WorldWideScience

Sample records for hidex oy biotox

  1. Yritysmarkkinointisuunnitelma : -Case Kakadu Oy

    OpenAIRE

    Lamberg, Leena

    2009-01-01

    Opinnäytetyön aihe on yritysmarkkinointisuunnitelman kehittäminen tilasuunnitteluyritys Kakadu Oy:lle. Työn tavoitteena on segmentoida Kakadu Oy:n asiakaskunta ja määrittää tärkein asiakassegmentti sekä tehdä valitulle, potentiaalisimmalle asiakassegmentille kohdistettu markkinointisuunnitelma. Markkinointisuunnitelman tarkoitus on auttaa Kakadu Oy:tä suuntaamaan erittäin rajalliset resurssit mahdollisimman perustellusti ja tuottavasti. Yrityksessä ei ole aikaisemmin toteutettu markkinoin...

  2. AquaBuOY

    DEFF Research Database (Denmark)

    Weinstein, Alla; Fredrikson, Göran; Claeson, Lennart

    2003-01-01

    BuOY in five representative generic sea states. Ocean energy and offshore wave energy conversion in the United States is at a significant milestone. During the next year, ocean energy technology developers and energy officials have the potential to deploy pilot scale ocean power plants and transition......This paper describes development of the mathematical model simulating ocean performance of an offshore wave energy point absorber device-AquaBuOY. The AquaBuOY is the next generation of the technology, based on the IPS point absorber system and the hose pump, both of Sweden. AquaEnergy Group Ltd......, engineers, and developers can continue to lay the groundwork for government spending and interest in ocean energies....

  3. Customer database for Watrec Oy

    OpenAIRE

    Melnichikhina, Ekaterina

    2016-01-01

    This thesis is a development project for Watrec Oy. Watrec Oy is a Finnish company specializes in “waste-to-energy” issues. Customer Relation Management (CRM) strategies are now being applied within the company. The customer database is the first and trial step towards CRM strategy in Watrec Oy. The reasons for database project lie in lacking of clear customers’ data. The main objectives are: - To integrate the customers’ and project data; - To improve the level of sales and mar...

  4. Markkinointisuunnitelma, URHOtv Oy

    OpenAIRE

    Pesonen, Matti

    2012-01-01

    Opinnäytetyön tarkoituksena on paneutua suomalaiseen maksu-tv markkinaan ja kilpailutilanteeseen jonka jälkeen laatia yritykselle vuoden 2012 markkinointisuunnitelma. URHOtv Oy on suurin kotimaiseen urheiluun keskittyä maksu-tv kanava. URHOtv:llä on noin 300 000 asiakasta. Opinnäytetyön pohjana on käytetty Jobberin markkinointisuunnitelman tekoprosessin teoriaa hiukan mukailtuna URHOtv:n tarpeisiin. Markkinointisuunnitelman tueksi opinnäytetyössä tutkitaan URHOtv:n tilaa analyysie...

  5. The biotoxicity of hydroxyapatite nanoparticles to the plant growth

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Hao [Key Laboratory for Advanced Materials, East China University of Science and Technology, Shanghai 200237 (China); Liu, Jin-Ku, E-mail: jkliu@ecust.edu.cn [Key Laboratory for Advanced Materials, East China University of Science and Technology, Shanghai 200237 (China); Wang, Jian-Dong; Lu, Yi; Zhang, Min [Key Laboratory for Advanced Materials, East China University of Science and Technology, Shanghai 200237 (China); Yang, Xiao-Hong, E-mail: yxh6110@yeah.net [Department of Chemistry, Chizhou University, Chizhou 247000 (China); Hong, Dan-Jing [Key Laboratory for Advanced Materials, East China University of Science and Technology, Shanghai 200237 (China)

    2014-04-01

    Highlights: • Mung bean sprouts were first used as the experimental model to research the cytotoxicity of the HAP nanomaterials. • The biotoxicity depends on the concentration and particle size of HAP nanomaterials. • The biotoxicity mechanism of HAP nanomaterials was discussed. - Abstract: In the present study, hydroxyapatite (HAP) nanoparticles of different particle sizes with high crystallinity and similiar structure were prepared by hydrothermal method. The crystal structure and particle size were characterized by X-ray diffraction pattern (XRD), transmission electron microscopy (TEM) and Fourier transform infrared (FT-IR) spectroscopy. Mung bean sprouts were first used as experimental models. Instead of by MTT assay, the cytoxicity of HAP nanoparticles were proved and evaluated by measuring the hypocotyle length of mung bean sprouts in the culture media. The result showed that the inhibition effect to the growth of mung bean sprouts enhanced when HAP nanoparticles existed. Culture media of HAP nanoparticles with different concentrations and particle sizes was prepared to investigate the level of inhibition effect to the growth of mung bean sprouts. The result found that hypocotyl length of mung bean sprouts were the shortest cultured in 5 mg/mL culture media in which the HAP nanoparticles were prepared by hydrothermal method for 24 h. It was concluded the inhibition effect depended on the amount of intracellular HAP nanoparticles. The nanostructure and Ca{sup 2+} concentration were considered as the main factors to cause cell apoptosis which was the reason of inhibition. The study provided a preliminary perspective about biotoxicity of HAP nanomaterials to the plant growth.

  6. The biotoxicity of hydroxyapatite nanoparticles to the plant growth

    International Nuclear Information System (INIS)

    Jiang, Hao; Liu, Jin-Ku; Wang, Jian-Dong; Lu, Yi; Zhang, Min; Yang, Xiao-Hong; Hong, Dan-Jing

    2014-01-01

    Highlights: • Mung bean sprouts were first used as the experimental model to research the cytotoxicity of the HAP nanomaterials. • The biotoxicity depends on the concentration and particle size of HAP nanomaterials. • The biotoxicity mechanism of HAP nanomaterials was discussed. - Abstract: In the present study, hydroxyapatite (HAP) nanoparticles of different particle sizes with high crystallinity and similiar structure were prepared by hydrothermal method. The crystal structure and particle size were characterized by X-ray diffraction pattern (XRD), transmission electron microscopy (TEM) and Fourier transform infrared (FT-IR) spectroscopy. Mung bean sprouts were first used as experimental models. Instead of by MTT assay, the cytoxicity of HAP nanoparticles were proved and evaluated by measuring the hypocotyle length of mung bean sprouts in the culture media. The result showed that the inhibition effect to the growth of mung bean sprouts enhanced when HAP nanoparticles existed. Culture media of HAP nanoparticles with different concentrations and particle sizes was prepared to investigate the level of inhibition effect to the growth of mung bean sprouts. The result found that hypocotyl length of mung bean sprouts were the shortest cultured in 5 mg/mL culture media in which the HAP nanoparticles were prepared by hydrothermal method for 24 h. It was concluded the inhibition effect depended on the amount of intracellular HAP nanoparticles. The nanostructure and Ca 2+ concentration were considered as the main factors to cause cell apoptosis which was the reason of inhibition. The study provided a preliminary perspective about biotoxicity of HAP nanomaterials to the plant growth

  7. Markkinointiviestintäsuunnitelma : Classic Coffee Oy

    OpenAIRE

    Eerola, Laura

    2015-01-01

    Opinnäytetyön aiheena oli laatia markkinointiviestintäsuunnitelma kalenterivuodelle 2016 vuosikellon muodossa, toimintansa jo vakiinnuttaneelle Classic Coffee Oy:lle. Classic Coffee Oy on vuonna 2011 perustettu, Tampereella toimiva kahvila-alan yritys joka tarjoaa lounaskahvilatoiminnan lisäksi laadukkaita konditoria-palveluita, yritys- ja kokoustarjoiluja sekä tilavuokrausta. Classic Coffee Oy:llä on yksi kahvila, Classic Coffee Tampella. Kahvila sijaitsee Tampellassa, Tampereen keskustan vä...

  8. Decreasing biotoxicity of fume particles produced in welding process.

    Science.gov (United States)

    Yu, Kuei-Min; Topham, Nathan; Wang, Jun; Kalivoda, Mark; Tseng, Yiider; Wu, Chang-Yu; Lee, Wen-Jhy; Cho, Kuk

    2011-01-30

    Welding fumes contain heavy metals, such as chromium, manganese, and nickel, which cause respiratory diseases and cancer. In this study, a SiO(2) precursor was evaluated as an additive to the shielding gas in an arc welding process to reduce the biotoxicity caused by welding fume particles. Transmission electron micrographic images show that SiO(2) coats on the surface of welding fume particles and promotes particle agglomeration. Energy dispersive X-ray spectroscopy further shows that the relative amount of silicon in these SiO(2)-coated agglomerates is higher than in baseline agglomerates. In addition, Escherichia coli (E. coli) exposed to different concentrations of pure SiO(2) particles generated from the arc welding process exhibits similar responses, suggesting that SiO(2) does not contribute to welding fume particle toxicity. The trend of E. coli growth in different concentrations of baseline welding fume particle shows the most significant inhibition occurs in higher exposure concentrations. The 50% lethal logarithmic concentrations for E. coli in arc welding particles of baseline, 2%, and 4.2% SiO(2) precursor additives were 823, 1605, and 1800 mg/L, respectively. Taken together, these results suggest that using SiO(2) precursors as an additive to arc welding shielding gas can effectively reduce the biotoxicity of welding fume. Copyright © 2010 Elsevier B.V. All rights reserved.

  9. Pienpanimon tuotekehitys : Mathildedalin Panimo Oy

    OpenAIRE

    Lilja, Henri

    2014-01-01

    Tässä opinnäytetyössä selvitettiin, minkälaisia asioita Mathildedalin Panimo Oy:n tulee tuotekehityksessään ottaa huomioon. Opinnäytetyön kirjallisuusosa käsittelee oluen määritelmää ja historiaa, valmistusprosessia pienpanimossa, sekä lainsäädäntöä ja myyntikanavia. Työn teoreettisena pohjana on käytetty Business Model Canvas -nimistä liiketoiminnan suunnittelutyökalua, joka toimii tuotekehityksen tukena. Verotus, tiukka lainsäädäntö ja kiristyvä kilpailu ovat pienpanimon toiminnan suuri...

  10. Ilmanpuhdistimen tuotekehitys : case: Mecastep Oy

    OpenAIRE

    Arasola, Aku

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli olla osana tuotekehitysprojektia, joka koskee Mecastep Oy:n ilmanpuhdistin innovaatiota. Kehitystä vaativia kohtia olivat komponenttien valinta ja mekaniikan saaminen toimivaksi. Edelläkävijän innovaatiosta tekee se, että samanlaista tuotetta ei ole vielä olemassa. Mekaniikan mallintaminen tapahtui 3D-ohjelmalla nimeltä KeyCreator. Ilmanpuhdistin tullaan sijoittamaan keittiön jätekaappiin. Puhdistuksella tässä tapauksessa tarkoitetaan epäpuhtaan ilman...

  11. --- Oy:n tavoitteellinen markkinointi Facebookissa

    OpenAIRE

    Järventaus, Aino

    2012-01-01

    Tämä opinnäytetyö on laadittu toimeksiantona ohjelmatoimisto ---- Oy:lle. Toimeksiantosopimus syntyi opinnäytetyön tekijän ehdotuksesta kehittää --- Oy:n digitaalista markkinointia yrityksen toivomasta näkökulmasta. Työn fokukseksi valittiin Facebook koska sillä on merkittävä osa musiikkiteollisuuden markkinoinnissa. Toimeksiantajan Facebook-markkinoinnin hyödyntäminen ja ylläpito oli jäänyt liian vähälle huomiolle. Näin ollen kehittämiskohteeksi valittiin --- Oy:n Facebook-markkinointi ...

  12. The biotoxicity of hydroxyapatite nanoparticles to the plant growth.

    Science.gov (United States)

    Jiang, Hao; Liu, Jin-Ku; Wang, Jian-Dong; Lu, Yi; Zhang, Min; Yang, Xiao-Hong; Hong, Dan-Jing

    2014-04-15

    In the present study, hydroxyapatite (HAP) nanoparticles of different particle sizes with high crystallinity and similiar structure were prepared by hydrothermal method. The crystal structure and particle size were characterized by X-ray diffraction pattern (XRD), transmission electron microscopy (TEM) and Fourier transform infrared (FT-IR) spectroscopy. Mung bean sprouts were first used as experimental models. Instead of by MTT assay, the cytoxicity of HAP nanoparticles were proved and evaluated by measuring the hypocotyle length of mung bean sprouts in the culture media. The result showed that the inhibition effect to the growth of mung bean sprouts enhanced when HAP nanoparticles existed. Culture media of HAP nanoparticles with different concentrations and particle sizes was prepared to investigate the level of inhibition effect to the growth of mung bean sprouts. The result found that hypocotyl length of mung bean sprouts were the shortest cultured in 5mg/mL culture media in which the HAP nanoparticles were prepared by hydrothermal method for 24h. It was concluded the inhibition effect depended on the amount of intracellular HAP nanoparticles. The nanostructure and Ca(2+) concentration were considered as the main factors to cause cell apoptosis which was the reason of inhibition. The study provided a preliminary perspective about biotoxicity of HAP nanomaterials to the plant growth. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. The benzoquinone-mediated electrochemical microbial biosensor for water biotoxicity assay

    International Nuclear Information System (INIS)

    Li, Jiuming; Yu, Yuan; Wang, Yuning; Qian, Jun; Zhi, Jinfang

    2013-01-01

    Graphical abstract: The mediator can participate in microorganism respiration, accept the electrons from respiratory chains, and therefore be reduced by microorganism. The re-oxidization currents of mediators on electrode can reflect the microbial activity, and when respiration is suppressed by toxicants, it can be detected by the resulting change of currents. Unlike other biotoxicity tests, which record the toxic effect after a fixed time for incubation of biocomponents and toxicants, this mediated whole cell biosensor can provide a real-time monitor of the microbial activity during the measurement. -- Abstract: A simple mediated microbial biosensor providing real-time monitoring of water quality and evaluation of biotoxicity was fabricated by entrapping Escherichia coli (E. coli) cells in gelatin on glassy carbon electrode with benzoquinone as the redox mediator. The biotoxicity assay was based on the respiratory activity of E. coli cells estimated by the oxidation current of microbially reduced benzoquinone. The neutrality and lipophilicity rendered benzoquinone better efficiency than ferricyanide in mediated microbial reactions. After the optimization of preparation conditions, the prepared microbial biosensors have measured several common toxicants with different concentrations. In addition, the biotoxicity of binary mixtures of heavy metals and wastewater were investigated. The fabricated biosensor exhibited good repeatability and stability in the biotoxicity measurements

  14. COSMOS-rice technology abrogates the biotoxic effects of municipal solid waste incinerator residues.

    Science.gov (United States)

    Guarienti, Michela; Cardozo, Sdenka Moscoso; Borgese, Laura; Lira, Gloria Rodrigo; Depero, Laura E; Bontempi, Elza; Presta, Marco

    2016-07-01

    Fly ashes generated by municipal solid waste incinerator (MSWI) are classified as hazardous waste and usually landfilled. For the sustainable reuse of these materials is necessary to reduce the resulting impact on human health and environment. The COSMOS-rice technology has been recently proposed for the treatment of fly ashes mixed with rice husk ash, to obtain a low-cost composite material with significant performances. Here, aquatic biotoxicity assays, including daphnidae and zebrafish embryo-based tests, were used to assess the biosafety efficacy of this technology. Exposure to lixiviated MSWI fly ash caused dose-dependent biotoxic effects on daphnidae and zebrafish embryos with alterations of embryonic development, teratogenous defects and apoptotic events. On the contrary, no biotoxic effects were observed in daphnidae and zebrafish embryos exposed to lixiviated COSMOS-rice material. Accordingly, whole-mount in situ hybridization analysis of the expression of various tissue-specific genes in zebrafish embryos provided genetic evidence about the ability of COSMOS-rice stabilization process to minimize the biotoxic effects of MSWI fly ash. These results demonstrate at the biological level that the newly developed COSMOS-rice technology is an efficient and cost-effective method to process MSWI fly ash, producing a biologically safe and reusable material. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Afrikkaviikko Antell Catering Oy:ssä

    OpenAIRE

    Bask, Tiina

    2011-01-01

    Ruokapalvelualalla erilaisten teemaviikkojen toteuttaminen on keino tarjota asiakkaille ainutkertaisia elämyksiä ja tuoda vaihtelua normaaliin arkiruokailuun. Tämän opinnäytetyön tavoitteena oli suunnitella Afrikka-aiheinen teemaviikko Antell Catering Oy:n lounasravintoloihin. Afrikka-teeman mukaisesti suunniteltiin vakioruokaohjeet yhden viikon lounasvaihtoehdoiksi sekä markkinointimateriaali somistuksineen. Opinnäytetyö on toiminnallinen työ, jossa Afrikka-viikon lounasruokaohjeet mu...

  16. Viestintäsuunnitelma : Lippupalvelu Oy

    OpenAIRE

    Olin, Noora

    2015-01-01

    Tämän opinnäytetyön tavoitteena oli rakentaa viestintäsuunnitelma Lippupalvelu Oy:lle. Viestintäsuunnitelma alkaa ajallisesti siitä hetkestä, kun asiakas ostaa lipun verkkokaupasta, ja päättyy tapahtuman jälkimarkkinointiin. Tähän ajanjaksoon liittyvä uusi viestintäprosessi otettiin käyttöön vuoden 2015 aikana, mutta sitä haluttiin vielä kehittää eteenpäin. Tutkimuksessa selvitettiin tapahtumajärjestäjien mielipiteitä ja kehitysehdotuksia viestintäprosessista. Tavoitteena oli aikaansaada tark...

  17. Salon Patarouva Oy : kertomus lounasravintolan perustamisesta

    OpenAIRE

    Aronen, Miina

    2011-01-01

    Salon Patarouva Oy on Salossa Meriniityn teollisuusalueella toimiva lounasravintola. Yrityksen perustaminen ja toiminnan alkuunsaattaminen oli lähtökohta tämän toiminnallisen opinnäytetyön tekemiseen. Omat lähtökohdat yrittäjäksi ryhtymiseen olivat vahva ammattitaito ja kokemus suurkeittiöympäristöistä. Vuokrasimme toimitilat ja ostimme uudet laitteet. Yrityslainan saimme Finnverasta ja pankista. Lainopillisia ja muita neuvoja saimme Yrityssalosta. Salon Pararouvan liikeidea on palvella...

