Department of Environmental Engineering, National I-Lan University, Ilan, Taiwan (China)

2016-01-30

Graphical abstract: The mechanism of OTC degradation can be described as follows. At first, the OTC molecule was adsorbed onto the surface of GTZ material. The conduction band electron (e{sup −}) and valence band holes (h{sup +}) are generated when aqueous GTZ suspension is irradiated with visible light. The generation of (e{sup −}/h+) pair leading to the formation of reactive oxygen species. The ·OH radical and ·O{sub 2}{sup −} can oxidize OTC molecular, resulting in the degradation and mineralization of the organics. - Highlights: • Determine optimal composites of graphene, TiO{sub 2}, and zeolite for maximal photodegradation efficiency via triangular mixture design. • Unravel most promising composites for high stability and absorptive capabilities for photocatalytic degradation. • Disclose time-series profiles of toxicity of advanced oxidation processes (AOPs) treatment of wastewater. • Propose plausible routes of mechanism of photocatalytical degradation of OTC. - Abstract: This first-attempt study revealed mixture design of experiments to obtain the most promising composites of TiO{sub 2} loaded on zeolite and graphene for maximal photocatalytic degradation of oxytetracycline (OTC). The optimal weight ratio of graphene, titanium dioxide (TiO{sub 2}), and zeolite was 1:8:1 determined via experimental design of simplex lattice mixture. The composite material was characterized by XRD, UV–vis, TEM and EDS analysis. The findings showed the composite material had a higher stability and a stronger absorption of the visible light. In addition, it was uniformly dispersed with promising adsorption characteristics. OTC was used as model toxicant to evaluate the photodegradation efficiency of the GTZ (1:8:1). At optimal operating conditions (i.e., pH 7 and 25 °C), complete degradation (ca. 100%) was achieved in 180 min. The biotoxicity of the degraded intermediates of OTC on cell growth of Escherichia coli DH5α were also assayed. After 180 min

Electrochemically Obtained TiO2/CuxOy Nanotube Arrays Presenting a Photocatalytic Response in Processes of Pollutants Degradation and Bacteria Inactivation in Aqueous Phase

Directory of Open Access Journals (Sweden)

Magda Kozak

2018-06-01

Full Text Available TiO2/CuxOy nanotube (NT arrays were synthesized using the anodization method in the presence of ethylene glycol and different parameters applied. The presence, morphology, and chemical character of the obtained structures was characterized using a variety of methods—SEM (scanning electron microscopy, XPS (X-ray photoelectron spectroscopy, XRD (X-ray crystallography, PL (photoluminescence, and EDX (energy-dispersive X-ray spectroscopy. A p-n mixed oxide heterojunction of Ti-Cu was created with a proved response to the visible light range and the stable form that were in contact with Ti. TiO2/CuxOy NTs presented the appearance of both Cu2O (mainly and CuO components influencing the dimensions of the NTs (1.1–1.3 µm. Additionally, changes in voltage have been proven to affect the NTs’ length, which reached a value of 3.5 µm for Ti90Cu10_50V. Degradation of phenol in the aqueous phase was observed in 16% of Ti85Cu15_30V after 1 h of visible light irradiation (λ > 420 nm. Scavenger tests for phenol degradation process in presence of NT samples exposed the responsibility of superoxide radicals for degradation of organic compounds in Vis light region. Inactivation of bacteria strains Escherichia coli (E. coli, Bacillus subtilis (B. subtilis, and Clostridium sp. in presence of obtained TiO2/CuxOy NT photocatalysts, and Vis light has been studied showing a great improvement in inactivation efficiency with a response rate of 97% inactivation for E. coli and 98% for Clostridium sp. in 60 min. Evidently, TEM (transmission electron microscopy images confirmed the bacteria cells’ damage.

The benefits of Outsourcing facility services when selecting right service provider for a hotel:Case Kämp Group Oy

OpenAIRE

Paudyal, Manoj; Acharya, Saroj

2015-01-01

This research paper examines about the outsourcing of facility services in the Kämp group of hotels. The scope of the study includes Facility Management, outsourcing facilities services, and the selection process of the service providers for a hotel. The research was carried at the hotels of Kämp group Oy in the Metropolitan Area of Helsinki. Facility management includes wide ranges of non-core functions such as Property management, real estates, design and technology. Activities such as secu...

Energiantuotannon ratkaisut Penttilän Puu Oy:n höyläämön sivuvirrasta

OpenAIRE

Kortelainen, Toni

2017-01-01

Tässä teknistaloudellisessa opinnäytetyössä selvitettiin Penttilän Puu Oy:n Joensuun höyläämölle taloudellisesti kannattavin energiantuotantoratkaisu. Käyttöikänsä päähän tulleen nykyisen ruuvisyötteisen arinakattilan tilalle on harkittu pienen kokoluokan sähkön ja lämmön yhteistuotantoa (pien-CHP), mikäli sellainen osoittautuu kannattavaksi. Muussa tapauksessa arinakattila vaihdetaan uuteen biokattilaan lähivuosina. Opinnäytetyön teknisessä osiossa esitellään korvaavat lämmitysvaih...

Superconducting transition temperature in the Y(1-x)M(x)Ba2Cu3O(y) system

Science.gov (United States)

Suzuki, Takeyuki; Yamazaki, Tsutomu; Sekine, Ryuuta; Koukitsu, Akinori; Seki, Hisashi

1989-04-01

Experimental results are presented for the inclusion of compositional additives, M, to the sintered high-temperature superconductor Y(1-x)M(x)Ba2Cu3O(y); M can be the oxides of Mg, Ce, Gd, Yb, Ti, Zr, V, Nb, Ta, Cr, Mo, W, Mn, Fe, Co, Ni, Zn, B, Al, Ga, In, Si, Ge, Sn, Pb, Sb, Bi, and Te, as well as Li, Na, K, Ca, Sr, and La carbonates. Temperature dependence of the electrical resistance was measured down to about 80 K. Attention is given to the influence of ionic radius and the valence of the M species.

Reinforced fluropolymer nanocomposites with high-temperature superconducting Bi2Sr2CaCu2Oy

Science.gov (United States)

Jayasree, T. K.

2014-10-01

Bismuth Strontium Calcium Copper Oxide (Bi2Sr2CaCu2Oy)/Polyvinylidene fluoride (PVDF) nanocomposite was prepared and their thermal properties were analyzed. The composite consists of the polyvinylidene fluoride (PVDF) as an insulating polymer matrix, and homogenously distributed Bismuth strontium calcium copperoxide (2212) nanoparticles. SEM data shows flaky grains of the superconductor coated and linked by polymer. Differential scanning calorimetry (DSC) results indicated that the melting point was not affected significantly by the addition of BSCCO. However, the addition of superconducting ceramic resulted in an extra melting peak at a lower temperature (145°C). Thermogravimetric analysis of the samples shows that the onset decomposition temperature of the PVDF matrix was decreased by the addition of SC filler.

Matkustussäännön toteuttaminen ja kehittäminen - Case Norilsk Nickel Harjavalta Oy

OpenAIRE

Sihvonen, Aino

2015-01-01

Tämä opinnäytetyö tehtiin toimeksiantona Norilsk Nickel Harjavalta Oy:lle. Opinnäytetyön tarkoituksena oli tutkia toimeksiantajan matkustussäännön vahvuuksia ja puutteita. Tutkimustehtävänä oli selvittää, miten yhtiön henkilöstö kokee nykyisen matkustussäännön sekä mistä johtuu, että matkustusasioissa ilmenee erilaisia käytänteitä. Tutkimuksen tavoitteena oli luoda kehitysehdotuksia yhtiön matkustussääntöön. Matkustussäännön kehittämisellä pyritään kustannustehokkuuden ja ympäristönäkökulmien...

Synthesis and Microstructure Properties of (Bi,Pb2Sr2Ca1Cu2Oy Ceramic Superconductor

Directory of Open Access Journals (Sweden)

nurmalita .

2015-11-01

Full Text Available Properties of (Bi, Pb2Sr2Ca1Cu2Oy ceramic superconductors were prepared by the melt textured growth methods in order to investigate the effects of the slow cooling time on the microstructur.  Phase analyses of the samples by X-ray diffraction (XRD has been carried out to assess the effects of the slow cooling time. From XRD analyses, the addition to the sample of  the slow cooling time degrades formation of the high-Tc Bi-2212 phase. The possible reasons for the observed degradation in the microstructure properties due to the slow cooling time addition were discussed.

CRM-tietojärjestelmän käyttöopas osana yrityksen asiakkuudenhallintaa : case: Fysioline Oy

OpenAIRE

Ilonen, Mikko

2012-01-01

Tämän opinnäytetyön aiheena on CRM-tietojärjestelmän käyttöopas osana yrityksen asiakkuudenhallintaa. Opinnäytetyön teoriaosuus käsittelee asiakkuudenhallintaa, CRM-tietojärjestelmiä ja CRM:n käyttöönottoa. Työn empiriaosuus muodostuu CRM-tietojärjestelmän käyttöoppaasta. CRM-tietojärjestelmän käyttöopas tehdään kohdeyritys Fysioline Oy:lle. Opinnäytetyön teoriaosuudessa selvitetään vastausta tutkimusongelmaan, miksi yrityksen tulee kiinnittää huomiota asiakkuudenhallintaan ja mitä hyötyä...

ISO 14001 -standardin mukaisen ympäristöjärjestelmän luominen : case: Plastep Oy

OpenAIRE

Harju, Siiri

2016-01-01

Opinnäytetyön tavoitteena oli luoda kattavan ympäristökartoituksen sisältävä ISO 14001 -standardin mukainen ympäristöjärjestelmä Plastep Oy:lle. Lisäksi tarkoituksena oli suunnitella yrityksen ympäristönsuojelun tilaa mahdollisimman luotettavasti kuvaava ympäristömittari sekä tarkastella muovin ruiskuvaluyritykseen kohdistuvia tulevaisuuden näkymiä ympäristönsuojelun näkökulmasta. Opinnäytetyössä esitellään ISO 14001 -ympäristöjärjestelmä sekä kyseisen standardin sisältä...

Verkkokauppa osaksi B2B-yrityksen sähköistä liike-toimintaa : case: Capcons Technology Oy

OpenAIRE

Kaitarinne, Tomi; Hannula, Tuomo

2010-01-01

Tämän opinnäytetyön tarkoituksena on kuvata monipuolisesti B2B-verkkokaupan perustamisprosessi nykyaikaisin menetelmin ja uusimpien vaatimusten mukaisesti. Opinnäytetyön case-yrityksenä toimii Capcons Technology Oy, jonka verkko-kaupan perustamisprosessissa on tarkoitus soveltaa työssä käsiteltyjä asioita. Tavoitteena on, että yritys pystyy hyödyntämään opinnäytetyötä kattavasti verkko-kaupan perustamisen eri vaiheissa. Lisäksi tätä työtä voidaan hyödyntää myös muita B2B-verkkokauppoja perust...

[Space-time water monitoring system at the Iriklinsk hydroelectric power station].

Science.gov (United States)

Deriabin, D G; Poliakov, E G; Priakhina, A A; Karimov, I F

2002-01-01

The Microbiosensor B 17677 F test system was applied to make a space-time monitoring of the biotoxicity of water used for production and everyday purposes at the Iriklinsk hydroelectric power station (IHEPS) and to identify the leading causes determining the biotoxicity of tested samples. There were seasonal variations in the biotoxicity with the maximum in spring and with minimum in winter and spring and a relationship of the spring rise in the biotoxicity to water pH changes. There was also an association of the certain values of the biotoxicity of industrial water with the concentration of petroleum products that are major pollutants at the IHEPS. The datum points that characterize the maximum level of technogenic exposure were identified.

Mixed pinning landscape in nanoparticle-introduced YGdBa2Cu3Oy films grown by metal organic deposition

Science.gov (United States)

Miura, M.; Maiorov, B.; Baily, S. A.; Haberkorn, N.; Willis, J. O.; Marken, K.; Izumi, T.; Shiohara, Y.; Civale, L.

2011-05-01

We study the field (H) and temperature (T) dependence of the critical current density (Jc) and irreversibility field (Hirr) at different field orientations in Y0.77Gd0.23Ba2Cu3Oy with randomly distributed BaZrO3 nanoparticles (YGdBCO+BZO) and YBa2Cu3Oy (YBCO) films. Both MOD films have large RE2Cu2O5 (225) nanoparticles (˜80 nm in diameter) and a high density of twin boundaries (TB). In addition, YGdBCO+BZO films have a high density of BZO nanoparticles (˜25 nm in diameter). At high temperatures (T > 40 K), the superconducting properties, such as Jc, Hirr, and flux creep rates, are greatly affected by the BZO nanoparticles, while at low temperatures the superconducting properties of both the YBCO and YGdBCO+BZO films show similar field and temperature dependencies. In particular, while the Jc of YBCO films follow a power-law dependence (∝H-α) at all measured T, this dependence is only followed at low T for YGdBCO+BZO films. As a function of T, the YGdBCO+BZO film shows Jc(T,0.01T)~[1-(T/Tc)2]n with n ˜ 1.24 ± 0.05, which points to “δTc pinning.” We analyze the role of different types of defects in the different temperature regimes and find that the strong pinning of the BZO nanoparticles yields a higher Hirr and improved Jc along the c axis and at intermediate orientations at high T. The mixed pinning landscapes due to the presence of disorder of various dimensionalities have an important role in the improvement of in-field properties.

Site investigation equipment developed by Teollisuuden Voima Oy

International Nuclear Information System (INIS)

Oehberg, A.

1991-02-01

Teollisuuden Voima Oy (TVO) carries out site investigations in Finland for final disposal of nuclear high level waste during 1987-2000. In order to carry out the investigations some essential equipment have been designed and constructed. The biggest insufficiency among different measuring methods was among water sampling and hydraulic testing. There are some common specifications which all of these equipment has to fulfil. The two most important are that they have to be operatable in deep slim boreholes down to 1000 meters depth with 56 mm in diameter. The main purpose of the Hydraulic Testing Unit is to determine hydraulic conductivity in crystalline rock, where water can flow primarily through fractures. In most commonly used configurations, measurement range is from 10 - 11 to 10 - 5 m/s with constant-head method. Although constant-head method is principally used, almost any known hydraulic method is possible with existing hardware. Most functions are controlled by the computer. The whole system is built into an electrically heated trailer. The system consists of inflatable packers, stainless steel rods, pressure transducers and datalogging devices. The maximum number of monitoring sections is seven. In addition to that as many blind sections as is needed to prevent vertical flow in boreholes can be installed. Water sampling is possible either with a double packer method or in conjunction with the hydraulic head monitoring equipment. The first possibility involves using the laboratory trailer and the second one using a separate pumping unit plus the laboratory trailer in a later phase when sampling is to be conducted. In the laboratory trailer there are all the measuring devices needed to control different chemical parameters (pH, Eh, pS, O 2 , conductivity and temperature) during pumping

CRM-järjestelmän suunnittelu ja käyttöönotto myynnin strategiseksi työkaluksi : case: Stala Oy

OpenAIRE

Pirkkalainen, Markus

2013-01-01

Tämän opinnäytetyön aiheena on asiakkuudenhallinta- eli Customer Relationship Management(CRM)-järjestelmän suunnittelu ja käyttöönotto myynnin strategiseksi työkaluksi. Opinnäytetyön teoriaosuudessa tutkitaan asiakkuudenhallintaa, CRM-järjestelmiä ja CRM-järjestelmien suunnitteluun sekä käyttöönottoon liittyviä haasteita. Työn empiirinen osuus koostuu CRM-järjestelmän käyttöoppaasta kohdeyritys Stala Oy:n myyntitiimille. Tutkimusongelma vastaa kysymykseen, miksi yrityksen tulisi panostaa a...

Quasiparticle Scattering off Defects and Possible Bound States in Charge-Ordered YBa_{2}Cu_{3}O_{y}.

Science.gov (United States)

Zhou, R; Hirata, M; Wu, T; Vinograd, I; Mayaffre, H; Krämer, S; Horvatić, M; Berthier, C; Reyes, A P; Kuhns, P L; Liang, R; Hardy, W N; Bonn, D A; Julien, M-H

2017-01-06

We report the NMR observation of a skewed distribution of ^{17}O Knight shifts when a magnetic field quenches superconductivity and induces long-range charge-density-wave (CDW) order in YBa_{2}Cu_{3}O_{y}. This distribution is explained by an inhomogeneous pattern of the local density of states N(E_{F}) arising from quasiparticle scattering off, yet unidentified, defects in the CDW state. We argue that the effect is most likely related to the formation of quasiparticle bound states, as is known to occur, under specific circumstances, in some metals and superconductors (but not in the CDW state, in general, except for very few cases in 1D materials). These observations should provide insight into the microscopic nature of the CDW, especially regarding the reconstructed band structure and the sensitivity to disorder.

Spin-Glass Transition and Giant Paramagnetism in Heavily Hole-Doped Bi2Sr2Co2Oy

Science.gov (United States)

Hsu, Hung Chang; Lee, Wei-Li; Lin, Jiunn-Yuan; Young, Ben-Li; Kung, Hsiang-Hsi; Huang, Jian; Chou, Fang Cheng

2014-02-01

Hole-doped single crystals of misfit-layered cobaltate Bi2-xPbxSr2-zCo2Oy (x = 0-0.61, y = 8.28-8.62, and z = 0.01-0.22) have been successfully grown using the optical floating-zone method. Heavier hole doping has been achieved through both Pb substitution in the Bi site and the more effective Sr vacancy formation. The Co4+ : Co3+ ratio can be raised significantly from its original ˜1 : 1 to 4.5 : 1, as confirmed by iodometric titration. A spin-glass transition temperature of Tg ˜ 70 K is confirmed by ac susceptibility measurement when the Co4+ : Co3+ ratio becomes higher than 2 : 1, presumably owing to the significantly increased probability of triangular geometrical frustration among antiferromagnetically coupled localized Co4+ spins.

Characterization and biotoxicity assessment of dissolved organic matter in RO concentrate from a municipal wastewater reclamation reverse osmosis system.

Science.gov (United States)

Sun, Ying-Xue; Gao, Yue; Hu, Hong-Ying; Tang, Fang; Yang, Zhe

2014-12-01

Reverse osmosis (RO) concentrate from municipal wastewater reclamation reverse osmosis (mWRRO) system containing organic compounds may associate with toxic risk, and its discharge might pose an environmental risk. To identify a basis for the selection of feasible technology in treating RO concentrates, the characteristics and biotoxicity of different fractions of dissolved organic matter (DOM) in RO concentrates from an mWRRO system were investigated. The results indicated that the hydrophilic neutrals (HIN), hydrophobic acids (HOA) and hydrophobic bases (HOB) accounted for 96% of the dissolved organic carbon (DOC) of the total DOM in the RO concentrate. According to the SEC chromatograph detected at 254 nm wavelength of UV, the DOM with molecular weight (MW) 1-3 kDa accounted for the majority of the basic and neutral fractions. The fluorescence spectra of the excitation emission matrix (EEM) indicated that most aromatic proteins, humic/fulvic acid-like and soluble microbial by-product-like substances existed in the fractions HOA and hydrophobic neutrals (HON). The genotoxicity and anti-estrogenic activity of the RO concentrate were 1795.6 ± 57.2 μg 4-NQOL(-1) and 2.19 ± 0.05 mg TAM L(-1), respectively. The HIN, HOA, and HOB contributed to the genotoxicity of the RO concentrate, and the HIN was with the highest genotoxic level of 1007.9 ± 94.8 μg 4-NQOL(-1). The HOA, HON, and HIN lead to the total anti-estrogenic activity of the RO concentrate, and HOA occupied approximately 60% of the total, which was 1.3 ± 0.17 mg TAM L(-1). Copyright © 2014 Elsevier Ltd. All rights reserved.

Käyttäjäystävällisen SharePoint 2013 -ohjeen laatiminen : Case VisualWeb Group Oy

OpenAIRE

Pynttäri, Henna

2014-01-01

Tässä toimintakeskeisessä opinnäytetyössä suunniteltiin ja toteutettiin VisualWeb Group Oy :n asiakkaille käyttäjäystävällinen ohje SharePoint 2013 -alustan käyttöön. Manuaali on suunnattu peruskäyttäjille, ja se sisältää ohjeet sellaisista toiminnoista, joita käyttäjä tarvitsee aloittaessaan SharePoint-alustan päälle rakennetun sivustonsa päivittämisen. Päätavoitteena oli laatia käyttöohjeesta mahdollisimman selkeä ja yksinkertainen, koska se on suunnattu käyttäjäryhmälle, jolla on vähän tai...

Effects of Dăoyĭn Qìgōng in postpolio syndrome patients with cold intolerance

Directory of Open Access Journals (Sweden)

Paulo Eduardo Ramos

2012-09-01

Full Text Available Postpolio syndrome (PPS is characterized by progressive muscle weakness due to former infection with poliomyelitis and can be associated with other symptoms such as cold intolerance (CI. Dăoyĭn Qìgōng (DQ is a technique in Traditional Chinese Medicine that impacts the circulation of energy and blood. OBJECTIVE: It was to verify the effects of DQ in PPS patients complaining of cold intolerance. METHODS: Ten PPS patients were assessed using the visual analogue scale (VAS adapted for CI before and after intervention with DQ; patients practiced it in a sitting position for 40 minutes, 3 times per week over 3 consecutive months. Patients were reassessed three months after ceasing DQ. RESULTS: There was a statistically significant difference in local and systemic VAS-Cold both at the end of DQ training and three months past the end of this. CONCLUSION: The DQ technique ameliorated CI complaints in patients with PPS.

Uranium and radium activities in samples of aquifers of the main cities of the Estado de Chihuahua

International Nuclear Information System (INIS)

Villalba, L.; Colmenero S, L.; Montero C, M.E.

2003-01-01

The natural uranium is in four valence states +3, +4, +5 and +6 being the hexavalent state the more soluble, which plays an important role in the transport of the uranium in the environment. The high concentrations of uranium in water not only in near waters to uranium mines, but also are in some mineral waters or in waters that are extracted of deep wells as it happens in the State of Chihuahua, where the underground waters are the fundamental source of consumption. The radium is a disintegration product of the uranium, the radio content in water is considered the second source of natural radioactivity. The distribution of radium in water is in function of the uranium content present in the aquifer. It was determined the uranium and radium content in samples of underground water of the main cities of the State of Chihuahua according to their number of inhabitants. The extraction methods for uranium and sulfates precipitation of Ba-Ra by means of the addition of barium carriers for the radium were used. The measures of the activities of uranium and radium were carried out by means of a portable liquid scintillation detector trade mark Thiathler-OY HIDEX. The obtained results have demonstrated that the content of uranium and radium in dissolution are in most of the sampling wells above the permissible maximum levels that manage the Mexican regulations. The high contents of uranium and radio can be attributed since to the influence of the geologic substrate characteristic of the zone in the State of Chihuahua they exist but of 50 uranium deposits. (Author)

Uranium and radium activities in samples of aquifers of the main cities of the Estado de Chihuahua; Actividades de uranio y radio en muestras de agua subterranea de las principales ciudades del Estado de Chihuahua

Energy Technology Data Exchange (ETDEWEB)

Villalba, L.; Colmenero S, L.; Montero C, M.E. [CIMAV, Av. Miguel de Cervantes Saavedra 120, 31109 Chihuahua (Mexico)]. e-mail: lourdes.villalba@cimav.edu.mx

2003-07-01

The natural uranium is in four valence states +3, +4, +5 and +6 being the hexavalent state the more soluble, which plays an important role in the transport of the uranium in the environment. The high concentrations of uranium in water not only in near waters to uranium mines, but also are in some mineral waters or in waters that are extracted of deep wells as it happens in the State of Chihuahua, where the underground waters are the fundamental source of consumption. The radium is a disintegration product of the uranium, the radio content in water is considered the second source of natural radioactivity. The distribution of radium in water is in function of the uranium content present in the aquifer. It was determined the uranium and radium content in samples of underground water of the main cities of the State of Chihuahua according to their number of inhabitants. The extraction methods for uranium and sulfates precipitation of Ba-Ra by means of the addition of barium carriers for the radium were used. The measures of the activities of uranium and radium were carried out by means of a portable liquid scintillation detector trade mark Thiathler-OY HIDEX. The obtained results have demonstrated that the content of uranium and radium in dissolution are in most of the sampling wells above the permissible maximum levels that manage the Mexican regulations. The high contents of uranium and radio can be attributed since to the influence of the geologic substrate characteristic of the zone in the State of Chihuahua they exist but of 50 uranium deposits. (Author)

Tek Millet, Tek Ses? Türk Konseyi Ülkelerinin Birleşmiş Milletler Genel Kurulu Oy Yakınlaşması, 1993-2011

OpenAIRE

Kaplan, Muhittin; Yuvacı, Abdullah; Amanov, Shatlyk

2015-01-01

Bu makale, CCTS veya Türk Konseyi olarak bilinen Türk Dili Konuşan Ülkeler İşbirliği Konseyi üyelerinin (Azerbaycan, Kazakistan, Kırgızistan ve Türkiye) Birleşmiş Milletler Genel Kurulundaki (UNGA) oylamalarda ne ölçüde uyumlu hareket ettiklerini incelemektedir. 1993 – 2011 dönemi Türk Konseyi ülkelerinin Birleşmiş Milletler Genel Kurulu oy yakınlaşması- nın analiz edildiği ve bunun tüm BM üyelerinin ortalamasıyla kıyaslandığı bu makalede, Türk Konseyi ülkelerinin dış politika meseleleriyle i...

Structure and Electrical Properties of NdBa2Cu3Oy Thin Films by Laser Ablation at Low Oxygen Partial Pressure

DEFF Research Database (Denmark)

Mozhaev, Peter B.; Mozhaeva, Julia; Khoryushin, Alexey

2017-01-01

in the film can be suppressed by an increase of the deposition temperature or by a decrease of the oxygen partial pressure during deposition. The presence of Nd/Ba disorder during deposition stimulates the introduction of oxygen into the growing film. A simple model is proposed for estimation of oxygen......A deposition process for NdBa2Cu3Oy thin films by laser ablation at decreased deposition temperature was developed using substitution of oxygen with argon in the chamber during deposition. A low deposition rate is the crucial factor to obtain high-quality NBCO films. The Nd/Ba cation disorder...... contents in the film using structural parameters measured with XRD techniques. Studies of the post-deposition annealing process showed ordering of the Nd/Ba sub-lattice and intense oxygen in- and out-diffusion. The temperature of the post-deposition annealing step should be chosen low enough (∼400 °C...

LASER APPLICATIONS AND OTHER TOPICS IN QUANTUM ELECTRONICS: Synthesis of bulk SiO2 : MxOy materials in a steady-state laser plume

Science.gov (United States)

Lebedev, V. F.

1997-01-01

An analysis was made of the conditions of existence of a two-component steady-state laser plume in atmospheric air. Such a plume is used in single-stage synthesis of bulk molten materials belonging to the SiO2 : MxOy system. Targets of the SiO2 : M type (metal foil and a silica glass rod) and doping elements with boiling points below and above the boiling point of silica glass are discussed. The regimes and efficiency of steady-state transfer of the dopants are considered. The efficiency of transfer of metal oxides during growth of samples with the aid of a cw CO2 laser is reported to be ~0.05, 0.4, and 0.75g min-1 kW-1 when the mass dopant concentration is ~8%, 20%, and 60% for the oxides of Ti, Cu, and Ni, respectively.

Cost effectiveness of pomalidomide in patients with relapsed and refractory multiple myeloma in Sweden.

Science.gov (United States)

Borg, Sixten; Nahi, Hareth; Hansson, Markus; Lee, Dawn; Elvidge, Jamie; Persson, Ulf

2016-05-01

Multiple myeloma (MM) patients who have progressed following treatment with both bortezomib and lenalidomide have a poor prognosis. In this late stage, other effective alternatives are limited, and patients in Sweden are often left with best supportive care. Pomalidomide is a new anti-angiogenic and immunomodulatory drug for the treatment of MM. Our objective was to evaluate the cost effectiveness of pomalidomide as an add-on to best supportive care in patients with relapsed and refractory MM in Sweden. We developed a health-economic discrete event simulation model of a patient's course through stable disease and progressive disease, until death. It estimates life expectancy, quality-adjusted life years (QALYs) and costs from a societal perspective. Effectiveness data and utilities were taken from the MM-003 trial comparing pomalidomide plus low-dose dexamethasone with high-dose dexamethasone (HIDEX). Cost data were taken from official Swedish price lists, government sources and literature. The model estimates that, if a patient is treated with HIDEX, life expectancy is 1.12 years and the total cost is SEK 179 976 (€19 100), mainly indirect costs. With pomalidomide plus low-dose dexamethasone, life expectancy is 2.33 years, with a total cost of SEK 767 064 (€81 500), mainly in drug and indirect costs. Compared to HIDEX, pomalidomide treatment gives a QALY gain of 0.7351 and an incremental cost of SEK 587 088 (€62 400) consisting of increased drug costs (59%), incremental indirect costs (33%) and other healthcare costs (8%). The incremental cost-effectiveness ratio is SEK 798 613 (€84 900) per QALY gained. In a model of late-stage MM patients with a poor prognosis in the Swedish setting, pomalidomide is associated with a relatively high incremental cost per QALY gained. This model was accepted by the national Swedish reimbursement authority TLV, and pomalidomide was granted reimbursement in Sweden.

Synthesized TiO{sub 2}/ZSM-5 composites used for the photocatalytic degradation of azo dye: Intermediates, reaction pathway, mechanism and bio-toxicity

Energy Technology Data Exchange (ETDEWEB)

Zhou, Kefu; Hu, Xin-Yan [College of the Environment and Ecology, Xiamen University, Xiamen (China); Chen, Bor-Yann; Hsueh, Chung-Chuan [Department of Chemical and Materials Engineering, National I-Lan University, I-Lan, Taiwan (China); Zhang, Qian [Department of Environmental Engineering, National Taiwan University, Taipei, Taiwan (China); Wang, Jiajie; Lin, Yu-Jung [College of the Environment and Ecology, Xiamen University, Xiamen (China); Chang, Chang-Tang, E-mail: ctchang73222@gmail.com [Department of Environmental Engineering, National I-Lan University, I-Lan, Taiwan (China)

2016-10-15

Highlights: • The major photo-catalytic degradation pathway of azo-dye was elaborated according to the identification of by-products from GC–MS and IC analysis. • Comparative assessment on characteristics of abiotic and biotic dye decolorization was analyzed. • EDTA (hole scavengers) and t-BuOH (radical scavengers) were used to determine the main active oxidative species in the system. • The toxicity effects of degradation intermediates of Reactive Black 5 (RB5) on the cellular respiratory activity were assessed. - Abstract: In this study, a one-step solid dispersion method was used to synthesize titanium dioxide (TiO{sub 2})/Zeolite Socony Mobil-5 (ZSM-5) composites with substantially reduced time and energy consumption. A degradation efficiency of more than 95% was achieved within 10 min using 50% PTZ (synthesized TiO{sub 2}/ZSM-5 composites with TiO{sub 2} contents of 50 wt% loaded on ZSM-5) at pH 7 and 25 °C. The possible degradation pathway of azo-dye Reactive Black 5 (RB5) was investigated using gas chromatography–mass spectrometry and ion chromatography (IC). The bonds between the N atoms and naphthalene groups are likely attacked first and cleaved by hydroxyl radicals, ultimately resulting in the decolorization and mineralization of the azo dye. A comparative assessment of the characteristics of abiotic and biotic dye decolorization was completed. In addition, the toxicity effects of the degradation intermediates of azo-dye RB5 on cellular respiratory activity were analyzed. The bio-toxicity results showed that the decay rate constants of CO{sub 2} production from the azo-dye RB5 samples at different degradation times increased initially and subsequently decreased, indicating that intermediates of higher toxicity could adhere to the catalyst surface and gradually destroyed by further photocatalytic oxidation. Additionally, EDTA (hole scavengers) and t-BuOH (radical scavengers) were used to detect the main active oxidative species in the system

Part II: Oxidative Thermal Aging of Pd/Al2O3 and Pd/CexOy-ZrO2 in Automotive Three Way Catalysts: The Effects of Fuel Shutoff and Attempted Fuel Rich Regeneration

Directory of Open Access Journals (Sweden)

Qinghe Zheng

2015-10-01

Full Text Available The Pd component in the automotive three way catalyst (TWC experiences deactivation during fuel shutoff, a process employed by automobile companies for enhancing fuel economy when the vehicle is coasting downhill. The process exposes the TWC to a severe oxidative aging environment with the flow of hot (800 °C–1050 °C air. Simulated fuel shutoff aging at 1050 °C leads to Pd metal sintering, the main cause of irreversible deactivation of 3% Pd/Al2O3 and 3% Pd/CexOy-ZrO2 (CZO as model catalysts. The effect on the Rh component was presented in our companion paper Part I. Moderate support sintering and Pd-CexOy interactions were also experienced upon aging, but had a minimal effect on the catalyst activity losses. Cooling in air, following aging, was not able to reverse the metallic Pd sintering by re-dispersing to PdO. Unlike the aged Rh-TWCs (Part I, reduction via in situ steam reforming (SR of exhaust HCs was not effective in reversing the deactivation of aged Pd/Al2O3, but did show a slight recovery of the Pd activity when CZO was the carrier. The Pd+/Pd0 and Ce3+/Ce4+ couples in Pd/CZO are reported to promote the catalytic SR by improving the redox efficiency during the regeneration, while no such promoting effect was observed for Pd/Al2O3. A suggestion is made for improving the catalyst performance.

Cadmium free high efficiency Cu2ZnSn(S,Se4 solar cell with Zn1−xSnxOy buffer layer

Directory of Open Access Journals (Sweden)

Md. Asaduzzaman

2017-06-01

Full Text Available We have investigated the simulation approach of a one-dimensional online simulator named A Device Emulation Program and Tool (ADEPT2.1 and the device performances of a thin film solar cell based on Cu2ZnSn(S,Se4 (CZTSSe absorber have been measured. Initiating with a thin film photovoltaic device structure consisting of n-ZnO:Al/i-ZnO/Zn1-xSnxOy (ZTO/CZTSSe/Mo/SLG stack, a graded space charge region (SCR and an inverted surface layer (ISL were inserted between the buffer and the absorber. The cadmium (Cd free ZTO buffer, a competitive substitute to the CdS buffer, significantly contributes to improve the open-circuit voltage, Voc without deteriorating the short-circuit current density, Jsc. The optimized solar cell performance parameters including Voc, Jsc, fill factor (FF, and efficiency (η were calculated from the current density-voltage curve, also known as J–V characteristic curve. The FF was determined as 73.17%, which in turns, yields a higher energy conversion efficiency of 14.09%.

Ethylbenzene dehydrogenation over binary FeOx–MeOy/Mg(Al)O catalysts derived from hydrotalcites

KAUST Repository

Balasamy, Rabindran J.; Khurshid, Alam; Al-Ali, Ali A S; Atanda, Luqman A.; Sagata, Kunimasa; Asamoto, Makiko; Yahiro, Hidenori; Nomura, Kiyoshi; Sano, Tsuneji; Takehira, Katsuomi; Al-Khattaf, Sulaiman S.

2010-01-01

A series of FeOx-MeOy/Mg(Al)O catalysts were prepared from hydrotalcite-like compounds as precursors and were tested in the ethylbenzene dehydrogenation to styrene in He atmosphere at 550 °C. The hydrotalcite-like precursors of the metal compositions of Mg3Fe 0.25Me0.25Al0.5 (Me = Cu, Zn, Cr, Mn, Fe, Co and Ni) were coprecipitated from the nitrates of metal components and calcined to mixed oxides at 550 °C. After the calcination, the mixed oxides showed high surface area of 150-200 m2 gcat -1, and were mainly composed of (MgMe)(Fe3+Al)O periclase in the bulk, whereas the surface was enriched by (MgMe)(Fe3+Al)2O 4 pinel. Among the Me species tested, Co2+ was the most effective, followed by Ni2+. Co2+ addition increased the activity of original FeOx/Mg(Al)O catalyst, whereas Ni2+ increased the activity at the beginning of reaction, but deactivated the catalyst during the reaction. The other metals formed isolated MeOx species in the catalyst, resulting in a decrease in the activity compared to the original FeOx/Mg(Al)O catalyst. The active Fe species exists as metastable Fe3+ on the FeOx/Mg(Al)O catalyst. By the addition of Co2+, the reduction-oxidation between Fe3+ and Fe2+ was facilitated and, moreover, the active Fe3+ species was stabilized. It is likely that the dehydrogenation proceeds on the active Fe3+ species via its reduction-oxidation assisted by Co 2+. © 2010 Elsevier B.V.

Ethylbenzene dehydrogenation over binary FeOx–MeOy/Mg(Al)O catalysts derived from hydrotalcites

KAUST Repository

Balasamy, Rabindran J.

2010-12-20

A series of FeOx-MeOy/Mg(Al)O catalysts were prepared from hydrotalcite-like compounds as precursors and were tested in the ethylbenzene dehydrogenation to styrene in He atmosphere at 550 °C. The hydrotalcite-like precursors of the metal compositions of Mg3Fe 0.25Me0.25Al0.5 (Me = Cu, Zn, Cr, Mn, Fe, Co and Ni) were coprecipitated from the nitrates of metal components and calcined to mixed oxides at 550 °C. After the calcination, the mixed oxides showed high surface area of 150-200 m2 gcat -1, and were mainly composed of (MgMe)(Fe3+Al)O periclase in the bulk, whereas the surface was enriched by (MgMe)(Fe3+Al)2O 4 pinel. Among the Me species tested, Co2+ was the most effective, followed by Ni2+. Co2+ addition increased the activity of original FeOx/Mg(Al)O catalyst, whereas Ni2+ increased the activity at the beginning of reaction, but deactivated the catalyst during the reaction. The other metals formed isolated MeOx species in the catalyst, resulting in a decrease in the activity compared to the original FeOx/Mg(Al)O catalyst. The active Fe species exists as metastable Fe3+ on the FeOx/Mg(Al)O catalyst. By the addition of Co2+, the reduction-oxidation between Fe3+ and Fe2+ was facilitated and, moreover, the active Fe3+ species was stabilized. It is likely that the dehydrogenation proceeds on the active Fe3+ species via its reduction-oxidation assisted by Co 2+. © 2010 Elsevier B.V.

Slow positrons in single-crystal samples of Al and Al-AlxOy

Science.gov (United States)

Lynn, K. G.; Lutz, H.

1980-11-01

Well-characterized Al(111) and Al(100) samples were studied with monoenergetic positrons before and after exposure to oxygen. Both positronium-formation and positron-emission curves were obtained for various incident positron energies at sample temperatures ranging from 160-900 K. The orthopositronium decay signal provides a unique signature that the positron has emerged from the surface region of a clean metal. In the clean Al crystals part of the positronium formed near the surface is found to be associated with a temperature-activated process described as the thermally activated detrapping of a positron from a surface state. A simple positron diffusion model, including surface and vacancy trapping, is fitted to the positronium data and an estimate of the binding energy of the positron in this trap is made. The positron diffusion constant is found to have a negative temperature dependence before the onset of positron trapping at thermally generated monovacancies (>500 K), in reasonable agreement with theoretical predictions. The depth of the positron surface state is reduced or positronium is formed in the chemisorbed layer as oxygen is adsorbed on both Al sample surfaces, thus increasing the positronium fraction and decreasing the positron emission. At higher oxygen exposures [>500 L (1 L = 10-6 torr sec)] positron or positronium traps are generated in the overlayer and the positronium fraction is reduced. The amorphous-to-crystalline surface transition of AlxOy on Al is observed between 650 and 800 K by the change in the positronium fraction and is interpreted as the removal of trapping centers in the metal-oxide overlayer. At the higher temperatures and incident energies vacancy trapping is observed by the decrease in the positron diffusion length in both the clean and the underlying Al of the oxygen-exposed samples. Similar vacancy formation enthalpies for Al are extracted in both the clean and oxygen-covered samples by a simple model and are in good

Review of the GPS deformation monitoring studies commissioned by Posiva Oy on the Olkiluoto, Kivetty and Romuvaara sites, 1994-2000

International Nuclear Information System (INIS)

Vermeer, M.