  18. Miesten muodin verkkokauppakonsepti : case: FRENN Company Oy

    OpenAIRE

    Hautaniemi, Tapio

    2015-01-01

    Tämä opinnäytetyö käsittelee miesten muodin verkkokaupan perustamista ja kehittämistä. Työ on tehty toimeksiantona vuoden 2013 syksyllä lanseeratulle suomalaisella miesten vaatemerkille Frenn Company Oy:lle. Opinnäytetyön aihe valikoitui toimeksiantajan toiveiden pohjalta sekä omasta mielenkiinnostani ja kokemuksestani aiheeseen. Työn tavoitteena on selvittää, millainen on kansainvälinen miesten muodin verkkokauppa ja miten alan muut toimijat ovat verkkokauppansa toteuttaneet. Opinnäytet...

  19. KOKEMUKSET ASIAKKUUKSIEN JOHTAMISESTA : Case: Buildercom Oy partneriasiakkaat

    OpenAIRE

    Porkka, Elina

    2013-01-01

    Tässä opinnäytetyössä tutkittiin, miten Buildercom Oy:n partneritason asiakkaat olivat kokeneet heihin kohdistetun asiakkuuden hoitomallin. Tavoitteena oli tutkia, miten asiakkaat oli tällä hetkellä jaettu erilaisiin ryhmiin, millaista lisäarvoa hoitomallilla on mahdollisesti kyetty asiakkaille tuottamaan, ja mitkä tekijät ovat vaikuttaneet asiakkaiden kokemusten laatuun. Tutkimus toteutettiin kokonaisuudessaan kevään 2012 ja kevään 2013 välisenä aikana. Tutkimus suoritettiin, koska toimeksia...

  20. Laadun parantaminen jalkinetuotannossa : case: Reima Oy

    OpenAIRE

    Huurre, Helena

    2014-01-01

    Tämä opinnäytetyö käsittelee laatua ja laadun kehittämisen työkaluja yrityksissä. Opinnäytetyön tarkoituksena oli tehdä kotimaiselle lastenvaatevalmistajalle, Reima Oy:lle, laatukäsikirja jalkinetuotantoa varten sekä laatukäsikirjaan sisältyvä laatuvaatimustaulukko, mistä jalkineiden laadulliset vaatimukset on löydettävissä. Laatukäsikirjan tavoitteena oli yhdistää Reiman jalkineen tuotekehitysprosessin kuvaus ja yleiset jalkinevaatimukset koko tuotantoprosessin ajalta yhtenäiseksi dokume...

  1. Hoivia Oy:n ruokapalvelujen asiakaskunnan laajentaminen

    OpenAIRE

    Sipilä, Satu

    2014-01-01

    Tämä opinnäytetyö syntyi Hoivia Oy:n tarpeesta markkinoida omia ruokapalveluitaan talon ulkopuolisille ja samalla kehittää lounasravintola Ludvigin palveluliiketoimintaa. Keskusteluissa toimitusjohtajan kanssa päätettiin selvityksen kohderyhmäksi ottaa kokonaisia palveluyksiköitä eikä yksittäisiä henkilöitä. Markkinatutkimukseen haluttiin mukaan kehitysvammaisten asuntoloita, päivätoimintayksiköitä, yksityisiä vanhainkoteja ja palvelutaloja sekä päiväkoteja. Ludvigissa on resursseja valmistaa...

  2. Tuotannon layoutin suunnittelu Flinkenberg OY:lle

    OpenAIRE

    Puotiniemi, Olli

    2013-01-01

    Opinnäytetyön aiheena on layoutsuunnittelu Flinkenberg Oy:lle. Yrityksen on tarkoitus tulevaisuudessa hankkia uusi työstökone nykyisiin toimitiloihin. Siitä seurasi tarve saada uusi layoutsuunnitelma tuotantohallista vanhan tilalle. Myös vanha layout kaipasi päivitystä. Opinnäytetyössä on pyritty soveltamaan jo olemassa olevaa teoriaa ja käytäntöä layoutsuunnittelussa. Teoriaa oli tarjolla paljon, ja olikin tärkeää osata perehtyä vain olennaiseen. Siihen tässäkin tutkimuksessa on pyritty....

  3. M Road Oy: Arvo-ja laatudokumentti

    OpenAIRE

    Röynä, Mira

    2017-01-01

    Opinnäytetyön aiheena on yrityksen arvot ja laatutekijät. Opinnäytetyön tutkimuksellinen näkökulma syntyy konstruktiivisesta tutkimuksesta sekä kyselystä ja tiimityöskentelystä. Työssä tutustutaan tarkasti arvojen ja laatutekijöiden teoriaan, joiden pohjalta analysoidaan työntekijäkyselyn ja tiimityöskentelyn tuloksia. Työn tavoitteena on saada yhdistettyä franchaising-yritys M Road Oy:n arvot koko M Room –ketjun arvoja vastaavaksi, sekä parantaa yrityksen tuottamaa laatua. Toimeksiantaja...

  4. Social media marketing communication plan for Hauskafe Oy

    OpenAIRE

    Uzunova, Aleksandra; Franko, Jan

    2017-01-01

    The case company of this project-based thesis is Hauskafe Oy, an SME company located in Espoo, Finland. Following examples of best practices in the field, Hauskafe Oy recognised the need of designing a social media marketing plan that will allow to build the brand, improve customer loyalty and as a final goal – increase the sales. A social media marketing communication plan for Hauskafe Oy is the outcome of this thesis. The theoretical framework of the thesis is a desktop study that discu...

  5. Developing and design a website for mc kalla oy

    OpenAIRE

    Bekele, Henok

    2013-01-01

    This bachelor thesis is about Website development and design. I have a chance to work with Mc kalla Oy. Mc kalla Oy is a construction company from Kempele which was founded 2011. They have projects in Central-Finland, through Northern Finland to Lapland. This thesis is to develop and design a new website to Mc kalla Oy. Wordpress is used to develop the new website. For the development process I use school server (.opiskelijaprojektit.net). The Thesis contains two main parts designing the ...

  6. Biotoxicity assessment and toxicity mechanism on coal gasification wastewater (CGW): A comparative analysis of effluent from different treatment processes.

    Science.gov (United States)

    Ma, Weiwei; Han, Yuxing; Xu, Chunyan; Han, Hongjun; Zhu, Hao; Li, Kun; Zheng, Mengqi

    2018-05-04

    Even though coal gasification wastewater (CGW) treated by various biochemical treatment processes generally met the national discharge standard, its potential biotoxicity was still unknown. Therefore, in this study, bioassay with Tetrahymena thermophila (T. thermophila) was conducted to comprehensively evaluate the variation of biotoxicity in raw CGW and the treated effluent from lab-scale micro-electrolysis integrated with biological reactor (MEBR), single iron-carbon micro-electrolysis (ICME) and conventional activated sludge (CAS) processes. The results illustrated that raw CGW presented intensive acute toxicity with 24 h EC 50 value of 8.401% and toxic unit (TU) value of 11.90. Moreover, it performed significant cell membrane destruction and DNA damage even at 10% dilution concentration. The toxicant identification results revealed that multiple toxic polar compounds such as phenolic, heterocyclic and polycyclic aromatic compounds were the main contributors for biotoxicity. Furthermore, these compounds could accelerate oxidative stress, thereby inducing oxidative damage of cell membrane and DNA. As for treated effluent, TU value was decreased by 90.58% in MEBR process. An effective biotoxicity reduction was achieved in MEBR process owing to high removal efficiency in polar organic toxicants. In contrast, effluent from ICME and CAS processes presented relatively high acute toxicity and genotoxicity, because various heterocyclic and polycyclic aromatic compounds were difficult to be degraded in these processes. Therefore, it was suggested that MEBR was a potential and feasible process for improving CGW treatment and minimizing ecological risk. Copyright © 2018. Published by Elsevier B.V.

  7. Biotoxicity and bioavailability of hydrophobic organic compounds solubilized in nonionic surfactant micelle phase and cloud point system.

    Science.gov (United States)

    Pan, Tao; Liu, Chunyan; Zeng, Xinying; Xin, Qiao; Xu, Meiying; Deng, Yangwu; Dong, Wei

    2017-06-01

    A recent work has shown that hydrophobic organic compounds solubilized in the micelle phase of some nonionic surfactants present substrate toxicity to microorganisms with increasing bioavailability. However, in cloud point systems, biotoxicity is prevented, because the compounds are solubilized into a coacervate phase, thereby leaving a fraction of compounds with cells in a dilute phase. This study extends the understanding of the relationship between substrate toxicity and bioavailability of hydrophobic organic compounds solubilized in nonionic surfactant micelle phase and cloud point system. Biotoxicity experiments were conducted with naphthalene and phenanthrene in the presence of mixed nonionic surfactants Brij30 and TMN-3, which formed a micelle phase or cloud point system at different concentrations. Saccharomyces cerevisiae, unable to degrade these compounds, was used for the biotoxicity experiments. Glucose in the cloud point system was consumed faster than in the nonionic surfactant micelle phase, indicating that the solubilized compounds had increased toxicity to cells in the nonionic surfactant micelle phase. The results were verified by subsequent biodegradation experiments. The compounds were degraded faster by PAH-degrading bacterium in the cloud point system than in the micelle phase. All these results showed that biotoxicity of the hydrophobic organic compounds increases with bioavailability in the surfactant micelle phase but remains at a low level in the cloud point system. These results provide a guideline for the application of cloud point systems as novel media for microbial transformation or biodegradation.

  8. Solidification and Biotoxicity Assessment of Thermally Treated Municipal Solid Waste Incineration (MSWI) Fly Ash.

    Science.gov (United States)

    Gong, Bing; Deng, Yi; Yang, Yuanyi; Tan, Swee Ngin; Liu, Qianni; Yang, Weizhong

    2017-06-10

    In the present work, thermal treatment was used to stabilize municipal solid waste incineration (MSWI) fly ash, which was considered hazardous waste. Toxicity characteristic leaching procedure (TCLP) results indicated that, after the thermal process, the leaching concentrations of Pb, Cu, and Zn decreased from 8.08 to 0.16 mg/L, 0.12 to 0.017 mg/L and 0.39 to 0.1 mg/L, respectively, which well met the limits in GB5085.3-2007 and GB16689-2008. Thermal treatment showed a negative effect on the leachability of Cr with concentrations increasing from 0.1 to 1.28 mg/L; nevertheless, it was still under the limitations. XRD analysis suggested that, after thermal treatments, CaO was newly generated. CaO was a main contribution to higher Cr leaching concentrations owing to the formation of Cr (VI)-compounds such as CaCrO₄. SEM/EDS tests revealed that particle adhesion, agglomeration, and grain growth happened during the thermal process and thus diminished the leachability of Pb, Cu, and Zn, but these processes had no significant influence on the leaching of Cr. A microbial assay demonstrated that all thermally treated samples yet possessed strong bactericidal activity according to optical density (OD) test results. Among all samples, the OD value of raw fly ash (RFA) was lowest followed by FA700-10, FA900-10, and FA1100-10 in an increasing order, which indicated that the sequence of the biotoxicity for these samples was RFA > FA700-10 > FA900-10 > FA1100-10. This preliminary study indicated that, apart from TCLP criteria, the biotoxicity assessment was indispensable for evaluating the effect of thermal treatment for MSWI fly ash.

  9. HPK Liiga Oy:n Facebook-markkinoinnin mittaaminen

    OpenAIRE

    Anttila, Pasi

    2016-01-01

    Opinnäytetyön toimeksiantaja on HPK Liiga Oy. Työn taustalla toimeksiantajan osalta oli lähteä kehittämään sosiaalisen median mittaamista, ja opinnäytetyön tekijä oli myös kiinnostunut tämän asian tutkimisesta. Taustalla olivat myös HPK Liiga Oy:n strategiset muutokset sekä yhtiöittäminen rekisteröidystä yhdistyksestä osakeyhtiöksi. Työn tavoitteena oli selvittää, millä mittareilla HPK Liiga Oy:n kannattaisi mitata Facebook-markkinointiaan ydintavoitteiden ollessa asiakkaiden sitouttamin...

  10. PUHELINPALVELUN FACEBOOK-MAINOS : Case: Harmonia Care Oy

    OpenAIRE

    Tirkkonen, Mari

    2014-01-01

    Opinnäytetyön toimeksiantaja oli Harmonia Care Oy. Tutkimuksessa käytettiin kvantitatiivista tutkimusmenetelmää. Opinnäytetyö oli luonteeltaan toiminnallinen opinnäytetyö, jossa samalla suunniteltiin, toteutettiin ja kehitettiin yrityksen sähköistä markkinointia. Tutkimuksessa haettiin vastausta seuraaviin kysymyksiin: ” Onko Facebook-mainonnasta hyötyä Harmonia Care Oy:lle?” ja ”Millainen markkinointikampanja tukee yrityksen strategiaa parhaiten?” Opinnäytetyössä suunniteltiin ja toteute...

  11. Tilinpäätösanalyysi : case Ilmatuote Oy

    OpenAIRE

    Luotola, Elina

    2014-01-01

    Opinnäytetyön tavoitteena oli saada selville Ilmatuote Oy:n taloudellinen tilanne tarkastellen tilinpäätösinformaatiota vuosien 2009-2012 väliseltä ajanjaksolta. Ilmatuote Oy:n erikoisalana on jo yli 40 vuoden ajan ollut talotekniikkajärjestelmien asennus, urakointi- ja huoltotoiminta. Tarkoituksena oli tehdä tilinpäätösanalyysi yhtiön tilinpäätöksistä ja selvittää, millä tasolla yritys taloudellisesti on ja mihin suuntaan yrityksen taloudellinen tila on kehittynyt. Teoreettisessa osassa t...

  12. Adidas Suomi Oy: Brändikuvan rakentaminen markkinoinnin keinoin

    OpenAIRE

    Leinonen, Miira

    2015-01-01

    Tämä opinnäytetyö tehtiin toimeksiantona Adidas Suomi Oy:lle syksyllä 2014. Opinnäytetyön tavoitteena oli selvittää muotialan mielipidevaikuttajien mielikuvat Adidaksesta ja sen merkittävimmistä kilpailijoista. Vertailtaviksi brändeiksi valittiin kuusi tärkeintä kilpailijaa, jotka ovat Converse, Karhu, New Balance, Nike, Puma ja Reebok. Opinnäytetyön toimeksiantaja Adidas Suomi Oy on osa kansainvälistä Adidas Group konsernia. Yritys on yksi maailman tunnetuimmista urheilumerkeistä ja toim...

  13. Inhalable desert dust, urban emissions, and potentially biotoxic metals in urban Saharan-Sahelian air

    Science.gov (United States)

    Garrison, Virginia H.; Majewski, Michael S.; Konde, Lassana; Wolf, Ruth E.; Otto, Richard D.; Tsuneoka, Yutaka

    2014-01-01

    Saharan dust incursions and particulates emitted from human activities degrade air quality throughout West Africa, especially in the rapidly expanding urban centers in the region. Particulate matter (PM) that can be inhaled is strongly associated with increased incidence of and mortality from cardiovascular and respiratory diseases and cancer. Air samples collected in the capital of a Saharan–Sahelian country (Bamako, Mali) between September 2012 and July 2013 were found to contain inhalable PM concentrations that exceeded World Health Organization (WHO) and US Environmental Protection Agency (USEPA) PM2.5 and PM10 24-h limits 58 – 98% of days and European Union (EU) PM10 24-h limit 98% of days. Mean concentrations were 1.2-to-4.5 fold greater than existing limits. Inhalable PM was enriched in transition metals, known to produce reactive oxygen species and initiate the inflammatory response, and other potentially bioactive and biotoxic metals/metalloids. Eroded mineral dust composed the bulk of inhalable PM, whereas most enriched metals/metalloids were likely emitted from oil combustion, biomass burning, refuse incineration, vehicle traffic, and mining activities. Human exposure to inhalable PM and associated metals/metalloids over 24-h was estimated. The findings indicate that inhalable PM in the Sahara–Sahel region may present a threat to human health, especially in urban areas with greater inhalable PM and transition metal exposure.

  14. Social Media Marketing : CASE: OY SUOMEN LYYRA AB

    OpenAIRE

    Eriksson, Irene

    2012-01-01

    This bachelor thesis was commissioned by Oy Suomen Lyyra Ab, the largest student online media and student card producer for higher education students in Finland. The the-sis objective was to understanding the current social media situation and activity among the students of higher education in Finland, the social media networks that the case company currently uses as well as understanding how to use these networks for successful marketing activities. The quantitative research was conducted in...

  15. Managing Customer Relationships in the Social Media : Case: Diamo oy

    OpenAIRE

    Laakso, Heidi

    2013-01-01

    The purpose of this study was to increase the amount of new likes of Diamo Oy in the social media network site Facebook, eventually aiming for the creation of new customer relationships, increased visibility of the company and into strictly increasing purchasing of their products. The theoretical part of the study consists of the role of content production in the social media field and customer relationship management, of which particularly customer acquisition and retention are discussed mor...

  16. Selvitys kulttuuriyrityksen laajentumis- mahdollisuuksista. Saiffa Oy:n tapaus

    OpenAIRE

    Sirviö, Jussi

    2013-01-01

    Opinnäytetyö selvittää kulttuuriyrityksen laajentumismahdollisuuksia. Teoreettinen viitekehys on franchisingtoimintamalli, mutta selvitys on avoin myös muille toimivaksi osoittuville malleille. Opinnäytetyö on tapaustutkimus katutanssikeskus Saiffa – Flow Mo Dance Schoolille, jota johtaa Saiffa oy. Vuonna 2010 perustettu Saiffa on helsinkiläinen tanssikoulu, joka on erikoistunut katutanssilajeihin, kuten breakdance, popping locking ja hip hop. Sen toimialaan kuuluu tanssiopetuksen lis...

  17. Ohjelmapalveluiden tuotekortit Lahti Travel Oy:n kokouspalveluhakemistoon

    OpenAIRE

    Lahti, Kirsi; Lehtola, Senni

    2010-01-01

    Tämä toiminnallinen opinnäytetyö käsittelee matkailun ohjelmapalveluiden markkinointia ja tuotteistamista. Opinnäytetyön tuloksena syntyi ohjelmapalveluiden tuotekortteja toimeksiantajan uudistetuille Internet-sivuille. Toimeksiantajana on Lahti Travel Oy, ja työn produkti eli tuotekortit ovat osa toimeksiantajan Internet-sivujen uudistusta. Tuotekortit sijoittuvat Internet-sivuilla kokouspalveluiden palveluhakemistoon ja siellä tarkemmin oheispalveluiden osioon. Työssä on toiminnallisen työn...

  18. Internetmarkkinoinnin mahdollisuudet : case NaNi Group Oy

    OpenAIRE

    Arvonen, Johanna

    2014-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia internetmarkkinoinnin mahdollisuuksia kolmessa internetpalvelussa pienten koirien vaatteita valmistavalle NaNi Group Oy:lle. Opinnäytetyö toimii hyödyllisenä oppaana toimeksiantajan internetmarkkinoinnin suunnittelussa. Lisäksi opinnäytetyössä arvioidaan toimeksiantajan Facebookissa ja YouTubessa suorittamaa mainontaa. Kampanjoiden tulosten arviointi ja vertailu antavat suuntaa sille, miten kampanjoita kannattaa toteuttaa tulevaisuudessa. Opinn...

  19. Creating strategic brand management manual : Case: Tukikallio Oy

    OpenAIRE

    Vepsäläinen, Sini

    2010-01-01

    The purpose of this Thesis was to create a Strategic Brand Management Manual for the use of a new company called Tukikallio Oy. The manual was composed of the elements that the company wanted to include in it. A qualitative research method was used in collecting information. The theoretical part of the thesis includes theories about brand building. Brand identity tells what the brand really is with its positive and negative sides, image reflects on what kind of things the consumer associa...

  20. Hissihuollon kehittäminen ThyssenKrupp hissit Oy

    OpenAIRE

    Nieminen, Jani

    2013-01-01

    Insinöörityössä kartoitettiin ThyssenKrupp Hissit Oy:n kunnossapidon tämänhetkinen toi-mintamalli ja sen pohjalta laadittiin kunnossapidon kehityssuunnitelman runko. Thyssen-Krupp Hissien huoltotoiminta on kasvanut voimakkaasti muutamassa vuodessa pienestä helposti johdettavasta yksiköstä usean henkilön johtamaksi organisaatioksi. Haastattelujen, vikatilastojen ja oman kokemukseni avulla päädyin siihen, että nykyinen hissien kunnossapito perustuu voimakkaasti korjaavaan kunnossapitoon ja ...

  1. Sosiaalisen median markkinoinnin vuosikello Weecos Oy:lle

    OpenAIRE

    Heinämäki, Lotta; Huuskonen, Leena

    2015-01-01

    Opinnäytetyön tarkoitus oli luoda kokonaisvaltainen ja selkeä suunnitelma Weecos Oy:n markkinointitoimenpiteille valituissa sosiaalisen median kanavissa. Weecos on vuonna 2012 perustettu ekologisia yrityksiä yhteen keräävä verkkokauppa-alusta. Pienestä koostaan johtuen se ei ole pystynyt toteuttamaan sosiaalisen median markkinointia toivomallaan tavalla ja markkinoinnin suunnittelu ja toteutus on ollut epäsäännöllistä. Markkinointisuunnitelman tavoitteena oli helpottaa yrityksen markkinoi...

  2. Integrated Brand Promotion – Advertisement for STADIUM OY

    OpenAIRE

    Mai, Tung

    2014-01-01

    This project-based thesis is an advertisement for Stadium Oy. In 23 years of leading marketing department, Stadium’s marketing manager had to say this is a pioneer time when Stadium’s outsources an advertising project to an external individual resource. The project, therefore, consists a number of business partners so that professional quality is guaranteed to deliver. STADIUM’s advertising strategy stays committed to the company’s business model and its mission. This directly affec...

  3. Low Biotoxicity of Mars Analog Soils Suggests that the Surface of Mars May be Habitable for Terrestrial Microorganisms

    Science.gov (United States)

    Schuerger, A. C.; Ming, Douglas W.; Golden, D. C.

    2012-01-01

    Recent studies on the interactive effects of hypobaria, low temperatures, and CO2-enriched anoxic atmospheres on the growth of 37 species of mesophilic bacteria identified 14 potential biocidal agents that might affect microbial survival and growth on the martian surface. Biocidal or inhibitory factors include (not in priority): (1) solar UV irradiation, (2) low pressure, (3) extreme desiccating conditions, (4) extreme diurnal temperature fluctuations, (5) solar particle events, (6) galactic cosmic rays, (7) UV-glow discharge from blowing dust, (8) solar UV-induced volatile oxidants [e.g., O2(-), O(-), H2O2, O3], (9) globally distributed oxidizing soils, (10) extremely high salts levels [e.g., MgCl2, NaCl, FeSO4, and MgSO4] in surficial soils at some sites on Mars, (11) high concentrations of heavy metals in martian soils, (12) likely acidic conditions in martian fines, (13) high CO2 concentrations in the global atmosphere, and (14) perchlorate-rich soils. Despite these extreme conditions several studies have demonstrated that dormant spores or vegetative cells of terrestrial microorganisms can survive simulated martian conditions as long as they are protected from UV irradiation. What has not been explored in depth are the effects of potential biotoxic geochemical components of the martian regolith on the survival and growth of microorganisms. The primary objectives of the research included: (1) prepare and characterize Mars analog soils amended with potential biotoxic levels of sulfates, salts, acidifying minerals, etc.; and (2) use the simulants to conduct biotoxicity assays to determine if terrestrial microorganisms from spacecraft can survive direct exposure to the analog soils.

  4. Biotoxic efficacy of two horticultural plants against infestation of Sitophilus oryzae on stored maize

    Directory of Open Access Journals (Sweden)

    Mercy Olayinka ONI

    2016-06-01

    Full Text Available Since botanicals still remained the most promising tool that could obviate the use of chemical insecticides, this study investigated the biotoxic effect of Acacia auriculiformis and Acalypha goddsefiana powder and oil against Sitophilus oryzae. The powder of the plants were tested at 0.0g (control, 0.1, 0.2, 0.4, 0.6, 0.8, 1.0 and 2.0g dosages while their extracts were prepared at 1, 2, 3, 4 and 5% concentrations per 20g of maize seeds. Solvent control was also prepared for the oil extracts bioassay. Mortality, adult emergence, % inhibition rate and % weight loss were observed. LD50 and LC50 of the powders and oils of the two botanicals were calculated at 48 hours of application. The powders of both plants achieved complete weevil mortality within 72h of application at 2.0g and their effect was significantly (p<0.05 different from other dosages except 1.0g dosage. Also, the extracts of both plant achieved 100% insect mortality within 48h hours of application at 5%. However the powder and oil of A. auriculiformis appeared more effective than that of A. goddsefiana in term of mortality as reflected by their lethal dosage and concentration. However, A. goddsefiana powder and extract appeared more effective than that of A. auriculiformis in term of protectability as they greatly reduced the emergence of the adult weevil and their ability to cause weight loss of the maize grains. Only the higher dosages and concentrations of the plants were able to achieve 100% inhibition rate.

  5. KUSTANNUS JA KANNATTAVUUSLASKENNAN KEHITTÄMINEN CASE KOTEK FACTORY SERVICE OY

    OpenAIRE

    Ilmonen, Hanna

    2009-01-01

    Opinnäytetyön toimeksiantajana oli Kotek Factory Service Oy ja kohteena oli Kotek Factory Service Oy:n maalaamo. Kotek Factory Service on Chesterton ARC- pinnoitteiden maahantuoja ja myyjä, joka vastaa tuotteidensa erilaisista urakoinneista, täydellisinä palvelukokonaisuuksina. Opinnäytetyön tavoitteena oli saada aikaiseksi toimintaehdotus siitä, kuinka Kotek Factory Service Oy voisi kehittää kustannus ja kannattavuuslaskentaansa maalaamon ja koko yrityksen osalta. Ongelmaan haettiin ratk...

  6. Situated Word Learning: Words of the Year (WsOY) and Social Studies Inquiry

    Science.gov (United States)

    Heafner, Tina L.; Triplett, Nicholas; Handler, Laura; Massey, Dixie

    2018-01-01

    Current events influence public interest and drive Internet word searches. For over a decade, linguists and dictionary publishers have analyzed big data from Internet word searches to designate "Words of the Year" (WsOY). In this study, we examine how WsOY can foster critical digital literacy and illuminate essential aspects of inquiry…

  7. RFID-tunnisteiden havaitseminen liikkuvasta ajoneuvosta : case: Fidera Oy

    OpenAIRE

    Artukka, Riku

    2016-01-01

    Tämän opinnäytetyön tarkoituksena on testata ja dokumentoida suoritettuja RFID- ajoneuvomittauksia eli ajoneuvojen ja henkilöiden automaattista tunnistusta hyödyntämällä RFID-tunnisteita. Opinnäytetyö on tehty toimeksiantona Fidera Oy:lle. Yrityksellä on jo käytössä automaattinen henkilötunnistusjärjestelmä, tarve olikin soveltaa samaa tekniikkaa ajoneuvojen ja niiden sisällä olevien henkilöiden tunnistukseen. Opinnäytetyön tavoitteena on luoda kuva RFID-tekniikan perusteista ja toimia s...

  8. Eclipse studies of the dwarf nova Oy Carinae in quiescence

    International Nuclear Information System (INIS)

    Wood, J.H.; Horne, K.; Berriman, G.; Wade, R.A.

    1989-01-01

    High-speed photometry of OY Car have been obtained which cover 20 eclipses in white light and seven eclipses in UBR. The results show the red dwarf to have a mass of 0.070 + or - 0.002 solar masses and a radius of 0.127 + or - 0.002 solar radii, and the white dwarf to have a temperature of several thousand degrees below 15,000 K. The bright spot is found to have a compact 15,000-K core and a tail that extends along the rim but does not penetrate far into the disk. 31 refs

  9. Markkinointiviestintäsuunnitelma Case: MK Kivipiha Oy

    OpenAIRE

    Ruohomaa, Sami

    2011-01-01

    Tämän opinnäytetyön tarkoituksena on ollut markkinointiviestintäsuunnitelman laatiminen MK Kivipiha Oy:lle. Opinnäytetyö toteutettiin projektityönä, jonka lisäksi benchmarkkaus osiossa hyödynnettiin kvalitatiivista eli laadullista analyysiä. Lähtökohtana pidettiin suunnitelman realistisuutta ja käytännön toteuttamisen mahdollisuutta. Opinnäytetyö rakentuu kahdesta eri osiosta: teoreettisesta viitekehyksestä sekä empiirisestä osuudesta. Teoriana käytettiin katsausta perinteisen markkinointivie...

  10. Mainonnan huomioarvotutkimus. Case Nelipyörä Oy

    OpenAIRE

    Survonen, Juha

    2013-01-01

    Tämä opinnäytetyö käsittelee mainontaa markkinointiviestinnän keinona. Toimeksiantajana tällä opinnäytetyöllä on Hämeenlinnassa ja Hyvinkäällä toimiva autoliike, Nelipyörä Oy. Opinnäytetyön tarkoituksena on antaa toimeksiantajalle tietoa heidän mainontansa huomioarvoista käytettyjen mainosmedioiden osalta. Opinnäytetyön teoriaosuus koostuu markkinointiviestinnästä sekä mainonnasta. Markkinointiviestinnän osuus keskittyy markkinointiviestinnän suunnitteluun sekä tavoitteisiin. Mainonnan os...

  11. Transpro Oy:n koulutustenhallintajärjestelmä

    OpenAIRE

    Pöntinen, Mika

    2011-01-01

    Opinnäytetyössä toteutetaan koulutustenhallintajärjestelmä tuusulalaiselle Transpro Oy:lle, joka on kuljettajien ammattipätevyyskoulutuksiin erikoistunut yritys. Järjestelmän tehtävänä on tarjota työkalu, jolla voidaan hallita tietoja koulutustapahtumista, koulutustapahtumiin osallistuvista oppilaista, kouluttajista ja asiakkaista. Järjestelmä on toteutettu WWW-sovelluksena. Pääohjelmointikieli on PHP ja järjestelmän dynaamiset toiminnot on toteutettu JavaScript-kielellä. Sivuston haku j...

  12. Valmistalokauppa : Toimintatapa ja omavalvonnan kehitystarpeet Muurametalot Oy:ssä

    OpenAIRE

    Kantola, Jussi

    2012-01-01

    Valmistalokauppa on kehittynyt paljon viimeisten vuosien aikana. Taloja valmistavia yrityksiä on perustettu runsaasti ja valmistalojen kysyntä on kasvanut. Työn tarkoituksena oli päivittää Muurametalot Oy:n omavalvontajärjestelmä vastaamaan paremmin tämän päivän tarpeita. Tavoitteena oli muokata omavalvonnassa käytettävät tarkastuspöytäkirjat nykypäivän asetusten tasolle. Ideaalitilanne olisi, että jokainen työntekijä osallistuu omavalvonnan käyttöön. Järjestelmän periaatteena on tarjota ...

  13. Markkinointiviestintäsuunnitelma: Charlotta-Production Oy

    OpenAIRE

    Wikman, Carita

    2015-01-01

    Tämän opinnäytetyön tarkoituksena on luoda markkinointiviestintäsuunnitelma hollolalaiselle askartelutukulle ja vähittäismyymälälle Charlotta-Production Oy:lle. Suunnitelman tavoitteena on aktivoida etenkin vanhoja yritysasiakkaita, mutta myös yksityisasiakkaita, sekä tavoittaa uusia potentiaalisia asiakkaita erityisesti digitaalisiin markkinointikeinoihin painostaen. Opinnäytetyö jakaantuu teoreettiseen ja empiiriseen osuuteen. Teoriaosuudessa käsitellään markkinointiviestintää kokonaisu...

  14. Balanced scorecard:Case ConnectedDay Oy

    OpenAIRE

    Alatalo, Teija

    2009-01-01

    Markkinoiden kasvaminen ja jatkuvasti koveneva kilpailu ovat luoneet yrityksille paineita tulevaisuuden kilpailukyvyn ylläpitämiselle, mikä edellyttää yrityksiltä uudenlaisia työkaluja liiketoiminnan seuraamiselle. Tämän opinnäytetyön aiheena oli soveltaa yritysmaailmassa yleisesti käytettyä seurantajärjestelmää, balanced scorecardia case –yrityksenä käytetyn ConnectedDay Oy:n liiketoimintaan. Robert Kaplan ja David Norton suunnittelivat 1990 –luvun alussa balanced scorecard -mallin eli tasap...

  15. Distribution strategy: : A case study of Plantui Oy

    OpenAIRE

    Korpinen, Sakari; Siltala, Roope

    2015-01-01

    Distribution strategy: A case study of Plantui Oy Year 2015 Pages 57 Plantui is a Finnish start-up company focusing on enabling customers to grow plants at home. Plantui operates in the field of design and food tech. Plantui’s product offering consists of the Smart Garden, a device in which the plants are grown. Another product which Plantui offers to its customers is the plant capsules from which the plants are grown, with the help of the Smart Garden device. Plantui’s selling propos...

  16. Mazda kiintotyövaiheiden perustaminen : Delta Auto Oy

    OpenAIRE

    Schreck, Ville

    2012-01-01

    Täyden palvelun autoliikeketju Delta Auto myy ja huoltaa Kia-, Mitsubishi- ja Mazda-merkkisiä autoja paikkakuntakohtaisesti kahdessakymmenessäviidessä toimipisteessä. Opinnäytetyön tarkoituksena oli tehdä toimiva ratkaisu Mazdan työvaiheiden sekä työpakettien myyntiin Automaster-ohjelmistoon. Työvaiheet sekä ohjeajat tulevat käyttöön kaikkiin Delta Auton toimipisteisiin ympäri Suomea. Työn lähdemateriaalin sain Inchcape Motor Finland Oy:ltä, joka toimii Suomessa Mazdan maahantuojana. Tarve tä...

  17. Effects of UV irradiation on humic acid removal by ozonation, Fenton and Fe0/air treatment: THMFP and biotoxicity evaluation

    International Nuclear Information System (INIS)

    Wei, Ming-Chi; Wang, Kai-sung; Hsiao, Tung-En; Lin, I.-Chen; Wu, Hui-Ju; Wu, Yuh-Luan; Liu, Pey-Horng; Chang, Shih-Hsien

    2011-01-01

    Highlights: → Fe 0 /air rapidly and effectively removed HA within 9 min and its COD, biotoxicity and THMFP were low. → THMFP of ozonation-treated solution was much higher than those of Fenton-treated and Fe 0 /air-treated solutions. → UV irradiation during ozonation and Fenton oxidation enhanced HA removal, but did not reduce the THMFP of the treated solutions. → Fe 0 /air treatment with UV irradiation obviously increased the THMFP of the treated solution. → The relationship between biotoxicity and chloroform in the chlorinated solution was insignificant. - Abstract: Effects of UV irradiation on humic acid (HA) removal by Fe 0 /air, ozonation and Fenton oxidation were investigated. The trihalomethane forming potential (THMFP) and toxicity of treated solutions were also evaluated. The experimental conditions were ozone of 21 mg min -1 , H 2 O 2 of 8 x 10 -4 M, Fe 0 of 20 g L -1 , air flow of 5 L min -1 , and UVC of 9 W. Results indicated that Fe 0 /air rapidly removed HA color (>99%) and COD (90%) within 9 min. 51-81% of color and 43-50% of COD were removed by ozonation and Fenton oxidation after 60 min. Both UV enhanced ozone and Fenton oxidation removed HA, but the Fe 0 /air process did not. Spectrum results showed all processes effectively diminished UV-vis spectra, except for ozonation. The THMFP of Fe 0 /air-treated solution (114 μg L -1 ) was much lower than those of Fenton- (226 μg L -1 ) and ozonation-treated solutions (499 μg L -1 ). Fe 0 /air with UV irradiation obviously increased the THMFP of treated solution (502 μg L -1 ). The toxicity results obtained from Vibrio fischeri light inhibition test indicated that the toxicity of Fe 0 /air-treated solution (5%) was much lower than that of ozonation- (33%) and Fenton-treated solutions (31%). Chlorination increased the solution toxicity. The correlation between biotoxicity and chloroform in the chlorinated solution was insignificant.