2002-05-01

This report reviews the work done by scientists from the Finnish Geodetic Institute at the three sites Olkiluoto, Kivetty and Romuvaara over the years 1994-2000, with a view to detecting and measuring possible local crustal movements by means of geodetic GPS. The work, which consisted of measurements, computations and analysis, was reported in seven technical reports of Posiva Oy. Reviewed was also the work related to the three permanent stations established in these three sites, which have operated as part of the twelve-station national FinnRef network. The conclusion was that on the whole, the work has been performed professionally using state of the art equipment, measurement and analysis techniques by competent and experienced personnel. A number of suggestions for improvement and future work are given, mainly concerning the way the modelling of atmospheric propagation effects was done and how that affects the scale of the network computation, a proposal for monitoring the absolute scale, as well as remarks concerning the regular re-measurement of reserve marker ties, and the importance of continuing monitoring for a full solar activity cycle. The importance of interdisciplinarity is stressed. This review report is an outcome of the Bedrock Movements Investigations Group which supports STUKs regulatory activities related to confirming site investigations at Olkiluoto. (orig.)

Decorative black TiCxOy film fabricated by DC magnetron sputtering without importing oxygen reactive gas

Science.gov (United States)

Ono, Katsushi; Wakabayashi, Masao; Tsukakoshi, Yukio; Abe, Yoshiyuki

2016-02-01

Decorative black TiCxOy films were fabricated by dc (direct current) magnetron sputtering without importing the oxygen reactive gas into the sputtering chamber. Using a ceramic target of titanium oxycarbide (TiC1.59O0.31), the oxygen content in the films could be easily controlled by adjustment of total sputtering gas pressure without remarkable change of the carbon content. The films deposited at 2.0 and 4.0 Pa, those are higher pressure when compared with that in conventional magnetron sputtering, showed an attractive black color. In particular, the film at 4.0 Pa had the composition of TiC1.03O1.10, exhibited the L* of 41.5, a* of 0.2 and b* of 0.6 in CIELAB color space. These values were smaller than those in the TiC0.29O1.38 films (L* of 45.8, a* of 1.2 and b* of 1.2) fabricated by conventional reactive sputtering method from the same target under the conditions of gas pressure of 0.3 Pa and optimized oxygen reactive gas concentration of 2.5 vol.% in sputtering gas. Analysis of XRD and XPS revealed that the black film deposited at 4.0 Pa was the amorphous film composed of TiC, TiO and C. The adhesion property and the heat resisting property were enough for decorative uses. This sputtering process has an industrial advantage that the decorative black coating with color uniformity in large area can be easily obtained by plain operation because of unnecessary of the oxygen reactive gas importing which is difficult to be controlled uniformly in the sputtering chamber.

Anisotropy of the Seebeck Coefficient in the Cuprate Superconductor YBa_{2}Cu_{3}O_{y}: Fermi-Surface Reconstruction by Bidirectional Charge Order

Directory of Open Access Journals (Sweden)

O. Cyr-Choinière

2017-09-01

Full Text Available The Seebeck coefficient S of the cuprate YBa_{2}Cu_{3}O_{y} is measured in magnetic fields large enough to suppress superconductivity, at hole dopings p=0.11 and p=0.12, for heat currents along the a and b directions of the orthorhombic crystal structure. For both directions, S/T decreases and becomes negative at low temperature, a signature that the Fermi surface undergoes a reconstruction due to broken translational symmetry. Above a clear threshold field, a strong new feature appears in S_{b}, for conduction along the b axis only. We attribute this feature to the onset of 3D-coherent unidirectional charge-density-wave modulations seen by x-ray diffraction, also along the b axis only. Because these modulations have a sharp onset temperature well below the temperature where S/T starts to drop towards negative values, we infer that they are not the cause of Fermi-surface reconstruction. Instead, the reconstruction must be caused by the quasi-2D bidirectional modulations that develop at significantly higher temperature. The unidirectional order only confers an additional anisotropy to the already reconstructed Fermi surface, also manifest as an in-plane anisotropy of the resistivity.

Manufacture of wood-pellets doubles. Biowatti Oy started a wood pellet plant in Turenki

International Nuclear Information System (INIS)

Rantanen, M.

1999-01-01

Wood pellets have many advantages compared to other fuels. It is longest processed biofuel with favorable energy content. It is simple to use, transport and store. Heating with wood pellets is cheaper than with light fuel oil, and approximately as cheap as utilization of heavy fuel oil, about 110 FIM/MWh. The taxable price of wood pellets is about 550 FIM/t. Stokers and American iron stoves are equally suitable for combustion of wood pellets. Chip fueled stokers are preferred in Finland, but they are also suitable for the combustion of wood pellets. Wood pellets is an environmentally friendly product, because it does not increase the CO 2 load in the atmosphere, and its sulfur and soot emissions are relatively small. The wood pelletizing plant of Biowatti Oy in Turenki was started in an old sugar mill. The Turenki sugar mill was chosen because the technology of the closed sugar factory was suitable for production of wood pellets nearly as such, and required only by slight modifications. A press, designed for briquetting of sugar beat clippings makes the pellets. The Turenki mill will double the volume of wood pellet manufacture in Finland during the next few years. At the start the annual wood pellet production will be 20 000 tons, but the environmental permit allows the production to be increased to 70 000 tons. At first the mill uses planing machine chips as a raw material in the production. It is the most suitable raw material, because it is already dry (moisture content 8-10%), and all it needs is milling and pelletizing. Another possible raw material is sawdust, which moisture content is higher than with planing machine chips. Most of the wood pellets produced are exported e.g. to Sweden, Denmark and Middle Europe. In Sweden there are over 10 000 single-family houses using wood pellets. Biowatti's largest customer is a power plant located in Stockholm, which combusts annually about 200 000 tons of wood pellets

B2B-verkkokaupan markkinointiviestintäsuunnitelma

OpenAIRE

Luoma, Hanna

2015-01-01

Opinnäytetyön aiheena oli luoda markkinointiviestintäsuunnitelma Yritys Oy:n kehitteillä olevalle verkkokaupalle. Työn tavoitteena oli markkinointiviestintäsuunnitelman avulla selvittää miten Yritys Oy:n B2B-verkkokauppa saadaan osaksi myyntitoimia ja miten se mahdollisimman tehokkaasti tuodaan asiakkaiden tietoisuuteen. Yritys Oy on vuonna 2003 perustettu perheyritys, jonka toiminta on kiinnitystekniikan tukkumyynti alan ammattilaisille. Yritys Oy:llä on useampi toimipiste ympäri Suomea...

Rapid method for determining Sr-89 and Sr-90 using Cherenkov and proportional counting; Schnellmethode zur Bestimmung von SR-89 und SR-90 durch Cerenkov- und Proportionalzaehlermessungen

Energy Technology Data Exchange (ETDEWEB)

Lange, S.; Wende, C.; Schwokowski, R.; Alisch-Mark, M.; Abraham, A.; Heinrich, T. [Staatliche Betriebsgesellschaft fuer Umwelt und Landwirtschaft, Radebeul (Germany)

2016-07-01

A rapid method for determining Sr-89 and Sr-90 in water, milk and biological samples has been developed and tested. After sample preparation strontium is separated by extraction chromatography using Sr resin. Eluate is divided and transfered to LSC vial and filter paper by SrCO{sub 3} precipitation. A Hidex 300 SL TDCR liquid scintillation counter and Thermo Fisher low level proportional counter have been used. Chemical yield of Sr-85 tracer is determined by Gamma spectroscopy. Uncertainty budget, decision threshold and detection limit are calculated in accordance with GUM and ISO 11929.

Studies of nitride- and oxide-based materials as absorptive shifters for embedded attenuated phase-shifting mask in 193 nm

Science.gov (United States)

Lin, Cheng-ming; Chang, Keh-wen; Lee, Ming-der; Loong, Wen-An

1999-07-01

Abstract-Five materials which are PdSixOy, CrAlxOy, SiNx, TiSixNy, and TiSixOyNz as absorptive shifters for attenuated phase-shifting mask in 193 nm wavelength lithography are presented. PdSixOy films were deposited by dual e-gun evaporation. CrAlxOy, TiSixNy and TiSixOyNz films were formed by plasma sputtering and SiNx films were formed with LPCVD. All of these materials are shown to be capable of achieving 4 percent - 15 percent transmittance in 193 nm with thickness that produce a 180 degrees phase shift. Under BCl3:Cl2 equals 14:70 sccm; chamber pressure 5 mtorr and RF power 1900W, the dry etching selectivity of TiSixNy over DQN positive resist and fused silica, were found to be 2:1 and 4,8:1 respectively. An embedded layer TiSixNy with 0.5 micrometers line/space was successfully patterned.

Heterogeneic dynamics of the structures of multiple gene clusters in two pathogenetically different lines originating from the same phytoplasma.

Science.gov (United States)

Arashida, Ryo; Kakizawa, Shigeyuki; Hoshi, Ayaka; Ishii, Yoshiko; Jung, Hee-Young; Kagiwada, Satoshi; Yamaji, Yasuyuki; Oshima, Kenro; Namba, Shigetou

2008-04-01

Phytoplasmas are phloem-limited plant pathogens that are transmitted by insect vectors and are associated with diseases in hundreds of plant species. Despite their small sizes, phytoplasma genomes have repeat-rich sequences, which are due to several genes that are encoded as multiple copies. These multiple genes exist in a gene cluster, the potential mobile unit (PMU). PMUs are present at several distinct regions in the phytoplasma genome. The multicopy genes encoded by PMUs (herein named mobile unit genes [MUGs]) and similar genes elsewhere in the genome (herein named fundamental genes [FUGs]) are likely to have the same function based on their annotations. In this manuscript we show evidence that MUGs and FUGs do not cluster together within the same clade. Each MUG is in a cluster with a short branch length, suggesting that MUGs are recently diverged paralogs, whereas the origin of FUGs is different from that of MUGs. We also compared the genome structures around the lplA gene in two derivative lines of the 'Candidatus Phytoplasma asteris' OY strain, the severe-symptom line W (OY-W) and the mild-symptom line M (OY-M). The gene organizations of the nucleotide sequences upstream of the lplA genes of OY-W and OY-M were dramatically different. The tra5 insertion sequence, an element of PMUs, was found only in this region in OY-W. These results suggest that transposition of entire PMUs and PMU sections has occurred frequently in the OY phytoplasma genome. The difference in the pathogenicities of OY-W and OY-M might be caused by the duplication and transposition of PMUs, followed by genome rearrangement.

Structure and charge transfer correlated with oxygen content for a Y0.8Ca0.2Ba2Cu3Oy (y = 6.84 6.32) system: a positron study

Science.gov (United States)

Cao, Shixun; Li, Lingwei; Liu, Fen; Li, Wenfeng; Chi, Changyun; Jing, Chao; Zhang, Jincang

2005-05-01

The structure and charge transfer correlated with oxygen content are studied by measuring the positron lifetime parameters of the Y0.8Ca0.2Ba2Cu3Oy system with a large range of oxygen content (y = 6.84-6.32). The local electron density ne is evaluated from the positron lifetime data. The positron lifetime parameters show a clear change around y = 6.50 where the compounds undergo the orthorhombic-tetragonal phase transition. The effect of ne and oxygen content on the structure, charge transfer and superconductivity are discussed. With the decrease of oxygen content y, O(4) tends to the Cu(1) site, causing carrier localization, and accordingly, the decrease of ne. This would prove that the localized carriers (electrons and holes) in the Cu-O chain region have great influence on the superconductivity by affecting the charge transfer between the reservoir layers and the conducting layers. The positron annihilation mechanism and its relation with superconductivity are also discussed.

Microbial diversity and ecotoxicity of sediments 3 years after the Jiaozhou Bay oil spill.

Science.gov (United States)

Gao, Wei; Yin, Xiaofei; Mi, Tiezhu; Zhang, Yiran; Lin, Faxiang; Han, Bin; Zhao, Xilong; Luan, Xiao; Cui, Zhisong; Zheng, Li

2018-05-09

In 2013, the "Qingdao oil pipeline explosion" released an estimated 2000 tons of oil into the environment. Sediment samples were collected from ten sites in Jiaozhou Bay and Shilaoren Beach to evaluate the influence of the spilled oil on the benthic environment 3 years after the oil spill accident. The compositions of oil, bacterial diversity and biotoxicity were examined in this study. The results showed that the concentration of total petroleum hydrocarbons (TPHs) peaked near the oil leak point and gradually decreased along the coastline, ranging from 21.5 to 133.2 μg/g. The distribution of polycyclic aromatic hydrocarbons (PAHs) was correlated with TPH, and naphthalenes were dominant in the 20 detected PAHs. The bacterial diversities in seriously polluted and slightly polluted sediments were completely different. As degrading bacteria, Alcanivorax and Lutibacter were the main genera at the oil-polluted sites. The analysis of biotoxicity by the luminescent bacteria method showed great differences among the polluted sites, the control site in Jiaozhou Bay, and the non-polluted site outside of Jiaozhou Bay. The biotoxicity also peaked at the site near the oil leak point. These results indicate that the oil spill that occurred 3 years ago still affects the environment and impacts the bacterial communities in the sediments.

75 FR 49447 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Snapper-Grouper Fishery off the...

Science.gov (United States)

2010-08-13

... vessels. Depending on the physical structure of a fish's mouth and the way that they take bait, the circle... until modified. OY at equilibrium would be 2,425,000 lb (1,099,961 kg) whole weight. The proposed action... set F OY at a level equivalent to 85 percent F 40%SPR such that OY at equilibrium equals 2,196,000 lb...

Rock stress measurements. Preparatory stage of the equipment development project

International Nuclear Information System (INIS)

Mononen, S.; Hakala, M.; Mikkola, P.

2002-01-01

In recent years the rock stress measurement methods used in Finland have been overcoring and hydraulic fracturing. There have been mainly two companies involved in these measurements, namely Suomen Malmi Oy (Smoy) and SwedPower AB. Smoy has done measurements for mines and for rock engineering projects, whereas SwedPower AB has mainly been involved in nuclear waste disposal investigations and conducted hydraulic fracturing measurements in deep boreholes. Smoy together with its partners started in February 2001 a project named JTM, which was a preliminary stage for a future project, which aims to develop a device most suitable for rock stress measurements in Finland. The partners in the project were HUT Rock Engineering, Posiva Oy, Saanio and Riekkola Oy, Gridpoint Finland Oy and Geopros Oy. Tekes, the National Technology Agency, provided almost half of the project funding. In the management group of the project were Pekka Mikkola (chairman) and Tero Laurila from Smoy, Pekka Saerkkae and Sakari Mononen (full-time researcher) from HUT, Aimo Hautojaervi (Posiva Oy), Erik Johansson (Saanio and Riekkola Oy), Matti Hakala (Gridpoint Finland Oy) and Heikki Haemaelaeinen (Geopros Oy). The aim of the JTM-project was to find out the needs for the development of a device most suitable for rock stress measurements in Finnish mines and rock engineering projects. During the project work was done to find out the range of rock stress measurement devices available, to find out the needs for measurements, and to get acquainted to the measurements done in Scandinavia. Also a report of the most suitable methods for Finnish rock conditions was done based on literature and on interviews of rock stress experts. Based on all the information collected during the project a clear picture of the needs for rock stress measurements in Finland could be formed and a preliminary plan of a future project was done. The aim of the suggested project is to build a device based on hydraulic fracturing

Pretreatment and preheating of scrap; Tarkastelu koskien romun esikaesittely- ja esikuumennusmenetelmiae

Energy Technology Data Exchange (ETDEWEB)

Hooli, P.; Hanni, J. [Outokumpu Oy Tornion Tehtaat, Tornio (Finland)

1990-12-31

As a background for this study has been those demands for scrap treatments and transportation, which are coming with increasing production of melting shop of Outokumpu Oy`s Tornio works and also problems caused by snow among productionrate. Different pretreatment-, transport-, and preheatingmethods and some alternatives has been studied to arrange those as a functioning complete. Also very exact plannings for some pretreatmentmethods has been made. From preheatingmethods some methods, which are concerned to be effective and possible in the future has been studied. In addition those parameters, which are involved to the effectivity of preheating process in melting shop of Outokumpu Oy`s Tornio works has been examined.

A COMPARISON OF McC OY LARYNGOSCOPE AND MCGRATH VIDEO LARYNGOSCOPES FOR TRACHEAL INTUBATION IN PATIENTS WITH IMMOBILIZED CERVICAL SPINE

Directory of Open Access Journals (Sweden)

Annapurna Sarma

2015-08-01

Full Text Available INTRODUCTION : Expert airway management is the most essential requirement of an anesthesiologist . Difficult and failed intubation is the leading causes of anesthetic related morbidity and mortality. AIM OF STUDY: The purpose of this study was to compare the effectiveness of McCoy laryngoscope and McGrath video laryngoscope in tracheal intubation in patients using Manual in - line stabilization (MILS for cervical spine injury. MATERIALS AND METHODS : This study was condu cted in King George Hospital , Visakhapatnam, Andhra Pradesh on 60 patients aged 20 – 70, of American Society of Anesthesiologists physical status I – III, posted for elective surgery for cervical spine injury under general anesthesia. The patients were assigne d to two groups. One group was named as MC where McCoy laryngoscope was used, other group named as MG, where McGrath video laryngoscope was used for laryngoscopy during tracheal intubation . Two groups were compared on the basis of demogr aphic data, airway examination, comparison of visualization of vocal cords with McC oy laryngoscope and video laryngoscope and comparison of laryngoscope time. RESULTS: There was no significant difference between male and female sex. Most of the patients falls into Mallampati score I (60%, followed by score II and III (25 and 14% respectively. Statistically highly significant improvement in laryngoscope view was noted with video laryngoscope than with McCoy laryngoscope with Chi - square value=49.52; DF= 10; p - value=0.000(highl y significant. Statistically highly significant difference was seen in effective laryngoscopy time of McCoy and Video laryngoscope. CONCLUSION: We conclude McGrath video laryngoscope is superior to McCoy laryngoscope in terms of providing better intubatin g conditions in patients requiring MILS, though there is a little prolongation of effective laryngoscope time .

Characterization of Nα-Fmoc-protected dipeptide isomers by electrospray ionization tandem mass spectrometry (ESI-MS(n)): effect of protecting group on fragmentation of dipeptides.

Science.gov (United States)

Ramesh, M; Raju, B; Srinivas, R; Sureshbabu, V V; Vishwanatha, T M; Hemantha, H P

2011-07-30

A series of positional isomeric pairs of Fmoc-protected dipeptides, Fmoc-Gly-Xxx-OY/Fmoc-Xxx-Gly-OY (Xxx=Ala, Val, Leu, Phe) and Fmoc-Ala-Xxx-OY/Fmoc-Xxx-Ala-OY (Xxx=Leu, Phe) (Fmoc=[(9-fluorenylmethyl)oxy]carbonyl) and Y=CH(3)/H), have been characterized and differentiated by both positive and negative ion electrospray ionization ion-trap tandem mass spectrometry (ESI-IT-MS(n)). In contrast to the behavior of reported unprotected dipeptide isomers which mainly produce y(1)(+) and/or a(1)(+) ions, the protonated Fmoc-Xxx-Gly-OY, Fmoc-Ala-Xxx-OY and Fmoc-Xxx-Ala-OY yield significant b(1)(+) ions. These ions are formed, presumably with stable protonated aziridinone structures. However, the peptides with Gly- at the N-terminus do not form b(1)(+) ions. The [M+H](+) ions of all the peptides undergo a McLafferty-type rearrangement followed by loss of CO(2) to form [M+H-Fmoc+H](+). The MS(3) collision-induced dissociation (CID) of these ions helps distinguish the pairs of isomeric dipeptides studied in this work. Further, negative ion MS(3) CID has also been found to be useful for differentiating these isomeric peptide acids. The MS(3) of [M-H-Fmoc+H](-) of isomeric peptide acids produce c(1)(-), z(1)(-) and y(1)(-) ions. Thus the present study of Fmoc-protected peptides provides additional information on mass spectral characterization of the dipeptides and distinguishes the positional isomers. Copyright © 2011 John Wiley & Sons, Ltd.

Study of the total uranium in underground water in the city of Jimenez, Chihuahua; Estudio del uranio total en agua subterranea en la Ciudad de Jimenez, Chihuahua

Energy Technology Data Exchange (ETDEWEB)

Renteria V, M. [Centro de Investigacion de Materiales Avanzados (CIMAV), Av. Miguel de Cervantes Saavedra 120, 31109 Chihuahua (Mexico)]. e-mail: marusia.renteria@cimav.edu.mx

2004-07-01

Samples of water of wells in the city of Jimenez, Chihuahua were analyzed, and its were determined the content of total uranium. It was used the technique of extraction of uranium from water adding Bis ( 2- ethylexyl) phosphate and scintillating Beta plate Hi safe, and the measures of the activities were carried out in the portable scintillation detector Thiathler- O Y HIDEX. The obtained interval of concentrations was 0.12 to 0.26 Bq/l that it is finds below the maximum permissible limits that it manages the Mexican regulation. It was found a significant correlation among the concentration of uranium and those total solid dissolved present in the samples. (Author)

Study of the total uranium in underground water in the city of Jimenez, Chihuahua

International Nuclear Information System (INIS)

Renteria V, M.

2004-01-01

Samples of water of wells in the city of Jimenez, Chihuahua were analyzed, and its were determined the content of total uranium. It was used the technique of extraction of uranium from water adding Bis ( 2- ethylexyl) phosphate and scintillating Beta plate Hi safe, and the measures of the activities were carried out in the portable scintillation detector Thiathler- O Y HIDEX. The obtained interval of concentrations was 0.12 to 0.26 Bq/l that it is finds below the maximum permissible limits that it manages the Mexican regulation. It was found a significant correlation among the concentration of uranium and those total solid dissolved present in the samples. (Author)

Applied strain dependence of critical current and internal lattice strain for BaHfO_3-doped GdBa_2Cu_3O_y coated conductors

International Nuclear Information System (INIS)

Usami, Takashi; Yoshida, Yutaka; Ichino, Yusuke; Sugano, Michinaka; Machiya, Shutaro; Ibi, Akira; Izumi, Teruo

2016-01-01

The strain effect of REBa_2Cu_3O_y (REBCO: RE = Y, Gd, Sm)-coated conductors (CCs) on critical current (I_c) is one of the most fundamental factors for superconducting coil applications. In this study, we aim to clarify the effect of artificial pinning center shapes on the strain effect in BHO-doped GdBCO CCs. To achieve this, we fabricated a Pure-GdBCO CC, a BHO nanorod-doped GdBCO CC and a multilayered-GdBCO (ML-GdBCO) CC, and carried out bending tests. As the result, the strain dependence of I_c for each CC showed an upward convex and the peak strain of the BHO-doped GdBCO CC shifts towards the compressive strain independent of the BHO shapes. In addition, the strain sensitivity of I_c in the GdBCO CCs including BHO becomes smaller. To clarify the difference between the strain sensitivity of I_c and the peak strain among the CCs, we evaluated the residual strain and the slopes of the internal lattice strains against the applied tensile strain (β). From this measurement, the residual strains for the Pure-GdBCO CC and the ML-GdBCO CC were almost the same. In addition, there was no change in the β value between the Pure-GdBCO and ML-GdBCO CCs. These results suggest that the changes in peak strain and strain sensitivity were not related to the internal lattice strain. (author)

KYLÄKAUPPAKETJUN LIIKETOIMINTASUUNNITELMAN PERUSTA

OpenAIRE

Rantala, Miki

2013-01-01

Tämän opinnäytetyön tarkoitus oli laatia Gimmefive Oy:lle kyläkauppaketjun liiketoimintasuunnitelman perusta. Gimmefive Oy hallinnoi kahta kyläkauppaa Kymenlaakson alueella. Tarkoitus oli tutkia ja tehdä kehitysehdotuksia asioista, joissa vaatimukset kasvavat liiketoiminnan laajentuessa ketjutasolle. Tavoitteena oli saada Gimmefive Oy:lle suunnitelma siitä, miten sen kannattaa lähteä toteuttamaan ja kehittämään liiketoimintaa kyläkauppaketjun toimintaympäristössä, koska kyläkauppojen lukumäär...

Online classified advertising - Business needs in the US market : Case: FiareAds web platform

OpenAIRE

Tulea, Diana

2013-01-01

This Bachelor’s thesis was conducted for Fiare Oy, which offers web platforms for online classified advertising as a service. Fiare Oy intended to grow internationally, develop its US market share and possibly open an office in the US. The objective of this thesis was to shed light on the business needs in the US market and give recommendations for actions to Fiare Oy. The thesis project started on 4 October 2012 and ended on 17 September 2013. The literature consulted for this study rela...

Novel nano-calcium phosphate generation to improve cell activity in bone restructuring

CSIR Research Space (South Africa)

Wepener, I

2010-01-01

Full Text Available This presentation addresses the replacement and repair of bone. There are four types of biomaterials; namely biotoxic, bioinert, bioactive and ioresorbable. The most abundant inorganic mineral in bone is hydroxyapatite, which is a good candidate...

The role of phytoplankton in the modulation of dissolved and oyster cadmium concentrations in Deep Bay, British Columbia, Canada

International Nuclear Information System (INIS)

Cassis, David; Lekhi, Priyanka; Pearce, Christopher M.; Ebell, Nadene; Orians, Kristin; Maldonado, Maria T.

2011-01-01

We previously identified dissolved cadmium (Cd diss ) as the main source of this metal in cultured Pacific oysters, Crassostrea gigas, in Deep Bay, British Columbia, Canada (Lekhi et al., 2008). Total suspended particulate Cd (Cd part ) was not found to be a significant source of oyster Cd (Cd oys ), with Cd part > 20 μm negatively correlated with Cd oys concentration. High phytoplankton abundance in spring and summer was hypothesized to reduce Cd oys indirectly by drawing down Cd diss and increasing oyster growth. In the present study we expanded on these results by examining specifically how the phytoplankton community composition modulates both Cd diss and Cd oys concentrations in Deep Bay. Based on calculations of nutrients and Cd diss drawdown, phytoplankton accounted for approximately 90% of the overall summer reduction in Cd diss in the bay. Diatoms were the dominant phytoplankton group, being correlated negatively with Cd oys and positively with Cd part . This suggests that diatom growth mediates the transfer of Cd from the dissolved to the particulate phase, resulting in lower Cd oys . Spring blooms and sporadic harmful algal blooms may mediate a large flux of Cd part to the sediments. Thus, phytoplankton act as a sink, rather than a source, of Cd to oysters in Deep Bay and have a crucial role in the seasonality of Cd oys by reducing the concentration of Cd diss during the summer. Based on environmental variables, two descriptive models for annual Cd oys concentrations were developed using multiple linear regression. The first model (R 2 = 0.870) was created to explain the maximum variability in Cd oys concentrations throughout the year, while the second (R 2 = 0.806) was based on parameters that could be measured easily under farm conditions. Oyster age heavily affected both models, with the first model being secondarily affected by temperature and the second one being more sensitive to changes in salinity. - Highlights: → Phytoplankton and

Protecting the endangered lake salmon

International Nuclear Information System (INIS)

Soimakallio, H.; Oesch, P.

1997-01-01

In addition to the Ringed Seal, the labyrinthine Saimaa lake system created after the Ice Age also trapped a species of salmon, whose entire life cycle became adapted to fresh water. In order to improve the living conditions of this lake salmon which - like the ringed seal - is today classified as an endangered species, an intensive research programme has been launched. The partners include the Finnish Game and Fisheries Research Institute, fishing and environmental authorities and - in collaboration with UPM-Kymmene Oy and Kuurnan Voima Oy - the IVO subsidiary Pamilo Oy

Protecting the endangered lake salmon

Energy Technology Data Exchange (ETDEWEB)

Soimakallio, H.; Oesch, P. [ed.

1997-11-01

In addition to the Ringed Seal, the labyrinthine Saimaa lake system created after the Ice Age also trapped a species of salmon, whose entire life cycle became adapted to fresh water. In order to improve the living conditions of this lake salmon which - like the ringed seal - is today classified as an endangered species, an intensive research programme has been launched. The partners include the Finnish Game and Fisheries Research Institute, fishing and environmental authorities and - in collaboration with UPM-Kymmene Oy and Kuurnan Voima Oy - the IVO subsidiary Pamilo Oy

3D-mainosvideo teollisuusyritykselle : Case: Leppäkosken Lämpö

OpenAIRE

Utriainen, Sari

2015-01-01

Toimeksiantajana opinnäytetyölle toimi biolämmitysjärjestelmiä valmistava ja markkinoiva Ariterm Oy. Tavoitteena oli tuottaa messu- ja markkinointikäyttöön 3D-mainosvideo Ariterm Oy:n toimittamasta, elokuussa 2014 käyttöönotetusta Leppäkosken Lämpö Oy:n pellettilämpölaitoksesta. Opinnäytetyössä käsiteltiin 3D-mallien hyödyntämistä eri teollisuuden aloilla sekä tutustuttiin 3D-mainosvideoprojektissa käytettyihin ohjelmistoihin ja teollisuuden 3D-suunnitteluohjelmien eri tiedostomuotoihin se...

MM-rallin vaikutus Toyotan brändiin

OpenAIRE

Laurila, Heini

2017-01-01

Tämän insinöörityön tarkoituksena oli selvittää, millainen vaikutus MM-ralliin palaamisella on Toyotan brändiin Suomessa. Insinöörityö toteutettiin yhteistyössä Suomen Toyotan ja Lexuksen maahantuojayrityksen, Toyota Auto Finland Oy:n sekä AKK Sports Oy:n kanssa. AKK Sports Oy on vastuussa vuosittaisen Suomen MM-ralliosakilpailun, Neste Rallin, järjestämisestä. Tutkimuksen taustatyönä tutustuttiin ensin brändejä ja markkinointia koskevaan kirjallisuuteen. Sen lisäksi käytiin läpi Toyotan ...

Nuclear waste management programme 2003 for the Loviisa and Olkiluoto nuclear power plants

International Nuclear Information System (INIS)

2002-09-01

A joint company Posiva Oy founded by nuclear energy producing Teollisuuden Voima Oy (TVO) and Fortum Power and Heat Oy coordinates the research work of the companies on nuclear waste management in Finland. In Posiva's Nuclear Waste Management Programme 2003, an account of the nuclear waste management measures of TVO and Fortum is given as required by the sections 74 and 75 of the Finnish Nuclear Energy Degree. At first, nuclear waste management situation and the programme of activities are reported. The nuclear waste management research for the year 2003 and more generally for the years 2003-2007 is presented

Air Power for Patton’s Army

Science.gov (United States)

2002-01-01

TROYES 04-T7S•9LIE MANS - .. IoY-35 oA-39 • ORLEANS OY4 NIANTES TOURS IRE uOWs *SOURSES gYg9 OY-50 PIEVERS OY-4 LE GREU30T ,LA EI.LE F R A N C E 50 0 50...moving forward rapidly against Melun, Louviers, and Troyes , they anticipated the highly mobile campaign would soon move beyond Paris to the German...while the XX Corps reached Melun and the XI1 Corps captured Troyes . In the increasingly distant west, VIII Corps as promised, launched its long-awaited

The role of phytoplankton in the modulation of dissolved and oyster cadmium concentrations in Deep Bay, British Columbia, Canada

Energy Technology Data Exchange (ETDEWEB)

Cassis, David, E-mail: dcassis@telus.net [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Lekhi, Priyanka [Department of Chemistry, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Pearce, Christopher M. [Pacific Biological Station, Fisheries and Oceans Canada, Nanaimo, BC, Canada V9T 6N7 (Canada); Ebell, Nadene [Ministry of Agriculture, Nanaimo, BC, Canada V9T 6J9 (Canada); Orians, Kristin [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Department of Chemistry, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Maldonado, Maria T. [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada)

2011-09-15

We previously identified dissolved cadmium (Cd{sub diss}) as the main source of this metal in cultured Pacific oysters, Crassostrea gigas, in Deep Bay, British Columbia, Canada (Lekhi et al., 2008). Total suspended particulate Cd (Cd{sub part}) was not found to be a significant source of oyster Cd (Cd{sub oys}), with Cd{sub part} > 20 {mu}m negatively correlated with Cd{sub oys} concentration. High phytoplankton abundance in spring and summer was hypothesized to reduce Cd{sub oys} indirectly by drawing down Cd{sub diss} and increasing oyster growth. In the present study we expanded on these results by examining specifically how the phytoplankton community composition modulates both Cd{sub diss} and Cd{sub oys} concentrations in Deep Bay. Based on calculations of nutrients and Cd{sub diss} drawdown, phytoplankton accounted for approximately 90% of the overall summer reduction in Cd{sub diss} in the bay. Diatoms were the dominant phytoplankton group, being correlated negatively with Cd{sub oys} and positively with Cd{sub part}. This suggests that diatom growth mediates the transfer of Cd from the dissolved to the particulate phase, resulting in lower Cd{sub oys}. Spring blooms and sporadic harmful algal blooms may mediate a large flux of Cd{sub part} to the sediments. Thus, phytoplankton act as a sink, rather than a source, of Cd to oysters in Deep Bay and have a crucial role in the seasonality of Cd{sub oys} by reducing the concentration of Cd{sub diss} during the summer. Based on environmental variables, two descriptive models for annual Cd{sub oys} concentrations were developed using multiple linear regression. The first model (R{sup 2} = 0.870) was created to explain the maximum variability in Cd{sub oys} concentrations throughout the year, while the second (R{sup 2} = 0.806) was based on parameters that could be measured easily under farm conditions. Oyster age heavily affected both models, with the first model being secondarily affected by temperature and the

Assessment of heavy metals in loose deposits in drinking water distribution system.

Science.gov (United States)

Liu, Quanli; Han, Weiqiang; Han, Bingjun; Shu, Min; Shi, Baoyou

2018-06-09

Heavy metal accumulation and potential releases from loose deposits in drinking water distribution system (DWDS) can have critical impacts on drinking water safety, but the associated risks have not been sufficiently evaluated. In this work, the potential biological toxicity of heavy metals in loose deposits was calculated based on consensus-based sediment quality guidelines, and the effects of some of the main water quality parameters, such as the pH and bicarbonate and phosphate content, on the release behaviors of pre-accumulated heavy metals were investigated. The results showed that heavy metals (Cu, As, Cr, Pb, and Cd) significantly accumulated in all the samples, but the contents of the heavy metals were multiple magnitudes lower than the Fe and Mn contents. The potential biotoxicity of As and Cu was relatively high, but the biotoxicity of Cd was negligible. The water quality can significantly influence the release of heavy metals from loose deposits. As the pH increased from 7.0 to 9.0, the release of As and Cr obviously increased. The release of As, Cu, Pb, and Cr also accelerated with the addition of phosphate (from 1 to 5 mg/L). In contrast to the trends for the pH and phosphate, variations in the bicarbonate content did not have a significant influence on the release of As and Cr. The release ratios of heavy metals in the samples were very low, and there was not a correlation between the release rate of the heavy metals in the loose deposits and their potential biotoxicity.

Walnut and almond oil screw-press extraction at industrial scale: Effects of process parameters on oil yield and quality

Directory of Open Access Journals (Sweden)

M. L. Martínez

2018-01-01

Full Text Available Walnut and almond kernels are highly nutritious mainly due to their high oil contents. In this study, 32 factorial experimental designs were used to optimize processes for oil extraction by screw-pressing at industrial scale. Experimental designs included seed moisture content (SMC, and restriction die (RD as the main processing parameters. Theoretical models were scanned against experimental data in order to optimize oil extraction conditions. The response variables analyzed were oil yield (OY, fine solid content (FC in oil, and oil quality parameters. Fitted models for OY indicated maximum predicted values similar to the highest experimental values. Walnut oil extractions showed a maximum OY (84.5 ± 2.3 % at 7.21% SMC, and 10 mm RD. For almond kernels, maximum OY (71.9 ± 3.5% was obtained at 9.42% SMC, and 12 mm RD. Chemical quality parameters from both oils were in the ranges stated in Codex (FAO/WHO standards for virgin (non-refined oils.

Walnut and almond oil screw-press extraction at industrial scale: Effects of process parameters on oil yield and quality

International Nuclear Information System (INIS)

Martínez, M. L.; Bordón, M.G.; Bodoira, R. M.; Penci, M.C.; Ribotta, P.D.; Maestri, D.M.

2017-01-01

Walnut and almond kernels are highly nutritious mainly due to their high oil contents. In this study, 32 factorial experimental designs were used to optimize processes for oil extraction by screw-pressing at industrial scale. Experimental designs included seed moisture content (SMC), and restriction die (RD) as the main processing parameters. Theoretical models were scanned against experimental data in order to optimize oil extraction conditions. The response variables analyzed were oil yield (OY), fine solid content (FC) in oil, and oil quality parameters. Fitted models for OY indicated maximum predicted values similar to the highest experimental values. Walnut oil extractions showed a maximum OY (84.5 ± 2.3 %) at 7.21% SMC, and 10 mm RD. For almond kernels, maximum OY (71.9 ± 3.5%) was obtained at 9.42% SMC, and 12 mm RD. Chemical quality parameters from both oils were in the ranges stated in Codex (FAO/WHO) standards for virgin (non-refined) oils. [es

Improvement of the effective work function and transmittance of thick indium tin oxide/ultrathin ruthenium doped indium oxide bilayers as transparent conductive oxide

International Nuclear Information System (INIS)

Taweesup, Kattareeya; Yamamoto, Ippei; Chikyow, Toyohiro; Lothongkum, Gobboon; Tsukagoshi, Kazutoshi; Ohishi, Tomoji; Tungasmita, Sukkaneste; Visuttipitukul, Patama; Ito, Kazuhiro; Takahashi, Makoto; Nabatame, Toshihide

2016-01-01

Ruthenium doped indium oxide (In_1_−_xRu_xO_y) films fabricated using DC magnetron co-sputtering with In_2O_3 and Ru targets were investigated for use as transparent conductive oxides. The In_1_−_xRu_xO_y films had an amorphous structure in the wide compositional range of x = 0.3–0.8 and had an extremely smooth surface. The transmittance and resistivity of the In_1_−_xRu_xO_y films increased as the Ru content increased. The transmittance of the In_0_._3_8Ru_0_._6_2O_y film improved to over 80% when the film thickness was less than 5 nm, while the specific resistivity (ρ) was kept to a low value of 1.6 × 10"−"4 Ω cm. Based on these experimental data, we demonstrated that thick indium tin oxide (In_0_._9Sn_0_._1O_y, ITO) (150 nm)/ultrathin In_0_._3_8Ru_0_._6_2O_y (3 nm) bilayers have a high effective work function of 5.3 eV, transmittance of 86%, and low ρ of 9.2 × 10"−"5 Ω cm. This ITO/In_0_._3_8Ru_0_._6_2O_y bilayer is a candidate for use as an anode for organic electroluminescent devices. - Highlights: • We investigated characteristics of thick ITO/ultrathin Ru doped In_2O_3 bilayers. • Effect of Ru addition in In_2O_3 results in smooth surface because of an amorphous structure. • The In_0_._3_8Ru_0_._6_2O_y film with less than 5 nm improves to high transmittance over 80%. • ITO/In_0_._3_8Ru_0_._6_2O_y bilayer has a high effective work function of 5.3 eV. • We conclude that ITO/ultrathin In_0_._3_8Ru_0_._6_2O_y bilayer is a candidate as an anode of OEL.

78 FR 39700 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Snapper-Grouper Fishery off the...

Science.gov (United States)

2013-07-02

... this rule is to provide socio-economic benefits to snapper-grouper fishermen and communities that... councils to prevent overfishing and to achieve, on a continuing basis, the OY for federally managed fish... fishery managers to end overfishing of stocks while achieving OY from the fishery, and to minimize bycatch...