  18. Mortality, fertility, and the OY ratio in a model hunter-gatherer system.

    Science.gov (United States)

    White, Andrew A

    2014-06-01

    An agent-based model (ABM) is used to explore how the ratio of old to young adults (the OY ratio) in a sample of dead individuals is related to aspects of mortality, fertility, and longevity experienced by the living population from which the sample was drawn. The ABM features representations of rules, behaviors, and constraints that affect person- and household-level decisions about marriage, reproduction, and infant mortality in hunter-gatherer systems. The demographic characteristics of the larger model system emerge through human-level interactions playing out in the context of "global" parameters that can be adjusted to produce a range of mortality and fertility conditions. Model data show a relationship between the OY ratios of living populations (the living OY ratio) and assemblages of dead individuals drawn from those populations (the dead OY ratio) that is consistent with that from empirically known ethnographic hunter-gatherer cases. The dead OY ratio is clearly related to the mean ages, mean adult mortality rates, and mean total fertility rates experienced by living populations in the model. Sample size exerts a strong effect on the accuracy with which the calculated dead OY ratio reflects the actual dead OY ratio of the complete assemblage. These results demonstrate that the dead OY ratio is a potentially useful metric for paleodemographic analysis of changes in mortality and mean age, and suggest that, in general, hunter-gatherer populations with higher mortality, higher fertility, and lower mean ages are characterized by lower dead OY ratios. Copyright © 2014 Wiley Periodicals, Inc.

  19. RFID- TEKNIIKAN MAHDOLLISTAMAT TYÖAIKASÄÄSTÖT HUONEKALUTEOLLISUUDESSA : - CASE INCAP FURNITURE OY

    OpenAIRE

    Taskinen, Jarkko

    2009-01-01

    Opinnäytetyön tarkoituksena oli selvittää RFID- tekniikan eli radiotaajuudella toimivan etätunnistamisen mahdollistamia työaikasäästöjä huonekaluteollisuudessa. Toimeksiantaja oli Incap Furniture Oy. Incap Furniture Oy on yksi suurimmista mäntyhuonekalusopimusvalmistajista maailmassa. Pääasiakas on Ikea. Incap Furniture Oy on aloittanut projektin, jonka tarkoitus on tutkia RFID- tekniikan mahdollisuuksia ja hyötyjä tehtaiden toiminnassa. Opinnäytetyö oli osa projektia. Opinnäyt...

  20. Developing an e-commerce Website for Spicetown Oy, using Drupal.

    OpenAIRE

    Inegbedion, Usunobun

    2015-01-01

    This project is aimed at creating a website to be used for e-commerce by Spicetown Oy, a wholesaler of African and Asian food products based in Helsinki. Spicetown Oy is a traditional brick-and-mortar business in the process of transitioning into a business model combining tra-ditional business carried out on physical premises with running an online shop. The main aim of this project is to design and build a website with an online store for Spicetown Oy. The website is implemented using Drup...

  1. Sosiaalisen median merkitys mikroyrityksille - Case: TallFits Oy

    OpenAIRE

    Nousiainen, Ari; Koskivuori, Timo

    2011-01-01

    Tämän opinnäytetyön aiheena on sosiaalinen media mikroyritysten näkökulmasta. Työssä käsi-tellään sosiaalista mediaa ja markkinoinnissa tapahtunutta muutosta sekä niitä toimintatapoja, joita interaktiivinen mediaympäristö yrityksille ja sen asiakkaille tarjoaa. Työn tavoitteena on tuottaa tietoa sosiaalisen median hyödyistä ja haasteista mikroyrityksille ja lisätä koh-deyrityksemme TallFits Oy:n myyntiä ja löydettävyyttä. Tavoitteiden saavuttamiseksi opinnäytetyömme tarkoituksena oli tehd...

  2. Equilibrium Structures and Absorption Spectra for SixOy Molecular Clusters using Density Functional Theory

    Science.gov (United States)

    2017-05-05

    Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6390--17-9724 Equilibrium Structures and Absorption Spectra for SixOy Molecular Clusters...TELEPHONE NUMBER (include area code) b. ABSTRACT c. THIS PAGE 18. NUMBER OF PAGES 17. LIMITATION OF ABSTRACT Equilibrium Structures and Absorption...and electronic excited-state absorption spectra for eqilibrium structures of SixOy molecular clusters using density function theory (DFT) and time

  3. RESEARCH ON THE EFFECTIVENESS OF ADVERTISING CHANNELS AT VIITAMAA CARAVAN OY

    OpenAIRE

    Huumonen, Anna-Sofia

    2012-01-01

    The topic of this study is the effectiveness of advertising channels.The topic was chosen by the request of Viitamaa Caravan Oy. The company wants this study to give more information about the effectiveness of different advertising channels in their own advertising. Viitamaa Caravan Oy also wanted some insight into the fact how much money in the budget should be reserved for each channel. The research problem can be defined as: Which of the advertising channels already used in Viitamaa Carav...

  4. Digitaalisen markkinointiviestinnän mahdollisuudet : Case Kelloliike EA Lahti Oy

    OpenAIRE

    Harmaala, Tiina

    2011-01-01

    TIIVISTELMÄ Harmaala, Tiina. 2011. Digitaalisen markkinointiviestinnän mahdollisuudet – Case Kelloliike EA Lahti Oy. Opinnäytetyö. Kemi-Tornion ammattikorkeakoulu. Kaupan ja kulttuurin toimiala. Sivuja 62. Opinnäytetyön tavoitteena on Kelloliike EA Lahti Oy:n digitaalisen markkinointiviestinnän suunnittelu. Tutkimuksessa tarkastelen digitaalista markkinointiviestintää integroidun markkinointiviestinnän näkökulmasta. Tutkimuksen tarkoituksena on selvittää toimeksiantajalle sen markkino...

  5. Commensurability oscillations in NdBa2Cu3Oy single crystals

    Indian Academy of Sciences (India)

    gated by angular dependent magnetization in very pure twinned and twin-free NdBa2 Cu3 Oy single ... The layered structure and the c-axis coherence length, ξc ≈ 4 ˚A, smaller than the lattice ... The high quality of both crystals is demonstrated by ... Commensurability oscillations in NdBa2Cu3Oy single crystals. 2. 3. 4. 5. 6.

  6. Customer Satisfaction in Internal Customer Service : Case: Abloy Oy Internal Customer Service

    OpenAIRE

    Turunen, Susanna

    2011-01-01

    ABSTRACT Turunen, Susanna Marita 2011. Customer Satisfaction in Internal Customer Service. Case: Abloy Oy Internal Customer Service. Master’s thesis. Kemi-Tornio University of Applied Sciences. Business and Culture. Pages 73. Appendix 1. This thesis discusses and studies service quality and customer satisfaction in internal customer service. The main objective is to find out what the service quality level in the internal customer service at Abloy Oy is and whether there exists a diffe...

  7. Markkinointisuunnitelma sosiaalista mediaa hyödyntäen : Case Branda Oy

    OpenAIRE

    Hämeenniemi, Henna-Riika

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli tehdä markkinointisuunnitelma toimintaansa aloittelevalle yritykselle nimeltä Branda Oy. Branda Oy perusti vuoden 2015 alussa verkkokaupan, jonka kautta se myy naisten urheiluvaatteita suomalaisille kuluttajille. Opinnäytetyön tavoitteena oli antaa yritykselle välineet markkinoida itseään sosiaalisessa mediassa parhaalla mahdollisella tavalla. Työ toteutettiin kahdessa vaiheessa, josta ensimmäisessä toteutettiin itse markkinointisuunnitelma Branda O...

  8. OpenOffice.org -toimisto-ohjelmiston soveltuvuus Sastamalan Tukipalvelu Oy:lle : selvitys

    OpenAIRE

    Ojanen, Olli-Veikko

    2009-01-01

    Tässä opinnäytetyössä selvitettiin OpenOffice.org toimisto-ohjelmiston soveltuvuutta Sastamalan Tukipalvelu Oy:lle, joka huolehtii osakkaittensa tieto-, talous- ja henkilöstöhallinnon palveluista. Sastamalan Tukipalvelu Oy:n osakkaina ovat Kiikoisten, Lavian ja Punkalaitumen kunnat, Sastamalan kaupunki, Sastamalan perusturvakuntayhtymä sekä Sastamalan koulutuskuntayhtymä. Selvityksen tavoitteena oli tuoda esille OpenOffice.org -toimisto-ohjelmistoon siirtymisen hyötyjä, joi...

  9. Teollisuuden Voima Oy - Industrial Power Company Ltd. Local information activity

    International Nuclear Information System (INIS)

    Engros, Taina

    1989-01-01

    There are two nuclear power producers in Finland - the state-owned power company Imatran Voima Oy which operates two 440 MW Soviet-made PWR units in southern Finland, east of Helsinki and the Teollisuuden Voima Oy - Industrial Power Company Ltd, or TVO, owned by Finnish industrial companies. TVO operates two 710 MW ABB ATOM BWR units producing about one fifth of the country's electricity consumption. Operating experiences are extremely good from all Finnish nuclear power plants. The Finns' attitude towards nuclear power has changed into a positive direction in recent times. This can probably be noted as an international trend now that the Chernobyl accident is becoming an incident of the past. The Finnish citizens and politicians are facing two questions; first, what is their attitude towards nuclear power as a source of energy, in other words, do they approve of the plants currently in operation. The second question is how they stand on the building of new plants. It is probably another universal phenomenon that the attitudes of people living in the vicinity of nuclear power plants are less critical than the attitudes of those living farther away. This does not, by any means, result in local information activity being easier or less important than nationwide information activity. On the contrary, local decision-makers, local media and inhabitants are those who can, and through whom we can, influence also wider circles. The Nuclear Energy Act, which became effective in Finland last year, defines that the final decision on whether nuclear power plants can be built inside a municipality, is made at local level. As far as TVO is concerned one factor making local information activity easier is the small size of the locality. The difficulty TVO has to face is the people's suspicion of information activity. All information is considered propaganda, regardless of its form, and only negative news are considered information. Also, a large proportion of people are passive

  10. Teollisuuden Voima Oy - Industrial Power Company Ltd. Local information activity

    Energy Technology Data Exchange (ETDEWEB)

    Engros, Taina [Department of Information, TVO, Olkiluoto FIN-27160 (Finland)

    1989-07-01

    There are two nuclear power producers in Finland - the state-owned power company Imatran Voima Oy which operates two 440 MW Soviet-made PWR units in southern Finland, east of Helsinki and the Teollisuuden Voima Oy - Industrial Power Company Ltd, or TVO, owned by Finnish industrial companies. TVO operates two 710 MW ABB ATOM BWR units producing about one fifth of the country's electricity consumption. Operating experiences are extremely good from all Finnish nuclear power plants. The Finns' attitude towards nuclear power has changed into a positive direction in recent times. This can probably be noted as an international trend now that the Chernobyl accident is becoming an incident of the past. The Finnish citizens and politicians are facing two questions; first, what is their attitude towards nuclear power as a source of energy, in other words, do they approve of the plants currently in operation. The second question is how they stand on the building of new plants. It is probably another universal phenomenon that the attitudes of people living in the vicinity of nuclear power plants are less critical than the attitudes of those living farther away. This does not, by any means, result in local information activity being easier or less important than nationwide information activity. On the contrary, local decision-makers, local media and inhabitants are those who can, and through whom we can, influence also wider circles. The Nuclear Energy Act, which became effective in Finland last year, defines that the final decision on whether nuclear power plants can be built inside a municipality, is made at local level. As far as TVO is concerned one factor making local information activity easier is the small size of the locality. The difficulty TVO has to face is the people's suspicion of information activity. All information is considered propaganda, regardless of its form, and only negative news are considered information. Also, a large proportion of people are passive

  11. Changes in the components and biotoxicity of dissolved organic matter in a municipal wastewater reclamation reverse osmosis system.

    Science.gov (United States)

    Sun, Ying-Xue; Hu, Hong-Ying; Shi, Chun-Zhen; Yang, Zhe; Tang, Fang

    2016-09-01

    The characteristics of dissolved organic matter (DOM) and the biotoxicity of these components were investigated in a municipal wastewater reclamation reverse osmosis (mWRRO) system with a microfiltration (MF) pretreatment unit. The MF pretreatment step had little effect on the levels of dissolved organic carbon (DOC) in the secondary effluent, but the addition of chlorine before MF promoted the formation of organics with anti-estrogenic activity. The distribution of excitation emission matrix (EEM) fluorescence constituents exhibited obvious discrepancies between the secondary effluent and the reverse osmosis (RO) concentrate. Using size exclusion chromatography, DOM with low molecular weights of approximately 1.2 and 0.98 kDa was newly formed during the mWRRO. The normalized genotoxicity and anti-estrogenic activity of the RO concentrate were 32.1 ± 10.2 μg4-NQO/mgDOC and 0.36 ± 0.08 mgTAM/mgDOC, respectively, and these values were clearly higher than those of the secondary effluent and MF permeate. The florescence volume of Regions I and II in the EEM spectrum could be suggested as a surrogate for assessing the genotoxicity and anti-estrogenic activity of the RO concentrate.

  12. Site investigation equipment developed by Teollisuuden Voima Oy

    International Nuclear Information System (INIS)

    Oehberg, A.

    1991-02-01

    Teollisuuden Voima Oy (TVO) carries out site investigations in Finland for final disposal of nuclear high level waste during 1987-2000. In order to carry out the investigations some essential equipment have been designed and constructed. The biggest insufficiency among different measuring methods was among water sampling and hydraulic testing. There are some common specifications which all of these equipment has to fulfil. The two most important are that they have to be operatable in deep slim boreholes down to 1000 meters depth with 56 mm in diameter. The main purpose of the Hydraulic Testing Unit is to determine hydraulic conductivity in crystalline rock, where water can flow primarily through fractures. In most commonly used configurations, measurement range is from 10 - 11 to 10 - 5 m/s with constant-head method. Although constant-head method is principally used, almost any known hydraulic method is possible with existing hardware. Most functions are controlled by the computer. The whole system is built into an electrically heated trailer. The system consists of inflatable packers, stainless steel rods, pressure transducers and datalogging devices. The maximum number of monitoring sections is seven. In addition to that as many blind sections as is needed to prevent vertical flow in boreholes can be installed. Water sampling is possible either with a double packer method or in conjunction with the hydraulic head monitoring equipment. The first possibility involves using the laboratory trailer and the second one using a separate pumping unit plus the laboratory trailer in a later phase when sampling is to be conducted. In the laboratory trailer there are all the measuring devices needed to control different chemical parameters (pH, Eh, pS, O 2 , conductivity and temperature) during pumping

  13. Characterization and biotoxicity assessment of dissolved organic matter in RO concentrate from a municipal wastewater reclamation reverse osmosis system.

    Science.gov (United States)

    Sun, Ying-Xue; Gao, Yue; Hu, Hong-Ying; Tang, Fang; Yang, Zhe

    2014-12-01

    Reverse osmosis (RO) concentrate from municipal wastewater reclamation reverse osmosis (mWRRO) system containing organic compounds may associate with toxic risk, and its discharge might pose an environmental risk. To identify a basis for the selection of feasible technology in treating RO concentrates, the characteristics and biotoxicity of different fractions of dissolved organic matter (DOM) in RO concentrates from an mWRRO system were investigated. The results indicated that the hydrophilic neutrals (HIN), hydrophobic acids (HOA) and hydrophobic bases (HOB) accounted for 96% of the dissolved organic carbon (DOC) of the total DOM in the RO concentrate. According to the SEC chromatograph detected at 254 nm wavelength of UV, the DOM with molecular weight (MW) 1-3 kDa accounted for the majority of the basic and neutral fractions. The fluorescence spectra of the excitation emission matrix (EEM) indicated that most aromatic proteins, humic/fulvic acid-like and soluble microbial by-product-like substances existed in the fractions HOA and hydrophobic neutrals (HON). The genotoxicity and anti-estrogenic activity of the RO concentrate were 1795.6 ± 57.2 μg 4-NQOL(-1) and 2.19 ± 0.05 mg TAM L(-1), respectively. The HIN, HOA, and HOB contributed to the genotoxicity of the RO concentrate, and the HIN was with the highest genotoxic level of 1007.9 ± 94.8 μg 4-NQOL(-1). The HOA, HON, and HIN lead to the total anti-estrogenic activity of the RO concentrate, and HOA occupied approximately 60% of the total, which was 1.3 ± 0.17 mg TAM L(-1). Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. B2B-uutiskirjeen visuaalisen ilmeen kehitys — Case Tamtron Solutions Oy

    OpenAIRE

    Salo, Sari

    2014-01-01

    Opinnäytetyön tarkoituksena oli kehittää Tamtron Solutions Oy:n uutiskirjeelle uusi visuaalinen ilme. Yrityksen lähettämästä uutiskirjeestä yritysasiakkaille puhutaan B2B-uutiskirjeenä. Tamtron Solutions Oy halusi B2B-uutiskirjeen avulla tehostaa markkinointia, kasvattaa myyntiä ja luoda uusia asiakassuhteita. Yritys halusi toteuttaa markkinointikampanjan B2B-uutiskirjeen muodossa rakennusalan yrityksille. Yritys valitsi kampanjan kohderyhmäksi rakennusalan yritykset, koska lakimuutos rakennu...

  15. Jatkuvan koulutuksen antama tuki myyntityölle : Case: Systemair Oy

    OpenAIRE

    Mattila, Jeremias

    2017-01-01

    Opinnäytetyössä pyritään selvittämään, kokevatko myyjät koulutuksen edistävän heidän itse-varmuuttaan työtä kohden tai kokevatko he koulutuksen antaman tuen jollain muulla tavalla? Tulokset perustuvat laadulliseen Systemair Oy:n myyntihenkilöstön teemahaastatteluun. Kaikki tulokset ovat siis subjektiivisia Systemair Oy:n toimialaa ja sisäistä yrityskulttuuria kos-kien. Sovellettavuus muihin yrityksiin ja toimialoihin vaatii uuden tutkimuksen, mutta työ voi antaa osviittaa siihen, millaiset ja...

  16. Entering market in St. Petersburg, Russia– Kärävä Oy

    OpenAIRE

    Tsirkunov, Aleksandr

    2013-01-01

    The company commissioning this thesis is Kärävä Oy. This company was founded in 1988 and since then they focus on producing timber of different quality and size. Their clients are wholesalers of timber and wood products, along with sauna manufacturers. Produced products are used for interior finishing in commercial and public areas. More-over, Kärävä Oy is also producing interior materials for saunas. Main purpose for this thesis is to analyse if entering Russian market will be profitable...

  17. Customer Orientation vs. Customer Orientation Perception : Case J & J Lakkapää Oy Tornio

    OpenAIRE

    Angeria, Heli

    2011-01-01

    Heli, Angeria 2011. Customer Orientation vs. Customer Orientation Perception. Case: J & J Lakkapää Oy Tornio. Kemi-Tornio University of Applied Sciences. Business and Culture. Pages 51. Appendices 5. The objective of this thesis is to study customer orientation with the help of a widely adapted Selling-Orientation-Customer Orientation (SOCO) scale, in order to find out what is the extent to which J & J Lakkapää Oy Tornio and its consumer customers agree or disagree about the company’s cus...

  18. Online video marketing plan for a product launch : Case company: Altal Oy

    OpenAIRE

    Ngo, Quan

    2015-01-01

    This bachelor’s thesis aims to create a detailed guideline for using marketing videos in various online channels for Altal Oy. The commissioning company, Altal Oy is a Finn-ish start-up founded by three employees in 2014. It operates in the smart home tech-nology sector. The thesis topic is based on the current needs of the company to pro-mote for the launch of its brand new products in the Finnish market. A real project of making a promotion video is conducted and reported in parallel with t...

  19. SIEVIN JALKINE OY:N AVAINASIAKKAIDEN KÄSITYKSIÄ YRITYKSEN TOIMINNASTA

    OpenAIRE

    Haapakoski, Sanna

    2014-01-01

    Opinnäytetyön toimeksiantaja on Sievin Jalkine Oy. Yritys on Pohjoismaiden johtava turva- ja ammattijalkineiden valmistaja. Opinnäytetyön tavoitteena oli selvittää, kuinka tyytyväisiä avainasiakkaat ovat Sievin Jalkine Oy:n toimintaan ja miten toimintaa voidaan kehittää asiakkaiden hyväksi. Opinnäytetyössä selvitettiin, miten tyytyväisiä avainasiakkaat ovat tuotetarjontaan, palvelujen tarjontaan, markkinointiviestintään, asiakaspalveluun ja henkilöstöön. Opinnäytetyön tietoperustassa...

  20. Turvajalkineiden vaikutus jalkaterveyteen Suur-Savon Sähkötyö Oy:ssä

    OpenAIRE

    Pulkkinen, Riikka; Tossavainen, Inka; Ryynänen, Elina

    2014-01-01

    Opinnäytetyön tarkoituksena oli selvittää, millaisia vaikutuksia turvajalkineilla voi olla jalkaterveyteen, minkälaisia jalkaongelmia turvajalkineiden käyttö voi aiheuttaa, voivatko työntekijät itse vaikuttaa turvajalkineiden hankintaan ja millainen on turvajalkineiden hankintaprosessi Suur-Savon Sähkötyö Oy:ssä. Opinnäytetyömme toimeksiantaja oli Suur-Savon Sähkötyö Oy. Tutkimusmenetelmänä käytettiin pääasiassa kvantitatiivista tutkimusta ja aineisto kerättiin puolistrukturoidulla kysely...

  1. Graphene/TiO2/ZSM-5 composites synthesized by mixture design were used for photocatalytic degradation of oxytetracycline under visible light: Mechanism and biotoxicity

    Science.gov (United States)

    Hu, Xin-Yan; Zhou, Kefu; Chen, Bor-Yann; Chang, Chang-Tang

    2016-01-01

    This first-attempt study revealed mixture design of experiments to obtain the most promising composites of TiO2 loaded on zeolite and graphene for maximal photocatalytic degradation of oxytetracycline (OTC). The optimal weight ratio of graphene, titanium dioxide (TiO2), and zeolite was 1:8:1 determined via experimental design of simplex lattice mixture. The composite material was characterized by XRD, UV-vis, TEM and EDS analysis. The findings showed the composite material had a higher stability and a stronger absorption of the visible light. In addition, it was uniformly dispersed with promising adsorption characteristics. OTC was used as model toxicant to evaluate the photodegradation efficiency of the GTZ (1:8:1). At optimal operating conditions (i.e., pH 7 and 25 °C), complete degradation (ca. 100%) was achieved in 180 min. The biotoxicity of the degraded intermediates of OTC on cell growth of Escherichia coli DH5α were also assayed. After 180 min photocatalytic treatment, OTC solution treated by GTZ (1:8:1) showed insignificant biotoxicity to receptor DH5α cells. Furthermore, EDTA (hole scavengers) and t-BuOH (radical scavengers) were used to detect the main active oxidative species in the system. The results showed that the holes are the main oxidation species in the photocatalytic process.

  2. Työohjeistus Perälän Turve Oy

    OpenAIRE

    Haukka, Arto

    2014-01-01

    Perälän Turve Oy:n uusille työntekijöille laadittu työohjeistus ja siitä raportointi. Työhön kuuluu kaksi osaa, word-raportti sekä powerpoint-työohjeistuskansio. Powerpoint-tiedosto upotettuna tiedostona alkuperäisessä word-tiedostossa.

  3. Determination of interstitial oxygen atom position in U2N3+xOy by near edge structure study

    Science.gov (United States)

    Jiang, A. K.; Zhao, Y. W.; Long, Z.; Hu, Y.; Wang, X. F.; Yang, R. L.; Bao, H. L.; Zeng, R. G.; Liu, K. Z.

    2018-06-01

    The determination of interstitial oxygen atom site in U2N3+xOy film could facilitate the understanding of the oxidation mechanism of α-U2N3 and the effect of U2N3+xOy on anti-oxidation. By comparing the similarities and variances between N K edge and O K edge electron energy loss spectra (EELS) for oxidized α-U2N3 and UO2, the present work looks at the local structure of nitrogen and oxygen atoms in U2N3+xOy film, identifying the most possible position of interstitial O atom.

  4. Henkilöstötilinpäätös Yritys Oy

    OpenAIRE

    Turunen, Tytti

    2011-01-01

    Tämän opinnäytetyön aiheena oli Yritys Oy:n henkilöstötilinpäätös vuodelta 2009. Henkilöstötilinpäätös jaetaan kahteen osaan, henkilöstötuloslaskelmaan ja henkilöstökertomukseen. Tavoitteena oli laatia Yritys Oy:lle henkilöstötilinpäätöksestä malli, jota yritys voi käyttää ja hyödyntää tulevaisuudessa henkilöstötilinpäätöstä laatiessa. Tavoitteena oli myös antaa kehittämisehdotuksia, minkälaista tietoa kannattaa kerätä seuraavia henkilöstötilinpäätöksiä varten. Henkilöstötilinpäätöksen tavoit...

  5. High-speed photometry of the eclipsing dwarf nova OY Carinae

    Science.gov (United States)

    Cook, M. C.

    1985-01-01

    High-speed photometry of the eclipsing dwarf nova OY Car in the quiescent state is presented. OY Car becomes highly reddened during eclipse, with minimum flux colours inconsistent with optically thick emission in the U and B bandpasses. Mass ratios in the range 6.5 to 12 are required to reconcile the eclipse structure with theoretical gas stream trajectories. Primary eclipse timings reveal a significant decrease in the orbital period and the duration of primary eclipse indicates the presence of a luminous ring about the white dwarf. The hotspot eclipse reveals a hotspot which is elongated along the rim of the accretion disc, with optical emission being non-uniformly distributed along the rim. The location of the hotspot in the accretion disc implies a disc radius larger than that of an inviscid disc, with variation in the position of the hotspot being consistent with a fixed stream trajectory.

  6. Taloushallintoprosessien kehittäminen Iisalmen Putkiasennus Oy:ssä

    OpenAIRE

    Juntunen, Tiia

    2015-01-01

    Tämä opinnäytetyö käsittelee taloushallintoprosessien kehittämistä Iisalmen Putkiasennus Oy:ssä. Kehittämistyötä päädyttiin rajaamaan keskittyen myynti- ja ostolaskuprosessien kehittämiseen, koska niissä oli havaittu olevan eniten kehitettävää. Iisalmen Putkiasennus Oy on LVI-alalla työskentelevä perheyritys, joka on ollut toiminnassa jo yli 35 vuotta. Yritys sijaitsee Iisalmessa ja työllistää noin 50 henkilöä. Tässä opinnäytetyössä taloushallintoprosessien kehittäminen alkoi tilanteesta...

  7. A visible and infrared study of the eclipsing dwarf nova OY Carinae

    International Nuclear Information System (INIS)

    Berriman, G.

    1984-01-01

    This paper presents four visible light curves of the highly inclined, short-period cataclysmic binary star OY Carinae in quiescence. These light curves show that the red dwarf eclipses both its white dwarf companion and the accretion disc and hotspot, which originate from material transferred from the red dwarf to the white dwarf. The consequences of the findings are discussed in the light of current ideas about the evolution of cataclysmic variable stars. (author)

  8. Corporate Social Responsibility: A Case Study of BSCI Implementation at Best Friend Group Oy

    OpenAIRE

    Qi, Yuan

    2012-01-01

    With the current polarized debate over CSR issues worldwide, ever increasing number of companies believe that incorporating ethical values into the business operation is an attractive option to upgrade the brand value, maintain the competitive advantage and cater for the social demand of various stakeholders. Business Social Compliance Initiative, a division of FTA, serves as a platform to assist companies in achieving the goal. The study was commissioned by Best Friend Group Oy, a medium...

  9. Markkinointi murroksessa: Mistä on toimiva Facebook-markkinointi tehty? : Case: Infokone Oy

    OpenAIRE

    Korhonen, Taneli

    2010-01-01

    Opinnäytetyön tavoitteena oli kartoittaa Facebook-markkinoinnin toimivia käytänteitä B2B-yritykselle. Tutkimuksessa saatuja tuloksia on tarkoitus käyttää apuna toimeksiantaja Infokone Oy:n Facebook-strategian suunnittelussa. Käytetty tutkimusote oli kvalitatiivinen eli laadullinen tutkimus ja tutkimusmenetelmä teemahaastattelu. Tutkimukseen haastateltiin syys–lokakuussa 2010 kolmea B2B-yrityksen edustajaa, jotka olivat olleet mukana toteuttamassa edustamansa yrityksen Facebook-markkinoint...

  10. Assessing demand for physical objects among marketing agencies : market research for Alphaform RPI Oy

    OpenAIRE

    Popova, Oxana

    2012-01-01

    The market for 3D printing services is projected to grow significantly. A service provider of 3D printing and rapid prototyping services, Alphaform RPI Oy recognizes that there are numerous growth opportunities that can be exploited. A market research was initiated by the case company to look for any emerging trends to use physical objects. The study was focused on exploring marketing agencies and their vision on 3D printing and rapid prototyping services. Theoretical framework was built ...

  11. Neste Oy starts the production of extra high viscosity index lubricating oil in Porvoo

    International Nuclear Information System (INIS)

    Kilander, H.

    1997-01-01

    Neste Oy is starting the manufacture of basic oil, used in advanced motor lubricants, in Finland. The plant will start the manufacture of the EHVI (Extra High Viscosity) by the end of 1997. The EHVI basic oil is a synthetic-like oil product, suitable for manufacture of high-quality lubricants. In the beginning the production of the basic oil will be about 50 000 tons/a. The investment costs of the plants are 180 million FIM

  12. Establishing a pricing structure for software products : Case study: Viope Solutions Oy

    OpenAIRE

    Nguyen, Tram

    2013-01-01

    This thesis is a case study that explores how to establish a pricing structure for software products. The objective is to provide a guideline to establish a pricing structure for Viope Solutions Oy. A new pricing structure is crucial for the company due to recent changes in its business such as internationalisation and new product launches. The literature review introduces five attributes of a pricing structure. They are the unit definition, price determination, price segmentation, versio...

  13. Internationalization Strategies for Multinational Companies (MNCs) : In the case of KWH Mirka Oy to Ethiopia

    OpenAIRE

    Yigzaw, Tamirat

    2015-01-01

    This thesis is done for the fulfilment of Masters of Business Administration (MBA) degree program in Business Management and Entrepreneurship at Häme University of Applied Sciences (HAMK). The main focus of the study is internationalization of companies to a new market as a development task for the company. The commissioner of the thesis is Mirka Oy, a Finnish multinational company. The purpose of the thesis was to study factors that should be considered in internationalization strategies...

  14. Kankaan tuotekehittäminen erikoisolosuhteisiin K&H Annala Oy:lle

    OpenAIRE

    Koski, Marjo

    2017-01-01

    Opinnäytetyö tehtiin yhteistyössä Suomen ainoan huonekalukankaita valmistavan yrityksen K&H Annala Oy:n kanssa. Työn aiheena oli suunnitella ja tuotteistaa kangasmallisto erikoisolosuhteisiin innovatiivisesta, Italiassa valmistettavasta Flyer-langasta. Projektin lähtökohtana oli opinnäytetyöntekijän kasvava kiinnostuneisuus kudottuja tekstiilejä kohtaan ja kankaan suunnitteluprosessin vieminen teollisen tuotannon puolelle. Projektissa tähdättiin uudentyyppiseen kankaaseen ilmeen ja materiaali...

  15. The effect of CO2 on the plasma remediation of NxOy

    Science.gov (United States)

    Gentile, Ann C.; Kushner, Mark J.

    1996-04-01

    Plasma remediation is being investigated for the removal of oxides of nitrogen (NxOy) from atmospheric pressure gas streams. In previous works we have investigated the plasma remediation of NxOy from N2/O2/H2O mixtures using repetitively pulsed dielectric barrier discharges. As combustion effluents contain large percentages of CO2, in this paper we discuss the consequences of CO2 in the gas mixture on the efficiency of remediation and on the end products. We find that there is a small increase in the efficiency of total NxOy remediation (molecules/eV) with increasing CO2 fraction, however the efficiency of NO remediation alone generally decreases with increasing CO2. This differential is more pronounced at low energy deposition per pulse. More remediation occurs through the reduction channel with increasing CO2 while less NO2 and HNOx are produced through the oxidation channel. CO is produced by electron impact of CO2 though negligible amounts of cyanides are generated.

  16. Graphene/TiO{sub 2}/ZSM-5 composites synthesized by mixture design were used for photocatalytic degradation of oxytetracycline under visible light: Mechanism and biotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Xin-Yan; Zhou, Kefu [College of the Environment and Ecology, Xiamen University, Xiamen (China); Chen, Bor-Yann, E-mail: boryannchen@yahoo.com.tw [Department of Chemical and Materials Engineering, National I-Lan University, Ilan, Taiwan (China); Chang, Chang-Tang, E-mail: ctchang73222@gmail.com [Department of Environmental Engineering, National I-Lan University, Ilan, Taiwan (China)

    2016-01-30

    Graphical abstract: The mechanism of OTC degradation can be described as follows. At first, the OTC molecule was adsorbed onto the surface of GTZ material. The conduction band electron (e{sup −}) and valence band holes (h{sup +}) are generated when aqueous GTZ suspension is irradiated with visible light. The generation of (e{sup −}/h+) pair leading to the formation of reactive oxygen species. The ·OH radical and ·O{sub 2}{sup −} can oxidize OTC molecular, resulting in the degradation and mineralization of the organics. - Highlights: • Determine optimal composites of graphene, TiO{sub 2}, and zeolite for maximal photodegradation efficiency via triangular mixture design. • Unravel most promising composites for high stability and absorptive capabilities for photocatalytic degradation. • Disclose time-series profiles of toxicity of advanced oxidation processes (AOPs) treatment of wastewater. • Propose plausible routes of mechanism of photocatalytical degradation of OTC. - Abstract: This first-attempt study revealed mixture design of experiments to obtain the most promising composites of TiO{sub 2} loaded on zeolite and graphene for maximal photocatalytic degradation of oxytetracycline (OTC). The optimal weight ratio of graphene, titanium dioxide (TiO{sub 2}), and zeolite was 1:8:1 determined via experimental design of simplex lattice mixture. The composite material was characterized by XRD, UV–vis, TEM and EDS analysis. The findings showed the composite material had a higher stability and a stronger absorption of the visible light. In addition, it was uniformly dispersed with promising adsorption characteristics. OTC was used as model toxicant to evaluate the photodegradation efficiency of the GTZ (1:8:1). At optimal operating conditions (i.e., pH 7 and 25 °C), complete degradation (ca. 100%) was achieved in 180 min. The biotoxicity of the degraded intermediates of OTC on cell growth of Escherichia coli DH5α were also assayed. After 180 min

  17. Graphene/TiO_2/ZSM-5 composites synthesized by mixture design were used for photocatalytic degradation of oxytetracycline under visible light: Mechanism and biotoxicity

    International Nuclear Information System (INIS)

    Hu, Xin-Yan; Zhou, Kefu; Chen, Bor-Yann; Chang, Chang-Tang

    2016-01-01

    Graphical abstract: The mechanism of OTC degradation can be described as follows. At first, the OTC molecule was adsorbed onto the surface of GTZ material. The conduction band electron (e"−) and valence band holes (h"+) are generated when aqueous GTZ suspension is irradiated with visible light. The generation of (e"−/h+) pair leading to the formation of reactive oxygen species. The ·OH radical and ·O_2"− can oxidize OTC molecular, resulting in the degradation and mineralization of the organics. - Highlights: • Determine optimal composites of graphene, TiO_2, and zeolite for maximal photodegradation efficiency via triangular mixture design. • Unravel most promising composites for high stability and absorptive capabilities for photocatalytic degradation. • Disclose time-series profiles of toxicity of advanced oxidation processes (AOPs) treatment of wastewater. • Propose plausible routes of mechanism of photocatalytical degradation of OTC. - Abstract: This first-attempt study revealed mixture design of experiments to obtain the most promising composites of TiO_2 loaded on zeolite and graphene for maximal photocatalytic degradation of oxytetracycline (OTC). The optimal weight ratio of graphene, titanium dioxide (TiO_2), and zeolite was 1:8:1 determined via experimental design of simplex lattice mixture. The composite material was characterized by XRD, UV–vis, TEM and EDS analysis. The findings showed the composite material had a higher stability and a stronger absorption of the visible light. In addition, it was uniformly dispersed with promising adsorption characteristics. OTC was used as model toxicant to evaluate the photodegradation efficiency of the GTZ (1:8:1). At optimal operating conditions (i.e., pH 7 and 25 °C), complete degradation (ca. 100%) was achieved in 180 min. The biotoxicity of the degraded intermediates of OTC on cell growth of Escherichia coli DH5α were also assayed. After 180 min photocatalytic treatment, OTC solution treated

  18. Insta Trust Oy:n tuottamien kriisiharjoitusten kehittäminen

    OpenAIRE

    Väinölä, Marko

    2016-01-01

    Insta Trust Oy toteuttaa asiakkaidensa kanssa kymmeniä kriisiharjoituksia vuosittain. Kriisiharjoitusten avulla pyritään kehittämään harjoittelevien tahojen kriisijohtamisen ja kriisiviestinnän osaamista, tunnistamaan kehittämistä vaativia toimintamalleja ja ohjeita sekä lisäämään organisaation avainhenkilöiden motivaatiota ja tietoisuutta kriisijohtamisesta ja ennakoivaa turvallisuustyötä kohtaan. Kriisiharjoitusten kehittämisessä on osattava kuunnella asiakkaiden tarpeita ja pysyttävä mukan...