Strong Photoluminescence Enhancement of Silicon Oxycarbide through Defect Engineering

Directory of Open Access Journals (Sweden)

Brian Ford

2017-04-01

Full Text Available The following study focuses on the photoluminescence (PL enhancement of chemically synthesized silicon oxycarbide (SiCxOy thin films and nanowires through defect engineering via post-deposition passivation treatments. SiCxOy materials were deposited via thermal chemical vapor deposition (TCVD, and exhibit strong white light emission at room-temperature. Post-deposition passivation treatments were carried out using oxygen, nitrogen, and forming gas (FG, 5% H2, 95% N2 ambients, modifying the observed white light emission. The observed white luminescence was found to be inversely related to the carbonyl (C=O bond density present in the films. The peak-to-peak PL was enhanced ~18 and ~17 times for, respectively, the two SiCxOy matrices, oxygen-rich and carbon-rich SiCxOy, via post-deposition passivations. Through a combinational and systematic Fourier transform infrared spectroscopy (FTIR and PL study, it was revealed that proper tailoring of the passivations reduces the carbonyl bond density by a factor of ~2.2, corresponding to a PL enhancement of ~50 times. Furthermore, the temperature-dependent and temperature-dependent time resolved PL (TDPL and TD-TRPL behaviors of the nitrogen and forming gas passivated SiCxOy thin films were investigated to acquire further insight into the ramifications of the passivation on the carbonyl/dangling bond density and PL yield.

Fiscal 1975 Sunshine Project research report. Research on safety technology for hydrogen energy systems; 1975 nendo suiso energy system ni okeru hoan gijutsu ni kansuru chosa kenkyu seika hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

1976-05-01

Important notices and problems on the safety for hydrogen gas were analyzed. Analysis was made on hydrogen gas property, flammability, explosivility, bio-toxicity, equipment, storage, transport, leakage, fire, technology and education for safety management, and quality and analysis of products. Study was also made on the relation between the above items and every domestic or overseas standard. Important notices and problems on the safety for liquid hydrogen were analyzed. Analysis was made on liquid hydrogen property, liquefaction and refining equipment, transport, storage, materials concerned, bio-toxicity, leakage, fire fighting technique, and safety management. Among them, such problems are pointed out from the viewpoint of accident prevention, as O-P conversion, refining of hydrogen gas for liquefaction, selection of structural materials, hydrogen embrittlement, layout of various equipment and devices, explosion-proof electric devices, and leakage detection. Research on effective fire fighting and fire preventive measures against hydrogen leakage and diffusion from tanks or piping are also in demand. (NEDO)

The positive relationship between ocean acidification and pollution.

Science.gov (United States)

Zeng, Xiangfeng; Chen, Xijuan; Zhuang, Jie

2015-02-15

Ocean acidification and pollution coexist to exert combined effects on the functions and services of marine ecosystems. Ocean acidification can increase the biotoxicity of heavy metals by altering their speciation and bioavailability. Marine pollutants, such as heavy metals and oils, could decrease the photosynthesis rate and increase the respiration rate of marine organisms as a result of biotoxicity and eutrophication, facilitating ocean acidification to varying degrees. Here we review the complex interactions between ocean acidification and pollution in the context of linkage of multiple stressors to marine ecosystems. The synthesized information shows that pollution-affected respiration acidifies coastal oceans more than the uptake of anthropogenic carbon dioxide. Coastal regions are more vulnerable to the negative impact of ocean acidification due to large influxes of pollutants from terrestrial ecosystems. Ocean acidification and pollution facilitate each other, and thus coastal environmental protection from pollution has a large potential for mitigating acidification risk. Copyright © 2014 Elsevier Ltd. All rights reserved.

Assessment of zerovalent iron for stabilization of chromium, copper, and arsenic in soil

International Nuclear Information System (INIS)

Kumpiene, Jurate; Ore, Solvita; Renella, Giancarlo; Mench, Michel; Lagerkvist, Anders; Maurice, Christian

2006-01-01

Stabilization of soil contaminated with trace elements is a remediation practice that does not reduce the total content of contaminants, but lowers the amounts of mobile and bioavailable fractions. This study evaluated the efficiency of Fe to reduce the mobility and bioavailability of Cr, Cu, As and Zn in a chromated copper arsenate (CCA)-contaminated soil using chemical, biochemical and biotoxicity tests. Contaminated soil was stabilized with 1% iron grit. This treatment decreased As and Cr concentrations in leachates (by 98% and 45%, respectively), in soil pore water (by 99% and 94%, respectively) and in plant shoots (by 84% and 95%, respectively). The stabilization technique also restored most of analyzed soil enzyme activities and reduced microbial toxicity, as evaluated by the BioTox TM test. After stabilization, exchangeable and bioaccessible fractions of Cu remained high, causing some residual toxicity in the treated soil. - Zerovalent iron effectively reduces mobility and bioavailability of As and Cr, but does not adequately stabilize Cu

Comparison of triple to double coincidence ratio and Quench Parameter External methods for the determination of 3H efficiency by liquid scintillation counting

International Nuclear Information System (INIS)

Nisti, M.B.; Saueia, C.H.R.; Mazzilli, B.P.

2013-01-01

The aim of this study is to determine the tritium efficiency by liquid scintillation counting using two methodologies, Quench Parameter External (QPE) and Triple to Double Coincidence Ratio (TDCR), and to compare the results. The equipment used was the HIDEX model 300-SL Liquid Scintillation Counter, composed of three photomultipliers coupled with coincidence pulses, discrimination level and Mikro Win 2000 software. The efficiency varied from 0.028 to 0.706 cps dps -1 for QPE and from 0.061 to 0.703 cps dps -1 for TDCR. Different efficiencies were obtained using both methods, in the range from 459 to 572 quenching, above this range the efficiencies were similar. The verification of the efficiencies was performed by participating in the Intercomparison National Program (PNI). (author)

Finskii grafitsheskii beton teper takzhe i v Estonii / Mait Eelrand

Index Scriptorium Estoniae

Eelrand, Mait

2007-01-01

Graafilise betooni meetodi arendas 1990. aastate lõpul välja soome sisearhitekt Samuli Naamanka, tehnoloogia on patenteerinud tema asutatud firma Graphic Concrete Oy. AS E-Betoonelement kasutas graafilise betooni tehnoloogiat esimesena Rakveres büroohoone fassaadi kujundamiseks. Kommenteerivad Graphic Concrete Oy tegevdirektor H. Lanningu ja K. Meus AS-st E-Betoonelement

Soomlaste graafiline betoon nüüd ka Eestis / Mait Eelrand

Index Scriptorium Estoniae

Eelrand, Mait

2007-01-01

Graafilise betooni meetodi arendas 1990. aastate lõpul välja soome sisearhitekt Samuli Naamanka, tehnoloogia on patenteerinud tema asutatud firma Graphic Concrete Oy. AS E-Betoonelement kasutas graafilise betooni tehnoloogiat esimesena Rakveres büroohoone fassaadi kujundamiseks. Kommenteerivad Graphic Concrete Oy tegevdirektor H. Lanningu ja K. Meus AS-st E-Betoonelement

Test manufacture of the canister insert 135

International Nuclear Information System (INIS)

Raiko, H.

2005-10-01

This report describes the insert-manufacturing test of a disposal canister for spent nuclear fuel that was made by Metso Foundries Jyvaeskylae Oy, in June 2004 on contract for Posiva Oy. The test manufacture was a part of the co-operation development programme of encapsulation technology between SKB AB and Posiva Oy. Insert casting was specified according to the current manufacturing specifications of SKB. The canister insert was of BWR-type with integral bottom. This was the second trial manufacture of this type of insert in Finland and, in total, the third test manufacture of insert by Metso Foundries Jyvaeskylae Oy. The result fulfilled all the requirements but the material mechanical properties of the cast material. The measured ultimate strength and elongation at rupture were lower than specified in the upper part of the cast. The reason for this was revealed in the metallurgical investigation of the cast material. The cast contained slag (dross). Avoiding the dross formation will be the most demanding challenge of the forthcoming development of the cast procedure. (orig.)

Universal Music Finland OY ruumid = Interiors of Universal Music Finland OY

Index Scriptorium Estoniae

2011-01-01

Helsingis Merimiehenkatu 36D asuvate kontoriruumide sisekujundusest. Sisearhitekt Jan Skolimowski (KAMP Arhitektid OÜ), loetletud tema tehtud töid. Laudadele ja klaasseintele kantud graafika kaasautorid: Martin ja Marje Eelma (Tuumik Stuudio OÜ)

Effects of aluminum on root growth and absorption of nutrients by ...

African Journals Online (AJOL)

Aluminum (Al) is a biotoxic which often influences the absorption of nutrients by plants in strongly acidic soils. In this experiment, the effect of Al on root growth, absorption of macronutrients; phosphorus (P), potassium (K), calcium (Ca), magnesium (Mg) and micronutrients; iron (Fe), manganese (Mn), copper (Cu) and zinc ...

Photocatalytic ozonation of terephthalic acid: a by-product-oriented decomposition study.

Science.gov (United States)

Fuentes, Iliana; Rodríguez, Julia L; Poznyak, Tatyana; Chairez, Isaac

2014-11-01

Terephthalic acid (TA) is considered as a refractory model compound. For this reason, the TA degradation usually requires a prolonged reaction time to achieve mineralization. In this study, vanadium oxide (VxOy) supported on titanium oxide (TiO2) served as a photocatalyst in the ozonation of the TA with light-emitting diodes (LEDs), having a bandwidth centered at 452 nm. The modified catalyst (VxOy/TiO2) in combination with ozone and LEDs improved the TA degradation and its by-products. The results obtained by this system were compared with photolysis, single ozonation, catalytic ozonation, and photocatalytic ozonation of VxOy/TiO2 with UV lamp. The LED-based photocatalytic ozonation showed almost the same decomposition efficiency of the TA, but it was better in comparison with the use of UV lamp. The oxalic acid accumulation, as the final product of the TA decomposition, was directly influenced by either the presence of VxOy or/and the LED irradiation. Several by-products formed during the TA degradation, such as muconic, fumaric, and oxalic acids, were identified. Besides, two unidentified by-products were completely removed during the observed time (60 min). It was proposed that the TA elimination in the presence of VxOy/TiO2 as catalyst was carried out by the combination of different mechanisms: molecular ozone reaction, indirect mechanism conducted by ·OH, and the surface complex formation.

Zeolite-Y entrapped Ru(III and Fe(III complexes as heterogeneous catalysts for catalytic oxidation of cyclohexane reaction

Directory of Open Access Journals (Sweden)

Chetan K. Modi

2017-02-01

Full Text Available Catalysis is probably one of the greatest contributions of chemistry to both economic growth and environmental protection. Herein we report the catalytic behavior of zeolite-Y entrapped Ru(III and Fe(III complexes with general formulae [M(VTCH2·2H2O]+-Y and [M(VFCH2·2H2O]+-Y [where, VTCH = vanillin thiophene-2-carboxylic hydrazone and VFCH = vanillin furoic-2-carboxylic hydrazone] over the oxidation of cyclohexane forming cyclohexanone and cyclohexanol. The samples were corroborated by various physico-chemical techniques. These zeolite-Y based complexes are stable and recyclable under current reaction conditions. Amongst them, [Ru(VTCH2⋅2H2O]+-Y showed higher catalytic activity (41.1% with cyclohexanone (84.6% selectivity.

Suitability of Haestholmen Loviisa for final disposal of spent fuel. Preliminary study; Loviisan Haestholmenin soveltuvuus kaeytetyn polttoaineen loppusijoitukseen. Esiselvitys

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-01

Based on the amendment of the Nuclear Energy Act the spent nuclear fuel of Imatran Voima Oy (IVO) will be disposed of in Finland instead of returning it to Russia. After Teollisuuden Voima Oy (TVO) and IVO had founded a joint company Posiva Oy the work IVO started in 1995 was brought together with the ongoing research programme for final disposal of spent fuel and extended to a feasibility study. The feasibility study was launched in the beginning of 1996. The geological evaluation was mainly based on the previous investigations at the island. For this study the complementary geological mapping has been carried out at the Haestholmen and on the surrounding area with a radius of 20 km. (49 refs.).

Optimization of cocktail volume in estimation of Tritium activity using liquid scintillation spectrometer

International Nuclear Information System (INIS)

Kumaravel, S.; Narashimha Nath, V.; Prashanth Kumar, M.; Sunil, C.N.; Raghunath, T.; Bera, Utpal; Ramakrishna, V.; Nair, B.S.K.; Ganesh, G.; Tripathi, R.M.

2016-01-01

Liquid Scintillation Spectrometers (LSS) are widely used for the estimation of Tritium in Nuclear Industry and Environmental labs to find out the Tritium concentration. The main component used for the detection of tritium is the liquid scintillation cocktail composed of different chemicals. To reduce the radioactive chemical wastes and the cost of liquid scintillation cocktails the use of as small volume of cocktail as possible is required. Typically, 1 ml of the aqueous sample is added with 5 ml of the liquid scintillation cocktail in a 20 ml low potassium glass. In this study, suitability of the combination of I ml aqueous sample with 2.5 ml cocktail in a 7 ml low potassium glass vial using a HIDEX 300 SL TDCR LSS was carried out instead of the other combination

Dust emissions eliminated in pneumatic harvesting

International Nuclear Information System (INIS)

Kallio, M.

1998-01-01

Pneumatic harvesting is the most efficient milled peat production method in unsteady weather conditions. In good summers, the best contractors harvest more than 1 000 m 3 /ha milled peat from suitable production fields. The greatest problem of the method is caused by dust emissions, in particular in fields close to settled areas. About 15 % of Finland's present peat production is collected using pneumatic harvesters. A pneumatic harvester with smaller dust emissions has been developed by VTT Energy and Vapo Oy. The wagon is based on two-stage separation of peat. The main part of the coarser milled peat is first separated, e.g. in a settling chamber, and fine dry peat dust in correctly dimensioned side by side cyclones. The first series of pneumatic harvesters based on the new separation technology was employed in summer 1996. Besides decreasing the dust emissions the harvesting capacity of the new equipment was increased. The collection capacity of the pneumatic harvester can be made more effective by enlarging the container size, be decreasing the weight, by increasing the driving speed and by developing the suction capacity. Using lighter and durable construction materials combined with advanced design lighter and stronger pneumatic harvesters have been constructed. Nozzles and their mounting have also been developed. In the improvement of nozzles, the former studies with pneumatic simulator of VTT Energy, have been of great help. Studies with the pneumatic simulator and field conditions have been made in collaboration with Turveruukki Oy, Turvemetalli Oy, Raussin Metalli Oy and Vapo Oy, as well as VNIITP of St. Petersburg, Russia

Biomass CFB gasifier connected to a 350 MW{sub t}h steam boiler fired with coal and natural gas - THERMIE demonstration project in Lahti in Finland

Energy Technology Data Exchange (ETDEWEB)

Palonen, J. [Foster Wheeler Energia Oy, Varkaus (Finland). Varkaus Global New Products

1997-12-31

The successful experience in developing the advanced Foster Wheeler Energi Oy`s (former Ahlstroem Pyropower) Circulating Fluidized Bed combustion system subsequently led to the development of the CFB gasification technology in the early 1980s. The driving force for the developing work was the dramatic increase in oil price during the oil crises. The primary advantage of CFB gasification technology is that the it enables the substitution of expensive fuels e.g. oil or gas with cheap solid fuels. These cheap fuels are typically different types of waste woods, bark or other biofuels. In the CFB gasifier these solid fuels are converted to gaseous fuel which can be used instead of other expensive fuels. In some cases this also solves a waste disposal problem, providing a secondary economic and environmental benefit. Foster Wheeler Energia Oy has supplied four commercial scale atmospheric CFB gasifiers in the mid 80s to the pulp and paper industry with capacities from 17 to 35 MW based on fuel input. These applications utilize waste wood as feedstock and the units are still successfully operation today. Lahden Laempoevoima Oy is a Finnish power company producing power and district heat for the city of Lahti. The company is 50 % owned by the city of Lahti and 50 % by Imatran Voima Oy, which is the largest utility power company in Finland. Lahden Laempoevoima Oy operates the Kymijaervi power plant locating nearby the city of Lahti in Southern Finland. To keep the energy prices as low as possible, Lahden Laempoevoima is continuously looking for the most economical fuel sources, and simultaneously, trying to improve the environmental acceptability of the energy production. At the moment, about 300 GWh/a different type of biofuels and refuse fuels are available in the Lahti area. On an annual basis, the available amount of biofuels and refuse fuels is enough to substitute for about 15 % of the fuels burned in the main boiler equalling max 30 % of coal. The aim in this Lahden

Biomass CFB gasifier connected to a 350 MW{sub t}h steam boiler fired with coal and natural gas - THERMIE demonstration project in Lahti in Finland

Energy Technology Data Exchange (ETDEWEB)

Palonen, J [Foster Wheeler Energia Oy, Varkaus (Finland). Varkaus Global New Products

1998-12-31

The successful experience in developing the advanced Foster Wheeler Energi Oy`s (former Ahlstroem Pyropower) Circulating Fluidized Bed combustion system subsequently led to the development of the CFB gasification technology in the early 1980s. The driving force for the developing work was the dramatic increase in oil price during the oil crises. The primary advantage of CFB gasification technology is that the it enables the substitution of expensive fuels e.g. oil or gas with cheap solid fuels. These cheap fuels are typically different types of waste woods, bark or other biofuels. In the CFB gasifier these solid fuels are converted to gaseous fuel which can be used instead of other expensive fuels. In some cases this also solves a waste disposal problem, providing a secondary economic and environmental benefit. Foster Wheeler Energia Oy has supplied four commercial scale atmospheric CFB gasifiers in the mid 80s to the pulp and paper industry with capacities from 17 to 35 MW based on fuel input. These applications utilize waste wood as feedstock and the units are still successfully operation today. Lahden Laempoevoima Oy is a Finnish power company producing power and district heat for the city of Lahti. The company is 50 % owned by the city of Lahti and 50 % by Imatran Voima Oy, which is the largest utility power company in Finland. Lahden Laempoevoima Oy operates the Kymijaervi power plant locating nearby the city of Lahti in Southern Finland. To keep the energy prices as low as possible, Lahden Laempoevoima is continuously looking for the most economical fuel sources, and simultaneously, trying to improve the environmental acceptability of the energy production. At the moment, about 300 GWh/a different type of biofuels and refuse fuels are available in the Lahti area. On an annual basis, the available amount of biofuels and refuse fuels is enough to substitute for about 15 % of the fuels burned in the main boiler equalling max 30 % of coal. The aim in this Lahden

Part I: A Comparative Thermal Aging Study on the Regenerability of Rh/Al2O3 and Rh/CexOy-ZrO2 as Model Catalysts for Automotive Three Way Catalysts

Directory of Open Access Journals (Sweden)

Qinghe Zheng

2015-10-01

Full Text Available The rhodium (Rh component in automotive three way catalysts (TWC experiences severe thermal deactivation during fuel shutoff, an engine mode (e.g., at downhill coasting used for enhancing fuel economy. In a subsequent switch to a slightly fuel rich condition, in situ catalyst regeneration is accomplished by reduction with H2 generated through steam reforming catalyzed by Rh0 sites. The present work reports the effects of the two processes on the activity and properties of 0.5% Rh/Al2O3 and 0.5% Rh/CexOy-ZrO2 (CZO as model catalysts for Rh-TWC. A very brief introduction of three way catalysts and system considerations is also given. During simulated fuel shutoff, catalyst deactivation is accelerated with increasing aging temperature from 800 °C to 1050 °C. Rh on a CZO support experiences less deactivation and faster regeneration than Rh on Al2O3. Catalyst characterization techniques including BET surface area, CO chemisorption, TPR, and XPS measurements were applied to examine the roles of metal-support interactions in each catalyst system. For Rh/Al2O3, strong metal-support interactions with the formation of stable rhodium aluminate (Rh(AlO2y complex dominates in fuel shutoff, leading to more difficult catalyst regeneration. For Rh/CZO, Rh sites were partially oxidized to Rh2O3 and were relatively easy to be reduced to active Rh0 during regeneration.

Emerging trends in chemical separations with liquid membranes: an overview

International Nuclear Information System (INIS)

Shukla, J.P.

1997-01-01

It can be concluded that varied configurations of liquid membranes (LMs) will definitely play an important role in metal separations particularly in situations where other conventional chemical separation techniques fail to deliver goods. Potential areas include decontamination of biotoxic/ radioactive wastes, recovery of precious and strategic metals from lean/ extremely dilute solutions, add on to existing units, hydrometallurgy, etc

Laatu- ja validointitoiminta elintarviketeollisuudessa

OpenAIRE

Vanhatalo, Heidi

2017-01-01

Opinnäytetyö laadittiin Zeus Tech Oy:n toimeksiannosta. Zeus Tech Oy tuottaa validointi-, mittaus-, testaus- ja laadunvarmistuspalveluja lääke- ja bioteollisuuden, sekä elintarviketeollisuuden alojen toimijoille. Tarkoituksena oli selvittää laatu- ja validointitoiminnan kehittämiskohteita elintarviketeollisuudessa. Opinnäytetyön teoriaosuudessa käsitellään laatua, laadunvalvontaa ja -hallintaa, sekä validointia elintarviketeollisuudessa. Työn kokeellisessa osuudessa luotiin kyselytutkimus...

Living with genome instability: the adaptation of phytoplasmas todiverse environments of their insect and plant hosts

Energy Technology Data Exchange (ETDEWEB)

Bai, Xiaodong; Zhang, Jianhua; Ewing, Adam; Miller, Sally A.; Radek, Agnes; Shevchenko, Dimitriy; Tsukerman, Kiryl; Walunas, Theresa; Lapidus, Alla; Campbell, John W.; Hogenhout Saskia A.

2006-02-17

Phytoplasmas (Candidatus Phytoplasma, Class Mollicutes) cause disease in hundreds of economically important plants, and are obligately transmitted by sap-feeding insects of the order Hemiptera, mainly leafhoppers and psyllids. The 706,569-bp chromosome and four plasmids of aster yellows phytoplasma strain witches broom (AY-WB) were sequenced and compared to the onion yellows phytoplasma strain M (OY-M) genome. The phytoplasmas have small repeat-rich genomes. The repeated DNAs are organized into large clusters, potential mobile units (PMUs), which contain tra5 insertion sequences (ISs), and specialized sigma factors and membrane proteins. So far, PMUs are unique to phytoplasmas. Compared to mycoplasmas, phytoplasmas lack several recombination and DNA modification functions, and therefore phytoplasmas probably use different mechanisms of recombination, likely involving PMUs, for the creation of variability, allowing phytoplasmas to adjust to the diverse environments of plants and insects. The irregular GC skews and presence of ISs and large repeated sequences in the AY-WB and OY-M genomes are indicative of high genomic plasticity. Nevertheless, segments of {approx}250 kb, located between genes lplA and glnQ are syntenic between the two phytoplasmas, contain the majority of the metabolic genes and no ISs. AY-WB is further along in the reductive evolution process than OY-M. The AY-WB genome is {approx}154 kb smaller than the OY-M genome, primarily as a result of fewer multicopy sequences, including PMUs. Further, AY-WB lacks genes that are truncated and are part of incomplete pathways in OY-M. This is the first comparative phytoplasma genome analysis and report of the existence of PMUs in phytoplasma genomes.

Integrated natural gas pipeline control and customer service system of Gasum; Le systeme integre de controle des canalisations de gaz et de service au consommateur chez Gasum

Energy Technology Data Exchange (ETDEWEB)

Aho, J.; Manty, O.; Ahlnas, B. [Gasul Oy (Finland)

2000-07-01

Due to the rapid development of the information technology, ageing is not the only driving force for replacing old computer systems with more sophisticated ones. The Finnish natural Gas company, Gasum Oy, has recently taken into use a new control and monitoring system for natural gas pipeline. A special customer service system, developed by Gasum Oy, is closely connected to monitoring system. It provides up-to-date information to all customers of Gasum Oy. The information is layered in three confidential levels: general information, operational data and invoicing information. The system is operating interactively in confidential Extranet. Inside Gasum Oy to meet the needs of departments outside the control room, a new GID system is developed. GID is a way to present pipeline process data and its further modifications with a very user-friendly interface based on geographical map. The system is based on data warehouse architecture and it is working on company's Intranet. This makes it possible to present various secrecy level information based on user ID. Gasum's new SCADA is not only the base for operating the pipeline, but it also provides lot of vital information to other systems serving different user groups within natural gas business in Finland. (authors)

Technology of Furniture Production

OpenAIRE

Danilova, Kseniia

2016-01-01

Manufacturing of furniture is one of the main processes of timber utilization. Furniture of Timberica Oy brand is made by special technology which does not allow use aggressive chemicals that can be harmful to humans, in wood processing. The furniture is made of Karelian "white" pine. Company's headquarters are located in Finland, its specialists improve and carefully controlled manufacturing process at the furniture factory in Karelia. Timberica Oy has produced furniture since 1998. They...

GOF ON THE GO -myymäläkonseptin suunnittelu

OpenAIRE

Myllylä, Tiina

2014-01-01

Suunnittelin opinnäytetyönäni lahtelaiselle Great Outfit Oy:lle uudenlaisen GOF ON THE GO -myymäläkonseptin, heidän visuaalisen markkinointinsa työkaluksi. Great Outfit Oy on tunnettu erikoismateriaaleista, kuten turkiksesta, nahasta ja alpakan villasta valmistetuista muoti- ja sisustustuotteista. Yrityksen palveluihin kuuluvat myös erikoismateriaaliosaamista vaativat alihankintatyöt ja yhteistyö sisustusalan ammattilaisten kanssa. Suunnittelemani myymäläkonseptin erikoisuutena o...

Study and analysis of how to optimize marketing & sales of a b-to-b company for the target group

OpenAIRE

Kauppila, Kasper

2014-01-01

Study and analysis of how to optimize the marketing & sales strategy of a b-to-b company for the target group. Case study for Green Fortune Plantwall Oy. This thesis is a case study of Green Fortune Plantwall Oy. The objective of this thesis is to study and analyze how to optimize the current marketing and sales strategy of a small b-to-b company for its target group (i.e. architects and interior designers).

Acute toxicity and genotoxicity of fermented traditional medicine oyaksungi-san

OpenAIRE

Hwayong Park; Youn-Hwan Hwang; Jin Yeul Ma

2017-01-01

Background: The traditional medicine oyaksungi-san (OY) has been prescribed in East Asia for hundreds of years for the treatment of stroke, paralysis, and ataxia. OY also has therapeutic effects on arthralgia, myalgia, and rheumatoid arthritis, and recent studies have shown its protective effects against apoptosis of hippocampal cells and its anti-inflammatory effects on the peripheral blood cells of patient with cerebral infarction. Many studies have explored the use of traditional medicine ...

Automotive shredder residue (ASR) and compact disc (CD) waste: options for recovery of materials and energy. Final report for study funded by Ekokem Oy Ab 2002

Energy Technology Data Exchange (ETDEWEB)

Zevenhoven, R.; Saeed, L.

2002-07-01

. Some implications of these are limitations on what types of waste may be landfilled or incinerated (for example, car tyres may not be landfilled any longer within EU member states, and especially on how ASR may be treated. Still, in Europe ASR is mostly disposed of on landfills, despite the high concentration of organic species that will take part in chemical and biological degradation processes; apparently ASR is to some extent biodegradable. At some places, ASR is incinerated or coincinerated with other wastes or fuel, which within the EU may be restricted by the Incineration of Waste Directive when considering ASR composition or requirements to flue gas emissions control. The aim of this study is to give an overview of what problem the ASR presents to modern society and what the options are for processing this waste into recovered products or materials, or energy, with a minimum of useless by-products for which landfilling is the only route. Not addressed in this work are waste car tyres or scrapped car tyres, sometimes referred to as tyre derived fuel (TDF), since for this waste stream several options for material, chemical, or energy recovery have been developed which also find use in Finland. Examples are co-firing in cement clinker production and road construction work. Important here are the role of the Finnish tyre recycling organisation Rengaskierraetys Oy and the use of waste tyres as alternative fuel at the cement plant of Finnsementti Oy at Parainen. 1.2 Compact disc (CD) waste Compact disc waste, especially those related to computer software are often disposed of with other waste electrical and electronic equipment (WEEE) fractions, if they don't end up in the wastes from households or offices. The structure and composition of CDs and DVDs is such that when these end up on landfills or in waste incinerators not much harm will be done. Nonetheless, looking at the sheer number of CDs and DVDs that are produced should trigger considerations on their end

Creating Service Concepts for Finnish Elderly Care : Case: Virtual Interactive Care Service

OpenAIRE

Nwagu, Promise

2016-01-01

This thesis looks at creating service concept by evaluating the research project of Virtual Interactive Care Service. The research project was initiated and implemented by the author together with Hovi Group Oy and Suomen kotilääkäripalvelu Oy. The goal was to provide a virtual care service business that uses interactive and stimulating activities to improve the wellbeing of elderly people in Finland. The study employed qualitative research method by reviewing existing works particularly...

Microsoft Hololens -applikaation toteuttaminen

OpenAIRE

Pesu, Joel

2017-01-01

Opinnäytetyö tehtiin Valve Group Oy:lle. Opinnäytetyön tarkoituksena oli toteuttaa Valve Group Oy:n asiakkaalle Nokia Oyj:lle Microsoft Hololens-applikaatio Barcelona Mobile World Congress 2017 -messuille demotarkoitukseen. Applikaatio toteutettiin käyttäen pelimoottori Unityä, 3D-mallinnusohjelma Blenderiä ja 3D-mallien maalausohjelmaa Substance Painteria. Opinnäytetyön teoriaosuus keskittyy sovelluksessa käytetyn mixed realityn kehityshistoriaan. Esiteltyjä tekniikoita ovat virtual reality ...

How can companies build and maintain trust in social media?

OpenAIRE

Donchev, Mihail

2012-01-01

In the PR and Communications industry there has been a dramatic shift in the effectiveness of bought channels vs. earned media. The client of this research project, Miltton Oy has developed its PR and Communications business by focusing on earned media models successfully over the last 10 years. Miltton sees social media as the fastest growing earned media channel. Miltton Oy has expressed interest in finding how corporations can better use social media in corporate communications. While...

SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

Energy Technology Data Exchange (ETDEWEB)

Hakulin, H. [ed.

1996-12-31

The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

Energy Technology Data Exchange (ETDEWEB)

Hakulin, H [ed.

1997-12-31

The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

Impact of solvent mixture on iron nanoparticles generated by laser ablation

Science.gov (United States)

Chakif, M.; Prymak, O.; Slota, M.; Heintze, E.; Gurevich, E. L.; Esen, C.; Bogani, L.; Epple, M.; Ostendorf, A.

2014-03-01

The present work reveals the structural and magnetic properties of iron oxide (FexOy) nanoparticles (NPs) prepared by femtosecond laser ablation. The FexOy-NPs were produced in solutions consisting of different ratios of water and acetone. Laser ablation in water yields agglomerates and that in acetone yields chain structures whereas that in water/acetone show a mixture of both. We observe significant fabrication dependent properties such as different crystallinities and magnetic behaviors. The structural characterization shows a change from iron (Fe) to a FexOy state of the NPs which depends on the solution composition. Furthermore, transmission electron microscopy measurements exhibit a broad particle size distribution in all samples but with significant differences in the mean sizes. Using magnetic measurements we show that nanoparticles fabricated in pure acetone have lower coercive fields which come along with a smaller mean particle size and therefore increasing superparamagnetic behavior.

Carvacrol importance in veterinary and human medicine as ecologic insecticide and acaricide

Directory of Open Access Journals (Sweden)

Vučinić Marijana

2011-01-01

Full Text Available Carvacrol is an active ingredient of essential oils from different plants, mainly from oregano and thyme species. It poseses biocidal activity agains many artropodes of the importance for veterinary and human medicine. Carvacrol acts as repelent, larvicide, insecticide and acaricide. It acts against pest artropodes such as those that serve as mechanical or biological vectors for many causal agents of viral, bacterial and parasitic diseases for animals and humans. Therefore, it may be used not only in pest arthropodes control but in vector borne diseases control, too. In the paper carvacrol bioactivity against mosquitoes, house flies, cockroaches, ticks and mites are described. Potencial modes of carvacrol action on artropodes are given, too. Carvacrol reachs its biotoxicity against arthropodes alone or in combination with other active ingredients from the same plant of its origin, such as tymol, cymen or others. The paper explains reasons for frequently investigations on essential oils and other natural products of plant origin to their biotoxicity against food stored pest or pest of medicinal importance, as well as, needs for their use in agriculture, veterinary and human medicine.

Mise-a-la-masse surveys at Olkiluoto, 2006

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2007-02-01

Suomen Malmi Oy conducted Mise-a-la-masse surveys at Olkiluoto site in Eurajoki during November and December 2006. The surveys are a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included field work, data processing and technical raporting. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. Data is delivered digitally in xyz-format. (orig.)

Intranetin rakentaminen yritykselle

OpenAIRE

Uronen, Mikko

2013-01-01

Tämän opinnäytetyön tavoitteena oli rakentaa intranet Lahti Precision Oy:lle. Lahti Precision Oy on suurin punnitusalan yritys Suomessa. Asiakkaina sillä on lasiteollisuus, laasti- ja tasoiteteollisuus. Yrityksen vanhempi intranet-toteutus ei palvellut kunnolla yrityksen henkilökuntaa ja aiheutti tehottomuutta asioiden hoidossa. Yritys halusi myös siirtää intranetin toimimaan omaan lähiverkkoonsa. Yritys oli valinnut käytettäväksi SharePoint Foundation 2010 alustan, jolla intranet oli tar...

Proof-of-Concept Prototyping for Observis Platform

OpenAIRE

Ekimov, Victor

2012-01-01

Observis Oy is a start-up company first appeared in January 2011. The company is building up a measurement platform that is open and easy to connect. It helps measurement device suppliers, system and service providers, and analyzing services to found and combine each other’s products to create more value to the end customers. Observis Oy intends to develop a platform for integration with other services in order to provide management functionality in environmental field of business. Platform i...

Konto-eriste

OpenAIRE

Kananoja, Tomi

2010-01-01

Työn tarkoitus oli määrittää Konto Oy:n kehittämälle turve-eristeelle optimaalinen lämmönjohtavuus ja ääneneristävyys. Hankkeessa olivat yhteistyössä Konto Oy, TAMK:n Tutkimus & Kehitysosasto sekä opiskelijoita. Tutkimukset omalta osaltani jakautuivat Tampereen teknillisen yliopiston laboratoriokokeisiin lämmönjohtavuudesta ja Tampereen ammattikorkeakoulun tiloissa tapahtuvaan koputuskokeeseen. Työ oli kokonaisuudessaan mielenkiintoinen. Yhteyttä pidettiin monen eri tahon kanssa, ja voidaan s...

Odoon ja Jaspersoft Studion integrointi

OpenAIRE

Iivonen, Kalle

2015-01-01

Opinnäytetyö tehtiin toimeksiantona EM Systems Oy:lle. EM Systems Oy on turkulainen yritys, joka tekee asiakkailleen Odoo-toiminnanohjausjärjestelmäpaketteja ja muita tiedonhallinnan ratkaisuja. He halusivat selvittää kuinka helppoa ja hyödyllistä on yhdistää Jaspersoftin raportointiohjelmisto Odoo-toiminnanohjausjärjestelmän kanssa. Työ sisälsi Jaspersoft Studion, joka on raporttien suunnitteluohjelma, yhdistämisen Odoo-toiminnanohjausjärjestelmän tietokantaan. Yhdistäminen vaati PostgreS...

Katsastustoiminnan lisääminen korjaamopalveluihin

OpenAIRE

Kuonanoja, Tuomo

2015-01-01

Opinnäytetyön aiheena oli selvittää ja suunnitella, kuinka katsastustoiminta voidaan liittää osaksi Pärnäisen korjaamo Oy:n palveluita. Pärnäisen korjaamo Oy on monimerkkikorjaamo, jonka palveluihin kuuluvat kattavasti kevyiden ajoneuvojen huolto ja korjaus- sekä puhdistustyöt. Katsastustoiminnan on määrä lisätä palveluiden monipuolisuutta mahdollistaen kevyiden ajoneuvojen määräaikais- ja valvontakatsastamisen sekä korjaamisen samassa paikassa. Katsastustoiminnan aloittamista varten teht...

Testing the stability of magnetic iron oxides/kaolinite nanocomposite under various pH conditions

Science.gov (United States)

Tokarčíková, Michaela; Tokarský, Jonáš; Kutláková, Kateřina Mamulová; Seidlerová, Jana

2017-09-01

Magnetically modified clays containing iron oxides nanoparticles (FexOy NPs) are low-cost and environmentally harmless materials suitable for sorption of pollutants from wastewaters. Stability of this smart material was evaluated both experimentally and theoretically using molecular modelling. Original kaolinite and prepared FexOy/kaolinite nanocomposite were characterized using X-ray fluorescence spectroscopy, X-ray powder diffraction, infrared spectroscopy, and transmission electron microscopy, and the stability was studied using leaching tests performed according to the European technical standard EN 12457-2 in deionized water and extraction agents with varying pH (2, 4, 9, and 11). The influence of pH on amount of FexOy NPs released from the composite and amount of the basic elements released from the kaolinite structure was studied using inductively coupled plasma atomic emission spectroscopy. All experiments proved that the magnetic properties of the nanocomposite will not change even after leaching in extraction agents with various pH.

The Role of III-V Substrate Roughness and Deoxidation Induced by Digital Etch in Achieving Low Resistance Metal Contacts

Directory of Open Access Journals (Sweden)

Florent Ravaux

2017-06-01

Full Text Available To achieve low contact resistance between metal and III-V material, transmission-line-model (TLM structures of molybdenum (Mo were fabricated on indium phosphide (InP substrate on the top of an indium gallium arsenide (InGaAs layer grown by molecular beam epitaxy. The contact layer was prepared using a digital etch procedure before metal deposition. The contact resistivity was found to decrease significantly with the cleaning process. High Resolution Transmission & Scanning Electron Microscopy (HRTEM & HRSTEM investigations revealed that the surface roughness of treated samples was increased. Further analysis of the metal-semiconductor interface using Energy Electron Loss Spectroscopy (EELS showed that the amount of oxides (InxOy, GaxOy or AsxOy was significantly decreased for the etched samples. These results suggest that the low contact resistance obtained after digital etching is attributed to the combined effects of the induced surface roughness and oxides removal during the digital etch process.

Metal Oxide Thin Films Grafted on Silica Gel Surfaces: Recent Advances on the Analytical Application of these Materials

Directory of Open Access Journals (Sweden)

Gushikem Yoshitaka

2001-01-01

Full Text Available In the highly dispersed MxOy monolayer film on a porous SiO2 surface, denoted as SiO2/MxOy, the Si-O-M covalent bond formed on the SiO2 surface restricts the mobility of the attached oxide resulting in coordinatively unsaturated metal oxides (LAS in addition to the Brønsted acid sites (BAS. The BAS arise from the MOH and SiOH groups, the latter due to the unreacted silanol groups. As the attached oxides are strongly immobilized on the surface, they are also thermally very stable. The amphoteric character of most of the attached oxides allows the immobilization of various chemical species, acid or bases, resulting in a wide application of these surface modified materials. In this work many of the recent applications of these MxOy coated silica surfaces are described, such as selective adsorbents, in preconcentration processes, as new packing material for use in HPLC, support for immobilization of enzymes, amperometric electrodes, sensors and biosensors

Manufacture, delivery and marketing of wood pellets

International Nuclear Information System (INIS)

Huhtanen, T.

2001-01-01

Wood pellet is a cheap fuel, the use of which can easily bee automated. Pellet heating can be carried out with a stoker or a pellet burner, which can be mounted to oil and solid fuels boiler or to solid fuel boilers. Vapo Oy delivers wood pellet to farms and detached houses via Agrimarket stores. Vapo Oy delivers pellets to large real estates, municipalities, industry, greenhouses and power plants directly as bulk. The pellets are delivered either by trailers or lorries equipped with fan-operated unloaders. The use of wood pellets is a suitable fuel especially for real estates, the boiler output of which is 20 - 1000 kW. Vapo Oy manufactures wood pellets of cutter chips, grinding dust and sawdust. The raw material for Ilomantsi pellet plant is purchased from the province of North Karelia. The capacity of pelletizing plant is 45 000 t of pellets per year, half of which is exported mainly to Sweden and Denmark

Test manufacture of a canister insert

International Nuclear Information System (INIS)

Raiko, H.

2004-11-01

This report describes the insert-manufacturing test of a disposal canister for spent nuclear fuel that was made by Metso Paper Oy, Jyvaeskylae Foundry, in 2003 on contract for Posiva Oy. The test manufacture was a part of the co-operation development programme of encapsulation technology between SKB AB and Posiva Oy. Insert casting was specified according to the current manufacturing specifications of SKB. The canister insert was of BWR-type with integral bottom. This was the first trial manufacture of this type of insert in Finland and, in total, the second test manufacture of insert by Metso Paper. The result fulfilled all the requirements but the material mechanical properties and metallurgical structure of the cast material. The measured tensile strength, ultimate strength and elongation at rupture were lower than specified. The reason for this was revealed in the metallurgical investigation of the cast material. The nodulizing of the graphite was not occurred during the casting process according to the requirements. (orig.)