  19. Kanta-asiakkuuksien hankinta paikallisessa yö-kerhossa, Case: Giggling Marlin Oy

    OpenAIRE

    Ylärakkola, Emmi

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli saada käsitys siitä, saadaanko työssä toteutettujen keinojen avulla uusia kanta-asiakkaita ja aiempia kanta-asiakkaita uusimaan jäsenyytensä paikallisessa yökerhossa. Työn toimeksiantaja oli Giggling Marlin Oy, joka kuuluu Night People Group -ravintolayhtiöön. Giggling Marlin sijaitsee Lappeenrannan keskustassa ja on perustettu alkukeväällä 2006. Toiminnallisena osana suunniteltiin ja toteutettiin mainosmateriaalia kampanja-ajankohdalle sekä valmisteltiin...

  20. 5S-MENETELMÄN KÄYTTÖÖNOTTO: LUVATA PORI OY

    OpenAIRE

    Rantanen, Suvi

    2015-01-01

    Opinnäytetyön aiheena oli 5S-menetelmän käyttöönotto Luvata Pori Oy:n tuotannos-sa. Tutkimuksen lähtökohtana ja ongelmana oli siisteyden ja järjestyksen puute. Ta-voitteena oli aikaansaada valittuun pilottikohteeseen toimivat, siistit ja turvalliset tuotantotilat sekä luoda järjestelmä, jonka avulla ylläpidetään saavutettu taso. Lisäksi tavoiteltiin hukan poistamista ja Luvatan Lean toimintatavan syventämistä. Projekti toteutettiin toimintatutkimuksena syksyn 2015 aikana. Tutkimuksen teor...

  1. 5S-menetelmän käyttöönotto Case: Planmeca Oy

    OpenAIRE

    Velic, Adel

    2014-01-01

    Opinnäytetyön tavoitteena on tutkia Planmeca Oy:n panoraamaröntgentuotannossa syksyllä 2012 toteutetun 5S-projektin onnistuneisuutta. Työ kattaa sekä 5S-periaatteiden mukaisesti suunniteltujen ja toteutettujen panoraamaröntgentuotannon Elko-, Pystytys 1 -, Pystytys 2 - sekä Potilastuki- ja skannausmekanismitiimin työpisteiden että projektin toteutustavan onnistuneisuuden mittaamisen. Tutkimusmenetelmänä käytetään Elko-, Pystytys 1 -, Pystytys 2 - sekä Potilastuki- ja skannausmekanismitiim...

  2. A/B Testing in Improving Conversion on a Website : Case: Sanoma Entertainment Oy

    OpenAIRE

    Arento, Thomas

    2010-01-01

    The purpose of this thesis is to study marketing possibilities of improved conversion rates on websites. The study was made for Sanoma Entertainment Oy’s Gaming & Online unit. The main objective was to explore A/B testing as a tool to improve conversion rates by increasing click-through rates. The secondary objective was to test Google Website Optimizer as an A/B testing tool in comparison to current methods of A/B testing in Sanoma Entertainment Oy. The results of this study will be used as ...

  3. Content Marketing Plan for Logistics Company : Case: NetLogistic JVM Oy

    OpenAIRE

    Riabochkina, Elizaveta

    2017-01-01

    This project aim is to create a Content Marketing Strategy for a Finnish logistics company. The aim of the thesis is to develop an action plan that will help the commissioning company increase sales and gain new customers. The commissioner for the study is NetLogistic JVM Oy. The Company specializes in handling trade of transit and export shipments to Russia and CIS-countries via Finland. The company does not have huge resources to run large campaign, but is looking for ways to reach new...

  4. Entering Chinese market for Finnish fashion jewellery company : case: Ninja Finland Oy

    OpenAIRE

    Wang, Yujue

    2014-01-01

    As one of the fastest-growing economies in the world, China is expected to become the largest fashion market in the world in a few years. As a result, more and more foreign companies have entered the Chinese market and the market has been more competitive than ever. This requires any fashion company to adopt a strategic development plan when entering the Chinese market. Ninja Finland Oy is a fashion jewellery company which offers a wide range of fashion jewellery and accessories. The comp...

  5. Kanta-asiakasohjelman kehittäminen : case Crocs Stores Oy

    OpenAIRE

    Manninen, Mirka

    2014-01-01

    Kanta-asiakkuuden tavoitteena on molemminpuolinen arvon tuottaminen asiakkaan ja yrityksen välillä. Tämän tutkimuksen tavoitteena on selvittää, millainen kanta-asiakasohjelma olisi toimeksiantajayrityksen kannalta toimivin. Tutkimus on tapaus- eli case -tutkimus, jonka toimeksiantaja on Crocs Stores Oy. Toimeksiantajalla on tällä hetkellä käytössään kanta-asiakasohjelma, joka ei palvele yrityksen tarpeita. Paremman kanta-asiakasohjelman kehittämisen lisäksi tavoitteina on selvittää asiakkaide...

  6. Toimenpide-ehdotuksia sosiaaliseen mediaan : case: Sony Music Entertainment Finland Oy

    OpenAIRE

    Marttila, Noora

    2016-01-01

    Tämä opinnäytetyö toteutettiin toimeksiantona Sony Music Entertainment Finland Oy levy-yhtiölle. Toimeksiantaja on kansainvälinen yritys joka on yksi Suomen suurimmista levy-yhtiöistä. Yritys käyttää sosiaalista mediaa osana digitaalista markkinointiaan. Sitä käytetään erityisesti artistien sekä julkaisujen tunnettuuden lisäämiseen. Sosiaalinen media on kasvava markkinoinnin keino, joka oikein hyödynnettynä voi johtaa hyviin lopputuloksiin. Tämän työn tarkoituksena on antaa yrityksell...

  7. Tuotteiden ohjeistaminen osana hankintatoimintaa ja tuotetiedonhallintaa : case: Seppälä Oy

    OpenAIRE

    Heikkonen, Veera

    2010-01-01

    Tuoteohjeistusten tekeminen on arkipäivää suomalaisissa vaatetusalan yrityksissä. Tuotteiden hankinta ulkomailta on yleistynyt huomattavasti, joka taas on tehnyt tuoteohjeistuksista tärkeitä työkaluja yrityksen toiminnassa. Tuoteohjeistusten avulla suunnittelijan ideat ja ajatukset toteutetaan oikeaksi tuotteeksi. Tämän opinnäytetyön tarkoitus oli kehittää Seppälä Oy:lle yhtenäinen tuoteohjeis-tuspohja, joka on selkeä ja toimiva. Projektin lähtökohtainen tarkoitus on, että Seppälä voi hy...

  8. Todellista asiakasarvoa luomassa – myynnistä arvomyyntiin : case Mediamaisteri Oy

    OpenAIRE

    Brander, Heli

    2017-01-01

    Tämän opinnäytetyön tavoite oli case-yritys Mediamaisteri Oy:n B2B-myyntiprosessin kehittäminen. Tarkoitus oli hyödyntää palvelumuotoilua lisäämään asiakasymmärrystä ja tukemaan asiakkaiden kokeman arvon muodostumista sekä positiivisten asiakaskokemusten syntymistä myyntiprosessin alkuvaiheen asiakaskohtaamisissa. Lisäksi tarkoitus oli kiteyttää empiirisen aineiston pohjalta saatu tieto asiakasprofiileiksi, joita voidaan hyödyntää asiakaslähtöisten ratkaisujen suunnittelussa heti asiakkuuden ...

  9. Yritys X Oy:n myyntijohtolankojen hallintaprosessin kehittäminen

    OpenAIRE

    Jokinen, Mika

    2014-01-01

    Tässä kehittämistehtävässä tutkittiin miten Yritys X Oy:n myyntijohtolankojen hallintaprosessia voidaan kehittää niin, että se tuottaisi enemmän ja laadukkaampia myyntijohtolankoja myynnin käsiteltäväksi. Yritys X on kansainvälisiä logistiikkapalveluja tuottava yritys ja myyntijohtolankojen avulla voidaan hankkia uusia asiakkaita ja lisämyyntiä. Tutkimuksen lähtöaineisto kerättiin kyselytutkimuksella kuljettajilta ja ajojärjestelijöiltä. Kehittämistyön tueksi aineistoa kerättiin myös myy...

  10. Ostotoiminnan laadunvarmistus ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä

    OpenAIRE

    Hiltunen, Jarmo

    2012-01-01

    Opinnäytetyön aiheena oli ostotoiminnan laadunvarmistuksen ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä. Työssä on perehdytty erityisesti niihin ostotoiminnan laadun kehittämisen haasteisiin mitkä liittyvät alihankintaostamisen osa-alueeseen. Opinnäytetyön päätavoitteena oli luoda työkaluja hankinnan laadun jatkuvan parantamisen avuksi. Lisäksi tavoitteena oli perehtyä hankintojen mittaamisen teoriaan. Opinnäytetyön tutkimusmenetelmänä on käytetty käytännön tietoa ostam...

  11. The development of Facebook marketing utilizing Content marketing. Case: Pirjon Pakari Oy.

    OpenAIRE

    Lehtikangas, Pauliina

    2015-01-01

    The purpose of this thesis was to learn how to improve Pirjon Pakari Oy’s brand visibility and overall visibility on Facebook. This was done by trying to add value to the end customer by producing interesting and engaging posts to Pirjon Pakari Oy’s Facebook page. This case study utilized theory from content marketing in attempts to improve the marketing of “Pirjon” Facebook page and therefore a Facebook content marketing strategy was created for Pirjon Pakari Oy. This strategy was implemente...

  12. Ympäristöjärjestelmän rakentaminen : Case: Inno Interior Oy

    OpenAIRE

    Pirinen, Liisa

    2009-01-01

    Tavoitteena oli rakentaa huonekalualalla toimivalle Inno Interior Oy:lle, joka valmistuttaa tuotteet alihankkijoilla, sertifiointikelpoinen ympäristönhallintajärjestelmä. Yrityksellä ei ollut ympäristösertifikaattia. Asiakkaat vaativat yritykseltä ympäristöasioiden hoitamisen tason osoittamista. Ympäristöhallintajärjestelmän rakentaminen ja sertifiointi oli sopivin ratkaisu ongelmaan. Ympäristöjärjestelmän rakentamisen lähtökohtana olivat toiminnan aiheuttamat ympäristö-vaikutukset ja...

  13. Digitaalinen markkinointi pk-yrityksessä inbound-markkinoinnin keinoin CASE: Customer Intelligence Finland Oy

    OpenAIRE

    Lassila, Anna-Sofia

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia kuinka digitaalista markkinointia kannattaa tehdä inbound-markkinoinnin keinoin. Tutkimuksen ensisijaisena tavoitteena oli löytää tehokkaimmat keinot inbound-markkinoinnin toteuttamiseen. Toisena tavoitteena oli antaa tuloksiin pohjautuen suosituksia digitaalisen markkinoinnin jatkotoimenpiteistä inbound-metodia hyödyntäen. Tämän opinnäytetyön toimeksiantajana toimi Customer Intelligence Finland Oy (CIFI). Tämän opinnäytetyön tutkimusmenetelmän...

  14. Toimintolaskennan soveltaminen : Case Hyvönen Yhtiöt Oy

    OpenAIRE

    Hyvönen, Krista

    2014-01-01

    Tässä opinnäytetyössä kehitetään toimeksiantajayrityksenä toimivalle Hyvönen Yhtiöt Oy:lle toimintolaskentaa hyödyntävä kustannuslaskentamalli. Tehdyn kehitystyön tavoitteena on luoda kohdeyritykselle täysin uudenlainen kustannuslaskentamalli, joka näyttää kustannukset uudesta näkökulmasta erilaisen ryhmittelyn ansiosta sekä selvittää toimintolaskennan soveltuvuutta yrityksen palvelukohtaisten kustannusten laskemiseen. Tutkimustehtävänä on selvittää, miten toimintolaskentaa voidaan soveltaa H...

  15. Sisäisen viestinnän kehittäminen osana parempia kampanjatoteutuksia : Case: Nike Finland Oy

    OpenAIRE

    Kankkunen, Eeva

    2014-01-01

    Tämä opinnäytetyö tehtiin Nike Finland Oy:lle, ja sen aiheena oli sisäisen viestinnän kehittäminen osana parempia kampanjatoteutuksia. Nike Finland Oy on maailman tunnetuimman urheilubrändin Niken Suomen organisaatio, ja tällä hetkellä se on toisena vastaavien tuotteiden valmistajana Suomen markkinoilla. Yritys tunnetaan niin Suomessa kuin maailmallakin kuuluisasta ja uniikista Niken logosta, ja sloganista ”Just do it”. Koska yritys on aina enemmän kuin pelkästään sen hyvä yritysimag...

  16. Vähittäismyymälän markkinoinnin kehittäminen : case Mattomies Oy

    OpenAIRE

    Hellstén, Maren

    2015-01-01

    Opinnäytetyön tavoitteena oli löytää toimeksiantajana toimineelle Mattomies Oy Ruohola & Ruoholalle konkreettisia keinoja yrityksen vähittäismyymälän markkinoinnin kehittämiseksi. Teoriaosassa käytiin läpi 4P-mallin mukaiset markkinoinnin kilpailukeinot. Toteutusosassa analysoitiin Mattomies Oy Ruohola & Ruoholan myymälän nykytilaa, myymälän merkitystä liiketoiminnalle sekä koottiin myymälälle markkinointimix, jossa annettiin konkreettisia ehdotuksia markkinoinnin kehittämiseksi. Ehdo...

  17. Asiakkuudenhallinnan avulla lisäarvoa asiakkaalle ja lisämyyntiä yritykselle : case Naaantalin Matkailu Oy

    OpenAIRE

    Korpiranta, Mirka

    2012-01-01

    Tässä opinnäytetyössä on selvitetty, miten Naantalin Matkailu Oy voi asiakkuudenhallinnan avulla luoda lisäarvoa asiakkaille ja tuottaa lisänmyyntiä yritykselle. Lisäksi on selvitetty, miten Winres-matkatoimistojärjestelmää voidaan hyödyntää asiakkuudenhallinnassa tavoitteiden saavuttamiseksi. Vertailukohteina käytettiin muita matkailutoimistoja, jotka muistuttavat Naantalin Matkailu Oy:tä ja Naantalia kohteena. Opinnäytetyön vertailukartoitus toteutettiin kyselynä, jonka tarkoituksena oli...

  18. Period changes of cataclysmic variables below the period gap: V2051 Oph, OY Car and Z Cha

    Science.gov (United States)

    Pilarčík, L.; Wolf, M.; Zasche, P.; Vraštil, J.

    2018-04-01

    We present our results of a long-term monitoring of cataclysmic variable stars (CVs). About 40 new eclipses were measured for the three southern SU UMa-type eclipsing CVs: V2051 Oph, OY Car and Z Cha. Based on the current O - C diagrams we confirmed earlier findings that V2051 Oph and OY Car present cyclic changes of their orbital periods lasting 25 and 29 years, respectively. In case of Z Cha we propose the light-time effect caused probably by a presence of the third component orbiting the eclipsing CV with the period of 43.5 years. The minimal mass of this companion results about 15 MJup.

  19. Työterveys- ja työturvallisuusjohtamisjärjestelmä : Case Tapojärvi Oy

    OpenAIRE

    Honkanen, Päivi

    2011-01-01

    Honkanen, Päivi. 2011. Työterveys- ja työturvallisuusjohtamisjärjestelmä. Case Tapo-järvi Oy. Opinnäytetyö. Kemi-Tornion ammattikorkeakoulu. Kaupan ja kulttuurin toimiala. Sivuja 33. Tämän opinnäytetyön tavoitteena on selvittää Tapojärvi Oy:n työterveys- ja työturvalli-suusjohtamisjärjestelmän nykytilaa ja arvioida kuinka se vastaa standardin OHSAS 18001:2007 vaatimuksia. Opinnäytetyö koostuu teoriaosuudesta ja empiirisestä tutkimuksesta. Teoriaosassa käsit-telen turvallisuusjohtamis...