24 Pesulan seurantaohjelmisto

OpenAIRE

Lumme, Tristan

2017-01-01

Insinöörityö tehtiin 24 Pesula Oy:n projektista, joka suoritettiin Helsingissä. Projektin tarkoituksena oli luoda sovellus listaamaan yrityksen toimipisteiden koneet ja niiden käyttökerrat automatisoidusti tietokantaan. 24 Pesula Oy on vuonna 1999 perustettu yritys ja Suomen ainoa itsepalvelupesulaketju. Aikaisemmin koneiden käytönseuranta hoidettiin siten, että käyttödata haettiin paikan päältä lukemalla yksittäisten koneiden lokitiedot. Yrityksen koneissa käytettiin myös Atmelin modifio...

Meteorological data and update of climate statistics of Olkiluoto 2005 - 2006

International Nuclear Information System (INIS)

Ikonen, A.T.K.

2007-10-01

In this working report the data of some routine field observations of Posiva Oy and automatic measurements of the Olkiluoto nuclear power plant weather station owned and operated by Teollisuuden Voima Oy is published for further reference. The data reported here covers observations in 2005-2006. First, a concise description of data acquisition methods and handling is provided. Thereafter the actual data is presented in the appendices. Weather measurements (e.g. temperature, wind speed and direction, humidity) and snow and ground frost observations are reported. (orig.)

Servicenow-tietämyskannan käyttöönotto ja kehitys

OpenAIRE

Juvonen, Mikko

2013-01-01

Tämän opinnäytetyön tavoitteena oli tutkia ja kehittää ServiceNow-palvelunhallintaohjelmistoa Kaisanet Oy:lle sopivaksi. ServiceNow-ohjelmistosta on Kaisanetille erinäisiä hyötyjä. Se nopeuttaa vikailmoitusten ja palvelu-pyyntöjen ratkaisuaikoja, parantaa ratkaisujen laatua ja tekee ratkaisuista tehokkaampia. Näin ollen samalla henkilöstöllä saadaan ratkaistua suurempi määrä ongelmia ja vikailmoituksia. Ohjelmisto kasvattaa yleisesti Kaisanet Oy:n it-toiminnan laatua ja parantaa sen tehokkuut...

Aquabuoy Wave Energy Converter

DEFF Research Database (Denmark)

Vicinanza, Diego; Margheritini, Lucia; Frigaard, Peter

The work reported here is part of the contract agreement between the Finavera Renewables Ocean Energy Ltd. and the Department of Civil Engineering Hydraulics and Coastal Engineering Laboratory to instrument a model in scale 1:10 to prototype of the AquaBuOY (AB) wave energy converter and to analyse...... its performances in real sea testing in Nissum Bredning, Denmark. This report is part of Fineveras contribution to ForskEl project no 6435 “AquaBuOY skala 1:10 forsøg I Nissum Bredning”....

TEHDASPROSESSIN 3D-MALLINNUS, PROSESSI- JA LAITEKUVAUS

OpenAIRE

Huhtala, Aki

2010-01-01

Opinnäytetyö tehtiin tilauksesta AkkuSer Oy:lle. Tarkoituksena oli kartoittaa tehdasprosessi, selvittää laitetiedot ja luoda 3D-malli tehdasprosessista. Prosessin toiminta kuvattiin. Selvitettiin, miten prosessi eteni ja millä tavoin AkkuSer Oy kierrättää ongelma jätettä. Selitetään, mitkä ovat prosessin lähtökohdat ja mitä tuotteita prosessissa syntyi. Tämän lisäksi mitattiin kuljettimien sekä taajuusmuuttajatoimisten kuljettimien pyörimisnopeuksia. Tehdasprosessi kuvattiin Visual Compon...

Optical imaging of borehole PR10 at Olkiluoto 2006

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2007-03-01

Suomen Malmi Oy carried out optical imaging of borehole PR10 at Olkiluoto site in Eurajoki during December 2006. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and the data processing. This report describes the field operation, the equipment as well as the processing procedures and shows the obtained results and their quality. The raw and processed data are delivered digitally in WellCAD and PDF format. (orig.)

IMS-järjestelmän käyttäminen ammattikeittiöiden ilmanvaihdossa

OpenAIRE

Marttinen, Olli

2017-01-01

Opinnäytetyön tilaajana toimii Jeven Oy. Jeven Oy on vuonna 1989 perustettu mikkeliläinen ammattikeittiöiden ilmanvaihtoon erikoistunut yritys. Opinnäytetyön tavoitteena oli selvittää IMSjärjestelmän käyttömahdollisuus ammattikeittiöiden ilmanvaihdossa sekä vaikutukset lämmöntalteenottojärjestelmään. Opinnäytetyön lähtökohtana oli tutustua erityyppisiin ja kokoisiin ammattikeittiöihin. Kohteiksi valikoituivat Pohjois-Karjalan Keskussairaala (PKSSK) Joensuussa, Ravintola Talli Mikkelissä j...

Myymäläkalusteen tuotekehitys

OpenAIRE

Mehto, Elsa

2015-01-01

Pikval Oy on suomalainen myymäläkalusteiden suunnittelija ja valmistaja Jyväskylän Vaaja-koskella, Keski-Suomessa. Digitalisoitumista ja myymälän kiinnittämistä osaksi verkkokaup-paa on pidetty mahdollisena vaihtoehtona edistää kaupan toimintaa ja asiakaspalvelua suoraan myymälässä. Tähän markkinarakoon Pikval Oy on tarttunut tarjoamillaan Digital Signage -myymäläkalusteilla. Digital Signage -tuotteet ovat mainostamiseen ja asiakkaan informoimiseen soveltuvia näyttöjä, jotka on suunniteltu os...

Growth Hacking for Startups : How Growth Hacking can utilised for growing startups

OpenAIRE

Lee, Jin

2016-01-01

In the era of start-ups, many failed to put out their prototypes or products to the market due to lack of funds or experience in marketing. Growth Hacking is a tool that start-ups can benefit from if they learn what Growth Hacking is and how to implement it. The aim of this thesis is to explore what Growth Hacking is and how to implement it for the commissioner CubiCasa Oy. A couple of Growth Hacking tactics are used for CubiCasa Oy and the process of implementation and findings are rec...

Lahden seudun vapaa-ajan matkailu ja markkinointitoimenpiteet

OpenAIRE

Ranki, Arto

2011-01-01

Opinnäytetyön tarkoituksena on tutkia Lahden seudun markkinoinnin ja markkinointiviestintätoimenpiteiden vaikuttavuutta vapaa-ajan matkailijoihin. Työn tarkoituksena on myös luoda uusi markkinoinnin mittaamisen työkalu Lahti Travel Oy:lle. Opinnäytetyön tutkimusongelmana on selvittää Lahden seudun markkinointitoimenpiteiden laatua, huomioarvoa ja onnistuneisuutta. Työelämälähtöisen opinnäytetyön yhteistyökumppani on Lahti Travel Oy, joka vastaa pääosin Lahden seudun matkailupalveluiden myynni...

Meteorological data at Olkiluoto in period of 2002-2004

International Nuclear Information System (INIS)

Ikonen, A.T.

2005-07-01

In this working report the data of some routine field observations of Posiva Oy and automatic measurements of the Olkiluoto nuclear power plant weather station owned and operated by Teollisuuden Voima Oy is published for further reference. The data reported here covers observations from 2002 to 2004. First, a concise description of data acquisition methods and handling is provided. Thereafter the actual data is presented in the appendices. Weather measurements (e.g. temperature, wind speed and direction, humidity) and snow, ground frost and ditch flow rate observations are reported. (orig.)

Linjasaneerauksen työvaiheiden yhteensovituksen vaikutus linja-aikatauluun

OpenAIRE

Luomala, Joni

2017-01-01

Opinnäytetyössä käsitellään perinteistä putkiremonttia, sen aikataulua ja aikataulun yhteensovittamisen vaikutusta lopulliseen linja-aikatauluun. Opinnäytetyö tehtiin pääkaupunkiseudulla toimivalle talotekniikkaurakointiyritykselle LVIS-Hokka Oy:lle. Opinnäytetyössä perehdytään tarkemmin 1960–70-luvulla rakennettujen kerrostalojen perinteiseen putkiremonttiin ja siinä tehtäviin työvaiheisiin. Työssä on esitelty LVI-, sähkö ja rakennustöiden laajuus huoneistoittain yhden LVIS-Hokka Oy:n li...

CRM-ohjelmiston käyttöönotto tilitoimistossa

OpenAIRE

Kempas, Mervi

2013-01-01

Opinnäytetyössä selvitettiin, mitä Pretax Pohjois-Karjala Oy:n tulisi ottaa huomioon CRM-ohjelmiston käyttöönotossa. Asiakashallinta eli Customer Relationship Management on osa asiakaslähtöistä liiketoimintamallia. Yrityksen liiketoiminta saadaan asiakaslähtöiseksi CRM-ohjelmiston avulla. CRM-ohjelmisto tarjoaa paljon mahdollisuuksia hyödynnettäväksi liiketoiminnassa. Tutkimuskohteena käytettiin Pretax Jyväskylä Oy:tä, jossa CRM-ohjelmisto oli otettu alkuvuodesta 2013 käyttöön. Tutkimustu...

Pakkaustarvikkeiden imuohjauksen suunnittelu ja toteutus kiintokalustetehtaassa

OpenAIRE

Kiviahde, Juho

2015-01-01

Opinnäytetyö on tehty Mellano Oy:lle. Yritys on Suomen johtava kiintokalusteiden valmistaja. Yrityksellä on toimipisteet Lapinlahdella ja Pieksämäellä. Tämä opinnäytetyö tehtiin Mellano Oy Pieksämäen tehtaalle. Opinnäytetyön tavoitteena oli suunnitella ja toteuttaa pakkausmateriaalien imuohjausjärjestelmä käyttäen kanban- kortti menetelmää sekä suunnitella ja toteuttaa pakkausmateriaalien varastointi uudelleen. Työ toteutettiin selvittämällä lähtötilanne, opiskelemalla imuohjauksen t...

Täyteaineiden painatusominaisuudet

OpenAIRE

Takkinen, Annemari

2013-01-01

Opinnäytetyö oli Nordkalk Oy:n teettämä ja työn tavoitteena oli tarkastella uudentyyppisten täyteaineiden vaikutuksia painatusominaisuuksiin. Työssä tutkittiin neljää eri täyteainetta yhdellä täyttöasteella. Opinnäytetyö painottui offset-painomenetelmän painettavuusominaisuuksien tutkimiseen. Työn kokeellinen osa on luottamuksellista aineistoa. This thesis was comissioned from Nordkalk Oy. The aim of the thesis was to research how new fillers affect printing properties. In this thesis four...

Increasing girls’ physical activity during an organised youth sport basketball program: a randomised controlled trial protocol

Science.gov (United States)

2014-01-01

Background Participation in organised youth sports (OYS) has been recommended as an opportunity to increase young peoples’ moderate-to-vigorous physical activity (MVPA) levels. Participants, however, spend a considerable proportion of time during OYS inactive. The purpose of this study, therefore, was to investigate whether coaches who attended coach education sessions (where education on increasing MVPA and decreasing inactivity during training was delivered) can increase players’ MVPA during training sessions over a 5-day basketball program compared to coaches who did not receive coach education sessions. Methods/design A convenience sample of 80 female players and 8 coaches were recruited into the UWS School Holiday Basketball Program in Greater Western Sydney, Australia. A two-arm, parallel-group randomised controlled trial was employed to investigate whether coaches who attended 2 coach education sessions (compared with a no-treatment control) can increase their players’ MVPA during training sessions over a 5-day basketball program. Objectively measured physical activity, directly observed lesson context and leader behaviour, player motivation, players’ perceived autonomy support, and coaching information (regarding training session planning, estimations on player physical activity and lesson context during training, perceived ability to modify training sessions, perceived importance of physical activity during training, intention to increase physical activity/reduce inactivity, and likelihood of increasing physical activity/reducing inactivity) were assessed at baseline (day 1) and at follow-up (day 5). Linear mixed models will be used to analyse between arm differences in changes from baseline to follow-up on all outcomes. Discussion The current trial protocol describes, to our knowledge, the first trial conducted in an OYS context to investigate the efficacy of an intervention, relative to a control, in increasing MVPA. This study’s findings will

SAFIR. The Finnish research programme on nuclear power plant safety 2003-2006. Executive summary

International Nuclear Information System (INIS)

Puska, E.

2006-12-01

Major part of Finnish public research on nuclear power plant safety during the years 2003-2006 has been carried out in the SAFIR programme. The programme has been administrated by the steering group that was nominated by the Ministry of Trade and Industry (KTM). The steering group of SAFIR has consisted of representatives from Radiation and Nuclear Safety Authority (STUK), Ministry of Trade and Industry (KTM), Technical Research Centre of Finland (VTT), Teollisuuden Voima Oy (TVO), Fortum Power and Heat Oy, Fortum Nuclear Services Oy (Fortum), Finnish Funding Agency for Technology and Innovation (Tekes), Helsinki University of Technology (TKK) and Lappeenranta University of Technology (LTY). The key research areas of SAFIR have been (1) reactor fuel and core, (2) reactor circuit and structural safety, (3) containment and process safety functions, that was divided in 2005 into (3a) thermal hydraulics and (3b) severe accidents, (4) automation, control room and IT, (5) organisations and safety management and (6) risk-informed safety management. The research programme has included annually from 20 up to 24 research projects, whose volume has varied from a few person months to several person years. The total volume of the programme during the four year period 2003-2006 has been 19.7 million euros and 148 person years. The research in the programme has been carried out primarily by Technical Research Centre of Finland (VTT). Other research units responsible for the projects include Lappeenranta University of Technology, Fortum Nuclear Services Oy, Helsinki University of Technology and RAMSE Consulting Oy. In addition, there have been a few minor subcontractors in some projects. The programme management structure has consisted of the steering group, a reference group in each of the seven research areas and a number of ad hoc groups in the various research areas. This report gives a short summary of the results of the SAFIR programme for the period January 2003 - November

Assessing the Variability of Heavy Metal Concentrations in Liquid-Solid Two-Phase and Related Environmental Risks in the Weihe River of Shaanxi Province, China

Science.gov (United States)

Song, Jinxi; Yang, Xiaogang; Zhang, Junlong; Long, Yongqing; Zhang, Yan; Zhang, Taifan

2015-01-01

Accurate estimation of the variability of heavy metals in river water and the hyporheic zone is crucial for pollution control and environmental management. The biotoxicities and potential ecological risks of heavy metals (Cu, Zn, Pb, Cd) in a solid-liquid two-phase system were estimated using the Geo-accumulation Index, Potential Ecological Risk Assessment and Quality Standard Index methods in the Weihe River of Shaanxi Province, China. Water and sediment samples were collected from five study sites during spring, summer and winter, 2013. The dominant species in the streambed sediments were chironomids and flutter earthworm, whose bioturbation mainly ranged from 0 to 20 cm. The concentrations of heavy metals in surface water and pore water varied obviously in spring and summer. The degrees of concentration of Cu and Cd in spring and summer were higher than the U.S. water quality Criteria Maximum Concentrations. Furthermore, the biotoxicities of Pb and Zn demonstrated season-spatial variations. The concentrations of Cu, Zn, Pb and Cd in spring and winter were significantly higher than those in summer, and the pollution levels also varied obviously in different layers of the sediments. Moreover, the pollution level of Cd was the most serious, as estimated by all three assessment methods. PMID:26193293

Lipophilic organic pollutants induce changes in phospholipid and membrane protein composition leading to Vero cell morphological change.

Science.gov (United States)

Liao, Ting T; Wang, Lei; Jia, Ru W; Fu, Xiao H; Chua, Hong

2014-01-01

Membrane damage related to morphological change in Vero cells is a sensitive index of the composite biotoxicity of trace lipophilic chemicals. However, judging whether the morphological change in Vero cells happens and its ratio are difficult because it is not a quantitative characteristic. To find biomarkers of cell morphological change for quantitatively representing the ratio of morphological changed cell, the mechanism of cell membrane damage driven by typical lipophilic chemicals, such as trichlorophenol (TCP) and perfluorooctanesulphonate (PFOS), was explored. The ratio of morphologically changed cells generally increased with increased TCP or PFOS concentrations, and the level of four major components of phospholipids varied with concentrations of TCP or PFOS, but only the ratio of phosphatidylcholine (PC)/phosphatidylethanolamine (PE) decreased regularly as TCP or PFOS concentrations increased. Analysis of membrane proteins showed that the level of vimentin in normal cell membranes is high, while it decreases or vanishes after TCP exposure. These variations in phospholipid and membrane protein components may result in membrane leakage and variation in rigid structure, which leads to changes in cell morphology. Therefore, the ratio of PC/PE and amount of vimentin may be potential biomarkers for representing the ratio of morphological changed Vero cell introduced by trace lipophilic compounds, thus their composite bio-toxicity.

A Facile Route to Metal Oxides/Single-Walled Carbon Nanotube Macrofilm Nanocomposites for Energy Storage

Science.gov (United States)

Cao, Zeyuan; Wei, Bingqing

2015-05-01

Nanocomposites consisting of transition-metal oxides and carbon nanomaterials with a desired size and structure are highly demanded for high performance energy storage devices. Here, a facile two-step and cost-efficient approach relying on directly thermal treatment of chemical-vapor-deposition products is developed as a general synthetic method to prepare a family of metal oxides (MxOy (M=Fe, Co, Ni))/single-walled carbon nanotube (SWNT) macrofilm nanocomposites. The MxOy nanoparticles obtained are of 3-17 nm in diameter and homogeneously anchor on the free-standing SWNT macrofilms. NiO/SWNT also exhibits a high specific capacitance of 400 F g-1 and fast charge-transfer Faradaic redox reactions to achieve asymmetric supercapacitors with a high power and energy density. All MxOy/SWNT nanocomposites could deliver a high capacity beyond 1000 mAh g-1 and show excellent cycling stability for lithium-ion batteries. The impressive results demonstrate the promise for energy storage devices and the general approach may pave the way to synthesize other functional nanocomposites.

Tailoring properties of lossy-mode resonance optical fiber sensors with atomic layer deposition technique

Science.gov (United States)

Kosiel, Kamil; Koba, Marcin; Masiewicz, Marcin; Śmietana, Mateusz

2018-06-01

The paper shows application of atomic layer deposition (ALD) technique as a tool for tailoring sensorial properties of lossy-mode-resonance (LMR)-based optical fiber sensors. Hafnium dioxide (HfO2), zirconium dioxide (ZrO2), and tantalum oxide (TaxOy), as high-refractive-index dielectrics that are particularly convenient for LMR-sensor fabrication, were deposited by low-temperature (100 °C) ALD ensuring safe conditions for thermally vulnerable fibers. Applicability of HfO2 and ZrO2 overlays, deposited with ALD-related atomic level thickness accuracy for fabrication of LMR-sensors with controlled sensorial properties was presented. Additionally, for the first time according to our best knowledge, the double-layer overlay composed of two different materials - silicon nitride (SixNy) and TaxOy - is presented for the LMR fiber sensors. The thin films of such overlay were deposited by two different techniques - PECVD (the SixNy) and ALD (the TaxOy). Such approach ensures fast overlay fabrication and at the same time facility for resonant wavelength tuning, yielding devices with satisfactory sensorial properties.

A Facile Route to Metal Oxides/Single-Walled Carbon Nanotube Macrofilm Nanocomposites for Energy Storage

Directory of Open Access Journals (Sweden)

Zeyuan eCao

2015-05-01

Full Text Available Nanocomposites consisting of transition-metal oxides and carbon nanomaterials with a desired size and structure are highly demanded for high performance energy storage devices. Here, a facile two-step and cost-efficient approach relying on directly thermal treatment of chemical-vapor-deposition products is developed as a general synthetic method to prepare a family of metal oxides (MxOy (M=Fe, Co, Ni/single-walled carbon nanotube (SWNT macrofilm nanocomposites. The MxOy nanoparticles obtained are of 3-17 nm in diameter and homogeneously anchor on the free-standing SWNT macrofilms. NiO/SWNT also exhibits a high specific capacitance of 400 F g-1 and fast charge-transfer Faradaic redox reactions to achieve asymmetric supercapacitors with a high power and energy density. All MxOy/SWNT nanocomposites could deliver a high capacity beyond 1000 mAh g-1 and show excellent cycling stability for lithium-ion batteries. The impressive results demonstrate the promise for energy storage devices and the general approach may pave the way to synthesize other functional nanocomposites.

Nanomaterials and the environmental risk: is there some room left for ethics and law?

Science.gov (United States)

Byk, Christian

2011-01-01

How legitimate may be the concern posed by the nanotechnologies for health and environment,this effort for reaching a better knowledge of the biotoxicity of nanomaterials is not enough. As Pr Didier Sicard noted, we believe that the ethical reflection should not be the good conscience that may help science in getting rid of social fears. But the ethical reflection is there also to discuss taboo issues in the perspective of a better societal understanding.

Effect of wood fuels on power plant operability

International Nuclear Information System (INIS)

Orjala, M.; Ingalsuo, R.

2001-01-01

The objective of the research is to determine the critical properties of wood fuels on the basis of power plant operability, to determine the optimal conditions for reduction of harmful detriments, and to study how the storage and processing of wood fuels effect on the operability. Both the CFB and BFB technologies are studied. The project started in December 2000 and it will be ended by the end of 2002. Experts of the Fuels and Combustion research field of VTT Energy carry out the main parts of the research. Experts of the research field of Mineral Processing of VTT Chemical Technology, located in Outokumpu, and Kemian tutkimuspalvelut Oy/Oulu University, located in Outokumpu, participate in the analytics, and the research field of Materials and Manufacturing Technology of VTT Manufacturing Technology in Otaniemi participates in the research on material effects. System Technology Laboratory of Oulu University carries out the power plant automation and boiler control technology research under supervision of Professor Urpo Kortela. Co-operation with the materials research unit of EU's JRC, located in Petten, which started in the research 'Combustion of Forest Chips', will be continues in this research. Co-operation will be made with Swedish Vaermeforsk in the field of information exchange on experiences in utilisation of wood fuels in Swedish power plants and possibilities to join in the projects of Vaermeforsk in this research field. Following companies participate in the project: Etelae-Savon Energia Oy, Foster Wheeler Energia Oy, Kvaerner Pulping Oy, Simpele pasteboard factory of M-Real Oyj and Vaermeforsk AB (Sweden). (orig.)

Acute toxicity and genotoxicity of fermented traditional medicine oyaksungi-san.

Science.gov (United States)

Park, Hwayong; Hwang, Youn-Hwan; Ma, Jin Yeul

2017-06-01

The traditional medicine oyaksungi-san (OY) has been prescribed in East Asia for hundreds of years for the treatment of stroke, paralysis, and ataxia. OY also has therapeutic effects on arthralgia, myalgia, and rheumatoid arthritis, and recent studies have shown its protective effects against apoptosis of hippocampal cells and its anti-inflammatory effects on the peripheral blood cells of patient with cerebral infarction. Many studies have explored the use of traditional medicine and herb materials in the development of safe, novel, and effective pharmaceuticals with fewer side effects. These efforts commonly adopt a bioconversion tool for fermentation with beneficial microbes. However, only pharmaceuticals with high levels of safety and low levels of toxicity can be used in healthcare system. OY water extract was fermented with Lactobacillus and assayed for acute toxicity and genotoxicity. Single dose acute toxicity, bacterial reverse mutation, chromosome aberrations, and micronucleus were observed and assayed in rats, histidine/tryptophan auxotrophic bacteria, Chinese hamster ovary fibroblast cells, and mice bone marrow cells, respectively. All the experimental animals showed no abnormal behavior, clinical signs, body weight increases, or mortality. In the bacterial cultures, no revertant colonies were observed. Morphological and numerical chromosomal aberrations were not found in all metaphases examined. Frequency of induced micronuclei was not significantly increased in all doses applied. As a whole, no acute toxicity or genotoxicity were observed in all the assays examined. Therefore, fermented OY is considered to be a safe material that can be used for development of complementary and alternative medicine using bioconversion.

Assessment of Sr-90 in water samples: precision and accuracy

International Nuclear Information System (INIS)

Nisti, Marcelo B.; Saueia, Cátia H.R.; Castilho, Bruna; Mazzilli, Barbara P.

2017-01-01

The study of artificial radionuclides dispersion into the environment is very important to control the nuclear waste discharges, nuclear accidents and nuclear weapons testing. The accidents in Fukushima Daiichi Nuclear Power Plant and Chernobyl Nuclear Power Plant, released several radionuclides in the environment by aerial deposition and liquid discharge, with various level of radioactivity. The 90 Sr was one of the elements released into the environment. The 90 Sr is produced by nuclear fission with a physical half-life of 28.79 years with decay energy of 0.546 MeV. The aims of this study are to evaluate the precision and accuracy of three methodologies for the determination of 90 Sr in water samples: Cerenkov, LSC direct method and with radiochemical separation. The performance of the methodologies was evaluated by using two scintillation counters (Quantulus and Hidex). The parameters Minimum Detectable Activity (MDA) and Figure Of Merit (FOM) were determined for each method, the precision and accuracy were checked using 90 Sr standard solutions. (author)

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available phytoplasma OY-M] ... Length = 73 ... Query: 1 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAG...PVDKF 60 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAGPVDKF Sbjct: 1 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAGPVDKF 60 ...

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available phytoplasma OY-M] ... Length = 91 ... Query: 5 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRN...VLPQF 64 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRNVLPQF Sbjct: 1 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRNVLPQF 60 ...

Geophysical borehole logging of the boreholes KR37, KR37B and KR38, at Olkiluoto 2005

International Nuclear Information System (INIS)

Majapuro, J.

2006-03-01

Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR37, KR37b and KR38 at the Olkiluoto site in Eurajoki during September and October 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Ferriittinen ruostumaton teräs syvävetoprosessissa

OpenAIRE

Oksanen, Kyösti

2011-01-01

Tämä opinnäytetyö käsittelee ferriittisen ruostumattoman teräksen soveltamista syvävetoprosessiin. Työ tehdään Stala Oy:lle. Työn tarkoituksena on tutkia mahdollisuutta soveltaa hinnaltaan edullisempaa ferriittistä ruostumatonta terästä nyt käytetyn austeniittisen laadun sijasta. Sovelluskohteena on Stala P40R -allaskomponentti. Ferriittinen materiaali on tyypiltään EN 1.4509. Opinnäytetyön ensimmäinen osio käsittelee Stala Oy – yritystä, syvävetämisen teoriaa ja EN 1.4509 ominaisuuksis...

Improvements of high temperature properties of iron ore agglomerate

Energy Technology Data Exchange (ETDEWEB)

Lilius, K.R. [Helsinki Univ. of Technology, Otaniemi (Finland). Materials Science and Rock Engineering

1996-12-31

This final report is about research done in 1992-94 in the framework of Jernkontoret project JK 2131/92, at Helsinki University of Technology, Finland. The aim of this study was the investigation of reduction of magnetite and wuestite in different reduction conditions and influence of doping of CaO and MgO thereon. Project participants were: Jernkontoret (Stockholm), Fundia Wire Oy (Koverhar), Rautaruukki Oy (Raahe), SSAB Oxeloesund AB (Oxeloesund), SSAB Tunnplaat AB (Luleaa), LKAB (Malmberget), Royal School of Technology (Stockholm), Luleaa University of Technology (Luleaa) and Helsinki University of Technology (Espoo) SULA 2 Research Programme; 12 refs.

Geophysical borehole logging of the boreholes KR23 extension, KR29 and KR29b at Olkiluoto 2004

International Nuclear Information System (INIS)

Lahti, M.; Heikkinen, E.

2005-04-01

Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR23 extension, KR25b, KR29 and KR29b at the Olkiluoto site in Eurajoki during October 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Improvements of high temperature properties of iron ore agglomerate

Energy Technology Data Exchange (ETDEWEB)

Lilius, K R [Helsinki Univ. of Technology, Otaniemi (Finland). Materials Science and Rock Engineering

1997-12-31

This final report is about research done in 1992-94 in the framework of Jernkontoret project JK 2131/92, at Helsinki University of Technology, Finland. The aim of this study was the investigation of reduction of magnetite and wuestite in different reduction conditions and influence of doping of CaO and MgO thereon. Project participants were: Jernkontoret (Stockholm), Fundia Wire Oy (Koverhar), Rautaruukki Oy (Raahe), SSAB Oxeloesund AB (Oxeloesund), SSAB Tunnplaat AB (Luleaa), LKAB (Malmberget), Royal School of Technology (Stockholm), Luleaa University of Technology (Luleaa) and Helsinki University of Technology (Espoo) SULA 2 Research Programme; 12 refs.

MS CRM 3.0 Dymamics SBS

OpenAIRE

Salmensuu, Jussi

2008-01-01

Tämä opinnäytetyö käsittelee kuinka Microsoftin Customer Relationship Management (CRM) 3.0 SBS toimisi Primanet Oy:lle, joka on pieni IT-ylläpitoa ja - palveluja tarjoava yritys. Opinnäytetyön tavoitteena oli luoda testiympäristö, joka kattaisi CRM - järjestelmän testaamisen seuraavin osa-aluein: toimeksiantojen käsittely, asiakastietokannan luominen ja ylläpitäminen, työjonojen hallinta ja niihin liittyvät toiminnot. Primanet Oy päätti lähteä kokeilemaan CRM -järjestelmän soveltuvuutta, kosk...

Tiedonkeruujärjestelmän kehitys ja käyttöönotto

OpenAIRE

Uusitalo, Jarkko

2007-01-01

Tämän opinnäytetyön tavoitteena oli kehittää Rauman Akku Oy:n tiedonkeruujärjestelmää. Uusi viivakoodijärjestelmä on joustavampi ja helpompi käyttää kuin vanha systeemi. Lisäksi viivakoodijärjestelmä poistaa virheet manuaalisesta tiedonsyötöstä ja nopeuttaa tiedon siirtoa. Kehitys siis korvaa vanhan systeemin viivakoodijärjestelmällä. Vaihtoehtoina oli viivakoodi ja saattomuisti, mutta jälkimmäinen olisi ollut liian hankala toteuttaa. Syy tälle kehityshakuisuudelle on se, että Rauman Akku Oy ...

Geophysical borehole logging of the boreholes KR23 extension, KR29 and KR29b at Olkiluoto 2004

Energy Technology Data Exchange (ETDEWEB)

Lahti, M. [Suomen Malmi Oy, Espoo (Finland); Heikkinen, E. [JP-Fintact Oy, Vantaa (Finland)

2005-04-15

Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR23 extension, KR25b, KR29 and KR29b at the Olkiluoto site in Eurajoki during October 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Marketing Plan for Urheiluareena Oy

OpenAIRE

Venables, Simon

2013-01-01

The role of marketing is an essential part of any enterprise. Marketing is the key element that seeks to meet customer’s demand for a good or service to the supply of the good or service. Without Marketing a customer would not know of the product that would satisfy their need or demand for a product. It is this connection of meeting the desires of the customers with the capabilities and competences of the business that is the very core of the strategic marketing process. These two key factors...

GLOBAALI PALKKAHALLINTO : CASE: Yritys Oy

OpenAIRE

Salo, Paula

2017-01-01

Kehittämistyössä tutkittiin globaalia palkkahallintoa, sen käsitettä, vaatimuksia ja globaalin palkkahallinnon käyttöönottoa kansainvälisesti toimivassa yrityksessä. Tavoitteena oli löytää keinoja, joilla kohdeyritys pääsee tavoitteisiinsa palkkahallinnon toteuttamisessa. Kehittämistyö tehtiin kevään 2016 ja kevään 2017 välisenä aikana haastatellen ja havainnoiden käynnissä olevaa palkkahallinnon projektia. Kehittämistyön teoreettisessa osuudessa käydään läpi ulkoistamisen syyt lyhyesti ...

Osatuloutusmenettelyn arviointia : case Konepaja Oy

OpenAIRE

Kaarnavaara, Anu

2011-01-01

Kirjanpidon perussääntöjä on suoriteperusteisuus: suoritteen vaihtaessa omistajaa suoritteen luovuttajalle vaihdanta tietää tuloa ja vastaanottajalle menoa. Osatuloutus on poikkeus tähän sääntöön. Siinä pääperiaatteena on suoritteen valmistumisasteeseen perustuva jaksottaminen, kun pitkän valmistusajan vaativan suoritteen tulo kirjataan tuotoksi. Tämän opinnäytetyön toimeksiantajana on laivateollisuudessa toimiva varsinaissuomalainen yritys, josta käytetään työssä nimeä Konepaja. Yri...

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... phytoplasma OY-M] ... Length = 97 ... Query: 5 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANV...YYTILSDDPTVLKLTEE 64 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANVYYTILS...DDPTVLKLTEE Sbjct: 1 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANVYYTILSDDPTVLKLTEE 60 ...

Experiences of CFD simulations at Foster Wheeler Energia Oy`s Karhula R and D center

Energy Technology Data Exchange (ETDEWEB)

Hyppaenen, T. [Foster Wheeler Energia Oy, Karhula (Finland). Karhula R and D Center

1996-12-31

Karhula R and D Center is specialized in the research of solid fuel combustion based on circulating fluidized bed technology. Since the 1970`s, numerical models have been utilized in process development to enhance fundamental understanding of the technology. Both own and commercial computer models have been used. Until now, a special problem in circulating fluidized beds has been the modeling of dense phase multiphase flow, especially for industrial solid-fuel boilers. This has prevented the Karhula R and D Center from using commercial codes, and as a consequence, own modeling approaches have been necessary. This presentation describes some main points of the modeling activities in circulating fluidized bed boilers. (author)

Experiences of CFD simulations at Foster Wheeler Energia Oy`s Karhula R and D center

Energy Technology Data Exchange (ETDEWEB)

Hyppaenen, T [Foster Wheeler Energia Oy, Karhula (Finland). Karhula R and D Center

1997-12-31

Karhula R and D Center is specialized in the research of solid fuel combustion based on circulating fluidized bed technology. Since the 1970`s, numerical models have been utilized in process development to enhance fundamental understanding of the technology. Both own and commercial computer models have been used. Until now, a special problem in circulating fluidized beds has been the modeling of dense phase multiphase flow, especially for industrial solid-fuel boilers. This has prevented the Karhula R and D Center from using commercial codes, and as a consequence, own modeling approaches have been necessary. This presentation describes some main points of the modeling activities in circulating fluidized bed boilers. (author)

Formas de potássio em solos de várzea e sua disponibilidade para o feijoeiro Potassium forms in lowland soils and availability to common bean

Directory of Open Access Journals (Sweden)

M. R. Villa

2004-08-01

Full Text Available O presente estudo teve como objetivos caracterizar as formas de K em solos de várzea e o aproveitamento dessas formas pela planta, avaliar a resposta do feijoeiro à aplicação desse nutriente nesses solos e determinar os seus níveis críticos nos solos e nas plantas. O delineamento experimental utilizado foi o inteiramente casualizado, em esquema fatorial 4 x 5, com quatro repetições, sendo quatro solos de várzea [Gleissolo Melânico (GM, Gleissolo Háplico (GX, Neossolo Flúvico (RU e Organossolo Méssico (OY] e cinco níveis de saturação por K da CTC potencial (natural, 4, 6, 8 e 10 %. Foram cultivadas quatro plantas de feijoeiro (Phaseolus vulgaris L. por vaso até a produção de grãos. Amostras dos solos foram coletadas para a determinação do K total, não-trocável, trocável, em solução, disponível pelos extratores Mehlich-1 e Resina e medidas da relação Quantidade/Intensidade de K. Os teores de K total e K não-trocável foram maiores nos solos OY e RU, enquanto os teores de K trocável e K em solução foram maiores nos solos OY e GM. As saturações críticas por K da CTC potencial foram de 5,0, 4,1, 8,7 e 5,3 %, enquanto os níveis críticos de K foliar foram de 17,9, 30,5, 16,8 e 14,6 mg kg-1, para os solos OY, GM, GX e RU, respectivamente.The present study had as objectives to characterize K forms, plant use of these forms and to evaluate the common bean (Phaseolus vulgaris L. response to K application in four lowland soils. It was also sought to determine the critical levels for K in soils and plant. The experimental design was completely randomized in a 4 x 5 factorial scheme with four replications. The treatments were a combination of four lowland soils [Mesic Organosoil (OY, Melanic Gleysoil (GM, Haplic Gleysoil (GX, and Fluvic Neosoil (RU] and five K CEC saturation levels (native, 4, 6, 8, and 10 %. Four bean plants per pot were cultivated until grain production. Soil samples were analyzed for total K, non

Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coating.

Science.gov (United States)

Hübsch, C; Dellinger, P; Maier, H J; Stemme, F; Bruns, M; Stiesch, M; Borchers, L

2015-01-01

In this study, the application of transparent physical vapor deposition (PVD) coatings on zirconia ceramics was examined as an approach to retard the low-temperature degradation of zirconia for dental applications. Transparent monolayers of titanium oxide (TixOy) and multilayers consisting of titanium oxide-alumina-titanium oxide (TixOy-AlxOy-TixOy) were deposited onto standardized discs of 3Y-TZP using magnetron sputtering. Using X-ray photospectroscopy and time-of-flight secondary-ion mass spectrometry, the compositions of the coatings were verified, and an approximate thickness of 50 nm for each type of coating was ascertained. After aging the coated and uncoated samples in water vapor at 134°C and 3 bar for 4, 8, 16, 32, 64 and 128 h, the monoclinic phase content was determined using X-ray diffraction, and its impact on mechanical properties was assessed in biaxial flexural strength tests. In addition, the depth of the transformation zone was measured from scanning electron microscopy images of the fracture surfaces of hydrothermally aged samples. The results revealed that the tetragonal-to-monoclinic phase transformation of the zirconia ceramic was retarded by the application of PVD coatings. During the first stages of aging, the coated samples exhibited a significantly lower monoclinic phase content than the uncoated samples and, after 128 h of aging, showed a transformation zone which was only ∼12-15 μm thick compared to ∼30 μm in the control group. Biaxial flexural strength decreased by ∼10% during aging and was not influenced by the application of a PVD coating. Copyright © 2014 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

Unique morphological changes in plant pathogenic phytoplasma-infected petunia flowers are related to transcriptional regulation of floral homeotic genes in an organ-specific manner.

Science.gov (United States)

Himeno, Misako; Neriya, Yutaro; Minato, Nami; Miura, Chihiro; Sugawara, Kyoko; Ishii, Yoshiko; Yamaji, Yasuyuki; Kakizawa, Shigeyuki; Oshima, Kenro; Namba, Shigetou

2011-09-01

Abnormal flowers are often induced by infection of certain plant pathogens, e.g. phytoplasma, but the molecular mechanisms underlying these malformations have remained poorly understood. Here, we show that infection with OY-W phytoplasma (Candidatus Phytoplasma asteris, onion yellows phytoplasma strain, line OY-W) affects the expression of the floral homeotic genes of petunia plants in an organ-specific manner. Upon infection with OY-W phytoplasma, floral morphological changes, including conversion to leaf-like structures, were observed in sepals, petals and pistils, but not in stamens. As the expression levels of homeotic genes differ greatly between floral organs, we examined the expression levels of homeotic genes in each floral organ infected by OY-W phytoplasma, compared with healthy plants. The expression levels of several homeotic genes required for organ development, such as PFG, PhGLO1 and FBP7, were significantly downregulated by the phytoplasma infection in floral organs, except the stamens, suggesting that the unique morphological changes caused by the phytoplasma infection might result from the significant decrease in expression of some crucial homeotic genes. Moreover, the expression levels of TER, ALF and DOT genes, which are known to participate in floral meristem identity, were significantly downregulated in the phytoplasma-infected petunia meristems, implying that phytoplasma would affect an upstream signaling pathway of floral meristem identity. Our results suggest that phytoplasma infection may have complex effects on floral development, resulting in the unique phenotypes that were clearly distinct from the mutant flower phenotypes produced by the knock-out or the overexpression of certain homeotic genes. © 2011 The Authors. The Plant Journal © 2011 Blackwell Publishing Ltd.