  20. Instrumentation of the model in scaled 1:10 to prototype of the AquaBuOY wave energy converter

    DEFF Research Database (Denmark)

    Margheritini, Lucia; Frigaard, Peter

    The objective of this report is to provide guidelines for the instrumentation of a model in scale 1:10 to prototype of the AquaBuOY wave energy converter. The model will be located in Nissum Bredning area: this is an important waterway already used by Aalborg University for real sea tests of wave...... energy converters....

  1. Hierarchical α-MnO2 nanowires@Ni1-x Mnx Oy nanoflakes core-shell nanostructures for supercapacitors.

    Science.gov (United States)

    Wang, Hsin-Yi; Xiao, Fang-Xing; Yu, Le; Liu, Bin; Lou, Xiong Wen David

    2014-08-13

    A facile two-step solution-phase method has been developed for the preparation of hierarchical α-MnO2 nanowires@Ni1-x Mnx Oy nanoflakes core-shell nanostructures. Ultralong α-MnO2 nanowires were synthesized by a hydrothermal method in the first step. Subsequently, Ni1-x Mnx Oy nanoflakes were grown on α-MnO2 nanowires to form core-shell nanostructures using chemical bath deposition followed by thermal annealing. Both solution-phase methods can be easily scaled up for mass production. We have evaluated their application in supercapacitors. The ultralong one-dimensional (1D) α-MnO2 nanowires in hierarchical core-shell nanostructures offer a stable and efficient backbone for charge transport; while the two-dimensional (2D) Ni1-x Mnx Oy nanoflakes on α-MnO2 nanowires provide high accessible surface to ions in the electrolyte. These beneficial features enable the electrode with high capacitance and reliable stability. The capacitance of the core-shell α-MnO2 @Ni1-x Mnx Oy nanostructures (x = 0.75) is as high as 657 F g(-1) at a current density of 250 mA g(-1) , and stable charging-discharging cycling over 1000 times at a current density of 2000 mA g(-1) has been realized. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Synthesis of vanadium oxides 5 wt.%VO2–MxOy by sol–gel process ...

    Indian Academy of Sciences (India)

    Experimental results indicated that the VO2–SiO2 catalysts .... crucible, which was supported by the beam of a balance in the oven. ... Epoxidation of cyclohexene on VO2–Mx Oy (M = Si, Al, Ti). 1189 ... tially amorphous nature of silica.

  3. Inter- and intragranular properties of bismuth calcium strontium copper oxide (Bi2CaSr2Cu2Oy) superconductors

    NARCIS (Netherlands)

    Emmen, J.H.P.M.; Brabers, V.A.M.; Steen, van der C.; Dalderop, J.H.J.; Lenczowski, S.K.J.; Jonge, de W.J.M.

    1989-01-01

    The granular behaviour of sintered bulk Bi2CaSr2Cu2Oy superconductor is investigated by resistivity and ¿ac measurements. The observed temperature and magnetic field dependence is discussed within the framework of a granular model. The frequency dependence of the intragranular losses leads to a flux

  4. Characteristics of NixFe1−xOy Electrocatalyst on Hematite as Photoanode for Solar Hydrogen Production

    Directory of Open Access Journals (Sweden)

    Chih-Ping Yen

    2017-11-01

    Full Text Available The use of hematite as the photoanode for photoelectrochemical hydrogen production by solar energy has been actively studied due to its abundance, stability, and adequate optical properties. Deposition of an electrocatalyst overlayer on the hematite may increase kinetics and lower the onset potential for water splitting. NixFe1−xOy is one of the most effective electrocatalysts reported for this purpose. However, the condition and results of the previous reports vary significantly, and a comprehensive model for NixFe1−xOy/hematite is lacking. Here, we report a simple and novel chemical bath deposition method for depositing low-onset-potential NixFe1−xOy electrocatalyst on hematite. With a Ni percentage of 80% and an immersion time of 2 min, the as-prepared NixFe1−xOy overlayer raised the photovoltage from 0.2 V to 0.7 V, leading to a cathodic shift of the onset potential by 400 mV, while maintaining the same level of current density. The dependence of the electrochemical and photoelectrochemical characteristics of the photoanode on the condition of the electrocatalyst was studied systematically and explained based on energy level diagrams and kinetics.

  5. Synthesis and photoluminescence properties of CaSixOy:Tb3+ phosphors prepared using solution-combustion method

    CSIR Research Space (South Africa)

    Dejene, FB

    2011-07-01

    Full Text Available Effect of Tb3+ ion concentrations on the structural and persistence luminescence properties of CaSixOy:Tb3+ crystals were evaluated using powders grown by the solution combustion technique. The XRD study indicates the change of phase from CaSiO3...

  6. Electronic states of SiO2-MxOy (MxOy=P205, TiO2 and ZrO2) glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kowada, Y [Hyogo Univ. of Teacher Education, Hyogo (Japan); Adachi, H [Kyoto Univ. (Japan). Faculty of Engineering; Minami, T [Univ. of Osaka Prefecture, Osaka (Japan). Faculty of Engineering

    1993-12-01

    Using the sol-gel method the surface of metal and glass substrates can be modified. For example, stainless steel sheets coated with the SiO2-ZrO2 glass films have higher resistance to corrosion and oxidation. The coating films contain high concentration of alkali ions diffusing from the glass substrates. It suggests that the sodium ions are trapped strongly within the coating films and are blocked to further diffuse to the surface. This behavior must be associated with the chemical bonding around the sodium ions in the SiO2-TiO2 and SiO2-ZrO2 films. For better understanding of the chemical bonding in the glasses, the electronic states of the SiO2-MxOy glasses were calculated by means of the DV-Xa cluster method. In this paper, the calculation method is explained, the results are discussed and the conclusion is stated. 17 refs., 6 figs.

  7. A visible and infrared study of the eclipsing dwarf nova Oy Carinae

    International Nuclear Information System (INIS)

    Berriman, G.

    1984-01-01

    This paper presents three simultaneous visible (V) and infrared (J,H,K) light curves of the eclipsing dwarf nova binary system OY Carinae in quiescence. The infrared light curves show a secondary minimum, not seen in the visible, which is the ellipsoidal variations of the red dwarf and its eclipse by the accretion disc surrounding the white dwarf companion. The red star, an M dwarf, supplies between 30 and 60 per cent of the total light at J,H and K. This requires that the system is between 100 and 300 pc away. The infrared continuum of the accretion disc around the white dwarf companion comes largely from the optically thin gas giving rise to the emission lines seen in the visible and ultraviolet. (author)

  8. Markkinoinnin kehittäminen, Verkkomarkkinointi ja sosiaalinen media : JA-KI Muutto Oy

    OpenAIRE

    Kahanpää, Timo

    2015-01-01

    Tämän opinnäytetyön tavoitteena oli kehittää ja tehostaa helsinkiläisen muuttoalan yrityksen JA-KI Muutto Oy:n markkinointia verkossa ja siellä nimenomaan sosiaalisessa mediassa. Työn tavoitteena oli löytää ja tuoda esille keinoja ja kehittämisehdotuksia, joiden avulla markkinointia verkossa voitaisiin tehostaa entisestään. Opinnäytetyö tehtiin kehittämistehtävänä ja se jakautuu kahteen osaan: teoriaosaan ja kehittämisosaan. Teoriaosiossa käydään läpi eri lähteiden kautta ensin markkinoin...

  9. Array-level stability enhancement of 50 nm AlxOy ReRAM

    Science.gov (United States)

    Iwasaki, Tomoko Ogura; Ning, Sheyang; Yamazawa, Hiroki; Takeuchi, Ken

    2015-12-01

    ReRAM's low voltage and low current programmability are attractive features to solve the scaling issues of conventional floating gate Flash. However, read instability in ReRAM is a critical issue, due to random telegraph noise (RTN), sensitivity to disturb and retention. In this work, the array-level characteristics of read stability in 50 nm AlxOy ReRAM are investigated and a circuit technique to improve stability is proposed and evaluated. First, in order to quantitatively assess memory cell stability, a method of stability characterization is defined. Next, based on this methodology, a proposal to improve read stability, called ;stability check loop; is evaluated. The stability check loop is a stability verification procedure, by which, instability improvement of 7×, and read error rate improvement of 40% are obtained.

  10. Yrittäjyyden myytit ja möröt : case: Yritystakomo Oy, Oulu

    OpenAIRE

    Merentie, Elisa

    2012-01-01

    Tämän tutkimuksen tarkoituksena on selvittää mitkä yrittäjyyden myytit ja möröt vaikuttavat aloittavan yrittäjän uskallukseen aloittaa yrittäjänä. Ilmiötä tarkastelin tapausyrityksen, Yritystakomo Oy:n kautta. Ovatko vuosia kestäneet yrittäjyyden myytit, uskomukset aiheellisia ja sovellettavissa tämän päivän aloittelevan yrittäjän ajatusmaailmaan? Aihe on valittu, koska yrittäjyydestä ja sen edistämisestä puhutaan paljon, myös sen helppoudesta, mutta siitä huolimatta yrittäjyysidea jää usein...

  11. Influence of calcium on transport properties, band spectrum and superconductivity of YBa2Cu3O(y) and YBa(1.5)La(0.5)Cu3O(y)

    Science.gov (United States)

    Gasumyants, V. E.; Vladimirskaya, E. V.; Patrina, I. B.

    1995-01-01

    The comparative investigation of transport phenomena in Y(1-x)Ca(x)Ba2Cu3O(y) (0 is less than x is less than 0.25; 6.96 is greater than y is greater than 6.87 and 6.73 is less than x is less than 6.53); Y(1-x)Ca(x)Ba(1.5)La(0.5)Cu3O(y) (0 is less than x is less than 0.5; 7.12 is greater than y is greater than 6.96) and YBa(2-x)La(x)Cu3O(y) (0 is less than x is less than 0.5; 6.95 is less than y is less than 7.21) systems have been carried out. The temperature dependencies of resistivity and thermopower have been measured. It was found that the S(T) dependencies take some additional features with Ca content increase. The results obtained have been analyzed on the basis of the phenomenological theory of electron transport in the case of the narrow conductive band. The main parameters of the band spectrum (the band filling with electrons degree and the total effective band width) have been determined. The dependencies of these from contents of substituting elements are discussed. Analyzing the results obtained simultaneously with the tendencies in oxygen content and critical temperature change we have confirmed the conclusion that the oxygen sublattice disordering has a determinant effect on band structure parameters and superconductive properties of YBa2Cu3O(y). The results obtained suggest that Ca gives rise to some peculiarities in band spectrum of this compound.

  12. Electronic structure and fine structural features of the air-grown UNxOy on nitrogen-rich uranium nitride

    Science.gov (United States)

    Long, Zhong; Zeng, Rongguang; Hu, Yin; Liu, Jing; Wang, Wenyuan; Zhao, Yawen; Luo, Zhipeng; Bai, Bin; Wang, Xiaofang; Liu, Kezhao

    2018-06-01

    Oxide formation on surface of nitrogen-rich uranium nitride film/particles was investigated using X-ray photoelectron spectroscopy (XPS), auger electron spectroscopy (AES), aberration-corrected transmission electron microscopy (TEM), and high-angle annular dark-field scanning transmission electron microscopy (HAADF-STEM) coupled with electron energy-loss spectroscopy (EELS). XPS and AES studies indicated that the oxidized layer on UN2-x film is ternary compound uranium oxynitride (UNxOy) in 5-10 nm thickness. TEM/HAADF-STEM and EELS studies revealed the UNxOy crystallizes in the FCC CaF2-type structure with the lattice parameter close to the CaF2-type UN2-x matrix. The work can provide further information to the oxidation mechanism of uranium nitride.

  13. Selvitys HR House Oy:n vuokratyöntekijöiden työtyytyväisyydestä

    OpenAIRE

    Kaskela, Leeni

    2011-01-01

    Opinnäytetyön tarkoituksena oli selvittää HR House Oy:n palveluksessa olevien vuokratyöntekijöiden työtyytyväisyyteen vaikuttavia asioita. Opinnäytetyö on laadullinen tutkielma, jossa käytän tutkimusmenetelmänä teemahaastattelua. Tutkimuskysymykseni selvittävät, mitkä asiat vaikuttavat työntekijöiden työ- tyytyväisyyteen ja mitä he kertovat työtyytyväisyyteen vaikuttavista tekijöistä. Toimeksianto opinnäytetyön tekemiseen on tullut HR House Oy Henkilöstöpalveluilta. Tavoitteena oli löytää kei...

  14. Synthesized TiO{sub 2}/ZSM-5 composites used for the photocatalytic degradation of azo dye: Intermediates, reaction pathway, mechanism and bio-toxicity

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Kefu; Hu, Xin-Yan [College of the Environment and Ecology, Xiamen University, Xiamen (China); Chen, Bor-Yann; Hsueh, Chung-Chuan [Department of Chemical and Materials Engineering, National I-Lan University, I-Lan, Taiwan (China); Zhang, Qian [Department of Environmental Engineering, National Taiwan University, Taipei, Taiwan (China); Wang, Jiajie; Lin, Yu-Jung [College of the Environment and Ecology, Xiamen University, Xiamen (China); Chang, Chang-Tang, E-mail: ctchang73222@gmail.com [Department of Environmental Engineering, National I-Lan University, I-Lan, Taiwan (China)

    2016-10-15

    Highlights: • The major photo-catalytic degradation pathway of azo-dye was elaborated according to the identification of by-products from GC–MS and IC analysis. • Comparative assessment on characteristics of abiotic and biotic dye decolorization was analyzed. • EDTA (hole scavengers) and t-BuOH (radical scavengers) were used to determine the main active oxidative species in the system. • The toxicity effects of degradation intermediates of Reactive Black 5 (RB5) on the cellular respiratory activity were assessed. - Abstract: In this study, a one-step solid dispersion method was used to synthesize titanium dioxide (TiO{sub 2})/Zeolite Socony Mobil-5 (ZSM-5) composites with substantially reduced time and energy consumption. A degradation efficiency of more than 95% was achieved within 10 min using 50% PTZ (synthesized TiO{sub 2}/ZSM-5 composites with TiO{sub 2} contents of 50 wt% loaded on ZSM-5) at pH 7 and 25 °C. The possible degradation pathway of azo-dye Reactive Black 5 (RB5) was investigated using gas chromatography–mass spectrometry and ion chromatography (IC). The bonds between the N atoms and naphthalene groups are likely attacked first and cleaved by hydroxyl radicals, ultimately resulting in the decolorization and mineralization of the azo dye. A comparative assessment of the characteristics of abiotic and biotic dye decolorization was completed. In addition, the toxicity effects of the degradation intermediates of azo-dye RB5 on cellular respiratory activity were analyzed. The bio-toxicity results showed that the decay rate constants of CO{sub 2} production from the azo-dye RB5 samples at different degradation times increased initially and subsequently decreased, indicating that intermediates of higher toxicity could adhere to the catalyst surface and gradually destroyed by further photocatalytic oxidation. Additionally, EDTA (hole scavengers) and t-BuOH (radical scavengers) were used to detect the main active oxidative species in the system

  15. Isothermal Kinetics of Diesel Soot Oxidation over La0.7K0.3ZnOy Catalysts

    Directory of Open Access Journals (Sweden)

    Ram Prasad

    2014-10-01

    Full Text Available This paper describes the kinetics of catalytic oxidation of diesel soot with air under isothermal conditions (320-350 oC. Isothermal kinetics data were collected in a mini-semi-batch reactor. Experiments were performed over the best selected catalyst composition La0.7K0.3ZnOy prepared by sol-gel method. Characterization of the catalyst by XRD and FTIR confirmed that La1-xKxZnOy did not exhibit perovskite phase but formed mixed metal oxides. 110 mg of the catalyst-soot mixture in tight contact (10:1 ratio was taken in order to determine the kinetic model, activation energy and Arrhenius constant of the oxidation reaction under the high air flow rate assuming pseudo first order reaction. The activation energy and Arrhenius constant were found to be 138 kJ/mol and 6.46x1010 min-1, respectively. © 2014 BCREC UNDIP. All rights reservedReceived: 26th April 2014; Revised: 27th May 2014; Accepted: 28th June 2014How to Cite: Prasad, R., Kumar, A., Mishra, A. (2014. Isothermal Kinetics of Diesel Soot Oxidation over La0.7K0.3ZnOy Catalysts. Bulletin of Chemical Reaction Engineering & Catalysis, 9(3: 192-200. (doi: 10.9767/bcrec.9.3.6773.192-200Permalink/DOI: http://dx.doi.org/10.9767/bcrec.9.3.6773.192-200

  16. Ion-Molecule Reaction of Gas-Phase Chromium Oxyanions: CrxOyHz- + H2O

    International Nuclear Information System (INIS)

    Gianotto, Anita Kay; Hodges, Brittany DM; Benson, Michael Timothy; Harrington, Peter Boves; Appelhans, Anthony David; Olson, John Eric; Groenewold, Gary Steven

    2003-01-01

    Chromium oxyanions having the general formula CrxOyHz- play a key role in many industrial, environmental, and analytical processes, which motivated investigations of their intrinsic reactivity. Reactions with water are perhaps the most significant, and were studied by generating CrxOyHz- in the gas phase using a quadrupole ion trap secondary ion mass spectrometer. Of the ions in the Cr1OyHz envelope (y = 2, 3, 4; z = 0, 1), only CrO2- was observed to react with H2O, producing the hydrated CrO3H2- at a slow rate (∼0.07% of the ion-molecule collision constant at 310 K). CrO3-, CrO4-, and CrO4H- were unreactive. In contrast, Cr2O4-, Cr2O5-, and Cr2O5H2- displayed a considerable tendency to react with H2O. Cr2O4- underwent sequential reactions with H2O, initially producing Cr2O5H2- at a rate that was ∼7% efficient. Cr2O5H2- then reacted with a second H2O by addition to form Cr2O6H4- (1.8% efficient) and by OH abstraction to form Cr2O6H3- (0.6% efficient). The reactions of Cr2O5- were similar to those of Cr2O5H2-: Cr2O5- underwent addition to form Cr2O6H2- (3% efficient) and OH abstraction to form Cr2O6H- (<1% efficient). By comparison, Cr2O6- was unreactive with H2O, and in fact, no further H2O addition could be observed for any of the Cr2O6Hz- anions. Hartree-Fock ab initio calculations showed that reactive CrxOyHz- species underwent nucleophilic attack by the incoming H2O molecules, which produced an initially formed adduct in which the water O was bound to a Cr center. The experimental and computational studies suggested that Cr2OyHz- species that have bi- or tricoordinated Cr centers are susceptible to attack by H2O; however, when the metal becomes tetracoordinate, reactivity stops. For the Cr2OyHz- anions the lowest energy structures all contained rhombic Cr2O2 rings with pendant O atoms and/or OH groups. The initially formed [Cr2Oy- + H2O] adducts underwent H rearrangement to a gem O atom to produce stable dihydroxy structures. The calculations indicated that

  17. Ethylbenzene dehydrogenation over binary FeOx–MeOy/Mg(Al)O catalysts derived from hydrotalcites

    KAUST Repository

    Balasamy, Rabindran J.; Khurshid, Alam; Al-Ali, Ali A S; Atanda, Luqman A.; Sagata, Kunimasa; Asamoto, Makiko; Yahiro, Hidenori; Nomura, Kiyoshi; Sano, Tsuneji; Takehira, Katsuomi; Al-Khattaf, Sulaiman S.