Refraction seismic surveys in the investigation trench TK3 area in Olkiluoto, Eurajoki 2004

Energy Technology Data Exchange (ETDEWEB)

Ihalainen, M. [Suomen Malmi Oy, Espoo (Finland)

2005-03-15

Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, the ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) conducted refraction seismic surveys at Olkiluoto site in Eurajoki. The work was ordered by Posiva Oy. The field work was carried out during May and June 2004. On five profiles S70-S74 totally 1002.5 m was surveyed. The purpose of the work was to determine the overburden thickness and to study bedrock properties, e.g. eventual fractured zones. The work consisted of staking, levelling, seismic measurements, interpretation and reporting. Fieldwork and interpretation were concluded by May and June 2004. Previously in 2000 and 2002 Smoy has carried out 33.0 km of seismic surveys in the area. (orig.)

Performan produksi ternak domba dengan program intensifikasi beranak dua kali setahun

Directory of Open Access Journals (Sweden)

I Gedi Putu

1995-08-01

Full Text Available A total of 350, three to four year old Daldale ewes were allocated into two treatment groups balanced for age and liveweight. Group TY was joined twice yearly (April-May and September-October and group OY was joined once yearly (April-May. Three percent of fertile rams fitted with ewe marking crayons and harnesses were used in each group during the six weeks joining period. The productive performance were recorded during three years period. The average raddling rate, lambing rate and number of lambs born per ewe in the TY group were signicantly higher than those of the OY group (P0.05. Total weaning weight of lambs horn from both the TY and OY groups for the first, second and third year of research were 2.29 vs 2.49 tons, 2.50 vs 2.63 tons and 1.43 vs 2.34 tons, respectively. It was concluded that the Daldale ewes showed a high proportion of oestrual activity in all year round indicating their suitability for the use in the intensification of sheep husbandry. However, the twice yearly lambing program is still need further research particlularly in selecting breed and other supporting factors.

ORF Alignment: NC_005303 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... protein [Onion yellows phytoplasma OY-M] ... Length = 102 ... Query: 2 ... LNNIQLIGRITHDPEKQYINS...NNEQIPKIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY 61 ... LNNIQLIGRITHDPEKQYINSNNEQIP...KIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY Sbjct: 1 ... LNNIQLIGRITHDPEKQYINSNNEQIPKIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY 60 ...

Kuorma-auton tiedonsiirtoväylät ja HMS 990:n käyttö

OpenAIRE

Paajanen, Petri

2015-01-01

Tämän insinöörityön tavoitteena on selvittää Mercedes-Benz Actros -kuorma-auton tiedonsiirtoväylien toiminnan teoriaa sekä tarkastella merkkikorjaamojen käytössä olevaan HMS 990 -diagnostiikkatyökalua. Työn tilaajana on Veho Group Oy Ab. Varsinaisen insinöörityön liitteenä syntyi koulutusmateriaalia väylävikojen diagnosointiin Veho Oy:n käyttöön. Väylätekniikkaa on ollut ajoneuvoissa jo vuosia. Tiedonsiirtoväylien avulla saadaan mm. yksinkertaistettua ajoneuvojen sähköjärjestelmää ja kor...

Geophysical logging and imaging of shallow drillholes ONK-PP262 and ONK-274 at Olkiluoto in 2010

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2011-11-01

Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP262 and ONK-PP274 at ONKALO in the investigation niche ONK-TKU-4 (Hydco) in May and in December 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

5S-menetelmän implementointi

OpenAIRE

Kaikula, Kari-Marko

2017-01-01

Tässä opinnäytetyössä tavoiteltiin siisteyden ja järjestyksen tuomista 5S-menetelmän avulla Helen Oy:n kunnossapidon varaosavarastoon Salmisaaren voimalaitoksella. Helen Oy on Helsingin kaupungin omistama energia-alan yritys. Kehittämistehtävänä työssä oli 5S-menetelmän implementointi. Tutkimuksen tarkoituksena oli tutkia niitä seikkoja, jotka vaikuttavat 5S-menetelmän käyttöönottoon. 5S on menetelmä, jolla tuodaan siisteyttä ja järjestystä työympäristöön. Tutkimusmenetelmänä oli toiminta...

Sisäisen logistiikan parantaminen myymälöiden näkökulmasta

OpenAIRE

Pennanen, Elli

2010-01-01

Tässä insinöörityössä tutustuttiin Pentik Oy:n tilaus-toimitusketjuun etenkin myymälöiden näkökulmasta. Työn tarkoituksena oli tutkia ja parantaa sisäistä logistiikkaa erityisesti myymälöiden näkökulmasta, mistä johtuen yrityksen muihin toimintoihin ei olla erityisemmin keskitytty. Pentik Oy on noussut yhdeksi Suomen suurimmista myymäläketjuista sisustuksen saralla. Vuonna 2009 liikevaihto oli 37,1 miljoonaa euroa ja yritys työllisti yli 300 henkilöä, joista suurin osa työskentelee myymälöiss...

Optical imaging of the boreholes KR37, KR37B and KR38 at Olkiluoto 2005

International Nuclear Information System (INIS)

Majapuro, J.

2006-02-01

Suomen Malmi Oy conducted optical imaging surveys of the boreholes KR37, KR37B and KR38 at the Olkiluoto site in Eurajoki during September 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and preliminary processing of the images. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality through example images. The raw and processed data are delivered digitally in WellCAD format. The images are also attached to the appendix CD of this report in Adobe Acrobat PDF-format. (orig.)

Pretreatment and preheating of scrap. Tarkastelu koskien romun esikaesittely- ja esikuumennusmenetelmiae

Energy Technology Data Exchange (ETDEWEB)

Hooli, P.; Hanni, J. (Outokumpu Oy Tornion Tehtaat, Tornio (Finland))

1990-01-01

As a background for this study has been those demands for scrap treatments and transportation, which are coming with increasing production of melting shop of Outokumpu Oy's Tornio works and also problems caused by snow among productionrate. Different pretreatment-, transport-, and preheatingmethods and some alternatives has been studied to arrange those as a functioning complete. Also very exact plannings for some pretreatmentmethods has been made. From preheatingmethods some methods, which are concerned to be effective and possible in the future has been studied. In addition those parameters, which are involved to the effectivity of preheating process in melting shop of Outokumpu Oy's Tornio works has been examined.

Summary report - development of laboratory tests and the stress- strain behaviour of Olkiluoto mica gneiss

Energy Technology Data Exchange (ETDEWEB)

Hakala, M.; Heikkilae, E. [Helsinki Univ. of Technology, Espoo (Finland). Lab. of Rock Engineering

1997-05-01

This work summarizes the project aimed at developing and qualifying a suitable combination of laboratory tests to establish a statistically reliable stress-strain behaviour of the main rock types at Posiva Oy`s detailed investigation sites for disposal of spent nuclear fuel. The work includes literature study of stress-strain behaviour of brittle rock, development and qualification of laboratory tests, suggested test procedures and interpretation methods and finally testing of Olkiluoto mica gneiss. The Olkiluoto study includes over 130 loading tests. Besides the commonly used laboratory tests, direct tensile tests, damage controlled tests and acoustic emission measurements were also carried out. (orig.) (54 refs.).

Geophysical logging and imaging of characterisation drillholes ONK-KR13, ONK-KR14 and ONK-KR15

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2011-08-01

Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of drillholes ONK-KR13, ONK-KR14 and ONK-KR15 at ONKALO in June-July 2010 and in March 2011. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

Efectividad de siete productos antimancha contra ceratocystis sp. en madera de hevea brasiliensis muell arg. (hule

Directory of Open Access Journals (Sweden)

M. Fuentes Salinas

2002-01-01

Full Text Available El presente trabajo se realizó con el objeto de conocer la eficacia de siete productos antimancha que se comercializan en México, contra el hongo manchador Ceratocystis sp. en madera aserrada de Hevea brasiliensis (hule, mediante el método de los discos, conjuntamente con la norma ASTM D 4445-91. Los productos están elaborados a partir de pentaclorofenato de sodio, tres de ellos, siendo Osmotox, Pentatox y Biotox; tres más están hechos a base de metil bistiocianato y 2-tiocianometiltio benzotiazol y son Busan 1009, Busan 1450 y Busan 1071, y el séptimo solamente contiene 2-tiocianometiltio benzotiazol, siendo el Busan 1118. La concentración mínima observada para evitar el manchado de la madera (crecimiento cero en un tiempo de 4 semanas, para cada uno de los productos ensayados se obtuvo para Osmotox de 4.68 %, para Pentatox de 2.82 %, para Biotox de 3.24 %, para Busan 1118 de 2.00 % y para Busan 1009, Busan 1450 y Busan 1071 una concentración menor a 0.25%. Tomando en cuenta los precios comerciales de cada producto y de acuerdo con las concentraciones mínimas efectivas para crecimiento cero obtenidas, el tratamiento con Busan 1071 es el más económico y más efectivo.

Surface and interfacial chemistry of high-k dielectric and interconnect materials on silicon

Science.gov (United States)

Kirsch, Paul Daniel

Surfaces and interfaces play a critical role in the manufacture and function of silicon based integrated circuits. It is therefore reasonable to study the chemistries at these surfaces and interfaces to improve existing processes and to develop new ones. Model barium strontium titanate high-k dielectric systems have been deposited on ultrathin silicon oxynitride in ultrahigh vacuum. The resulting nanostructures are characterized with secondary ion mass spectroscopy (SIMS) and X-ray photoelectron spectroscopy (XPS). An interfacial reaction between Ba and Sr atoms and SiOxNy was found to create silicates, BaSixOy or SrSi xOy. Inclusion of N in the interfacial oxide decreased silicate formation in both Ba and Sr systems. Furthermore, inclusion of N in the interfacial oxide decreased the penetration of Ba and Sr containing species, such as silicides and silicates. Sputter deposited HfO2 was studied on nitrided and unnitrided Si(100) surfaces. XPS and SIMS were used to verify the presence of interfacial HfSixOy and estimate its relative amount on both nitrided and unnitrided samples. More HfSixOy formed without the SiNx interfacial layer. These interfacial chemistry results are then used to explain the electrical measurements obtained from metal oxide semiconductor (MOS) capacitors. MOS capacitors with interfacial SiNx exhibit reduced leakage current and increased capacitance. Lastly, surface science techniques were used to develop a processing technique for reducing thin films of copper (II) and copper (I) oxide to copper. Deuterium atoms (D*) and methyl radicals (CH3*) were shown to reduce Cu 2+ and/or Cu1+ to Cu0 within 30 min at a surface temperature of 400 K under a flux of 1 x 1015 atoms/cm2s. Temperature programmed desorption experiments suggest that oxygen leaves the surface as D2O and CO2 for the D* and CH3* treated surfaces, respectively.

Materials properties of hafnium and zirconium silicates: Metal interdiffusion and dopant penetration studies

Science.gov (United States)

Quevedo Lopez, Manuel Angel

Hafnium and Zirconium based gate dielectrics are considered potential candidates to replace SiO2 or SiON as the gate dielectric in CMOS processing. Furthermore, the addition of nitrogen into this pseudo-binary alloy has been shown to improve their thermal stability, electrical properties, and reduce dopant penetration. Because CMOS processing requires high temperature anneals (up to 1050°C), it is important to understand the diffusion properties of any metal associated with the gate dielectric in silicon at these temperatures. In addition, dopant penetration from the doped polysilicon gate into the Si channel at these temperatures must also be studied. Impurity outdiffusion (Hf, Zr) from the dielectric, or dopant (B, As, P) penetration through the dielectric into the channel region would likely result in deleterious effects upon the carrier mobility. In this dissertation extensive thermal stability studies of alternate gate dielectric candidates ZrSixOy and HfSixO y are presented. Dopant penetration studies from doped-polysilicon through HfSixOy and HfSixOyNz are also presented. Rutherford Backscattering Spectroscopy (RBS), Heavy Ion RBS (HI-RBS), X-ray Photoelectron Spectroscopy (XPS), High Resolution Transmission Electron Microscopy (HR-TEM), and Time of Flight and Dynamic Secondary Ion Mass Spectroscopy (ToF-SIMS, D-SIMS) methods were used to characterize these materials. The dopant diffusivity is calculated by modeling of the dopant profiles in the Si substrate. In this disseration is reported that Hf silicate films are more stable than Zr silicate films, from the metal interdiffusion point of view. On the other hand, dopant (B, As, and P) penetration is observed for HfSixO y films. However, the addition of nitrogen to the Hf - Si - O systems improves the dopant penetration properties of the resulting HfSi xOyNz films.

Improvement in genetic characteristics and oil yield of selected soybean progenies from octuple crosses

Directory of Open Access Journals (Sweden)

Hamawaki Osvaldo Toshiyuki

2000-01-01

Full Text Available The objective of the present study was to evaluate 44 soybean octuple crosses in the F4:3[8] and F5:3[8] generations in order to select progenies superior for seed oil yield (OY and other important agronomic characteristics. Octuple crosses were hybridized in a chain mating system. In one group, crosses were carried out for three generations with the adapted x exotic parents until octuple crosses with 75% adapted genes and 25% exotic genes were obtained. In a second group, hybridization of adapted x adapted parents originated crosses with 100% adapted genes. During the growing season 1994/95, the progenies F4:3[8] were evaluated by using the augmented block design. The progenies F5:3[8] were evaluated during the growing season 1995/96 in three experiments using augmented block design without repetition. The octuple crosses gave origin to superior progenies for all the characters studied. In the C22 cross, OY values were 707 kg/ha. The estimates of heritability in relation to the crosses average resulted in the following mean, minimum and maximum values, respectively: number of days to maturity (52.35%, 3.71%, 84.23%; agronomic value (26.69%, 1.62%, 61.28% and grain yield (29.28%, 1.52%, 61.06%. The observed genetic gains for grain yield in the early, intermediate and late F5:3[8] progenies were superior to the expected genetic gains and the observed genetic gains for OY were more expressive in the early and late F5:[8] progenies. The genetic variability remaining in the selected progenies of some crosses suggests that further genetic gains for grain yield and OY might be possible with advanced selection cycles.

Helsingi ehitab : lõppes Musiikkitalo konkurss / Ingrid Lillemägi

Index Scriptorium Estoniae

Lillemägi, Ingrid

2000-01-01

Helsingi uue kontserdimaja nn. Musiikkitalo rahvusvahelisest arhitektuurikonkursist, mille võitsid arhitektid Ola Laiho, Mikko Pulkkinen ja Marko Kivistö arhitektuuribüroost Laiho, Pulkkinen & Raunio OY

News/High speed oil defense boat

Energy Technology Data Exchange (ETDEWEB)

1978-01-01

An oil defense boat that can travel at 30 knots to the scene of a spill and surround the polluted area or protect a nearby beach or harbor, with a 200 m floating plastic barrier within 20 minutes, has been developed by Vator Oy of Helsinki in association with the Finnish Board of Navigation. The Vator 18T boat, which can carry a crew of three or four, has a trimaran glass reinforced plastic hull. The floating plastic barrier (Nokia SUP Spillbooms) is produced by the Oy Nokia A.B., Cable Works Division of Helsinki and is made of a PVC-coated fabric enclosing floats of polyethylene foam and either chain ballast or iron sinkers.

ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2011-08-01

Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

Geophysical drillhole logging and imaging of drillholes OL-KR51, OL-KR52, OL-KR52B, OL-KR53 and OL-KR53B at Olkiluoto in 2009 and 2010

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2010-10-01

Suomen Malmi Oy conducted geophysical drillhole logging and optical imaging of the drillholes OL-KR51, OL-KR52, OL-KR52B, OL-KR53 and OL-KR53B at the Olkiluoto site in Eurajoki between November 2009 and February 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

Geophysical borehole logging of the boreholes KR30, KR31, KR31b, KR32, KR33, KR33b and KR24 Upper Part, at Olkiluoto 2005

International Nuclear Information System (INIS)

Majapuro, J.

2005-12-01

Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR30, KR31, KR31B, KR32, KR33, KR33B and KR24 upper part at the Olkiluoto site in Eurajoki during December 2004, January, February and September 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Geophysical borehole logging, dummy-sonding and optical imaging of the borehole OL-KR24 at Olkiluoto 2005

International Nuclear Information System (INIS)

Majapuro, J.

2006-03-01

Suomen Malmi Oy conducted geophysical borehole logging, dummy-sonding and optical imaging surveys of the borehole OL-KR24 at the Olkiluoto site in Eurajoki during 1.10.2005 - 4.10.2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The methods applied are caliper survey and optical imaging. The assignment included the field work of surveys, interpretation and processing of the data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Artificial intelligence in nuclear power plants. Vol. 2

International Nuclear Information System (INIS)

Haapanen, P.J.

1990-01-01

The IAEA Specialists' Meeting on Artificial Intelligence in Nuclear Power Plants was arranged in Helsinki/Vantaa, Finland, on October 10-12, 1989, under auspices of the International Working Group of Nuclear Power Plant Control and Instrumentation of the International Atomic Energy Agency (IAEA/IWG NPPCI). Technical Research Centre of Finland together with Imatran Voima Oy and Teollisuuden Voima Oy answered for the practical arrangements of the meeting. 105 participants from 17 countries and 2 international organizations took part in the meeting and 58 papers were submitted for presentation. These papers gave a comprehensive picture of the recent status and further trends in applying the rapidly developing techniques of and safety in designing and using of nuclear power worldwide

Presentation of TVO's visitor's centre

International Nuclear Information System (INIS)

Aemmaelae, V.M.

1993-01-01

There are four nuclear power plant units in Finland, two of which are PWR's owned by Imatran Voima Oy. The two BWR units are located at Olkiluoto and owned by Teollisuuden Voima Oy. This presentation tells about TVO's concept of informing the visitors at Olkiluoto. At the site there are located, in addition to the two nuclear power plant units, the intermediate storage for spent fuel, the repository for low and medium-active waste as well as the training centre. At the Olkiluoto Visitor's Centre all the activities of the company are presented using varied audio-visual aids. The centre has several exhibits and there are also different installations to show how the plant works. (author)

Geophysical borehole logging of the boreholes KR30, KR31, KR31b, KR32, KR33, KR33b and KR24 Upper Part, at Olkiluoto 2005

Energy Technology Data Exchange (ETDEWEB)

Majapuro, J. [Suomen Malmi Oy, Espoo (Finland)

2005-12-15

Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR30, KR31, KR31B, KR32, KR33, KR33B and KR24 upper part at the Olkiluoto site in Eurajoki during December 2004, January, February and September 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Optical imaging of drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OL-KR42B, OL-KR43 and OL-KR43B at Olkiluoto, 2006 and 2007

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2007-03-01

Suomen Malmi Oy carried out optical imaging of drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OL-KR42B, OL-KR43 and OL-KR43B at Olkiluoto site in Eurajoki during July, August, November and December 2006 as well as January 2007. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and the data processing. This report describes the field operation, the equipment as well as the processing procedures and shows the obtained results and their quality. The raw and processed data are delivered digitally in WellCAD and PDF format. (orig.)

LHV kinnitab Soome laenuturul kanda / Silvia Kruusmaa ; kommenteerinud Raul Malmstein

Index Scriptorium Estoniae

Kruusmaa, Silvia

2010-01-01

LHV sai Soome finantsinspektsioonilt loa hakata osutama piiriüleseid teenuseid Soomes, pank sõlmis Luottotalo Fenno Oy-ga laenuportfelli ostulepingu, omandades ligikaudu 12 500 eraisiku laenulepingud

Assessment of Sr-90 in water samples: precision and accuracy

Energy Technology Data Exchange (ETDEWEB)

Nisti, Marcelo B.; Saueia, Cátia H.R.; Castilho, Bruna; Mazzilli, Barbara P., E-mail: mbnisti@ipen.br, E-mail: chsaueia@ipen.br, E-mail: bcastilho@ipen.br, E-mail: mazzilli@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2017-11-01

The study of artificial radionuclides dispersion into the environment is very important to control the nuclear waste discharges, nuclear accidents and nuclear weapons testing. The accidents in Fukushima Daiichi Nuclear Power Plant and Chernobyl Nuclear Power Plant, released several radionuclides in the environment by aerial deposition and liquid discharge, with various level of radioactivity. The {sup 90}Sr was one of the elements released into the environment. The {sup 90}Sr is produced by nuclear fission with a physical half-life of 28.79 years with decay energy of 0.546 MeV. The aims of this study are to evaluate the precision and accuracy of three methodologies for the determination of {sup 90}Sr in water samples: Cerenkov, LSC direct method and with radiochemical separation. The performance of the methodologies was evaluated by using two scintillation counters (Quantulus and Hidex). The parameters Minimum Detectable Activity (MDA) and Figure Of Merit (FOM) were determined for each method, the precision and accuracy were checked using {sup 90}Sr standard solutions. (author)

On-line gross alpha radiation monitoring of natural waters with extractive scintillating resins

International Nuclear Information System (INIS)

Hughes, Lara; De Vol, T.A.

2003-01-01

Extractive scintillating resins, which are used to simultaneously separate and quantify radioactivity in aqueous solutions, were developed for low-level alpha radiation monitoring of natural waters. Resins were investigated with bis(2-ethylhexyl)methane-diphosphonic acid (H 2 DEH[MDP], Dipex[reg]) extractant, which has a strong affinity for tri-, tetra- and hexavalent actinides in dilute acids. Extractive scintillating resins were manifested (1) as a mixed bed of scintillating resin and extraction chromatographic resin and (2) by diffusing the organic fluor 2-(1-naphtyl)-5-phenyloxazole into macroporous polystyrene chromatographic resin, then coating with H 2 DEH[MDP], or by coating H 2 DEH[MDP] on scintillating polyvinyltoluene beads. The scintillation light was detected with a modified Hidex Triathler to allow for continuous flow measurements. The average detection efficiencies were 51.7±2.6% and 65.8±10.1% for natural uranium and 241 Am, respectively, for the extractant coated scintillator. The resin was stable for solution flow of up to 1000 ml resulting in rapid real-time quantification of natural uranium in groundwater down to 30 μg/ml

Alkogol v Estonii - ne kazhdomu po pletshu / Andrei Akulistõi

Index Scriptorium Estoniae

Akulistõi, Andrei

2005-01-01

Onistari senine tegevjuht Oleg Kraizmer lahkus ettevõttest, aastatel 2001-2004 jõudis alkoholitootja 60 miljonilise kahjumini. Oleg Kraizmer jätkab firma Saimaa Beverages Oy Ltd ekspordiosakonna juhina

Dissolved organic matter removal using magnetic anion exchange resin treatment on biological effluent of textile dyeing wastewater.

Science.gov (United States)

Fan, Jun; Li, Haibo; Shuang, Chendong; Li, Wentao; Li, Aimin

2014-08-01

This study investigated the removal of dissolved organic matter (DOM) from real dyeing bio-treatment effluents (DBEs) with the use of a novel magnetic anion exchange resin (NDMP). DOMs in two typical DBEs were fractionized using DAX-8/XAD-4 resin and ultrafiltration membranes. The hydrophilic fractions and the low molecular weight (MW) (50%) of DOMs for the two effluents. The hydrophilic and low MW fractions of both effluents were the greatest contributors of specific UV254 absorbance (SUVA254), and the SUVA254 of DOM fractions decreased with hydrophobicity and MW. Two DBEs exhibited acute and chronic biotoxicities. Both acute and chronic toxicities of DOM fractions increased linearly with the increase of SUVA254 value. Kinetics of dissolved organic carbon (DOC) removal via NDMP treatment was performed by comparing it with that of particle active carbon (PAC). Results indicated that the removal of DOC from DBEs via NDMP was 60%, whereas DOC removals by PAC were lower than 15%. Acidic organics could be significantly removed with the use of NDMP. DOM with large MW in DBE could be removed significantly by using the same means. Removal efficiency of NDMP for DOM decreased with the decrease of MW. Compared with PAC, NDMP could significantly reduce the acute and chronic bio-toxicities of DBEs. NaCl/NaOH mixture regenerants, with selected concentrations of 10% NaCl (m/m)/1% NaOH (m/m), could improve desorption efficiency. Copyright © 2014. Published by Elsevier B.V.

Heavy metals and PCDD/Fs in solid waste incinerator fly ash in Zhejiang province, China: chemical and bio-analytical characterization.

Science.gov (United States)

Yao, Jun; Li, Wenbing; Xia, Fangfang; Zheng, Yuange; Fang, Chengran; Shen, Dongsheng

2012-06-01

Fly ash samples were taken from solid waste incinerators with different feeding waste, furnace type, and air pollution control device in six cities of Zhejiang province. The solid waste incinerators there constitute one fifth of incinerators in China. Heavy metals and polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) were analyzed in the fly ash. Moreover, the fly ash samples were extracted by toxicity characteristic leaching procedure (TCLP). The biotoxicity of the leachate was evaluated by Chlorella pyrenoidosa. High variation and contents were found for both the heavy metals and PCDD/Fs. The contents of Zn, Cu, As, Pb, Cd, Cr, Ni, and Hg in the fly ash samples varied from 300 to 32,100, 62.1-1175, 1.1-57, 61.6-620, 0.4-223, 16.6-4380, 1.2-94.7, and 0.03-1.4 μg g(-1) dw, respectively. The total contents of 17 PCDD/Fs varied from 0.1128 to 127.7939 μg g(-1) dw, and the 2,3,7,8-TeCDD toxic equivalents (TEQ) of PCDD/Fs ranged from 0.009 to 6.177 μg g(-1) dw. PCDF congeners were the main contributor to the TEQ. The leachate of the fly ash showed biotoxicity to C. pyrenoidosa. A significant correlation was found between the Cd and EC(50) values. Further research is required to investigate the environmental impact of the various pollutants in the fly ash.

Contribution of attendant anions on cadmium toxicity to soil enzymes.

Science.gov (United States)

Tian, Haixia; Kong, Long; Megharaj, Mallavarapu; He, Wenxiang

2017-11-01

Sorption and desorption are critical processes to control the mobility and biotoxicity of cadmium (Cd) in soils. It is known that attendant anion species of heavy metals could affect metal adsorption on soils and might further alter their biotoxicity. However, for Cd, the influence of attendant anions on its sorption in soils and subsequent toxicity on soil enzymes are still unknown. In this work, four Cd compounds with different salt anions (SO 4 2- , NO 3 - , Cl - , and Ac - ) were selected to investigate their impact of on the sorption, soil dehydrogenase activity (DHA) and alkaline phosphatase activity (ALP). Thus, a series of simulated Cd pollution batch experiments including measuring adsorption-desorption behavior of Cd on soils and soil enzyme activities were carried out. Results showed that CdSO 4 exhibited highest sorption capacity among the tested soils except in Hunan soil. The Cd sorption with NO 3 - displayed a similar behavior with Cl - on all tested soils. Compared with soil properties, all four kinds of anions on Cd sorption played a more significant role affecting Cd ecological toxicity to soil DHA and ALP. Cd in acetate or nitrate form appears more sensitive towards DHA than sulphate and chloride, while the later pair is more toxic towards ALP than the former. These results have important implications for evaluation of Cd contamination using soil enzyme as bioindicator. Copyright © 2017 Elsevier Ltd. All rights reserved.

Vuorovaikutteisuus Valio Oy:n Facebook-sivuilla

OpenAIRE

Heikkinen, Sanna

2014-01-01

Tässä tutkimustyyppisessä ja laadullisessa opinnäytetyössä tutkitaan Valion Facebook-sivujen vuorovaikutteisuutta. Työ on rajattu käsittelemään ainoastaan yritysten Facebook-sivuilla tapahtuvaa kuluttajille suunnattua viestintää. Tavoitteena oli tutkia Valion Facebook-sivujen vuorovaikutteisuuden tilaa ja tarjota Valiolle keinoja ja vinkkejä, joiden avulle se voi parantaa vuorovaikutteisuutta Facebook-sivuillaan. Tavoitteena oli myös työn aiheen asiantuntijaksi kasvaminen. Työssä käydään ...

3Oy SUPERCONDUCTOR IN BIPOLARON MODEL

African Journals Online (AJOL)

D. Mani Kongnine, A. Hamrita and K. Napo

1 sept. 2016 ... ION supraconducteurs, le cuivre et l'oxygène jouent un rôle prépondéran supraconductivité. Pour le composé supraconducteur YBa2Cu3O (Y re sont à distinguer : le cuivre Cu(1) qui forme avec les atomes d'ox t le cuivre Cu(2) qui forme avec l'oxygène les plans CuO2 [1, 2]. la supraconductivité dans les ...

Automation of library system: A study of John Harris library ...

African Journals Online (AJOL)

Information Technologist (The) ... and querying library records, maintains defaulting patrons overdue fines account while the OPAC empl oy ... The automated system generates reports necessary for an informed management decision making.

Geophysical drillhole logging of the drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OLKR42B, OL-KR43 and OL-KR43B, at Olkiluoto 2006 and 2007

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2007-05-01

Suomen Malmi Oy conducted geophysical borehole logging of the boreholes drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OL-KR42B, OL-KR43 and OL-KR43B at the Olkiluoto site in Eurajoki during August, September, December 2006 and January 2007. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

Ice detection and deicing system improves the economics of a wind turbine in the arctic weather conditions

Energy Technology Data Exchange (ETDEWEB)

Maekinen, J [Labko Ice Detection Oy (Finland)

1996-12-31

The Finnish Lapland is an excellent test area for the wind turbines due to strong winds and heavy icing. Also the need of ice protection is evident, for wind turbines cannot be used in the area at all without such devices which keep the blades free of ice, rime frost or heavy snow. Labco Ice Detection Oy has been working in good cooperation with VTT and Kemijoki Oy to solve this problem technically and economically by developing an ice detector and deicing system. This system detects ice when its thickness is 0,5 mm and melts it so that the blades will stay clean during the ice accretion. The enclosed estimation process indicates that the investment in this system is economically profitable. (author)

Ice detection and deicing system improves the economics of a wind turbine in the arctic weather conditions

Energy Technology Data Exchange (ETDEWEB)

Maekinen, J. [Labko Ice Detection Oy (Finland)

1995-12-31

The Finnish Lapland is an excellent test area for the wind turbines due to strong winds and heavy icing. Also the need of ice protection is evident, for wind turbines cannot be used in the area at all without such devices which keep the blades free of ice, rime frost or heavy snow. Labco Ice Detection Oy has been working in good cooperation with VTT and Kemijoki Oy to solve this problem technically and economically by developing an ice detector and deicing system. This system detects ice when its thickness is 0,5 mm and melts it so that the blades will stay clean during the ice accretion. The enclosed estimation process indicates that the investment in this system is economically profitable. (author)

Artificial intelligence in nuclear power plants

International Nuclear Information System (INIS)

Haapanen, P.J.

1990-01-01

The IAEA Specialists' Meeting on Artificial Intelligence in Nuclear Power Plants was arranged in Helsink/Vantaa, Finland, on October 10-12, 1989, under auspices of the International Working Group of Nuclear Power Plant Control and Instrumentation of the International Atomic Energy Agency (IAEA/IWG NPPCI). Technical Research Centre of Finland together with Imatran Voima Oy and Teollisuuden Voima Oy answered for the practical arrangements of the meeting. 105 participants from 17 countries and 2 international organizations took part in the meeting and 58 papers were submitted for presentation. These papers gave a comprehensive picture of the recent status and further trends in applying the rapidly developing techniques of artificial intelligence and expert systems to improve the quality and safety in designing and using of nuclear power worldwide

Silver manganese oxide electrodes for lithium batteries

Science.gov (United States)

Thackeray, Michael M.; Vaughey, John T.; Dees, Dennis W.

2006-05-09

This invention relates to electrodes for non-aqueous lithium cells and batteries with silver manganese oxide positive electrodes, denoted AgxMnOy, in which x and y are such that the manganese ions in the charged or partially charged electrodes cells have an average oxidation state greater than 3.5. The silver manganese oxide electrodes optionally contain silver powder and/or silver foil to assist in current collection at the electrodes and to improve the power capability of the cells or batteries. The invention relates also to a method for preparing AgxMnOy electrodes by decomposition of a permanganate salt, such as AgMnO4, or by the decomposition of KMnO4 or LiMnO4 in the presence of a silver salt.

Optical imaging of the boreholes KR29, KR29B, KR30, KR31, KR31B, KR32, KR33 and KR33B, at Olkiluoto 2005

International Nuclear Information System (INIS)

Majapuro, J.

2006-02-01

Suomen Malmi Oy conducted optical imaging surveys of the boreholes KR29, KR29B, KR30, KR31, KR31B, KR32, KR33 and KR33B at the Olkiluoto site in Eurajoki during June 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and preliminary processing of the images. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality through example images. The raw and processed data are delivered digitally in WellCAD format. The images are also attached to the appendix CD of this report in Adobe Acrobat PDF-format. (orig.)

75 FR 38030 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

Science.gov (United States)

2010-07-01

... disruption to summer fisheries, as no additional restrictions to fishery management measures are necessary at... impacts within the lowered yelloweye rockfish OY in accordance with the court's order; makes routine in...

Narva Elektrijaamade renoveerimine - projekti ettevalmistus, teostus ja tulemused / Mati Uus

Index Scriptorium Estoniae

Uus, Mati

2005-01-01

2001. a. sõlmis AS Narva Elektrijaamad tarnelepingu Soome firmaga Foster Wheeler Energia OY kahe energiaploki kompleksseks renoveerimiseks. Lepingu maksumus oli 244 miljonit eurot ning ühe ploki ehitusaeg 30 kuud

50 CFR 600.330 - National Standard 5-Efficiency.

Science.gov (United States)

2010-10-01

...) Efficiency. In theory, an efficient fishery would harvest the OY with the minimum use of economic inputs such... techniques of harvesting, processing, or marketing, and should avoid creating strong incentives for excessive...

An effort to improve the operators' habits of actions in normal operations and in disturbance situations at TVO NPP in Finland

International Nuclear Information System (INIS)

Karlsson, C.

2004-01-01

Teollisuuden Voima Oy owns and operates two ABB BWR's, each of 850 MW net outputs. A full-scope training simulator was commissioned in March 1990 at the TVO Olkiluoto plant site. This paper discusses the development of a method to evaluate and improve the operators' habits of actions in a task performance at the Teollisuuden Voima Oy full-scope training simulator. The development of the method started as a study in autumn 1992 and the first goal of the study was to analyse the dynamics of operators' decision making in the on-line control of a disturbance situation. The analysis was ready in 1994. The second goal was to develop out of the analysis method a tool that could serve as the instructor's in evaluating the individuals and the crew's simulator performances. It was assumed that such a tool would enhance the efficiency of the simulator training, because with it the instructors could provide more explicit performance feedback for the operators. The next stage was to apply the method to the entire simulator training and create a course, which consists of a theoretical part and practical training on the simulator. That was done in the retraining period in 1998. The future goals are to improve the method so that it will be used in all the simulator training at the Teollisuuden Voima Oy full-scope training simulator (OLKS). (author)

Soomlase disainitud tool sai preemia

Index Scriptorium Estoniae

2005-01-01

Isku OY disaineri Tapio Anttila loodud tool Haiku sai rahvusvahelisel disainikonkursil ADEX 2004 mööbli kategoorias Adex Silveri preemia. Mullu sai sama tool Chicago arhitektuuri- ja disainimuuseumi preemia Good Design Award

Millest unistad ja kelleks tahad saada, ilus poiss? / Kati Murutar

Index Scriptorium Estoniae

Murutar, Kati, 1967-

2008-01-01

Rene Vilbre noortefilm "Mina olin siin", mille aluseks on Sass Henno romaan "Mina olin siin. Esimene arest" : osades Rasmus Kaljujärv, Hele Kõre, Tambet Tuisk, Jaan Rekkor : Amrion Productions - Helsinki-filmi OY

Walnut and almond oil screw-press extraction at industrial scale: Effects of process parameters on oil yield and quality; Extracción de aceite de nuez y almendra a escala industrial: efecto de parámetros del proceso sobre el rendimiento y la calidad del aceite

Energy Technology Data Exchange (ETDEWEB)

Martínez, M. L.; Bordón, M.G.; Bodoira, R. M.; Penci, M.C.; Ribotta, P.D.; Maestri, D.M.

2017-07-01

Walnut and almond kernels are highly nutritious mainly due to their high oil contents. In this study, 32 factorial experimental designs were used to optimize processes for oil extraction by screw-pressing at industrial scale. Experimental designs included seed moisture content (SMC), and restriction die (RD) as the main processing parameters. Theoretical models were scanned against experimental data in order to optimize oil extraction conditions. The response variables analyzed were oil yield (OY), fine solid content (FC) in oil, and oil quality parameters. Fitted models for OY indicated maximum predicted values similar to the highest experimental values. Walnut oil extractions showed a maximum OY (84.5 ± 2.3 %) at 7.21% SMC, and 10 mm RD. For almond kernels, maximum OY (71.9 ± 3.5%) was obtained at 9.42% SMC, and 12 mm RD. Chemical quality parameters from both oils were in the ranges stated in Codex (FAO/WHO) standards for virgin (non-refined) oils. [Spanish] La nuez y almendra son frutos sumamente nutritivos debido a su alto contenido de aceite. Mediante un diseño experimental de tipo factorial 32 se optimizó el proceso de extracción de estos aceites con prensa de tornillo a escala industrial. Las variables de proceso analizadas fueron el contenido de humedad de la semilla (CHS) y el diámetro de reducción (DR). Los modelos ajustados para rendimiento de aceite (RA) indicaron valores máximos predichos similares a los valores experimentales. Las extracciones de aceite de nuez mostraron un RA máximo (84,5 ± 2,3%) a 7,21% CHS, y 10 mm DR. Para almendra, se obtuvo un máximo de RA (71,9 ± 3,5%) con 9,42% de CHS y 12 mm de DR. Los parámetros de calidad química de ambos aceites se encontraban en los rangos establecidos en las normas del Codex (FAO / OMS) para aceites vírgenes (no refinados).

Visualization and interpretation of the year 2004 mise-a-la-masse survey data at Olkiluoto site

International Nuclear Information System (INIS)

Lehtonen, T.

2006-01-01

This report concerns mise-a-la-masse surveys conducted from late autumn 2004 to early winter 2005 at the area of the underground characterisation facility (Onkalo) and surroundings. Surveys were made in 21 boreholes and at 6 ground survey areas. Suomen Malmi Oy conducted the fieldwork. Astrock Oy supervised field surveys and processed, interpreted and reported acquired data for Posiva Oy. The purpose of the study was to collect data for geological modelling with following continuity of the conducting features in bedrock from borehole to borehole and to ground surface. These conducting features in bedrock are often linked with lithologic characters or weakness zones. A basis for the current survey was the previous mine-a-la-masse measurements and their results. Current earthings were placed in 26 electrically conducting structures in 8 boreholes and in one outcrop. Current earthings were situated in boreholes KR4, KR7, KR8, KR25, KR27, KR28, KR29 and KR33. Electrical connections were probed in 22 boreholes and at 6 ground survey areas. The acquired survey data were collected to xyz-coordinate oriented databases for 3D processing, interpreting and visualization of the results. At first the data were transferred to Oasis Montaj, where the potential field profiles were drawn and studied borehole-by-borehole current earthing at a time to determine characteristics of the electrical connections. Next were constructed probable connections between boreholes and moved to SurpacVision for visualisation. They were delivered for Posiva Oy as Surpac string and DTM files. With the mise-a-la-masse data, it was possible to determine numerous low dipping electrically conducting structures. Ground surveys were hampered strongly by electrical disturbances of the infrastructure of the Olkiluoto. Results of the all surveys are also collected in the same table, where every one of connections is classified. Interpretations are merely based on mise-a-la-masse data. (orig.)

Visualization and interpretation of the year 2005 mise-a-la-masse survey data at Olkiluoto site

International Nuclear Information System (INIS)

Lehtonen, T.

2006-06-01

This report concerns mise-a-la-masse surveys conducted autumn 2005 at the area of the underground characterisation facility (Onkalo) and surroundings. Surveys were made in 14 boreholes and at 1 ground survey area. Suomen Malmi Oy conducted the fieldwork. Astrock Oy supervised field surveys and processed, interpreted and reported acquired data for Posiva Oy. The purpose of the study was to collect data for geological modelling with following continuity of the conducting features in bedrock from borehole to borehole and to ground surface. These conducting features in bedrock are often linked with lithologic characters or weakness zones. A basis for the current survey was the previous mine-a-la-masse measurements and their results. Current earthings were placed in 15 electrically conducting structures in 8 boreholes and in one outcrop. Current earthings were situated in boreholes KR4, KR7, KR25, KR27 and KR37. Electrical connections were probed in 14 boreholes and at 1 ground survey area. The acquired survey data were collected to xyz-coordinate oriented databases for 3D processing, interpreting and visualization of the results. At first the data were transferred to Oasis Montaj, where the potential field profiles were drawn and studied borehole-by-borehole current earthing at a time to determine characteristics of the electrical connections. Next probable connections between boreholes and moved were constructed and moved to SurpacVision for visualisation. They were delivered for Posiva Oy as Surpac string and DTM files. With the mise-a-la-masse data, it was possible to determine numerous low dipping electrically conducting structures. Additionally previously detected conducting structures were updated with the observations and interpretations. Ground surveys were hampered strongly by electrical disturbances of the infrastructure of the Olkiluoto. Results of the all surveys are also collected in the same table, where every one of connections is classified

Polumilliardnõi spor budut reshat v Londone / Artur Tooman

Index Scriptorium Estoniae

Tooman, Artur, 1971-

2006-01-01

Soome peatöövõtja Foster Wheeler Energia OY nõuab rahvusvahelise arbitraazhi kaudu Eesti Energialt 38 miljonit eurot, tegemist on Narva Elektrijaamade energiablokkide renoveerimise lepingu ja selle täitmisel tekkinud vaidlusega

Geophysical drillhole logging and optical imaging of the drillholes OL-KR43, OL-KR44, OL-KR44B, OL-KR45, OL-KR45B, OL-KR46, OL-KR46B, OL-KR47, OL-KR47B and OL-KR48, at Olkiluoto 2007 and 2008

International Nuclear Information System (INIS)

Tarvainen, A.-M.; Heikkinen, E.

2008-09-01

Suomen Malmi Oy conducted geophysical drillhole logging and optical imaging of the drillholes OL-KR43, OL-KR44, OL-KR44B, OL-KR45, OL-KR45B, OL-KR46, OL-KR46B, OL-KR47, OL-KR47B and OL-KR48 at the Olkiluoto site in Eurajoki during December 2007, May 2008. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

Geophysical borehole logging and optical imaging of the pilot hole ONK-PH2

International Nuclear Information System (INIS)

Lahti, M.; Heikkinen, E.

2005-01-01

Suomen Malmi Oy conducted geophysical borehole logging and optical imaging surveys of pilot hole ONK-PH2 in ONKALO tunnel at the Olkiluoto site in December 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The methods applied are magnetic susceptibility, natural gamma radiation, gamma-gamma density, single point resistance, Wenner-resistivity, borehole radar, full waveform sonic and optical imaging. The assignment included the field work of all the surveys, integration of the data as well as interpretation of the acoustic and borehole radar data. The report describes the field operation, equipment, processing procedures, interpretation results and shows the obtained geophysical and image data. The data as well as the interpretation results are delivered digitally in WellCAD and Excel format. (orig.)

Geophysical borehole logging and optical imaging of the boreholes KR34, KR35 and KR36, at Olkiluoto 2005

International Nuclear Information System (INIS)

Majapuro, J.

2005-09-01

Suomen Malmi Oy conducted geophysical borehole logging and optical imaging surveys of the boreholes KR34, KR35 and KR36 at the Olkiluoto site in Eurajoki during May - June 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The methods applied are magnetic susceptibility, natural gamma radiation, gamma-gamma density, single point resistance, Wenner-resistivity, borehole radar, full waveform sonic and optical imaging. The assignment included the field work of all surveys, interpretation and processing of the acoustic and borehole radar data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Geophysical borehole logging and optical imaging of the pilot hole ONK-PH2

Energy Technology Data Exchange (ETDEWEB)

Lahti, M. [Suomen Malmi Oy, Espoo (Finland); Heikkinen, E. [JP-Fintact Oy, Vantaa (Finland)

2005-01-15

Suomen Malmi Oy conducted geophysical borehole logging and optical imaging surveys of pilot hole ONK-PH2 in ONKALO tunnel at the Olkiluoto site in December 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The methods applied are magnetic susceptibility, natural gamma radiation, gamma-gamma density, single point resistance, Wenner-resistivity, borehole radar, full waveform sonic and optical imaging. The assignment included the field work of all the surveys, integration of the data as well as interpretation of the acoustic and borehole radar data. The report describes the field operation, equipment, processing procedures, interpretation results and shows the obtained geophysical and image data. The data as well as the interpretation results are delivered digitally in WellCAD and Excel format. (orig.)

Geophysical borehole logging and optical imaging of the boreholes KR34, KR35 and KR36, at Olkiluoto 2005

Energy Technology Data Exchange (ETDEWEB)

Majapuro, J. [Suomen Malmi Oy, Espoo (Finland)

2005-09-15

Suomen Malmi Oy conducted geophysical borehole logging and optical imaging surveys of the boreholes KR34, KR35 and KR36 at the Olkiluoto site in Eurajoki during May - June 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The methods applied are magnetic susceptibility, natural gamma radiation, gamma-gamma density, single point resistance, Wenner-resistivity, borehole radar, full waveform sonic and optical imaging. The assignment included the field work of all surveys, interpretation and processing of the acoustic and borehole radar data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

Hoiupanga peahoone. Tallinn, Rävala pst. 5

Index Scriptorium Estoniae

1998-01-01

Projekteerimise ajaloost: 1985. a. Tallinna Moemaja arhitektuurikonkurss ja 1988. a. RPIs "Eesti Tööstusprojekt" valmis ENSV Kergetööstuse Ministeeriumi Teaduslik-Tehnilise Keskuse ja Tallinna Moemaja I ehitusjärgu projekt (R. Kurvitz, U. Muru); !991. a. AS Astlanda ärikeskuse tellimusel krundi hoonestamiseks eskiisprojekt (J. Okas, M. Lõoke) ning alternatiivprojekt (T. Altosaar). Kvartali hoonestuskava: Arhitektuuribüroo Kalle Rõõmus. Projekteerijad: SRV OY, arhitekt Kari Mökkälä, Arhitektuuribüroo Kalle Rõõmus, arhitekt Kullervo Kliimand. Sisekujundus: ARS Interjöörprojekt, autorid Karolin Kõll, Eero Jürgenson, Martin Pärn. Projektijuht: SRV Teräsbetooni Oy. Ehituse peatöövõtt: Eesti Ehitus. Konstruktiivne osa: E - Inseneribüroo. Projekt 1995-97, valmis 1997. Täismonteeritav karkasssüsteemis 7-korruseline büroohoone

Mise-a-la-Masse Measurements at Olkiluoto in 2010

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2010-10-01

Suomen Malmi Oy carried out Mise-a-la-Masse measurements at Olkiluoto site in Eurajoki during March-June 2010. The survey consisted of measurements in 9 drillholes and on 76 surface profiles. The measured drillholes were OL-KR11, OL-KR40, OLKR44, OL-KR45 and OL-KR49..OL-KR53. Surface measurements were carried out at 4 different areas. Current electrodes were placed in drillholes OL-KR49 - OL-KR53. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work. This report describes the field operation, the equipment and shows the obtained results and their quality. The raw and processed data are delivered digitally in Microsoft Ecxel format. (orig.)

Esilinastus väge täis "Mina olin siin" / Kutt Kommel

Index Scriptorium Estoniae

Kommel, Kutt

2008-01-01

Rene Vilbre noortefilm "Mina olin siin", mille aluseks on Sass Henno romaan "Mina olin siin. Esimene arest" : operaator Mait Mäekivi : osades Rasmus Kaljujärv, Hele Kõre jt : Amrion Productions - Helsinki-filmi OY 2008

Tartu teadlased aitavad välja mõelda Ebola-vastast vaktsiini / Aime Jõgi

Index Scriptorium Estoniae

Jõgi, Aime, 1958-

2014-01-01

Eesti biotehnoloogiafirma Icosagen hakkab koos Soome ettevõtte FIT Biotech Oy'ga välja töötama Ebola viiruse vastast vaktsiini, arendustöös osaleb ka Tartu Ülikooli Tehnoloogiainstituudi rakendusviroloogia labor

Protective effect of apple (Ralls) polyphenol extract against aluminum-induced cognitive impairment and oxidative damage in rat.

Science.gov (United States)

Cheng, Dai; Xi, Yu; Cao, Jiankang; Cao, Dongdong; Ma, Yuxia; Jiang, Weibo

2014-12-01

Aluminum (Al) has long been implicated in the pathogenesis of Alzheimer's disease (AD). Dietary polyphenols have been strongly associated with reduced risk of AD and the other nervous diseases. We aimed to evaluate the preventive effect of the apple polyphenol extract (APE) on Al-induced biotoxicity, in order to provide a new focus on the design of strategies to prevent AD and the other human diseases related to Al overload. Control, Al-treated (171.8 mg Al kg(-1)day(-1) 10 weeks), APE+Al (Al-treatment as previously plus 200 mg kg(-1)day(-1) 10 weeks), and group of APE per se were used. Al intake caused memory impairment, significant decrease of acetylcholinesterase, CK, SOD, CAT activity and the rate of ATP synthesis, increase the Al content, the level of malondialdehyde and β-amyloid 42. Administration of APE significantly improved memory retention, attenuated oxidative damage, acetylcholinesterase activity and Al level in Al treated rats. Furthermore, chlorogenic acid (ChA) was used for analyzing stability of polyphenols-Al(3+) complex. Log K1 was 10.51, and the mole ratio of Al(3+) to ligand was 1:1. We further found that the amounts of Al increased significantly in feces of the rats gavaged with AlCl3 plus ChA compared with AlCl3. Our finding has shown APE has neuroprotective effects against Al-induced biotoxicity. Chelating with Al and disturbing its absorption could account for the neuroprotective roles of dietary polyphenols against Al toxicity. Copyright © 2014 Elsevier Inc. All rights reserved.

Chemical reactivities of the superconducting oxides, YBa2Cu3Oy and BiSrCaCu2Oy

International Nuclear Information System (INIS)

Toyama, Hisashi; Mizuno, Noritaka; Misono, Makoto

1989-01-01

The chemical reactivities of YBa 2 Cu 3 O y and BiSrCaCu 2 O y with various gases have been studied. It was found that large quantities of NO, CO, and NO 2 were rapidly absorbed (or intercalated) in the bulk of YBa 2 Cu 3 O y (T c : 90 K) at 573 K. The amount absorbed was in the order NO ∼ CO ∼ NO 2 > O 2 ∼ CO 2 > N 2 O ∼ 0. The amount for NO was more than two times the amount of YBa 2 Cu 3 O y in molar ratio and elongation by about 0.2 angstrom along c-axis was observed. NO absorbed was almost completely recovered as NO by the evacuation at 773 K. This absorption-desorption cycle proceeded reversively. The electronic resistivity at 573 K of YBa 2 Cu 3 O y increased upon the NO absorption and was restored by the evacuation at 773 K. CO was also absorbed rapidly accompanied by evolution of CO 2 . BiSrCaCu 2 O y did not absorb either NO or CO

Elcoteq lõpetas aasta esmakordselt kahjumis / Tõnis Arnover

Index Scriptorium Estoniae

Arnover, Tõnis, 1952-

2002-01-01

Soome elektroonikakontserni Elcoteq Network OY eelmise aasta käive vähenes turu üldise madalseisu ja Ericssoniga koostöö vähenemise tõttu 15,8% ning ettevõte lõpetas aasta esmakordselt kahjumis

Parimad Eesti Flakes toolid

Index Scriptorium Estoniae

2007-01-01

ELKE Mööbli, Eesti Sisearhitektide Liidu ja Piiroinen OY korraldatud Flakes toolide Eesti kujunduskonkursi tulemused: I preemia - Heino Prunsvelt, II - Kadi Hektor, III - Andres Labi. Piironen OÜ eripreemiad - Andres Lember, Gerly Grünbaum, Kaarin Kokk

Demonstration of the 500 kW stoker burning system; 500 kW stokeripolttojaerjestelmaen demonstrointi

Energy Technology Data Exchange (ETDEWEB)

Oravainen, H. [VTT Energy, Jyvaeskylae (Finland); Kantalainen, K. [Hoegfors Laempoe Oy, Saarijaervi (Finland)

1995-12-31

The objective of the project is to demonstrate the operation of a 500 kW stoker-burning system in practice. The project is continuation of the previous projects of the Bioenergy research programme, 303 - Development of automatic heating system for wood chips and sod peat, carried out by VTT Energy, and Y301 - Development of heating boiler for wood chips and sod peat, carried out by Hoegfors Laempoe Oy. A 500 kW (nominal power) stoker-burner was constructed on the basis of the results of these projects. The burner was mounted on ETNA 500 bioenergy boiler. Screw-feeders, constructed by Maamiehen Saehkoe Oy, were used as fuel feeding system. Maamiehen Saehkoe Oy delivered also the automation system for the combustion equipment. Combustion air pre-heater was mounted on the boiler for promotion of the combustion of moist fuel. Testing of the equipment was carried out at the laboratory of VTT Energy in Jyvaeskylae in October-November 1994. In December 1994 the equipment was transported to Jalasjaervi, to heating station of the farmer Juha Jyrae. The actual heat generation started in the beginning of February 1995, when the greenhouses started to require heating. Sod peat has been used as the fuel. VTT Energy has carried out the efficiency and emission measurements in the heating station with sod peat in March 1995, and with reed canary grass in autumn 1995. The energy generation and fuel consumption have been followed all the time

Demonstration of the 500 kW stoker burning system; 500 kW stokeripolttojaerjestelmaen demonstrointi

Energy Technology Data Exchange (ETDEWEB)

Oravainen, H [VTT Energy, Jyvaeskylae (Finland); Kantalainen, K [Hoegfors Laempoe Oy, Saarijaervi (Finland)

1996-12-31

The objective of the project is to demonstrate the operation of a 500 kW stoker-burning system in practice. The project is continuation of the previous projects of the Bioenergy research programme, 303 - Development of automatic heating system for wood chips and sod peat, carried out by VTT Energy, and Y301 - Development of heating boiler for wood chips and sod peat, carried out by Hoegfors Laempoe Oy. A 500 kW (nominal power) stoker-burner was constructed on the basis of the results of these projects. The burner was mounted on ETNA 500 bioenergy boiler. Screw-feeders, constructed by Maamiehen Saehkoe Oy, were used as fuel feeding system. Maamiehen Saehkoe Oy delivered also the automation system for the combustion equipment. Combustion air pre-heater was mounted on the boiler for promotion of the combustion of moist fuel. Testing of the equipment was carried out at the laboratory of VTT Energy in Jyvaeskylae in October-November 1994. In December 1994 the equipment was transported to Jalasjaervi, to heating station of the farmer Juha Jyrae. The actual heat generation started in the beginning of February 1995, when the greenhouses started to require heating. Sod peat has been used as the fuel. VTT Energy has carried out the efficiency and emission measurements in the heating station with sod peat in March 1995, and with reed canary grass in autumn 1995. The energy generation and fuel consumption have been followed all the time

Kundas hoitakse Eesti vedelkütuse varusid / Raivo Raigna

Index Scriptorium Estoniae

Raigna, Raivo

2006-01-01

Eesti vedelkütusevarude hoiustamise hanke üks võitjaid on Soome firma Baltic Tank OY, mis on Baltic Tank AS-i emafirma. Kunda sadamas asuvas Baltic Tanki AS-i terminalis hoitakse Eesti riigi diislikütuse tagavara

Kumu Kunstimuuseum / Pekka Vapaavuori, Pia Sabelström, Pille Lausmäe

Index Scriptorium Estoniae

Vapaavuori, Pekka, 1962-

2006-01-01

II ja V korruse plaan, 2 välis- ja 5 sisevaadet; fotod: Kaido Haagen; projekteerija: Arkkitehtitoimisto Vapaavuori OY, 7 kaasautorit loetletud; sisekujundus: P. Sabelström; mööbel: P. Lausmäe, maastik: DIA Arhitektuur

Fazer tahab kaaperdada Eesti Pagari tuntuimat kaubamärki / Eda-Liis Kann

Index Scriptorium Estoniae

Kann, Eda-Liis, 1979-

2005-01-01

Oy Karl Fazer Ab esitas patendiametile taotluse uute kaubamärkide registreerimiseks, mis on aga väga sarnased Eesti Pagari Õnne sarja toodete pakenditel olevate kujunditega ja mille värvikombinatsioonid langevad toonide lõikes kokku

Eco-friendly (green) synthesis of magnetically active gold nanoclusters

Science.gov (United States)

Kadasala, Naveen Reddy; Lin, Lu; Gilpin, Christopher; Wei, Alexander

2017-12-01

Au-FexOy composite nanoparticles (NPs) are of great technological interest due to their combined optical and magnetic properties. However, typical syntheses are neither simple nor ecologically friendly, creating a challenging situation for process scale-up. Here we describe conditions for preparing Au-FexOy NPs in aqueous solutions and at ambient temperatures, without resorting to solvents or amphiphilic surfactants with poor sustainability profiles. These magnetic gold nanoclusters (MGNCs) are prepared in practical yields with average sizes slightly below 100 nm, and surface plasmon resonances that extend to near-infrared wavelengths, and sufficient magnetic moment (up to 6 emu g-1) to permit collection within minutes by handheld magnets. The MGNCs also produce significant photoluminescence when excited at 488 nm. Energy dispersive X-ray (EDX) analysis indicates a relatively even distribution of Fe within the MGNCs, as opposed to a central magnetic core.

Geophysical drillhole logging and imaging of drillholes OL-KR54, OL-KR55 and OL-KR55B at Olkiluoto in 2010 and 2011

International Nuclear Information System (INIS)

Tarvainen, A.-M.; Heikkinen, E.

2011-08-01

Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of the drillholes OL-KR54, OL-KR55 and OL-KR55B at the Olkiluoto site in Eurajoki between August 2010 and January 2011. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. New focused resistivity, susceptibility, natural gamma and density probes were tested and compared with old probes. This report describes the major features of new probes and the comparison with old probes. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

Advanced control and instrumentation systems in nuclear power plants. Design, verification and validation

International Nuclear Information System (INIS)

Haapanen, P.

1995-01-01

The Technical Committee Meeting on design, verification and validation of advanced control and instrumentation systems in nuclear power plants was held in Espoo, Finland on 20 - 23 June 1994. The meeting was organized by the International Atomic Energy Agency's (IAEA) International Working Group's (IWG) on Nuclear Power Plant Control and Instrumentation (NPPCI) and on Advanced Technologies for Water Cooled Reactors (ATWR). VTT Automation together with Imatran Voima Oy and Teollisuuden Voima Oy responded about the practical arrangements of the meeting. In total 96 participants from 21 countries and the Agency took part in the meeting and 34 full papers and 8 posters were presented. Following topics were covered in the papers: (1) experience with advanced and digital systems, (2) safety and reliability analysis, (3) advanced digital systems under development and implementation, (4) verification and validation methods and practices, (5) future development trends. (orig.)

Human and organisational factors influencing the reliability of non-destructive testing. An international literary survey

International Nuclear Information System (INIS)

Kettunen, J.; Norros, L.

1996-04-01

The aim of the study is to chart human and organisational factors influencing the reliability of non-destructive testing (NDT). The emphasis will be in ultrasonic testing (UT) and in the planning and execution of in-service inspections during nuclear power plant maintenance outages. Being a literary survey this study is mainly based on the foreign and domestic research available on the topic. In consequence, the results presented in this report reflect the ideas of international research community. In addition to this, Finnish nuclear power plant operators (Imatran Voima Oy and Teollisuuden Voima Oy), independent inspection organisations and the Finnish Centre for Radiation and Nuclear Safety have provided us with valuable information on NDT theory and practice. Especially, a kind of 'big picture' of non-destructive testing has been pursued in the study. (6 figs., 2 tabs.)

Human and organisational factors influencing the reliability of non-destructive testing. An international literary survey; Inhimillisten ja organisatoristen tekijoeiden yhteys NDT- tarkastusten luotettavuuteen. Katsaus kansainvaeliseen kirjallisuuteen

Energy Technology Data Exchange (ETDEWEB)

Kettunen, J.; Norros, L.

1996-04-01

The aim of the study is to chart human and organisational factors influencing the reliability of non-destructive testing (NDT). The emphasis will be in ultrasonic testing (UT) and in the planning and execution of in-service inspections during nuclear power plant maintenance outages. Being a literary survey this study is mainly based on the foreign and domestic research available on the topic. In consequence, the results presented in this report reflect the ideas of international research community. In addition to this, Finnish nuclear power plant operators (Imatran Voima Oy and Teollisuuden Voima Oy), independent inspection organisations and the Finnish Centre for Radiation and Nuclear Safety have provided us with valuable information on NDT theory and practice. Especially, a kind of `big picture` of non-destructive testing has been pursued in the study. (6 figs., 2 tabs.).

CMS rewards its best suppliers with the Crystal Award

CERN Document Server

Patrice Loiez

2002-01-01

A. Ingman of the Finnish company Outokumpu Pori Oy, F. Krähenbuhl of the Swiss firm Nexans Suisse and M. Niemerski of the American company Plascore receive the highest distinction in the CMS supplier awards - the Crystal Award.

Sibeliuse Akadeemia, Helsingi Linnaorkester ja Raadio Sümfooniorkester saavad ühe katuse alla / Reet Marttila

Index Scriptorium Estoniae

Marttila, Reet

2004-01-01

16. XI otsustati, et Helsingi Musiikkitalo ehitamine käivitub aastal 2005 ja lõpeb hiljemalt 2010. 2000. a. toimunud arhitektuurikonkursi võitsid Turu arhitektid Marko Kivistö, Ola Laiho ja Mikko Pulkkinen (LPR-arkkitehdit OY). Akustik Yasuhisa Toyota

Mina olin siin. Kus siis täpselt? / Donald Tomberg

Index Scriptorium Estoniae

Tomberg, Donald

2008-01-01

Rene Vilbre noortefilm "Mina olin siin", mille aluseks on Sass Henno romaan "Mina olin siin. Esimene arest", osades Rasmus Kaljujärv, Hele Kõre, Tambet Tuisk, Jaan Rekkor : Amrion Productions - Helsinki-filmi OY. Artikli lõpus R. Vilbre filmograafia

Acute toxicity and genotoxicity of fermented traditional medicine oyaksungi-san

Directory of Open Access Journals (Sweden)

Hwayong Park

2017-06-01

Conclusion: As a whole, no acute toxicity or genotoxicity were observed in all the assays examined. Therefore, fermented OY is considered to be a safe material that can be used for development of complementary and alternative medicine using bioconversion.

Eesti Energia ekstöötaja asutas konkureeriva firma / Toivo Tänavsuu

Index Scriptorium Estoniae

Tänavsuu, Toivo

2006-01-01

OÜ Baltic Energy Partners (BEP) üks omanikke on endine Eesti Energia teeninduse hulgivaldkonna juht Peeter Pikk. BEP hakkab tegutsema ühena Eesti elektrisüsteemi bilansihalduritest. Eesti Energia ostis Skandinaavia elektribörsi Nord Pool maaklerfirma Solidus OY

Nanoscale Cross-Point Resistive Switching Memory Comprising p-Type SnO Bilayers

KAUST Repository

Hota, Mrinal Kanti; Hedhili, Mohamed N.; Wang, Qingxiao; Melnikov, Vasily; Mohammed, Omar F.; Alshareef, Husam N.

2015-01-01

Reproducible low-voltage bipolar resistive switching is reported in bilayer structures of p-type SnO films. Specifically, a bilayer homojunction comprising SnOx (oxygen-rich) and SnOy (oxygen-deficient) in nanoscale cross-point (300 × 300 nm2

RELATIONSHIP OF AMEBOCYTES AND TERRESTRIAL ELEMENTS TO ADULT SHELL DEPOSITION IN EASTERN OYSTERS

Science.gov (United States)

Fisher, William S. Submitted. Relationship of Amebocytes and Terrestrial Elements to Adult Shell Deposition in Eastern Oysters. J. Shellfish Res. 30 p. (ERL,GB 1197). Freshwater runoff contains terrestrial elements from geological deposits that may be vital to eastern oys...

Ryntäys Viroon jatkuu / Eeva-Riitta Seies

Index Scriptorium Estoniae

Seies, Eeva-Riitta

2002-01-01

Soome kontsern Vapo ostis ASi Tootsi Turvas enamusaktsiad. Soome ettevõte Fit Biotech ostis Tartu biotehnoloogiaettevõtte Quattromed ja Soome toiduainetetööstuse ettevõte Saarioinen Oy Eesti tütarfirma omandas üle 66-protsendilise osaluse valmistoidufirmas Meleco AS

78 FR 12356 - Notice Pursuant to the National Cooperative Research and Production Act of 1993-Telemanagement Forum

Science.gov (United States)

2013-02-22

... University, Fairfax, VA; i Engineering Group, Accra, GHANA; Incoma, Moscow, RUSSIA; International Software...--Road Town, VIRGIN ISLANDS (BRITISH); LIRIS Lab (Personne Morale), Villeurbanne C[eacute]dex, FRANCE... AFRICA; Onesto Services Oy, Jyvaskyla, FINLAND; Orange System Group, St.Petersburg, RUSSIA; Osaka...

Marketing plan and campaign for Riosol Oy

OpenAIRE

Toivonen, Kim

2016-01-01

The aim of this thesis was to create an efficient marketing plan and a working marketing campaign for the case company. The aspects of the marketing plan and campaign were adjusted to fit the company size, field of business and aims of the case company. To get a better view on the aspects of the marketing plan and campaign, theoretical frameworks are inspected, such as marketing mix, company stages and SWOT-analysis. This thesis consists of theoretical framework as well as practical implem...

Digital Interior Design by Stailia Design Oy

OpenAIRE

Lindroos, Jaana

2017-01-01

The objective of the thesis work is to research and create a web based service in a field of interior design. With my project, I am hoping to find out whether this kind of web service in the field of interior design can work in general and that the process together with the actual order form on internet is smooth from both customer and company point of view. The company has interior design related services but none entirely executed on the web. The target is to create a totally new service/pr...

Markkinoinnin strateginen suunnittelu : case: YogaROCKS Oy

OpenAIRE

Hiltunen, Antti

2012-01-01

Opinnäytetyön aiheena on strateginen markkinointisuunnitelma kaksi vuotta toimineelle liikunta-alan pienyritykselle. Työssä käsitellään markkinointisuunnitelman suurimmat osa-alueet yleisellä tasolla, mutta painopiste on uusilla markkinointitoimenpiteillä. Opinnäytetyön tutkimusongelmana on, miten luodaan tehokas markkinointisuunnitelma kaksi vuotta toimineelle yritykselle ja mitä se pitää sisällään. Työn tavoitteena on antaa yritykselle työkalut tehokkaan markkinointisuunnitelman toteutt...

Liiketoimintasuunnitelma aloittavalle yritykselle : Tilitoimisto TiliEnna Oy

OpenAIRE

Rinne, Enna

2015-01-01

Opinnäytetyön tavoitteena oli luoda toimiva liiketoimintasuunnitelma perustettavalle tilitoimistolle. Tavoitteena oli luoda liiketoimintasuunnitelma, joka on toteutettavissa ja jonka avulla aloittava yrittäjä voi kiinnittää huomiota kaikkiin yrityksen perustamisen kannalta olennaisiin seikkoihin. Yrityksen perustaminen ei ole riskitöntä, eikä sitä kannata tehdä hetken mielijohteesta. Huolellisilla esivalmisteluilla ja riskit tiedostamalla, voi uuden yrityksen perustaminen parhaimmillaan tarjo...

Tilitoimiston asiakkaiden hallinta Ovil Oy:ssä

OpenAIRE

Salo, Tiia

2016-01-01

Tämän toimintatutkimuksen tarkoitus oli kehittää asiakkuuksien hallintaa ja tutkia asiakkaiden arvoa sekä asiakkaiden säilyttämistä yrityksen muutostilanteessa. Asiakkuudella on kahdenlaista arvoa; faktuaalista ja evaluatiivista. Faktuaaliset arvot ovat nimensä mukaisesti faktoja ja siksi helposti määriteltäviä, esimerkiksi tuottoa tai liikevaihtoa. Evaluatiiviset arvot ovat nimensä mukaisesti arvioita ja siksi vaikeammin määriteltäviä. Evaluatiivisia arvoja ovat muun muassa tunnearvo ja...

The identification of the continuity of the long fractures by mise-a-la-masse surveys. A test work at ONKALO

International Nuclear Information System (INIS)

Lehtonen, T.; Mattila, J.

2007-02-01

This report concerns mise-a-la-masse surveys conducted in February 2006 at the area of the underground characterisation facility (ONKALO). Field surveys were made in 3 drillholes, in the ONKALO access tunnel and at 2 ground survey areas. Suomen Malmi Oy conducted the fieldwork. Astrock Oy supervised field surveys and processed acquired data. The interpretation and the reporting were made in cooperation with Posiva Oy. The purpose of the study was to test whether mise-a-la-masse measurements can be utilized in the identification of the continuity of the long fractures. Long fractures may pose a risk to canister integrity during post-glacial seismic activity. Therefore the development of methods for the identification of possible long fractures plays an important role in the evaluation of the suitability of the bedrock for the construction of deposition holes Current earthings were placed in 5 electrically conducting structures in the ONKALO access tunnel. Current earthings were situated in PL283, PL721, PL899, PL952 and in the mouth of the tunnel. Electrical connections were probed in 3 drillholes and at 2 ground survey areas. The acquired survey data were collected to xyz-coordinate oriented databases for 3D processing, interpreting and visualization of the results. At first the data were transferred to Oasis Montaj, where the potential field profiles were drawn and studied every current earthing at a time to determine characteristics of the electrical connections. Next probable connections were constructed and moved to SurpacVision for visualisation. They were delivered for Posiva Oy as Surpac string and DTM files. Ground surveys were hampered strongly by electrical disturbances of the infrastructure of the ONKALO area. Results of the all surveys are also collected in the tables, where every one of connections is classified. Mise-a-la-masse method seems to work moderately or fine to identify electrical connections from the current earthed fractures in the ONKALO

Karm betoon, roheline kanjon : STAKES-i ja Senati kinnisvara büroo, Lintulahdenkuja 4, Sörnäinen, Helsingi = Office Facilities for the National Research and Development Centre for Welfare an Health (STAKES) and Senate Properties / Mikko Heikkinen,

Index Scriptorium Estoniae

Heikkinen, Mikko

2004-01-01

Senati kinnisvarafirma valis oma peakorteri asukohaks endise lao. Samas ehitati STAKES-i uus hoone. Projekteerija: Heikkinen-Komonen OY. Autorid Mikko Heikkinen, Markku Komonen. Sisekujundus: Suunnittelupalvelut (STAKES), Heikkinen-Komonen (Senat). Maastikukujundus: Byman & Ruokonen. Valmis 2002. I korruse plaan, välis- ja sisevaated

76 FR 11737 - Fisheries of the Northeastern United States; Monkfish; Amendment 5

Science.gov (United States)

2011-03-03

... Policy Analyst, (978) 281-9103; fax: (978) 281-9135. SUPPLEMENTARY INFORMATION: Background The monkfish... (MSY), optimum yield (OY), overfishing limits (OFL), acceptable biological catch (ABC), ACLs, and... catches approach the proposed ABC, while the SFMA is less vulnerable. Amendment 5 also proposes measures...

Äripäev : Hiiumaa edukaim ettevõte on Dale LD AS / Urmas Lauri

Index Scriptorium Estoniae

Lauri, Urmas, 1956-

2006-01-01

Hiiumaa ettevõtete pingereas esimeseks tõusnud Dale LD AS-i tegevjuhi Tiit Asumetsa sõnul andis suurt efekti firma käibesse ja kasumisse Soome firmaga Ensto OY sõlmitud koostööleping. Lisa: Hiiumaa ettevõtete TOP aastal 2005

Akadeemikust ettevõtja võitleb viirustega / Kaire Talviste

Index Scriptorium Estoniae

Talviste, Kaire, 1979-

2012-01-01

Molekulaarbioloog Mart Ustavi tööst bioloogiliste ravimite väljatöötamisel. HIV1/AIDS vaktsiini väljatöötamisest FIT Biotech Oy Eesti filiaalis a-tel 2000-2011. M. Ustavi biotehnoloogia firma Icosagen Grupp tehnoloogilistest arendustest

Pärjatud disaintool Haiku

Index Scriptorium Estoniae

2005-01-01

Isku OY disaineri Tapio Anttila loodud tool Haiku pälvis rahvusvahelisel disainikonkursil ADEX 2004 (Award for Design Excellence) mööblikategoorias Adex Silver preemia. Eestis jõuab tool müüki maikuus, tooli valmistatakse kasest ja pöögist

Paroc - tulepüsivad paneelid

Index Scriptorium Estoniae

1998-01-01

Partek Paroc OY/Ab Panels System on Soome tööstuskontserni Partek tütarettevõte, mis tegeleb kaasaegsete tulepüsivate Paroc-paneelide tootmisega. Paroc-paneelidest, mida kasutatakse tööstus-, tootmis- ja laohoonete ehitamisel (fassaadid, tuuletõkke seinad, laed).

Inheritance of DNA methylation in DH and its backcrossed lines of ...

African Journals Online (AJOL)

Jane

2011-08-01

Aug 1, 2011 ... (Chen and Li, 2004). Salmon et al. .... M primer. MSAP bands. CTGCAG. Figure 2. A flowchart showing the MSAP method. ..... Doyle JJ, Doyle JL (1990). .... Yoon DB, Kang KH, Kim HJ, Ju HG, Kwon SJ, Suh JP, Jeong OY, Ahn.

76 FR 11857 - Magnuson-Stevens Fishery Conservation and Management Act Provisions; Fisheries of the...

Science.gov (United States)

2011-03-03

.... The pollock peer-reviewed benchmark stock assessment review (Stock Assessment Workshop, or SAW, 50... overfishing, rebuild overfished stocks, achieve optimum yield (OY), and minimize the economic impact of... Management Act (Magnuson-Stevens Act). This action would revise the biological reference points and stock...

76 FR 23041 - Magnuson-Stevens Fishery Conservation and Management Act Provisions; Fisheries of the...

Science.gov (United States)

2011-04-25

... updated peer-reviewed benchmark stock assessment conducted in July 2010 (Stock Assessment Workshop, or SAW..., including preventing overfishing, rebuilding overfished stocks, achieving optimum yield (OY), and minimizing... revises the biological reference points and stock status for pollock, updates annual catch limits (ACLs...

Eksperdid otsustavad eesti esimese filmi üle / Tiit Tuumalu

Index Scriptorium Estoniae

Tuumalu, Tiit, 1971-

2002-01-01

Johannes Pääsukese (1892-1918) "Utotshkini lendamised Tartu kohal 14. ja 15. aprillil 1912" on seni teadaolevalt esimene eestlase filmitud kroonikapala. Film restaureeriti Eesti Filmiarhiivi tellimusel Soomes Digital Film Finland OY laboris. Homme näidatakse seda Tartus eesti filmikunsti juubelipidustustel

Communications technologies for demand side management, DSM, and European utility communications architecture, EurUCA

Energy Technology Data Exchange (ETDEWEB)

Kaerkkaeinen, S.; Kekkonen, V. [VTT Energy, Espoo (Finland); Rissanen, P. [Tietosavo Oy (Finland)

1996-12-31

In this project the main target is to develop and assess methods for DSM (Demand Side Management) and distribution automation planning from the utility`s point of view. The final goal is to integrate these methods for the strategic planning of electric utilities. In practice the project is divided into four main parts: The development and assessment of DSM/IRP planning methods and cost/benefit analysis as a part of international co-operation (IEA DSM Agreement: Annex IV, European Cost/Benefit analysis of DSM, EUBC, and Finnish SAVE-project started in 1995 in co-operation with SRC International and six electric utilities in Finland); Development of PC-based DSM planning and assessment tools at VTT; Development of a decision support system of distribution network planning including DSM options at Tietosavo Oy and Integration of DSM planning and network planning tools in co-operation with VTT Energy and Tietosavo Oy

Dispersion strengthening of aluminium-aluminium-oxide products

DEFF Research Database (Denmark)

Hansen, Niels

1970-01-01

The true stress-true strain curves at room temperature and at 400°C were determined for various types of aluminium-aluminium-oxide products containing from 0.2 to 4.7 weight per cent of aluminium oxide. The effect of particles on the initial flow stress and the flow stress for 0.2% offset at room...... temperature and at 400°C is in agreement with Orowan's theory. The increase in flow stress at room temperature for strain values below 3 per cent was related to the plastic strain by the equation σ-σoy=k1ε 1/2, where σoy is the initial flow stress and where k1 increases for increasing volume fraction...... and decreasing particle size of the dispersed particles. A general expression for k1 was derived for the relationship between the dislocation density and the strain in dispersion-strengthened products...

Communications technologies for demand side management, DSM, and European utility communications architecture, EurUCA

Energy Technology Data Exchange (ETDEWEB)

Kaerkkaeinen, S; Kekkonen, V [VTT Energy, Espoo (Finland); Rissanen, P [Tietosavo Oy (Finland)

1997-12-31

In this project the main target is to develop and assess methods for DSM (Demand Side Management) and distribution automation planning from the utility`s point of view. The final goal is to integrate these methods for the strategic planning of electric utilities. In practice the project is divided into four main parts: The development and assessment of DSM/IRP planning methods and cost/benefit analysis as a part of international co-operation (IEA DSM Agreement: Annex IV, European Cost/Benefit analysis of DSM, EUBC, and Finnish SAVE-project started in 1995 in co-operation with SRC International and six electric utilities in Finland); Development of PC-based DSM planning and assessment tools at VTT; Development of a decision support system of distribution network planning including DSM options at Tietosavo Oy and Integration of DSM planning and network planning tools in co-operation with VTT Energy and Tietosavo Oy

An integrated (electro- and bio-oxidation) approach for remediation of industrial wastewater containing azo-dyes: Understanding the degradation mechanism and toxicity assessment

International Nuclear Information System (INIS)

Aravind, Priyadharshini; Selvaraj, Hosimin; Ferro, Sergio; Sundaram, Maruthamuthu

2016-01-01

Highlights: • Firstly, the mediated electro-oxidation allows rapid discoloration of the effluent. • Cost effective sunlight-mediated removal of bio-toxic active chlorine species. • Electrochemical pretreatment enhances the biodegradability of textile wastewater. • About 90% COD removal was achieved by a subsequent biodegradation. • By-products from degradation of dyes have shown to be ecofriendly and non-toxic. - Abstract: A hybrid approach for the remediation of recalcitrant dye wastewater is proposed. The chlorine-mediated electrochemical oxidation of real textile effluents and synthetic samples (using Ti/IrO_2-RuO_2-TiO_2 anodes), lead to discoloration by 92% and 89%, respectively, in 100 min, without significant mineralization. The remediation was obtained through biodegradation, after removing the residual bio-toxic active chlorine species via sunlight exposition. Results show that the electrochemical discoloration enhances the effluent biodegradability with about 90% COD removal employing acclimatized naphthalene-degrading bacterial consortia, within 144 h. Based on results obtained through FT-IR and GC–MS, it is likely that azo group stripping and oxidative cleavage of dyes occur due to the nucleophilic attack of active chlorine species during electro-oxidation. This leads to generation of aromatic intermediates which are further desulfonated, deaminated or oxidized only at their functional groups. These aromatic intermediates were mineralized into simpler organic acids and aldehydes by bacterial consortia. Phyto-toxicity trials on Vigna radiata confirmed the toxic nature of the untreated dye solutions. An increase in root and shoot development was observed with the electrochemically treated solutions, the same was higher in case of bio-treated solutions. Overall, obtained results confirm the capability of the proposed hybrid oxidation scheme for the remediation of textile wastewater.

MANU. Handling of bentonite prior buffer block manufacturing

International Nuclear Information System (INIS)

Laaksonen, R.

2010-01-01

The aim of this study is to describe the entire bentonite handling process starting from freight from harbour to storage facility and ending up to the manufacturing filling process of the bentonite block moulds. This work describes the bentonite handling prior to the process in which bentonite blocks are manufactured in great quantities. This work included a study of relevant Nordic and international well documented cases of storage, processing and techniques involving bentonite material. Information about storage and handling processes from producers or re-sellers of bentonite was collected while keeping in mind the requirements coming from the Posiva side. Also a limited experiment was made for humidification of different material types. This work includes a detailed description of methods and equipment needed for bentonite storage and processing. Posiva Oy used Jauhetekniikka Oy as a consultant to prepare handling process flow charts for bentonite. Jauhetekniikka Oy also evaluated the content of this report. The handling of bentonite was based on the assumption that bentonite process work is done in one factory for 11 months of work time while the weekly volume is around 41-45 tons. Storage space needed in this case is about 300 tons of bentonite which equals about seven weeks of raw material consumption. This work concluded several things to be carefully considered: sampling at various phases of the process, the air quality at the production/storage facilities (humidity and temperature), the level of automation/process control of the manufacturing process and the means of producing/saving data from different phases of the process. (orig.)

78 FR 46897 - Fisheries of the Northeastern United States; Atlantic Herring Fishery; Framework Adjustment 2 and...

Science.gov (United States)

2013-08-02

... CONTACT: Carrie Nordeen, Fishery Policy Analyst, (978) 281-9272, fax (978) 281-9135. SUPPLEMENTARY... overfishing limit (OFL), acceptable biological catch (ABC), annual catch limit (ACL), optimum yield (OY... uncertainty buffer between ABC and the stock-wide ACL, while giving the fleet some flexibility in choosing...

Uus rahvusringhäälingu hoone rõhutab läbipaistvust / Oliver Õunmaa

Index Scriptorium Estoniae

Õunmaa, Oliver

2007-01-01

Eesti Rahvusringhäälingu hoone arhitektuurikonkursi võitis Erik Nobel Taani arhitektuuribüroost Nobel Arkitekter A/S. Teise koha saavutasid Trevor Harris ja Taru Niskanen Soome arhitektuuribüroost Arkkitehtitoimisto Harris ja Kjisk Oy. Maja ehitatakse Tallinnasse Tuisu tänav 12

Lahekalda : sipelgarajast eineni roheluses = Lahekalda : from the ant trail to the lunch in the green / Andres Alver

Index Scriptorium Estoniae

Alver, Andres, 1953-

1999-01-01

Lahekalda elurajoon Tallinnas (kutsutud konkursi võistlustöö, 1997). Autorid: A. Alver, T. Trummal, T. Laht, S. Koppel, T. Tammis, E. Dufala (Alver Trummal Arhitektid), E. Kahri, J. Väisanen (Arkkitehtuuri OY Kahri & Co, Helsinki). Jaan Elkeni illustratsioon võistlustööle

Antibacterial polymer coatings.

Energy Technology Data Exchange (ETDEWEB)

Wilson, Mollye C.; Allen, Ashley N.; Barnhart, Meghan; Tucker, Mark David; Hibbs, Michael R.

2009-09-01

A series of poly(sulfone)s with quaternary ammonium groups and another series with aldehyde groups are synthesized and tested for biocidal activity against vegetative bacteria and spores, respectively. The polymers are sprayed onto substrates as coatings which are then exposed to aqueous suspensions of organisms. The coatings are inherently biocidal and do not release any agents into the environment. The coatings adhere well to both glass and CARC-coated coupons and they exhibit significant biotoxicity. The most effective quaternary ammonium polymers kills 99.9% of both gram negative and gram positive bacteria and the best aldehyde coating kills 81% of the spores on its surface.

75 FR 5537 - Fisheries of the Northeastern United States; Atlantic Mackerel, Squid, and Butterfish Fisheries...

Science.gov (United States)

2010-02-03

...://www.nero.noaa.gov . FOR FURTHER INFORMATION CONTACT: Carrie Nordeen, Fishery Policy Analyst, 978-281... of the initial optimum yield (IOY), allowable biological catch (ABC), domestic annual harvest (DAH... Year Specifications Loligo Illex Mackerel Butterfish Max OY 32,000 24,000 N/A 12,175 [[Page 5538

Eesti firma hakkab koostöös soomlastega välja töötama Ebola viiruse ravimit / Joosep Värk

Index Scriptorium Estoniae

Värk, Joosep

2014-01-01

Eesti biotehnoloogiafirma Icosagen hakkab koos Soome ettevõtte FIT Biotech Oy'ga välja töötama Ebola viiruse vastast vaktsiini, arendustöös osaleb professor Andres Meritsa juhtimisel ka Tartu Ülikooli Tehnoloogiainstituudi rakendusviroloogia labor. Vestlusest Tartu Ülikooli biomeditsiinitehnoloogia professori Mart Ustaviga

Curcumin and normal functioning of joints: evaluation of a health claim pursuant to Article 13(5) of Regulation (EC) No 1924/2006

DEFF Research Database (Denmark)

Sjödin, Anders Mikael

2017-01-01

Following an application from Suomen Terveysravinto Oy, submitted for authorisation of a health claim pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of Finland, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion...

77 FR 15915 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Comprehensive Annual Catch Limit...

Science.gov (United States)

2012-03-16

... Amendment, which includes a final environmental impact statement (FEIS), a regulatory flexibility analysis... proposed rule for the Comprehensive ACL Amendment specific to a revised allowable biological catch (ABC... equal to both the OY and the allowable biological catch (ABC). This final rule specifies an ACL for...

77 FR 28308 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of...

Science.gov (United States)

2012-05-14

... end overfishing of stocks and to minimize bycatch and bycatch mortality to the extent practicable. Status of the Gray Triggerfish Stock The last Southeast Data, Assessment, and Review (SEDAR) benchmark... achieve, on a continuing basis, the optimum yield (OY) from federally managed fish stocks. These mandates...

Trombektomia aivoinfarktin hoidossa Oulun yliopistollisessa sairaalassa 2011–2014

OpenAIRE

Hakala, S. (Salla)

2016-01-01

Tiivistelmä Mekaaninen trombektomia on melko uusi hoitomuoto akuutin aivoinfarktin hoidossa. Ensimmäiset laitteet hyväksyttiin käyttöön vuonna 2004. Trombektomiassa aivovaltimoissa oleva trombi poistetaan nivusvaltimon kautta erilaisten trombektomiakatetrien avulla. Oulun yliopistollisessa sairaalassa (OYS) trombektomioita alettiin tehdä vuonna 2011. T...

Review of safety related control room function research based on experience from nuclear power plants in Finland

International Nuclear Information System (INIS)

Juslin, K.; Wahlstroem, B.; Rinttilae, E.

1985-01-01

A comprehensive human engineering research programme was established in the second half of the 1970's at the Technical Research Centre of Finland (VTT). The research is performed in cooperation with the utility companies Imatran Voima Oy (IVO) and Teollisuuden Voima Oy (TVO) and includes topics such as Handling of alarm information, Disturbance analysis systems, Assessment of control rooms and Validation of safety parameter display systems. Reference is also made to the Finnish contribution to the OECD Halden Reactor Project (Halden) and the Nordic Liaison Committee for Atomic Energy (NKA) research projects. In this paper feasible realization alternatives of safety related control room functions are discussed on the basis of experience from the nuclear power plants in Finland, which at present are equipped with extensive process computer systems. A proposal for future power plant information systems is described. It is intended that this proposal will serve as the basis for future computer systems at nuclear power plants in Finland. (author)

PHYSICAL PROPERTIES OF InN PARTICLES OBTAINED BY RF MAGNETRON SPUTTERING

Directory of Open Access Journals (Sweden)

Roberto Bernal Correa

2014-01-01

Full Text Available InN layers were prepared by magnetron sputtering, in a mixed atmosphere of argon and nitrogen on Si substrates (100, Si (111, and glass. The substrate temperature Ts was varied (300-500 oC in order to correlate it with the optical, structural, and morphological properties of the layers. X-ray results have revealed a presence of hexagonal InN type wurtzite in each of the layers in addition to oxides of indium (InxOy attributed to different factors. Dependence was evident on the crystalline quality of each layer according to Ts. The optical absorption coefficient and the band gap were determined from the absorbance and transmittance spectra obtained by UV/Vis. Vibration modes associated with the semiconductor InN and InxOy were identified by Raman microscopy. The morphology of the layers and the grain size was analyzed from SEM micrographs where it was determined the formation of particulates  ~ 0.5 mm and ~ 50 nm of different geometries.

Results of monitoring at Olkiluoto in 2007. Environment

International Nuclear Information System (INIS)

Haapanen, R.

2008-06-01

This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2007. These summary reports have been published since 2005 (target year 2004). The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground characterization facility. Although some of the nuclear power production related monitoring studies by TVO (the power company) have been going on from the 1970s, the repository-related environmental monitoring of Olkiluoto Island has only recently been comprehensive. In the monitoring data, the ongoing construction work (OL3, ONKALO and related infrastructure) is seen for instance in raised noise levels and deposition of base cations and iron. The land-use continues to change, but where there is natural environment, it resembles other coastal locations. The nearby marine environment is affected by the cooling water from the nuclear power plant. (orig.)

Surface stoichiometry modification and improved DC/RF characteristics by plasma treated and annealed AlGaN/GaN HEMTs

Science.gov (United States)

Upadhyay, Bhanu B.; Takhar, Kuldeep; Jha, Jaya; Ganguly, Swaroop; Saha, Dipankar

2018-03-01

We demonstrate that N2 and O2 plasma treatment followed by rapid thermal annealing leads to surface stoichiometry modification in a AlGaN/GaN high electron mobility transistor. Both the source/drain access and gate regions respond positively improving the transistor characteristics albeit to different extents. Characterizations indicate that the surface show the characteristics of that of a higher band-gap material like AlxOy and GaxOy along with N-vacancy in the sub-surface region. The N-vacancy leads to an increased two-dimensional electron gas density. The formation of oxides lead to a reduced gate leakage current and surface passivation. The DC characteristics show increased transconductance, saturation drain current, ON/OFF current ratio, sub-threshold swing and lower ON resistance by a factor of 2.9, 2.0, 103.3 , 2.3, and 2.1, respectively. The RF characteristics show an increase in unity current gain frequency by a factor of 1.7 for a 500 nm channel length device.

Beliefs concerning the reliability of nuclear power plant in-service inspections; Uskomuksia ydinvoimalaitoksissa suoritettavien tarkastusten luotettavuudesta

Energy Technology Data Exchange (ETDEWEB)

Kettunen, J. [VTT Automation, Espoo (Finland)

1997-01-01

The aim of the study was to investigate belief systems held by the officials responsible for the planning and supervision of NDT operations within the Finnish nuclear industry. They were asked to express their opinions on (1) the reliability of NDT methods in general, (2) the factors influencing the reliability of in-service inspections, and (3) the degree of reliability of the current inspections operations conducted by means of NDT methods in the Finnish nuclear power plants. Another goal of the study was to assess the adequacy of officials` beliefs (or belief systems). The research data was collected by interviewing representatives from Finnish power companies (Imatran Voima Oy and Teollisuuden Voima Oy), independent inspection organisations, and the Finnish Centre for Radiation and Nuclear Safety (STUK). The adequacy of the beliefs expressed was assessed by means of the results obtained from international NDT reliability studies and on the basis of interviewees` own justification. (refs.).

Beliefs concerning the reliability of nuclear power plant in-service inspections

International Nuclear Information System (INIS)

Kettunen, J.

1997-01-01

The aim of the study was to investigate belief systems held by the officials responsible for the planning and supervision of NDT operations within the Finnish nuclear industry. They were asked to express their opinions on (1) the reliability of NDT methods in general, (2) the factors influencing the reliability of in-service inspections, and (3) the degree of reliability of the current inspections operations conducted by means of NDT methods in the Finnish nuclear power plants. Another goal of the study was to assess the adequacy of officials' beliefs (or belief systems). The research data was collected by interviewing representatives from Finnish power companies (Imatran Voima Oy and Teollisuuden Voima Oy), independent inspection organisations, and the Finnish Centre for Radiation and Nuclear Safety (STUK). The adequacy of the beliefs expressed was assessed by means of the results obtained from international NDT reliability studies and on the basis of interviewees' own justification. (refs.)

An efficient laser vaporization source for chemically modified metal clusters characterized by thermodynamics and kinetics

Science.gov (United States)

Masubuchi, Tsugunosuke; Eckhard, Jan F.; Lange, Kathrin; Visser, Bradley; Tschurl, Martin; Heiz, Ulrich

2018-02-01

A laser vaporization cluster source that has a room for cluster aggregation and a reactor volume, each equipped with a pulsed valve, is presented for the efficient gas-phase production of chemically modified metal clusters. The performance of the cluster source is evaluated through the production of Ta and Ta oxide cluster cations, TaxOy+ (y ≥ 0). It is demonstrated that the cluster source produces TaxOy+ over a wide mass range, the metal-to-oxygen ratio of which can easily be controlled by changing the pulse duration that influences the amount of reactant O2 introduced into the cluster source. Reaction kinetic modeling shows that the generation of the oxides takes place under thermalized conditions at less than 300 K, whereas metal cluster cores are presumably created with excess heat. These characteristics are also advantageous to yield "reaction intermediates" of interest via reactions between clusters and reactive molecules in the cluster source, which may subsequently be mass selected for their reactivity measurements.

Photoluminescence and semiconducting behavior of Fe, Co, Ni and Cu implanted in heavy metal oxide glasses

Directory of Open Access Journals (Sweden)

Mohamed A. Marzouk

2016-07-01

Full Text Available Transition metal ions (0.5 wt% of Fe2O3, CoO, NiO or CuO doped heavy metal oxide glasses having chemical composition of 60PbO·20Bi2O3·20 MxOy mol% (where MxOy = B2O3 or SiO2 or P2O5 were prepared by conventional melt annealing method. Combined optical and photoluminescence properties have been measured and employed to evaluate the prepared glassy samples. From the absorption edge data, the values of the optical band gap Eopt, Urbach energy (ΔE and refractive index were calculated to estimate semiconducting behavior. Photoluminescence and values of the optical energy gap were found to be dependent on the glass composition. The variations of the photoluminescence intensity, values of optical band gap, Urbach energy and refractive index gave an indication to use the prepared glasses for design of novel functional optical materials with higher optical performance.

78 FR 12012 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of...

Science.gov (United States)

2013-02-21

... recreational shallow-water grouper (SWG) fixed seasonal closure, which are in place to prevent overfishing of... the Gulf gag and other SWG resources and prevent overfishing from the stocks in the SWG complex. DATES... regional fishery management councils to prevent overfishing and achieve, on a continuing basis, OY from...

Norra Orkla otsib teed Idaturule / Sirje Rank

Index Scriptorium Estoniae

Rank, Sirje, 1966-

2004-01-01

Ülevaade Norra börsiettevõtte Orkla tegevusest toiduainetööstuses ja meedia valdkonnas, välisinvesteeringutest Baltimaade ettevõtetesse ning eesmärkidest laieneda Ida-Euroopa turgudele Põhjamaade suurima kartulikrõpsude tootja Chips OY 79,6% aktsiate ostmise kaudu. Lisad: Orkla ostab tuntud krõpsuvalmistaja

Lepingud kahe väikelaeva ehitamiseks

Index Scriptorium Estoniae

2006-01-01

Veeteede Amet sõlmis lepingud Uusikaupunki Työvene OY-ga kahe väikelaeva ehitamiseks, laevade ehitamine on osa ERDFi (European Regional Development Foundation) kaasfinantseeritavast projektist "Emajõe, Narva jõe ja Peipsi-Lämmijärve veeteede kaasajastamine ning eelduste loomine ohutu veeliikluse tagamiseks rekonstrueeritud veeteedel"

50 CFR 600.310 - National Standard 1-Optimum Yield.

Science.gov (United States)

2010-10-01

... Nation, the values that should be weighed and receive serious attention when considering the economic... research, and all fishing activities. (D) The OY specification should be translatable into an annual... that serves as the basis for invoking AMs. ACL cannot exceed the ABC, but may be divided into sector...

Pathogen-associated molecular pattern-triggered immunity and resistance to the root pathogen Phytophthora parasitica in Arabidopsis.

Science.gov (United States)

Larroque, Mathieu; Belmas, Elodie; Martinez, Thomas; Vergnes, Sophie; Ladouce, Nathalie; Lafitte, Claude; Gaulin, Elodie; Dumas, Bernard

2013-09-01

The cellulose binding elicitor lectin (CBEL) of the genus Phytophthora induces necrosis and immune responses in several plant species, including Arabidopsis thaliana. However, the role of CBEL-induced responses in the outcome of the interaction is still unclear. This study shows that some of CBEL-induced defence responses, but not necrosis, required the receptor-like kinase BAK1, a general regulator of basal immunity in Arabidopsis, and the production of a reactive oxygen burst mediated by respiratory burst oxidases homologues (RBOH). Screening of a core collection of 48 Arabidopsis ecotypes using CBEL uncovered a large variability in CBEL-induced necrotic responses. Analysis of non-responsive CBEL lines Ws-4, Oy-0, and Bla-1 revealed that Ws-4 and Oy-0 were also impaired in the production of the oxidative burst and expression of defence genes, whereas Bla-1 was partially affected in these responses. Infection tests using two Phytophthora parasitica strains, Pp310 and Ppn0, virulent and avirulent, respectively, on the Col-0 line showed that BAK1 and RBOH mutants were susceptible to Ppn0, suggesting that some immune responses controlled by these genes, but not CBEL-induced cell death, are required for Phytophthora parasitica resistance. However, Ws-4, Oy-0, and Bla-1 lines were not affected in Ppn0 resistance, showing that natural variability in CBEL responsiveness is not correlated to Phytophthora susceptibility. Overall, the results uncover a BAK1- and RBOH-dependent CBEL-triggered immunity essential for Phytophthora resistance and suggest that natural quantitative variation of basal immunity triggered by conserved general elicitors such as CBEL does not correlate to Phytophthora susceptibility.

An integrated (electro- and bio-oxidation) approach for remediation of industrial wastewater containing azo-dyes: Understanding the degradation mechanism and toxicity assessment

Energy Technology Data Exchange (ETDEWEB)

Aravind, Priyadharshini, E-mail: priya.bdu07@gmail.com [Corrosion and Materials Protection Division (CMPD), CSIR—Central electrochemical research institute (CECRI), Karaikudi 630 003 (India); Selvaraj, Hosimin [Corrosion and Materials Protection Division (CMPD), CSIR—Central electrochemical research institute (CECRI), Karaikudi 630 003 (India); Ferro, Sergio [Ecas4 Australia, Unit 8, 1 London Road, Mile End, South Australia 5031 (Australia); Sundaram, Maruthamuthu [Corrosion and Materials Protection Division (CMPD), CSIR—Central electrochemical research institute (CECRI), Karaikudi 630 003 (India)

2016-11-15

Highlights: • Firstly, the mediated electro-oxidation allows rapid discoloration of the effluent. • Cost effective sunlight-mediated removal of bio-toxic active chlorine species. • Electrochemical pretreatment enhances the biodegradability of textile wastewater. • About 90% COD removal was achieved by a subsequent biodegradation. • By-products from degradation of dyes have shown to be ecofriendly and non-toxic. - Abstract: A hybrid approach for the remediation of recalcitrant dye wastewater is proposed. The chlorine-mediated electrochemical oxidation of real textile effluents and synthetic samples (using Ti/IrO{sub 2}-RuO{sub 2}-TiO{sub 2} anodes), lead to discoloration by 92% and 89%, respectively, in 100 min, without significant mineralization. The remediation was obtained through biodegradation, after removing the residual bio-toxic active chlorine species via sunlight exposition. Results show that the electrochemical discoloration enhances the effluent biodegradability with about 90% COD removal employing acclimatized naphthalene-degrading bacterial consortia, within 144 h. Based on results obtained through FT-IR and GC–MS, it is likely that azo group stripping and oxidative cleavage of dyes occur due to the nucleophilic attack of active chlorine species during electro-oxidation. This leads to generation of aromatic intermediates which are further desulfonated, deaminated or oxidized only at their functional groups. These aromatic intermediates were mineralized into simpler organic acids and aldehydes by bacterial consortia. Phyto-toxicity trials on Vigna radiata confirmed the toxic nature of the untreated dye solutions. An increase in root and shoot development was observed with the electrochemically treated solutions, the same was higher in case of bio-treated solutions. Overall, obtained results confirm the capability of the proposed hybrid oxidation scheme for the remediation of textile wastewater.

Can Chlorella pyrenoidosa be a bioindicator for hazardous solid waste detoxification?

Energy Technology Data Exchange (ETDEWEB)

Hu, Li-Fang, E-mail: hulif127@163.com [College of Quality and Safety Engineering, China Jiliang University, Hangzhou 310018 (China); Long, Yu-Yang; Shen, Dong-Sheng [School of Environmental Science and Engineering, Zhejiang Gongshang University, Hangzhou 310012 (China); Jiang, Chen-Jing [The Second Institute of Oceanography, SOA, Hangzhou 310012 (China)

2012-02-01

Four kinds of solid waste residue (SWR, S1 to S4) from different stages in a sequential detoxification process were chosen. The biotoxicity of the leachates from S1 to S4 was tested by Chlorella pyrenoidosa. The growth inhibition, the chlorophyll a (chla) and chlorophyll b (chlb) concentrations, and the ultrastructural morphology of cells of C. pyrenoidosa were studied. It shows that the growth inhibition of C. pyrenoidosa significantly increased with increasing leachate concentration when exposed to the leachates from S1, S2, S3, and S4, respectively. It well reflects the toxicity difference of leachate from SWR at different treatment stages, namely S1 > S2 > S3 > S4. Correspondingly, the chla and chlb concentrations of C. pyrenoidosa increased gradually as SWR was treated deeply. Leachate disrupted chlorophyll synthesis and inhibited cell growth. The changing of the ultrastructural morphology of cells under different leachate exposures, such as volume of chloroplasts and quantity of thylakoids reducing, confirmed the toxicity decrease of leachates from different stages. C. pyrenoidosa is a good bioindicator for hazardous solid waste detoxification. The EC{sub 50} at difference scenarios also suggests that it was feasible to estimate ecological toxicity of leachates to C. pyrenoidosa after exposure times of 72 h. C. pyrenoidosa can be introduced to evaluate the effect of hazardous solid waste disposal by biotoxicity assessment. - Highlights: Black-Right-Pointing-Pointer The detoxification process of hazardous solid waste was evaluated by Chlorella pyrenoidosa. Black-Right-Pointing-Pointer The best exposure time of ecological toxicity assessment of Chlorella pyrenoidosa was presented. Black-Right-Pointing-Pointer The possible toxicity of the hazardous solid waste at different disposal stage on Chlorella pyrenoidosa was explored from cell tissue.

Visualisation and interpretation of the autumn 2006 mise-a-la-masse survey data at the Olkiluoto site

International Nuclear Information System (INIS)

Lehtonen, T.

2007-01-01

This report concerns mise-a-la-masse surveys conducted autumn 2006 at the area of the underground characterisation facility (ONKALO) and surroundings. Field surveys were made in both drillholes and on the ground surface. Suomen Malmi Oy conducted the fieldwork. Astrock Oy supervised field surveys and processed, interpreted and reported acquired data for Astrock Oy. The purpose of the study was to collect data for geological modelling with following continuity of the conducting features in bedrock from drillhole to drillhole and to ground surface. These conducting features in bedrock are often linked with lithologic characters or weakness zones. The completed survey supplements previous mise-a-la-masse measurement and on the other hand widens investigations to the newest drillholes OL-KR40-OL-KR43. A basis for the current survey was the previous mise-a-la-masse measurements and their results. Current earthings were placed in 15 electrically conducting structures in three drillholes, two at an investigation trench and one in ONKALO. Current earthings were situated in drillholes OL-KR4, OL-KR27 and OL-KR33, at OL-TK13 and at chainage 899 in ONKALO. Electrical connections were probed in nine drillholes, in four pregrouting holes and at two ground survey area. The acquired survey data were collected to xyz-coordinate oriented databases for 3D processing, interpreting and visualization of the results. At first the data were transferred to Oasis Montaj, where the potential field profiles were drawn and studied drillhole-by-drillhole current earthing at a time to determine characteristics of the electrical connections. Next probable connections between drillholes were constructed and moved to Surpac (registered trademark) Vision 3D software for visualisation. They were delivered for Posiva Oy as Surpac (registered trademark) string and DTM files. With the mise-a-la-masse data, it was possible to determine low dipping electrically conducting structures, congruent with the

Tallink kaalub müüki pandud Silja Line'i ostu / Priit Rajalo

Index Scriptorium Estoniae

Rajalo, Priit, 1975-

2005-01-01

Soome Silja Oy AB omanikfirma Sea Containers otsustas 2. novembril Silja Line'i müüki panna, kuna laevafirma kasumlikkus on järsult vähenenud. Tallink Grupi finantsdirektori Janek Stalmeistri sõnul on Tallinki võimalikku ostuhuvi Silja Line'i vastu vara veel kommenteerida. Lisa: Silja laevad

50 CFR 648.55 - Framework adjustments to management measures.

Science.gov (United States)

2010-10-01

... prevent overfishing on a continuing basis, as required by National Standard 1 of the Magnuson-Stevens Act... expected to achieve OY and prevent overfishing on a continuing basis, the PDT shall recommend to the... overfishing on a continuing basis. When making the status determination in the SAFE Report, the PDT shall...

76 FR 22345 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of...

Science.gov (United States)

2011-04-21

... effective January 1, 2011, and implement interim measures to reduce overfishing of gag in the Gulf of Mexico... effect of this proposed rule is to reduce overfishing of the gag resource in the Gulf. DATES: Written... to prevent overfishing and achieve, on a continuing basis, the optimum yield (OY) from federally...

Pärnu maanteele kerkib Tallinna suurim korterelamu Osten Tor

Index Scriptorium Estoniae

2004-01-01

Tallinnas Pärnu mnt. ja Tondi t. ristmikule kerkib 2006. a. alguseks 15-korruseline torniga äri- ja eluhoone. Hoone jaoks Soomes korraldatud arhitektuurikonkursi võitis Mutanen-Samninen-Vaarna OY ideekavand. Edasine projekteerimistöö toimub Eesti büroos KPME OÜ. Ehituse peatöövõtja: SRV Ehituse AS

The effect of O2 in a humid O2/N2/NOx gas mixture on NOx and N2O remediation by an atmospheric pressure dielectric barrier discharge

DEFF Research Database (Denmark)

Teodoru, Steluta; Kusano, Yukihiro; Bogaerts, Annemie

2012-01-01

A numerical model for NxOy remediation in humid air plasma produced with a dielectric barrier discharge at atmospheric pressure is presented. Special emphasis is given to NO2 and N2O reduction with the decrease of O2 content in the feedstock gas. A detailed reaction mechanism including electronic...

Investigations of Nitrogen Oxide Plasmas: Fundamental Chemistry and Surface Reactivity and Monitoring Student Perceptions in a General Chemistry Recitation

Science.gov (United States)

Blechle, Joshua M.

2016-01-01

Part I of this dissertation focuses on investigations of nitrogen oxide plasma systems. With increasing concerns over the environmental presence of NxOy species, there is growing interest in utilizing plasma-assisted conversion techniques. Advances, however, have been limited because of the lack of knowledge regarding the fundamental chemistry of…

Annual review of the Institute of Plasma Physics, Nagoya University, for fiscal 1987

International Nuclear Information System (INIS)

Akaishi, K.; Midzuno, Y.; Namba, C.

1988-01-01

During the past three years, the Institute acquired 47ha of land for the new site in Toki City. The new plan of a large helical system which will be undertaken in the Toki site has been developed by a special committee under the Ministry of Education, Science and Culture. After the 11th IAEA Conference held in Kyoto last autumn, the Institute started under the new organization in order to concentrate effort to the comprehensive study on toroidal confinement including the design study of the large herical system. The new organization and the related research program in this fiscal year were torus projects (NTX/JIPP T-11U tokamak, compact helical system, advanced torus experiment), RF heating, plasma and fusion technologies, theory and computer simulation, various centers and others. This report presents the summary of these research subjects. Nagoya torus experiment (NTX) and helical island diverter experiment (HIDEX) using the JIPP T-11U device, the compact helical system of Torsatron/Heliotron type, the RF system for fast wave current drive and ion Bernstein wave heating experiments in JIPP T-11U, wall-plasma interaction, NBI heating, the development of a long pulse positive ion source and a high current negative ion source, tritium diffusion and so on are reported. (K.I.)

Kehitysehdotusten tuottaminen palvelupolun parantamiseksi - Case Expert ASA Oy

OpenAIRE

Berg, Esa

2011-01-01

Kodintekniikka-alan kiristyvä kilpailutilanne ja maailmantalouden epävakaat ajat vaativat alalla toimivilta yrityksiltä keinoja löytää kilpailuetuja verrattuna muihin alan toimijoihin. Tämä tilanne johtaa siihen, että yritysten tulee entistä enemmän kiinnittää aitoa kiinnostusta asiakkaiden tarpeisiin ja toiveisiin, jotta yritys voisi palvella heitä paremmin. Tämän opinnäytetyön tavoitteena on ollut asiakkaan palvelupolun kehittämiseen tähtäävien kehitysideoiden tuottaminen Service ...

Cisco Meraki -palvelun tuottaminen Businessforum Oy:n palvelutarjoamaan

OpenAIRE

Liski, Juhani

2016-01-01

Tässä työssä perehdyttiin pilvihallittuihin Meraki-kytkimiin ja tukiasemiin, näiden verkkohal-lintaan sekä näillä laitteilla langattoman verkon palvelun toteuttamiseen. Yleisesti tutustuttiin myös palveluihin, pilviteknologiaan ja langattomiin verkkoihin. Työn teoriaosuus avasi palvelua, tämän tuotteistamista, pilvipalveluja ja niiden mahdollisia hyötyjä yrityksille, Meraki-yrityksen historiaa ja heidän tuotteidensa pilvipohjaisuutta. Teoria-osuuden lopuksi avattiin langattomien verkkojen...

Tehokkuutta liiketoimintaan asiakkuudenhallinnalla : case IdHAIR Finland Oy

OpenAIRE

Pesonen, Jaana

2014-01-01

Yksilöllisestä asiakaspalvelusta ja asiakkuuksien kehittämisestä on tullut nykypäivänä tärkeää yrityksille. Asiakkuuksia vaalimalla yritys pystyy kehittämään omaa arvoaan ja luomaan vahvempaa asemaa markkinoilla. Yrityksen on kannattavampaa pitää kiinni nykyisistä asiakkaistaan, kuin keskittyä uusien asiakkaiden hankkimiseen. Opinnäytteen tavoitteena oli selvittää miten case-yrityksessä voitaisiin hyödyntää asiakkuusjohtamista palveluprosessien tehostamisessa ja ka...

Online Content Marketing Strategy : Case: Mediatalo Toimelias Oy

OpenAIRE

Popova, Ekaterina

2014-01-01

The purpose of the study was to get a deeper knowledge of content marketing concepts, its techniques, benefits, challenges and trends, and to create an online content marketing strategy and give clear guidelines to the case company on how to lead customers through the buying cycle. The data for this study were gathered from the various sources, particularly articles and books. The information concerned core concepts of content marketing, consumer behaviour, Internet channels, customer att...

Álvaro de Oyon. Un príncipe de la libertad

Directory of Open Access Journals (Sweden)

Alberto Montezuma Hurtado

1969-07-01

Full Text Available Yo guardo mis dudas sobre la verdadera personalidad y los propósitos del célebre Álvaro de Oyón, que fuera ahorcado y sometido enseguida a terrible destazamiento en la muy noble Villa de Popayán, el día tres de noviembre de 1553.

77 FR 26238 - Fisheries of the United States; National Standard 1 Guidelines

Science.gov (United States)

2012-05-03

... this work, a number of issues regarding the application of the NS1 Guidelines were identified that may.... Further guidance on how OY should be specified to balance the multiple considerations in mixed-stock.... Under the MSA, stocks that have a life cycle of approximately 1 year and stocks subject to international...

50 CFR Table 1b to Part 660... - 2009, Harvest Guidelines for Minor Rockfish by Depth Sub-groups (weights in metric tons)

Science.gov (United States)

2010-10-01

... population in the California Current ecosystem, a non-quantitative assessment was conducted in 2007. The... 50 percent of the 2008 ABC and OY values. The stock is expected to remain at its current equilibrium... catcher/processors, 60.0 mt for motherships, and 105.0 mt for shore-based. r Canary rockfish—A canary...

Eesti - Soome turismikaubamaja -5%

Index Scriptorium Estoniae

2006-01-01

Turismikonverentsil "Eesti - Soome turismikaubamaja -5%" analüüsiti Eesti ja Soome vahelisi turismivõimalusi ning seati sihte edaspidiseks. Ülevaade Reilika Lelovi (Turismimaailm OÜ), Pauli Santala (Finnish Consulting Group), Tarja Vaakanaineni (Tallink Finland Vice Managing), Ain Hinsbergi (Turismimaailm OÜ), Jari Auraneni (Go Finland Oy) ja Mikko Saviko (The Baltic Guide) ettekannetest

Superconductivity in Bi-Sr-Ca-Cu-O bulk and film ceramics

Energy Technology Data Exchange (ETDEWEB)

Sukhanov, A A; Ozmanian, KH R; Sandomirskii, B B

1988-07-01

A superconducting transition with Tc0 = 82-95 K and Tc(R = 0) = 82-72 K was observed in Bi(Sr/1-x/Ca/x/)2Cu3O(y) bulk and film specimens obtained via a solid-phase reaction. Temperature dependences of the resistance, critical current, and magnetic susceptibility were measured.

Nigerian Food Journal - Vol 30, No 2 (2012)

African Journals Online (AJOL)

JO Arawande, OY Ogunyemi. http://dx.doi.org/10.1016/S0189-7241(15)30027-8 ... Effect of Soy Flour and Maize Flour Addition on Phase Separation in Moi- Moi from Soaked Cowpea (Vigna unguiculata) and Cowpea Flour from Different Cowpea Varieties · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT ...

Biomass thermochemical conversion - overview of results; Biomassan jalostus - tutkimusalueen katsaus

Energy Technology Data Exchange (ETDEWEB)

Sipilae, K. [VTT Energy, Espoo (Finland). Energy Production Technologies

1995-12-31

In this Bioenergy research program the thermochemical conversion activities are mainly concentrated in three fields (1) flash pyrolysis and the use of wood oil in boilers and engines (2) biomass gasification for gas engine power plants and finally (3) conversion of black liquor and extractives in a pulp mill to various liquid fuels. Parallel to activities in Finland also significant work has been done in EU-Joule and Apas projects and in the IEA Bioenergy Agreement. In the area of flash pyrolysis technology, three new laboratory and PDU-units have been installed to VTT in order to produce various qualities of bio oils from wood and straw. The quality of pyrolysis oils have been characterized by physical and chemical methods supported by EU and IEA networks. Several companies are carrying out pyrolysis activities as well: Neste Oy is testing the wood oil in a 200 kW boiler, Waertsilae Diesel Oy is testing Canadian wood oil in a 1.5 MWe diesel power plant engine and Vapo Oy is carrying out investigations to produce pyrolysis oils in Finland. The biomass gasification coupled to a gas engine is an interesting alternative for small scale power production parallel to existing fluid bed boiler technology. VTT has installed a circulating fluid bed gasifier with advanced gas cleaning system to test various technologies in order to feed the gas to an engine. In order to produce liquid fuels at a pulp mill, the laboratory work has continued using crude soap as a raw material for high pressure liquid phase treatment and atmospheric pyrolysis process. The quality of the oil is like light fuel oil or diesel fuel, possibilities to use it as a lubricant will be investigated

Biomass thermochemical conversion - overview of results; Biomassan jalostus - tutkimusalueen katsaus

Energy Technology Data Exchange (ETDEWEB)

Sipilae, K [VTT Energy, Espoo (Finland). Energy Production Technologies

1996-12-31

In this Bioenergy research program the thermochemical conversion activities are mainly concentrated in three fields (1) flash pyrolysis and the use of wood oil in boilers and engines (2) biomass gasification for gas engine power plants and finally (3) conversion of black liquor and extractives in a pulp mill to various liquid fuels. Parallel to activities in Finland also significant work has been done in EU-Joule and Apas projects and in the IEA Bioenergy Agreement. In the area of flash pyrolysis technology, three new laboratory and PDU-units have been installed to VTT in order to produce various qualities of bio oils from wood and straw. The quality of pyrolysis oils have been characterized by physical and chemical methods supported by EU and IEA networks. Several companies are carrying out pyrolysis activities as well: Neste Oy is testing the wood oil in a 200 kW boiler, Waertsilae Diesel Oy is testing Canadian wood oil in a 1.5 MWe diesel power plant engine and Vapo Oy is carrying out investigations to produce pyrolysis oils in Finland. The biomass gasification coupled to a gas engine is an interesting alternative for small scale power production parallel to existing fluid bed boiler technology. VTT has installed a circulating fluid bed gasifier with advanced gas cleaning system to test various technologies in order to feed the gas to an engine. In order to produce liquid fuels at a pulp mill, the laboratory work has continued using crude soap as a raw material for high pressure liquid phase treatment and atmospheric pyrolysis process. The quality of the oil is like light fuel oil or diesel fuel, possibilities to use it as a lubricant will be investigated

Surface chemical analysis and ab initio investigations of CsI coated C fiber cathodes for high power microwave sources

Science.gov (United States)

Vlahos, Vasilios; Morgan, Dane; LaCour, Matthew; Golby, Ken; Shiffler, Don; Booske, John H.

2010-02-01

CsI coated C fiber cathodes are promising electron emitters utilized in field emission applications. Ab initio calculations, in conjunction with experimental investigations on CsI-spray coated C fiber cathodes, were performed in order to better understand the origin of the low turn-on E-field obtained, as compared to uncoated C fibers. One possible mechanism for lowering the turn-on E-field is surface dipole layers reducing the work function. Ab initio modeling revealed that surface monolayers of Cs, CsI, Cs2O, and CsO are all capable of producing low work function C fiber cathodes (1 eV<Φ<1.5 eV), yielding a reduction in the turn-on E-field by as much as ten times, when compared to the bare fiber. Although a CsI-containing aqueous solution is spray deposited on the C fiber surface, energy dispersive x-ray spectroscopy and scanning auger microscopy measurements show coabsorption of Cs and I into the fiber interior and Cs and O on the fiber surface, with no surface I. It is therefore proposed that a cesium oxide (CsxOy) surface coating is responsible, at least in part, for the low turn E-field and superior emission characteristics of this type of fiber cathode. This CsxOy layer could be formed during preconditioning heating. CsxOy surface layers cannot only lower the fiber work function by the formation of surface dipoles (if they are thin enough) but may also enhance surface emission through their ability to emit secondary electrons due to a process of grazing electron impact. These multiple electron emission processes may explain the reported 10-100 fold reduction in the turn-on E-field of coated C fibers.

Environmental impact assessments of a fifth nuclear power plant unit in Finland

International Nuclear Information System (INIS)

Aurela, Jorma; Koivisto, Katarina

2000-01-01

This paper presents the results of president questionnaires and media monitoring of press cuttings concerned with siting of the new fifth in a row Finnish NPP. Two years ago both Fortum Power and Heat Oy and Teollisuuden Voima Oy (TVO) launched their Environmental impact assessment (EIA) procedures of a new nuclear power unit in Finland. The EIA procedures were launched to investigate the environmental impacts of a fifth nuclear power plant which possibly will be built in Loviisa or at Olkiluoto. In Finland there are four operating NPP units, two in Loviisa (Fortum) and two in Eurajoki, Olkiluoto (TVO). In the EIA procedure citizens and various associations and authorities have an opportunity to express their views on the matters related to the project. The Ministry of Trade and Industry (MTI) as the coordination authority arranges the organisation of the EIA hearings and the collection of statements and opinions. The EIA procedure in Finland takes place in two stages. The first stage i.e. the EIA programme describes the project and presents the plan on how the environmental effects are investigated and assessed. In the second stage the actual assessment of the environmental effects of the project will be submitted. Both Fortum and Teollisuuden Voima Oy (TVO) launched in spring 1998 their EIA procedures. The main alternatives are the Loviisa 3 project includes two plant type alternatives. The size of the plant is between 1000 and 1700 MWe, and the extension project of the Olkiluoto NPP to build a NPP unit of about 1000-1500 MWe at Olkiluoto. The EIA reports were submitted to the MTI in August 1999 and after that they were on display for two months for opinions and statements

76 FR 65662 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Coastal Migratory Pelagic...

Science.gov (United States)

2011-10-24

... mackerel, and cobia. The intent of this rule is to specify ACLs for species not undergoing overfishing... overfishing, ACLs and AMs must be established at a level that prevents overfishing and helps to achieve OY... mechanism for specifying ACLs at a level such that overfishing does not occur in a fishery and AMs to...

50 CFR Table 1c to Part 660... - 2009, Open Access and Limited Entry Allocations by Species or Species Group (weights in metric tons)

Science.gov (United States)

2010-10-01

... population in the California Current ecosystem, a non-quantitative assessment was conducted in 2007. The... 50 percent of the 2008 ABC and OY values. The stock is expected to remain at its current equilibrium... fishery: 85.0 mt for catcher/processors, 60.0 mt for motherships, and 105.0 mt for shore-based. r/ Canary...

Työturvallisuuden parantaminen rikastamon kunnossapidossa

OpenAIRE

Kaisanlahti, S. (Santeri)

2017-01-01

Tiivistelmä Diplomityön tavoitteena on parantaa työturvallisuutta Agnico Eagle Finland Oy:n Kittilän kaivoksen rikastamon kunnossapidossa. Työn tilaus tuli kaivoksen työturvallisuusosastolta. Syynä työn tilaamiseen oli rikastamon kunnossapidossa aikaisemmin sattuneet tapaturmat ja rikastamon alueella sijaitsevat haastavat työkohteet. Työturvallisuus on...

Dopamine receptors genes polymorphisms in Parkinson patients with levodopa-induced dyskinesia

NARCIS (Netherlands)

Pozhidaev, Ivan V; Alifirova, V. M.; Freidin, Maxim B.; Zhukova, I.A.; Fedorenko, Olga Yu; Osmanova, Diana Z; Mironova, Y.S.; Wilffert, Berend; Ivanova, Svetlana A.; Loonen, Antonius

2017-01-01

Dopamine receptors genes polymorphisms in Parkinson patients with levodopa-induced dyskinesia I. Pozhidaev(1), V.M. Alifirova(2), M.B. Freidin(3), I.A. Zhukova(2), O.Y. Fedorenko(1), D.Z. Osmanova(1), Y.S. Mironova(2), B. Wilffert(4), S.A. Ivanova(1), A.J.M. Loonen(5) (1)Mental Health Research

Experimental testing of an ABB Master application

International Nuclear Information System (INIS)

Haapanen, P.; Maskuniitty, M.; Korhonen, J.; Tuulari, E.

1995-10-01

A prototype dynamic testing harness for programmable automation systems has been specified and implemented at the Technical Research Centre of Finland (VTT). In order to get experience on the methodology and equipment for the testing of systems important to the safety of nuclear power plants, where the safety and reliability requirements often are very high, two different pilot systems have been tested. One system was an ABB Master application, which was loaned for testing from ABB Atom by Teollisuuden Voima Oy (TVO). Another system, loaned from Siemens AG (SAG) by IVO International Oy (IVO), was an application realized with SAG's digital SILT technology. The report describes the experiences gained in testing an APRM pilot system realized with ABB Master technology. The testing of the pilot application took place in the VTT Automation laboratory in Otaniemi in September-October 1994. The purpose of the testing was not to assess the quality of the pilot system, but to get experience in the testing methodology and find out the further development needs and potentials of the test methodology and equipment. (7 refs., 14 figs., 9 tabs.)

Geophysical logging and imaging of drillholes OL-KR45, OL-KR49, OL-KR50 and OL-KR50B at Olkiluoto in 2009

International Nuclear Information System (INIS)

Tarvainen, A.-M.

2010-04-01

Suomen Malmi Oy conducted geophysical drillhole logging, acoustic imaging and optical imaging of the drillholes OL-KR45 (re-measurements), OL-KR49, OL-KR50 and OL-KR50B at the Olkiluoto site in Eurajoki during January-November 2009. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. The missing density logging of drillhole OL-KR45 was carried out successfully. Dynamic rock mechanical parameters and natural gamma data were re-processed and this report includes updated WellCAD and Excel files. Acoustic imaging was also carried out in OL-KR45 after 700 meters depth. Acoustic imaging was used instead of optical imaging after 350 meters in OL-KR49 and 700 meters in OL-KR50. (orig.)

Feed type based expert systems in mineral processing plants

International Nuclear Information System (INIS)

Jamsa-Jounela, S.-L.; Laine, S.; Laurila, H.

1999-01-01

Artificial Intelligence includes excellent tools for the control and supervision of industrial processes. Several thousand industrial applications have been reported worldwide. Recently, the designers of the AI systems have begun to hybridize the intelligent techniques, expert systems, fuzzy logic and neural networks, to enhance the capability of the AI systems. Expert systems have proved to be ideal candidates especially for the control of mineral processes. As successful case projects, expert system based on on-line classification of the feed type is described in this paper. The essential feature of this expert system is the classification of different feed types and their distinct control strategies at the plant. In addition to the classification, the expert system has a database containing information about how to handle the determined feed type. This self-learning database scans historical process data to suggest the best treatment for the ore type under processing. The system has been tested in two concentrators, the Outokumpu Finnmines Oy, Hitura mine and Outokumpu Chrome Oy, Kemi mine. (author)

CONDUCTIVIDAD Y PERCOLACION DE UN MATERIAL COMPUESTO: OXIDO MAGNETICO-POLIANILINA

Directory of Open Access Journals (Sweden)

Juan C. Aphesteguy

2013-01-01

Full Text Available El objetivo de este trabajo es estudiar la conductividad de un material compuesto (óxido de hierro /polianilina a fin de determinar la relación mínima entre sus componentes que mantiene la interconexión entre las partículas de polianilina. Para ello se prepararon por mezcla sólida, sistemas formados por polianilina (en su forma básica, no conductora, emeraldina dopada con ácido canforsulfónico (CSA y un óxido de hierro magnético (Fe xOy (parcialmente encapsulado en polianilina. Los polvos fueron compactados a 1,3.103 MPa. Se estudió la conductividad del sistema en función de la fracción en volumen (P del óxido incluido. Se determinó, para las condiciones experimentales establecidas, una fracción de percolación Pc = 0,131 (38,6 % m/m FexOy a 300K. Los resultados experimentales indicaron que la conductividad presenta un comportamiento crítico no universal que se interpretó empleando el modelo de Kusy.

Operation of Finnish nuclear power plants. Quarterly report 4th quarter, 1994 and annual summary

Energy Technology Data Exchange (ETDEWEB)

Tossavainen, K [ed.

1995-05-01

The Loviisa NPP units were in power operation the whole last quarter, with the exception of a reactor scram at Loviisa 1. The load factor average of all Finnish plant units was 100.2 %. The annual average was 90.0 %. All events in the fourth annual quarter were assigned level 0 (no safety significance) on the international INES scale. Four events in 1994 were classified level 1 (an anomaly). The Finnish Centre for Radiation and Nuclear Safety in December approved Imatran Voima Oy`s application to extend the operation of the reactor pressure vessel of Loviisa 2 until the annual maintenance outage of 2010. During this quarter, a batch of spent fuel from Loviisa power plant was transported to Russia. Occupational doses and radioactive releases off-site were below authorised limits. Only such quantities of plant-based radioactive materials were measurable in samples collected around the plants as have no bearing on the radiation exposure of the population. The report includes a summary of all the items described in the Quarterly Reports of 1994. (8 figs., 4 tabs.).

Cross-Borehole research with EMRE-system. Radiofrequency measurements in drillhole section OL-KR40 - OL-KR45 at Olkiluoto, 2009

International Nuclear Information System (INIS)

Korpisalo, A.; Niemelae, M.

2010-04-01

Posiva Oy carries out research and development work for the spent nuclear fuel disposal in Finland. The repository will be constructed deep in the crystalline bedrock at Olkiluoto island in Eurajoki. Construction of the underground characterization facility ONKALO started in 2004. Posiva Oy has been actively reviewing the methods for examining granitic i.e. crystalline bedrock properties. One of the considered methods was electromagnetic cross-borehole survey. This report describes the field work carried out in 2009 and the interpretation of the continuous wave device in one drillhole panel at 100-750 m depth level. Panel was conic in shape thus the collars were in close vicinity (about 10 m) at the earth surface and diverged in deeper parts being several hundreds of meters from each others. The works were carried out by Geological Survey of Finland. After the pioneering work in 2005 the device was repaired thoroughly and the proper functioning of the device was ensured after several tests. Geological-geophysical characterization of Olkiluoto site has been run since 1989, and more than 40 drillholes have been prepared

Effect of annealing treatments on normal state resistivity of YBa 2 ...

African Journals Online (AJOL)

Samples of YBa2(Cu1-xTix)3Oy superconductor with x=0.00 , 0.01, 0.03 have been prepared by solide state reaction method. The effect of annealing treatments on normal electrical resistivity has been done using the bipolaron model. The results of this study show the increase of localized charge when the dopant content ...

Underground rock storage concepts for natural gas and LPG in Finland

International Nuclear Information System (INIS)

Saerkkae, P.

1990-01-01

Natural gas storage concepts are developed in Finland for both deep, unlined rock storages and cryogenic lined, near-surface storages. For butane and propane, Neste Oy has two unlined rock storages in Porvoo. Up to now, experiences are good on storage of LPG in rock temperature and higher than hydrostatic pressure. (author). 3 refs, 8 figs

Synthetic Platelets: Intravenous Infusible Nanoparticles to Promote Hemostasis and Survival Following Liver Injury in Swine

Science.gov (United States)

2014-08-12

measurements confirm the hydrodynamic diameter of the pru·ticles to be closer to 450 nm and the zeta potential to be -30 mY. The NME confirms the...ional studies. Brie Oy, the lefi lobe of the liver is iso lated and hemisected followed by c losure o f’the cavit y and quantification of blood loss

Structure and properties of (Sr, Ca)CuO2-BaCuO2 superlattices grown by pulsed laser interval deposition

NARCIS (Netherlands)

Koster, Gertjan; Verbist, Karen; Rijnders, Augustinus J.H.M.; Rogalla, Horst; van Tendeloo, Gustaav; Blank, David H.A.

2001-01-01

We report on the preparation of CuBa2(SrxCa1¿x)nCun¿1Oy compounds by fabrication of (Ba,Sr,Ca)CuO2 superlattices with pulsed laser deposition (PLD). A technique called interval deposition is used to suppress multi-level or island growth resulting in high-quality superlattice structures. Both, the

Viron televisio- ja radiokeskus = Estonian National Broadcasting Building / Pentti Kareoja

Index Scriptorium Estoniae

Kareoja, Pentti

2008-01-01

Eesti Rahvusringhäälingu hoone arhitektuurikonkursi võitis Taani arhitektuuribüroo Nobel Arkitekter. Teise koha pälvis Soome arhitektuuribüroo Harris-Kjisik OY (arhitektid Trevor Harris, Taru Niskanen) töö "Mediatetris". Ergutuspreemia pälvis Pekka Lassila Arhitektuuribüroo (arhitektid Pekka Lassila, Janne Kantee, Annika Ritola, Tuomas Arnala) töö "Auteur"

Browse Title Index

African Journals Online (AJOL)

Items 401 - 450 of 479 ... Vol 28, No 2 (2010), Proximate and sensory properties of fruit juice produced from varieties of watermelon (Citrullus lanatus). Abstract. O.Y Eziaghighala, M.O ... Vol 28, No 1 (2010), Quality Characteristics of bread made from Wheat and Fluted Pumpkin seed flour, Abstract. H.O Agu, J.A Ukonze, K.A ...

Browse Title Index

African Journals Online (AJOL)

Vol 18, No 4 (2016): Series B, D, E, Etude de la magnetoresistance du compose supraconducteur YBa2(Cu1-xTix)3Oy suite a un multicycle de traitement thermique, Abstract. D Mani Kongnine, A Hamrita, K Napo. Vol 16, No 2 (2014), Etude de la Pyrolyse en Analyse Thermogravimetrique du Carton : Cinetique Double ...

Author Details - African Journals Online

African Journals Online (AJOL)

Hamrita, A. Vol 18, No 4 (2016): Series B, D, E - Articles Etude de la magnetoresistance du compose supraconducteur YBa2(Cu1-xTix)3Oy suite a un multicycle de traitement thermique. Abstract. ISSN: 2413-354X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's ...

Regulatory control of nuclear safety in Finland. Annual report 1998

Energy Technology Data Exchange (ETDEWEB)

Tossavainen, K. [ed.

1999-10-01

The report describes regulatory control of the safe use of nuclear energy by the Radiation and Nuclear Safety Authority (STUK) in 1998. STUK is the Finnish nuclear safety authority. The submission of this report to the Ministry of Trade and Industry is stipulated in Section 121 of the Nuclear Energy Decree. It was verified by regulatory control that the operation of Finnish NPPs was in compliance with conditions set out in the operating licences of the plants and with regulations currently in force. In addition to supervising the normal operation of the plants, STUK oversaw projects carried out at the plant units, which related to the uprating of their power and the improvement of their safety. STUK issued to the Ministry of Trade and Industry a statement about applications for the renewal of the operating licences of Loviisa and Olkiluoto NPPs, which had been submitted by Imatran Voima Oy and Teollisuuden Voima Oy. Regulatory activities in the field of nuclear waste management were focused on the storage and final disposal of spent fuel as well as the treatment, storage and final disposal of reactor waste. STUK issued a statement to the Ministry of Trade and Industry about an environmental impact assessment programme pertaining to a spent fuel repository project, which had been submitted by Posiva Oy, as well as on Imatran Voima Oy's application concerning the operation of a repository for medium- and low-level reactor waste from Loviisa NPP. The use of nuclear materials was in compliance with the regulations currently in force and also the whereabouts of every batch of nuclear material were ensured by safeguards control. In international safeguards, important changes took place, which were reflected also in safeguards activities at national level. International co-operation continued based on financing both from STUK's budget and from additional sources. The focus of co-operation funded from outside sources was as follows: improvement of the safety of

Regulatory control of nuclear safety in Finland. Annual report 1998

International Nuclear Information System (INIS)

Tossavainen, K.

1999-10-01

The report describes regulatory control of the safe use of nuclear energy by the Radiation and Nuclear Safety Authority (STUK) in 1998. STUK is the Finnish nuclear safety authority. The submission of this report to the Ministry of Trade and Industry is stipulated in Section 121 of the Nuclear Energy Decree. It was verified by regulatory control that the operation of Finnish NPPs was in compliance with conditions set out in the operating licences of the plants and with regulations currently in force. In addition to supervising the normal operation of the plants, STUK oversaw projects carried out at the plant units, which related to the uprating of their power and the improvement of their safety. STUK issued to the Ministry of Trade and Industry a statement about applications for the renewal of the operating licences of Loviisa and Olkiluoto NPPs, which had been submitted by Imatran Voima Oy and Teollisuuden Voima Oy. Regulatory activities in the field of nuclear waste management were focused on the storage and final disposal of spent fuel as well as the treatment, storage and final disposal of reactor waste. STUK issued a statement to the Ministry of Trade and Industry about an environmental impact assessment programme pertaining to a spent fuel repository project, which had been submitted by Posiva Oy, as well as on Imatran Voima Oy's application concerning the operation of a repository for medium- and low-level reactor waste from Loviisa NPP. The use of nuclear materials was in compliance with the regulations currently in force and also the whereabouts of every batch of nuclear material were ensured by safeguards control. In international safeguards, important changes took place, which were reflected also in safeguards activities at national level. International co-operation continued based on financing both from STUK's budget and from additional sources. The focus of co-operation funded from outside sources was as follows: improvement of the safety of Kola and

Solidification of Bi2Sr2Ca1Cu2Oy and Bi2Sr1.75Ca0.25CuOy

International Nuclear Information System (INIS)

Holesinger, T.G.; Miller, D.J.; Viswanathan, H.K.; Chumbley, L.S.

1993-01-01

The solidification processes for the compositions Bi 2 Sr 2 CaCu 2 O y (2212) and Bi 2 Sr 1.75 Ca 0.25 CuO y (2201) were determined as a function of oxygen partial pressure. During solidification in argon, the superconducting phases were generally not observed to form for either composition. In both cases, the solidus is lowered to approximately 750 degree C. Solidification of Bi 2 Sr 1.75 Ca 0.25 CuO y in Ar resulted in a divorced eutectic structure of Bi 2 Sr 2-x Ca x O y (22x) and Cu 2 O while solidification of Bi 2 Sr 2 CaCu 2 O y in Ar resulted in a divorced eutectic structure of Bi 2 Sr 3-x Ca x O y (23x) and Cu 2 O. Solidification of Bi 2 Sr 1.75 Ca 0.25 CuO y in O 2 resulted in large grains of 2201 interspersed with small regions containing the eutectic structure of 22x and CuO/Cu 2 O. Solidification of Bi 2 Sr 2 CaCu 2 O y in partial pressures of 1%, 20%, and 100% oxygen resulted in multiphase samples consisting of 2212, 2201, some alkaline-earth cuprates, and both divorced eutectic structures found during solidification in Ar. For both compositions, these latter structures can be attributed to oxygen deficiencies present in the melt regardless of the overpressure of oxygen. These eutectic structures are unstable and convert into the superconducting phases during subsequent anneals in oxygen. The formation process of the 2212 phase during solidification from the melt was determined to proceed through an intermediate state involving the 2201 phase

Biotoxicity of TiO2 Nanoparticles on Raphidocelis subcapitata Microalgae Exemplified by Membrane Deformation

Directory of Open Access Journals (Sweden)

Merve Ozkaleli

2018-02-01

Full Text Available TiO2 nanoparticles (NPs, which are mainly used in consumer products (mostly cosmetics, have been found to cause ecotoxic effects in the aquatic environment. The green algae Raphidocelis subcapitata, as a representative of primary producers of the freshwater ecosystem, has been frequently used to study the effects of metal oxide NPs. An ecotoxicity study was conducted herein to investigate the effects of TiO2 NPs on survival and membrane deformation of algal cells. Five different concentrations of nano-TiO2 particles (1, 10, 50, 100 and 500 mg/L were prepared in synthetic surface water samples with five different water quality characteristics (pH 6.4–8.4, hardness 10–320 mg CaCO3/L, ionic strength 0.2–8 mM, and alkalinity 10–245 mg CaCO3/L. Results showed a significant increase in the hydrodynamic diameter of NPs with respect to both NP concentrations and ionic content of the test system. A soft synthetic freshwater system at pH 7.3 ± 0.2 appeared to provide the most effective water type, with more than 95% algal mortality observed at 50, 100 and 500 mg/L NP concentrations. At high exposure concentrations, increased malondialdehyde formations were observed. Moreover, due to membrane deformation, TEM images correlated the uptake of the NPs.

Biotoxicity of TiO2 Nanoparticles on Raphidocelis subcapitata Microalgae Exemplified by Membrane Deformation

Science.gov (United States)

Ozkaleli, Merve; Erdem, Ayca

2018-01-01

TiO2 nanoparticles (NPs), which are mainly used in consumer products (mostly cosmetics), have been found to cause ecotoxic effects in the aquatic environment. The green algae Raphidocelis subcapitata, as a representative of primary producers of the freshwater ecosystem, has been frequently used to study the effects of metal oxide NPs. An ecotoxicity study was conducted herein to investigate the effects of TiO2 NPs on survival and membrane deformation of algal cells. Five different concentrations of nano-TiO2 particles (1, 10, 50, 100 and 500 mg/L) were prepared in synthetic surface water samples with five different water quality characteristics (pH 6.4–8.4, hardness 10–320 mg CaCO3/L, ionic strength 0.2–8 mM, and alkalinity 10–245 mg CaCO3/L). Results showed a significant increase in the hydrodynamic diameter of NPs with respect to both NP concentrations and ionic content of the test system. A soft synthetic freshwater system at pH 7.3 ± 0.2 appeared to provide the most effective water type, with more than 95% algal mortality observed at 50, 100 and 500 mg/L NP concentrations. At high exposure concentrations, increased malondialdehyde formations were observed. Moreover, due to membrane deformation, TEM images correlated the uptake of the NPs. PMID:29495534

Kiekkosuotimen hyödyntäminen JVP-Euran jätevesiprosessissa

OpenAIRE

Virtanen, Laura

2017-01-01

Opinnäytetyön aiheena on koeajaa kiekkosuotimen koeajolaitteistoa toimeksiantajan jätevedenpuhdistusprosessissa. Toimeksiantajana toimii JVP-Eura Oy, jonka jätevedenpuhdistamon väliselkeytysaltaiden kapasiteetti ei riitä hulevesien sekä suurien ravinne- ja kiintoainekuormitusten aikana. Koeajolla on tarkoitus kartoittaa kiekkosuotimen soveltuminen ja hyödyntäminen JVP-Euran jätevedenpuhdistusprosessissa ratkaisuna kapasiteettiongelmaan. Koeajo suoritettiin kiekkosuotimen koeajolaitteistol...

Kasvisruokaviikkojen järjestäminen ravintola Introon

OpenAIRE

Ovaskainen, Kaisa

2010-01-01

Tämän opinnäytetyön tarkoituksena oli tuotekehittää kasvisruokateemaviikot Ravintolamestarit Oy:n omistamalle ravintola Baari & Grilli Introlle. Tavoitteena oli tuotekehittää kasvisruokalista, josta löytyisi annoksia mahdollisimman monelle eri kasvisruokavalion noudattajalle. Ruokien suunnittelussa oli otettava huomioon ravintolan liikeidea ja keittiön resurssit. Teemaviikkojen ruokapalvelut toteutettiin ruokatuotantoprosessin mukaisesti. Tuotekehitystyö suoritettiin ravintola Intron keit...

Parkkipaikkasovellus Android-käyttöjärjestelmälle

OpenAIRE

Pentonen, Pekka

2015-01-01

Opinnäytetyön toimeksianto tuli Ambientia Oy:ltä. Toimeksiantajalla oli tarve tehostaa Innoparkilta vuokraamiensa parkkipaikkojen käyttöastetta. Ratkaisuna ongelmaan toteutettiin parkkipaikkojen hallintaan tarkoitettu mobiilisovellus, jonka avulla yrityksen työntekijät voivat älylaitteillaan hallinnoida parkkipaikkoja. Työn tavoitteena oli suunnitella ja toteuttaa natiivi Android-sovellus, joka kommunikoi REST-rajapinnan periaatteita noudattaen palvelinsovelluksen kanssa...

Exports of Finnish wind power technology gaining momentum

International Nuclear Information System (INIS)

2005-01-01

In the 1990s, Finnish companies in the wind power sector focused on supplying advanced components and materials. This capability has now extended to cover entire turbines and wind farms. Winwind Oy, based in northern Finland, has developed a new type of solution for the export market, combining the advantages of modem direct drives with those of traditional high-speed gear systems

Ahlstroem Pyropower sold to Foster Wheeler

International Nuclear Information System (INIS)

Anon.

1995-01-01

Representatives of Foster Wheeler Corporation and A. Ahlstroem Oy have signed in the 3rd of October 1995 a contract which transfers the majority of the shares in Ahlstroem Pyropower to the American company Foster Wheeler at a price of some 200 million dollars. The final price will depend on the result of Ahlstroem Pyropower at the end of 1995. (1 fig.)

Local extinction and reignition of the flame; Liekin paikallinen sammuminen ja uudelleen syttyminen

Energy Technology Data Exchange (ETDEWEB)

Kjaeldman, L. [VTT Energia, Espoo (Finland); Brink, A. [Aabo Akademi, Turku (Finland)

1996-12-01

A model of the local extinction and reignition of the flame suitable to be used in computational fluid dynamic analysis of primarily multi-burner furnaces is developed. The model is implemented in the computational environment Ardemus of VTT and Imatran Voima Oy, and tested against well defined experiments. The model makes the simulation of especially the near burner processes more realistic. (author)

Oil spill waste treatment after a ship accident from the point of view of the Kymenlaakso region; Oeljyvahinkojaetteiden kaesittely alusonnettomuuden jaelkeen Kymenlaakson alueen naekoekulmasta

Energy Technology Data Exchange (ETDEWEB)

Hupponen, M.; Tanskanen, A.-L.; Luoranen, M.; Horttanainen, M.

2007-07-01

The aim of the study was to ascertain the treatment methods, disposal possibilities and capacities from the point of view of the Kymenlaakso region for oily waste that is collected from the shoreline after a large oil ship accident in the Gulf of Finland. The aim was to establish where the waste could be handled and how the oil spill waste could be processed during intermediate storage to make cleaning and disposal more effective. The focus of the study was on both solid oily waste from the shoreline and oily sea water. The beginning of the study focuses on waste disposal responsibility, i.e. whose responsibility the oily waste from a ship accident is. The principles of the technically suitable treatment methods of oil spill waste and limitations of the methods in handling the waste are presented briefly in the study. The volume of waste and the treatment methods applied in previous oil ship accidents that have influenced Finland or happened in the world are also mentioned in the study. The study introduces companies in the Kymenlaakso region, Ekokem Oy Ab in Riihimaeki and mobile treatment plants' possibilities to treat oily waste. Companies that are able to treat oily seawater are also introduced in the study from the point of view of the Kymenlaakso region. The information was collected by telephone and email from the companies' employees in the year 2007. In the Kymenlaakso region, approximately 10 000 t of oily organic matter and crushable equipment used in cleaning can be burned mixed with normal solid fuel in the fluidized bed furnaces of regional power plants annually. Approximately 1 200 t of homogenized oily organic matter can be burned annually in the rotary kiln of a Leca factory. The region's burning capacity will increase when the municipal solid waste incineration plant that was under construction during the study is ready and the waste can be burned on its grate. Soils polluted with vaporizable compounds can be treated with soil

Oyster Larval Survival Counts from Probiotic OY15 Experiments

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Environmentally-friendly methods for controlling microbial pathogenesis in aquaculture with probiotic bacteria are becoming increasingly preferred over use of...

Kohti palveluliiketoimintaa, palvelumuotoilulla palvelua teollisuusyritykselle. : Tapaus KiiltoClean Oy

OpenAIRE

Turpeinen, Pekka

2017-01-01

Suuret muutokset maailmassa vaikuttavat suomalaiseen yrityselämään. Näitä muutoksia ovat muun muassa globalisaatio ja teknologioiden nopea kehittyminen. Muutokseen vaikuttavat digitalisaation tuomat mahdollisuudet liiketoiminnalle, kuten asioiden internet, Internet of Things (IoT) ja keinoälyn kehitys. Yrityksen kilpailuetuihin tulisi löytää uusia keinoja. Kehitys on antanut yrityksille mahdollisuuden luoda asiakkailleen entistä vaivattomammin palveluita. Useimmat asiakkaat eivät hae enää tuo...

CalCOFI Larvae Counts, Scientific Names OY to PI

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

Developing of milled peat production control in Turveruukki Oy

Energy Technology Data Exchange (ETDEWEB)

Ljokkoi, R

1985-01-01

Control research on the production of milled peat has as its primary aim the ability to control the peat drying process under different weather and field conditions. Actual development work connected with production control was begun in 1982 with the clear aim of developing and applying in practice a monitoring adn control system complete with measuring equipment which would permit the drying process to be measured indirectly and weather forecasts to be used systematically in the planning of production at each individual peat site. During the 1984 production season development work reached the stage of experimental use. Experiences gained from trial use have been mainly positive and trial use of the manual system can be considered the first step in the application o the system. As regards the measuring technique, it is justified to say that an adequate technical level has already been attained and the correlation of the indirect measuring method with peat drying can be further improved by adjusting the location height of the evaporation meter. On the other hand, calculation of the length of the harvesting cycle requires further research, which from the point of view of practice must be orientated towards control of field conditions and changes in them during the production season. Although the application of the production control system is informative in nature, it is clearly of assistance when deciding how to carry out production. By means of this system iy id possible to achieve financial benefit in the form of lowered production costs and a larger harvest per hectare.

Developing a Business Model for Lappeenrannan Teatterikiinteistö Oy

OpenAIRE

Korhonen, Kati

2015-01-01

This thesis develops a business model for a real estate company and a subsidiary of the City of Lappeenranta. The case company is relatively new and has not yet started its business operations. Lappeenranta city theatre will be situated in this real estate and the theatre location is unique in Finland and worldwide. The research problem was defined in the following way: What are the available business model options for a real estate company starting its business. Which of the available option...

Standardization and estimation of gross alpha and beta activities for potable water samples in presence of TDS using TDCR based LSA (Hidex 300SL)

International Nuclear Information System (INIS)

Gupta, Anil; Lenka, P.; Sahoo, S.K.; Patra, A.C.; Jha, S.K.; Tripathi, R.M.

2018-01-01

Quality of water is important in environmental studies because of its daily use for human consumption and an important route of intake for various elements and radionuclides. Therefore radiological quality of drinking water must be ensured. The screening parameter to evaluate the radiological safety of potable water is by estimating gross alpha and gross beta activities with a limit of 0.5 Bq/l and 1 Bq/l respectively. These have been traditionally being done by radiochemical co-precipitation of alpha and beta emitters followed by counting by ZnS(Ag) counter for alpha and gas flow proportional counter for beta. Gross alpha estimation in water samples with high TDS by ZnS(Ag) is difficult and often leads to underestimation of result due to self-absorption of alpha within the residue. This study was carried out to standardize a method to provide rapid results by simultaneously estimating both gross alpha and gross beta activity in the presence of TDS with adequate sensitivity, minimum sample processing

Estimating potentials of solid wood-based fuels in Finland in 2020

Energy Technology Data Exchange (ETDEWEB)

Kaerhae, Kalle; Raesaenen, Tapio; Pajuoja, Heikki (Metsaeteho Oy, Helsinki (Finland)), e-mail: kalle.karha@metsateho.fi; Elo, Juha; Lahtinen, Perttu (Poeyry Energy Oy, Espoo (Finland))

2010-07-15

In the context of the Long-term Climate and Energy Strategy, it is estimated that the primary use of woodbased fuels in Finland will be 93 to 97 TWh by the year 2020. The overall target set for forest chips is 12 million m3, i.e. around 24 TWh. The objective of the research carried out by Metsaeteho Oy and Poeyry Energy Oy was to produce as realistic as possible a total analysis of the possibilities of increasing the usage of wood-based fuels in Finland by 2020. The research showed that the growth objective set in the Long-term Climate and Energy Strategy can be attained through the supply and demand of wood-based fuels. However, realizing this potential would require major investments in the entire forest chip production system, because the competitiveness of wood-based fuels in energy generation is currently not at a sufficient level. Considering the huge resources required by the forest chip production system and the current low competitiveness of forest chips, it is estimated that the use of forest chips in Finland will reach the level of 20 TWh at the earliest by the year 2020

Core drilling of short drillholes at Olkiluoto in Eurajoki 2006

International Nuclear Information System (INIS)

Rautio, T.

2007-05-01

Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled six short drillholes with a diameter of 75.7 mm at Olkiluoto in July - August 2006. The identification numbers of the drillholes are OL-PP51 - OL-PP56. The deviation of the drillholes was measured with the deviation measuring instruments Reflex EMS. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. The volume of the drilling water was recorded. Sodium fluorescein was used as a label agent in the drilling water. The total volume of the used drilling and flushing water were 37 m 3 . (orig.)

Fuel cycle management in Finland

International Nuclear Information System (INIS)

Vaeyrynen, H.; Mikkola, I.

1987-01-01

Both Finnish utilities producing nuclear power - Imatran Voima Oy (IVO) and Teollisuuden Voima Oy (Industrial Power Co. Ltd, TVO) - have created efficient fuel cycle management systems. The systems however differ in almost all respects. The reason is that the principal supplier for IVO is the Soviet Union and for TVO is Sweden. A common feature of both systems at the front end of the cycle is the building of stockpiles in order to provide for interruptions in fuel deliveries. Quality assurance supervision at the fuel factory for IVO is regulated by the Soviet Chamber of Commerce and Industry and a final control is made in Finland. The in-core fuel management is done by IVO using codes developed in Finland. The whole IVO fuel cycle is basically a leasing arrangement. The spent fuel is returned to the USSR after five years cooling. TVO carries out the in-core fuel management using a computer code system supplied by Asea-Atom. TVO is responsable for the back end of the cycle and makes preparations for the final disposal of the spent fuel in Finland. 6 refs., 2 figs

Production methods and costs of oxygen free copper canisters for nuclear waste disposal

International Nuclear Information System (INIS)

Aalto, H.; Rajainmaeki, H.; Laakso, L.

1996-10-01

The fabrication technology and costs of various manufacturing alternatives to make large copper canisters for disposal of spent nuclear fuel from reactors of Teollisuuden Voima Oy (TVO) and Imatran Voima Oy (IVO) are discussed. The canister design is based on the Posiva's concept where solid insert structure is surrounded by the copper mantle. During recent years Outokumpu Copper Products and Posiva have continued their work on development of the copper canisters. Outokumpu Copper Products has also increased capability to manufacture these canisters. In the study the most potential manufacturing methods and their costs are discussed. The cost estimates are based on the assumption that Outokumpu will supply complete copper mantles. At the moment there are at least two commercially available production methods for copper cylinder manufacturing. These routes are based on either hot extrusion of the copper tube or hot rolling, bending and EB-welding of the tube. Trial fabrications has been carried out with both methods for the full size canisters. These trials of the canisters has shown that both the forming from rolled plate and the extrusion are possible methods for fabricating copper canisters on a full scale. (orig.) (26 refs.)

Electricity statistics for Finland 1997; Saehkoetilasto 1997

Energy Technology Data Exchange (ETDEWEB)

Kangas, H; Savolainen, T [Adato Energia Oy, Helsinki (Finland)

1998-12-01

Until 1995 the electrical statistics information has according to the law about electric utilities and facilities been collected and handled by the Electrical Inspectorate. In 1996 the work was done by the Finnish Electricity Association and it was commissioned by the Ministry of Trade and Industry. Since 1996 the collection and handling of the information is based on the Electricity Market Act. The information is mainly submitted by the producers and distributors of electricity and processed since 1997 in Adato Energia Oy owned jointly by Finnish Energy Industries Federation, Finnish District Heating Association and Finnish Electricity Association. This action is based on a mutual contract of the Statistics Finland, Adato Energia Oy, Finnish Energy Industries Federation and Finnish Electricity Association. The Electricity Statistics for Finland 1997 contains several summaries about the consumption and the production. There is also summaries about the networks, the effects of electricity, the capacities of electricity, the fuels used in production and the dwellings heated by electric power. Like before a list of names, addresses, persons and telephone numbers is available. Additionally a list comprising the power consumption in all Finnish communes and a glossary in three languages (Finnish, Swedish and English) are included

Martin Pärn Kunstihoone salongis

Index Scriptorium Estoniae

1999-01-01

15. 03 Martin Pärna mööbligrupi "Martin" presentatsioon. 1998. a. pälvis M. Pärn Euroopa disainipreemia Best in the Best Rote Punkt, mida jagab Design Zentrum Nordrhein Westfalen. 1999. a. parim on M. Pärna Martela OY-le projekteeritud klapplaud. Aasta Design Team - Philipsi disaini meeskond. Äramärgitud tooted on näitusel Nordrhein Westfaleni Design Zentrumis

Chaplain Roles in Humanitarian and Civic Assistance Operations

Science.gov (United States)

1994-04-08

help one another is a cornerstone of the philanthropy that ha accompanied all religions and cultures since time began. INTERNATIONAL. Though no super...to cooperate internationally than to score cheap ideological victories. Pojlitic Considerations. Most elites in Third World countries are indifferent...of hostility-, b. The chasm separating tne elite trom the miserable masses is widened and deepqnpd oy ethnicl racial at religious cleavages. c

The geology of the Olkiluoto area

International Nuclear Information System (INIS)

Anttila, P.; Paulamaeki, S.; Lindberg, A.; Paananen, M.; Koistinen, T.; Front, K.; Pitkaenen, P.

1992-12-01

Teollisuuden Voima Oy (TVO) is preparing for the final disposal of spent nuclear fuel from the Olkiluoto nuclear power plant deep in the Finnish bedrock. An area close to the power plant at Olkiluoto, Eurajoki, was one of the five areas selected in 1987 for the preliminary site investigations. A summary of the geological conditions at the Olkiluoto site is presented in the report

Urbanisti unistuste kodu linna tuiksoonel / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2007-01-01

Arhitektuurivõistlusel osalenud arhitektide Mutanen-Salminen-Vaarna OY ja KPME OÜ korterelamu Osten Tor Pärnu mnt. 110, Aare Saksa ja Tomas Björklundi (SWECO FFNS) Admirali Maja Ahtri 6A ja Madis Eegi (AB Eek&Mutso) korterelamu City Residence Liivalaia 21. Põhiplaanid, välisvaated. Kommenteerivad kinnisvaraärimees Üllar Hinno, arhitektid Anne Valing ja Carolina Hunt. Lisaks Aivo Vahemetsa kommentaarid igale majale

ACD-Tool Mobile : Diagnostiikkasovelluksen siirtäminen mobiiliympäristöön

OpenAIRE

Kokkonen, Lauri

2015-01-01

Tämän työn tavoitteena oli suunnitella ja toteuttaa Andritz Oy:lle jo olemassa olevan, tietokoneella ajettavan ACD-Tool-työpöytäsovelluksen pohjalta mobiililaitteella, kuten tablettitietokoneella tai matkapuhelimella ajettava sovellus. ACD-Tool on diagnostiikkasovellus, jonka avulla voidaan tehdä laitoksen mittausautomaation tuottaman prosessidatan perusteella muun muassa trendejä, laskentaa ja erilaisia analyysejä. Sovelluksen erilaisista toteutustavoista tehtiin toimeksiantajan toiveest...

Development of an Acetate- or Sugar-fed Microbial Power Generator for Military Bases

Science.gov (United States)

2012-07-01

the U.S. military, which consumes 395,000 barrels of oil every day (Warner and Singer, 2009). Transport of fossil fuels to remote places in hostile... sOy ^ % (19%) ****** SP.(6%\\ ’ Soehngenia saccharolytica Geobocter sp. (14%) 11%) ^^ ^ Citrobacter 0</ £ -. sp...performance liquid chromatography (HPLC) equipped with BIORAD Aminex HPX-87H column for sugars and volatile acids analysis. Sucrose analysis employed water

Two boilers from Kvaerner to Sumatra, Indonesia; Sumatralle kaksi kattilaa Kvaernerilta

Energy Technology Data Exchange (ETDEWEB)

Salja, A. [Kvaerner Pulping Oy, Tampere (Finland)

1997-12-31

Kvaerner Pulping Oy has won a contract to supply soda and power boilers to the new Musi Pulp plant under construction in southern Sumatra in Indonesia. The boiler will be built in Tampere. The plant is scheduled for completion in December 1999 and it will produce 450 000 t/a. The contract is an important step forward for Kvaerner Pulping in promoting its fluidized bed technology

Säärisuojien suojaavuus ja käytettävyys jalkapallossa

OpenAIRE

Laaksonen, Kimmo

2015-01-01

Tutkimuksessa selvitettiin Zero Point Finland Oy:n valmistamien säärisuojaprototyyppien toimivuutta jalkapallossa. Säärisuojien toimivuus voidaan jakaa vammoilta suojaamiseen sekä käyttömukavuuteen. Tutkittavia prototyyppejä oli kolme, jotka erosivat toisistaan suojan sisäpehmusteen materiaalin osalta. Prototyyppien suojaavuutta tutkittiin iskutestien avulla, joissa tuloksia verrattiin jo markkinoilla oleviin Niken Mercurial Blade sekä Mercurial Flylite -suojiin. Laboratoriotutkimusta varten ...

Economic Evaluation and Assessment. Physical Evaluation and Assessment, South Cheyenne Area, Cheyenne, Wyoming

Science.gov (United States)

1985-10-01

0.2 ’ /AK/VKKrK CHET SCHY CASP RYAN LAND LARL RAILROCK GiRT DENY FT.C GUE~ SWOT SWC CITIES OR ARRAS [~~WATER COSTS =X SEMR COSTS CHEY =Cheyenne ROCK...those on vast Fox Farm Road, Reiner Court and Avenue B-6. Phase ITl calls fo.-. a -ater main along Apple Street in the Oy-chard Valley area and to loop