    2010-01-01

    A series of FeOx-MeOy/Mg(Al)O catalysts were prepared from hydrotalcite-like compounds as precursors and were tested in the ethylbenzene dehydrogenation to styrene in He atmosphere at 550 °C. The hydrotalcite-like precursors of the metal compositions of Mg3Fe 0.25Me0.25Al0.5 (Me = Cu, Zn, Cr, Mn, Fe, Co and Ni) were coprecipitated from the nitrates of metal components and calcined to mixed oxides at 550 °C. After the calcination, the mixed oxides showed high surface area of 150-200 m2 gcat -1, and were mainly composed of (MgMe)(Fe3+Al)O periclase in the bulk, whereas the surface was enriched by (MgMe)(Fe3+Al)2O 4 pinel. Among the Me species tested, Co2+ was the most effective, followed by Ni2+. Co2+ addition increased the activity of original FeOx/Mg(Al)O catalyst, whereas Ni2+ increased the activity at the beginning of reaction, but deactivated the catalyst during the reaction. The other metals formed isolated MeOx species in the catalyst, resulting in a decrease in the activity compared to the original FeOx/Mg(Al)O catalyst. The active Fe species exists as metastable Fe3+ on the FeOx/Mg(Al)O catalyst. By the addition of Co2+, the reduction-oxidation between Fe3+ and Fe2+ was facilitated and, moreover, the active Fe3+ species was stabilized. It is likely that the dehydrogenation proceeds on the active Fe3+ species via its reduction-oxidation assisted by Co 2+. © 2010 Elsevier B.V.

  18. Ethylbenzene dehydrogenation over binary FeOx–MeOy/Mg(Al)O catalysts derived from hydrotalcites

    KAUST Repository

    Balasamy, Rabindran J.

    2010-12-20

    A series of FeOx-MeOy/Mg(Al)O catalysts were prepared from hydrotalcite-like compounds as precursors and were tested in the ethylbenzene dehydrogenation to styrene in He atmosphere at 550 °C. The hydrotalcite-like precursors of the metal compositions of Mg3Fe 0.25Me0.25Al0.5 (Me = Cu, Zn, Cr, Mn, Fe, Co and Ni) were coprecipitated from the nitrates of metal components and calcined to mixed oxides at 550 °C. After the calcination, the mixed oxides showed high surface area of 150-200 m2 gcat -1, and were mainly composed of (MgMe)(Fe3+Al)O periclase in the bulk, whereas the surface was enriched by (MgMe)(Fe3+Al)2O 4 pinel. Among the Me species tested, Co2+ was the most effective, followed by Ni2+. Co2+ addition increased the activity of original FeOx/Mg(Al)O catalyst, whereas Ni2+ increased the activity at the beginning of reaction, but deactivated the catalyst during the reaction. The other metals formed isolated MeOx species in the catalyst, resulting in a decrease in the activity compared to the original FeOx/Mg(Al)O catalyst. The active Fe species exists as metastable Fe3+ on the FeOx/Mg(Al)O catalyst. By the addition of Co2+, the reduction-oxidation between Fe3+ and Fe2+ was facilitated and, moreover, the active Fe3+ species was stabilized. It is likely that the dehydrogenation proceeds on the active Fe3+ species via its reduction-oxidation assisted by Co 2+. © 2010 Elsevier B.V.

  19. Manufacture of wood-pellets doubles. Biowatti Oy started a wood pellet plant in Turenki

    International Nuclear Information System (INIS)

    Rantanen, M.

    1999-01-01

    Wood pellets have many advantages compared to other fuels. It is longest processed biofuel with favorable energy content. It is simple to use, transport and store. Heating with wood pellets is cheaper than with light fuel oil, and approximately as cheap as utilization of heavy fuel oil, about 110 FIM/MWh. The taxable price of wood pellets is about 550 FIM/t. Stokers and American iron stoves are equally suitable for combustion of wood pellets. Chip fueled stokers are preferred in Finland, but they are also suitable for the combustion of wood pellets. Wood pellets is an environmentally friendly product, because it does not increase the CO 2 load in the atmosphere, and its sulfur and soot emissions are relatively small. The wood pelletizing plant of Biowatti Oy in Turenki was started in an old sugar mill. The Turenki sugar mill was chosen because the technology of the closed sugar factory was suitable for production of wood pellets nearly as such, and required only by slight modifications. A press, designed for briquetting of sugar beat clippings makes the pellets. The Turenki mill will double the volume of wood pellet manufacture in Finland during the next few years. At the start the annual wood pellet production will be 20 000 tons, but the environmental permit allows the production to be increased to 70 000 tons. At first the mill uses planing machine chips as a raw material in the production. It is the most suitable raw material, because it is already dry (moisture content 8-10%), and all it needs is milling and pelletizing. Another possible raw material is sawdust, which moisture content is higher than with planing machine chips. Most of the wood pellets produced are exported e.g. to Sweden, Denmark and Middle Europe. In Sweden there are over 10 000 single-family houses using wood pellets. Biowatti's largest customer is a power plant located in Stockholm, which combusts annually about 200 000 tons of wood pellets

  20. Pienyrityksen B2B-myyntiprosessi Venäjän markkinoilla: Case Perfect Getaway Oy

    OpenAIRE

    Prokkola, Joni

    2014-01-01

    Opinnäytetyön tavoitteena oli luoda Perfect Getaway Oy:lle B2B myyntiprosessi suoramyyntiä varten Venäjän markkinoille. Yritys on luksuselämyksiä tarjoava matkailualan yritys, jonka pääkohderyhmänä ovat suomalaiset sekä venäläiset yksityis- ja yritysasiakkaat. Tavoitteena oli selvittää miten kylmäsoittoja voitaisiin käyttää hyväksi suoramyynnissä. Toimeksiantajana toimi yrityksen toimitusjohtaja. Opinnäytetyön kirjoittaja on myös työsuhteessa kyseiseen yritykseen. Tuotoksena toimisivat kaksi ...

  1. Lasten ulkovaatteiden kevät-kesämalliston seinäesillepano-ohje : case: Reima Oy

    OpenAIRE

    Järvenoja, Annika

    2014-01-01

    Opinnäytetyö tehtiin Reima Oy:lle. Työn tavoitteena oli kerätä asiakkaiden mielipiteitä lasten ulkovaatteiden seinäesillepanoista. Tutkimuksen pohjalta tehtiin seinäesillepano-ohje kevät-kesämallistolle. Reiman omat myymälät sijaitsevat pääosin Kiinassa, Suomessa ja Venäjällä. Kevät-kesämalliston tuotteiden vaihtelevuus välikausivaatteista ohuisiin aurinkosuojavaatteisiin koettiin myymälässä haasteelliseksi. Tavoitteena on tutkia lisäksi, mistä maiden kulttuurien eroavaisuudet johtuvat, ja mi...

  2. Franchising - liiketoiminnan käynnistämiseen vaadittavat toimenpiteet ja haasteet organisaatiossa : case: Touring Cars Finland Oy

    OpenAIRE

    Aaltonen, Suvi

    2013-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää franchise-liiketoiminnan käynnistämiseen liittyviä toimenpiteitä ja haasteita organisaatiossa. Opinnäytetyön teoriaosuus selvittää niitä asioita, joita franchise-antajan ja –ottajan on huomioitava franchise-liiketoimintaa aloittaessaan. Case-yrityksenä on suomalainen Touring Cars Finland Oy. Case-yritys siirtyy käyttämään franchise-liiketoimintamallia vuosien 2013–2018 aikana yrityksen kaikissa toimipisteissä Suomessa ja ulkomailla. Touring Ca...

  3. Synthesis and Microstructure Properties of (Bi,Pb2Sr2Ca1Cu2Oy Ceramic Superconductor

    Directory of Open Access Journals (Sweden)

    nurmalita .

    2015-11-01

    Full Text Available Properties of (Bi, Pb2Sr2Ca1Cu2Oy ceramic superconductors were prepared by the melt textured growth methods in order to investigate the effects of the slow cooling time on the microstructur.  Phase analyses of the samples by X-ray diffraction (XRD has been carried out to assess the effects of the slow cooling time. From XRD analyses, the addition to the sample of  the slow cooling time degrades formation of the high-Tc Bi-2212 phase. The possible reasons for the observed degradation in the microstructure properties due to the slow cooling time addition were discussed.

  4. Superconducting transition temperature in the Y(1-x)M(x)Ba2Cu3O(y) system

    Science.gov (United States)

    Suzuki, Takeyuki; Yamazaki, Tsutomu; Sekine, Ryuuta; Koukitsu, Akinori; Seki, Hisashi

    1989-04-01

    Experimental results are presented for the inclusion of compositional additives, M, to the sintered high-temperature superconductor Y(1-x)M(x)Ba2Cu3O(y); M can be the oxides of Mg, Ce, Gd, Yb, Ti, Zr, V, Nb, Ta, Cr, Mo, W, Mn, Fe, Co, Ni, Zn, B, Al, Ga, In, Si, Ge, Sn, Pb, Sb, Bi, and Te, as well as Li, Na, K, Ca, Sr, and La carbonates. Temperature dependence of the electrical resistance was measured down to about 80 K. Attention is given to the influence of ionic radius and the valence of the M species.

  5. ABB Oy Motors and Generators -yksikön energiansyöttöjen erotus- ja lukitusohjeet

    OpenAIRE

    Chi, Henri

    2017-01-01

    Tämä insinöörityö toteutettiin Quant Finland Oy:lle, joka vastaa Helsingin Pitäjänmäen ABB Motors and Generators -tehtaan kunnossapidosta. Insinöörityön tavoitteena oli luoda energiansyöttöjen lukitus- ja erotusohjeet tehtaan koneistoille, laitteille ja järjestelmille. Tehtaalla on isoja koneita ja laitteita, jonka erotus- ja lukitustoimenpiteitä kaikki eivät osaa. Näin ollen on haluttu mahdollistaa turvallinen työskentely tarjoamalla selkeät erotus- ja lukitusohjeet. ABB Motors and Gene...

  6. HENKILÖSTÖVUOKRAUSPALVELUN SÄHKÖISEN MARKKINOINTIVIESTINNÄN KEHITTÄMINEN : Case Nordic JobCentre Oy

    OpenAIRE

    Salmela, Heli

    2016-01-01

    Vuokratyön käyttö on ollut kasvussa jo pitkään. Erityisesti rakennus- ja teollisuusaloilla vuokratyön käyttö on hyvin yleistä, vaikka edelleen toimialan maine on joiltain osin negatiivinen. Kilpailu on kuitenkin kovaa, ja erityisesti Etelä-Suomen alueella vuokratyöfirmoja on syntynyt viime vuosikymmenen aikana runsaasti. Opinnäytetyöni on sähköisen markkinointiviestinnän kehitystehtävä, jonka toimeksiantajana on oululaislähtöinen henkilöstövuokrausyritys Nordic JobCentre Oy. Kehitystehtäv...

  7. Structural and superconducting properties of YBa2Cu3-xMxOy (M=Ag, Al

    Directory of Open Access Journals (Sweden)

    S Falahati

    2009-08-01

    Full Text Available   Samples of YBa2Cu3-xAgxOy with x=0, 0.1, 0.15, 0.2, 0.3 and samples of YBa2Cu3-xAlxOy with x=0, 0.01, 0.02, 0.03 and 0.045 are prepared by the sol-gel method. Structural and superconducting properties of samples are studied by electrical resistivity (R-T, X-ray diffraction (XRD and scanning electron microscopy (SEM. All the samples show transition to superconducting state and the transition temperatures of the samples increased with increasing Ag doping up to x=0.15. R-T measurements show a small decrease of TC (zero with increasing Al doping up to x=0.02, and followed by a faster decrease with increasing doping concentration. YBCO grains are better linked with increasing Ag doping. So, Ag has positive effects in superconducting properties of YBCO. The crystal structure of samples was refined by MAUD. These results show tha, Ag is substituted for Cu(1 in YBCO. According to these analysis, we introduce x=0.15 as the optimum value for doping concentration .

  8. Effects of Ni-5%RExOy Composite Additives on Electrochemical Hydrogen Storage Performances of Mg2Ni

    Directory of Open Access Journals (Sweden)

    ZHANG Guo-fang

    2017-11-01

    Full Text Available The Ni-5%RExOy (CeO2, La2O3, Eu2O3 as composite additives, Mg2Ni-Ni-5%RExOy composites were prepared by the ball milling method. The effects of different additives on the structure, morphology, electrochemistry and kinetic properties of Mg2Ni alloy were studied systematically. The results show that composite additives can improve the proportion of amorphous and nanocrystalline structure of Mg2Ni alloy. The particle size is homogeneous but the agglomeration is observed in the sample with Ni-5%CeO2 additives. The composites with additives show higher maximum discharge capacity and better cycle stabilities. All of these three kinds of composite additives can improve the kinetic properties of the composites effectively, including optimizing the charge-transfer ability, the reversibility of the electrochemical reaction on the alloy surface, and enhancing the diffusion coefficients of H atoms in the bulk of alloy. Among these three kinds of additives, Ni-5%CeO2 additive shows the best catalysis effect on promoting the kinetic properties of the composites.

  9. Enhanced thermoelectric properties of nano SiC dispersed Bi2Sr2Co2Oy Ceramics

    Science.gov (United States)

    Hu, Qiujun; Wang, Kunlun; Zhang, Yingjiu; Li, Xinjian; Song, Hongzhang

    2018-04-01

    The thermoelectric properties of Bi2Sr2Co2Oy + x wt% nano SiC (x = 0.00, 0.025, 0.05, 0.1, 0.2, and 0.3) prepared by the solid-state reaction method were investigated from 300 K to 923 K. The resistivity can be reduced effectively by adding a small amount of SiC nano particles, which is attributed to the increase of the carrier concentration. At the same time, the Seebeck coefficients can be improved effectively due to the energy filtering effect that low energy carriers are strongly dispersed at the interface between the SiC nano particles and the matrix. The decrease of thermal conductivity is due to the increase of the scattering ability of the phonons by the SiC nanoparticles distributed at the boundary of the matrix. As a result, the Bi2Sr2Co2Oy + x wt% SiC composites exhibit better thermoelectric properties. The maximum ZT value 0.24 is obtained when x = 0.05 at 923 K. Compared with the sample without SiC nano particles, the ZT value is increased by about 59.7%.

  10. Slow positrons in single-crystal samples of Al and Al-AlxOy

    Science.gov (United States)

    Lynn, K. G.; Lutz, H.

    1980-11-01

    Well-characterized Al(111) and Al(100) samples were studied with monoenergetic positrons before and after exposure to oxygen. Both positronium-formation and positron-emission curves were obtained for various incident positron energies at sample temperatures ranging from 160-900 K. The orthopositronium decay signal provides a unique signature that the positron has emerged from the surface region of a clean metal. In the clean Al crystals part of the positronium formed near the surface is found to be associated with a temperature-activated process described as the thermally activated detrapping of a positron from a surface state. A simple positron diffusion model, including surface and vacancy trapping, is fitted to the positronium data and an estimate of the binding energy of the positron in this trap is made. The positron diffusion constant is found to have a negative temperature dependence before the onset of positron trapping at thermally generated monovacancies (>500 K), in reasonable agreement with theoretical predictions. The depth of the positron surface state is reduced or positronium is formed in the chemisorbed layer as oxygen is adsorbed on both Al sample surfaces, thus increasing the positronium fraction and decreasing the positron emission. At higher oxygen exposures [>500 L (1 L = 10-6 torr sec)] positron or positronium traps are generated in the overlayer and the positronium fraction is reduced. The amorphous-to-crystalline surface transition of AlxOy on Al is observed between 650 and 800 K by the change in the positronium fraction and is interpreted as the removal of trapping centers in the metal-oxide overlayer. At the higher temperatures and incident energies vacancy trapping is observed by the decrease in the positron diffusion length in both the clean and the underlying Al of the oxygen-exposed samples. Similar vacancy formation enthalpies for Al are extracted in both the clean and oxygen-covered samples by a simple model and are in good

  11. Energiantuotannon ratkaisut Penttilän Puu Oy:n höyläämön sivuvirrasta

    OpenAIRE

    Kortelainen, Toni

    2017-01-01

    Tässä teknistaloudellisessa opinnäytetyössä selvitettiin Penttilän Puu Oy:n Joensuun höyläämölle taloudellisesti kannattavin energiantuotantoratkaisu. Käyttöikänsä päähän tulleen nykyisen ruuvisyötteisen arinakattilan tilalle on harkittu pienen kokoluokan sähkön ja lämmön yhteistuotantoa (pien-CHP), mikäli sellainen osoittautuu kannattavaksi. Muussa tapauksessa arinakattila vaihdetaan uuteen biokattilaan lähivuosina. Opinnäytetyön teknisessä osiossa esitellään korvaavat lämmitysvaih...

  12. Spin-Glass Transition and Giant Paramagnetism in Heavily Hole-Doped Bi2Sr2Co2Oy

    Science.gov (United States)

    Hsu, Hung Chang; Lee, Wei-Li; Lin, Jiunn-Yuan; Young, Ben-Li; Kung, Hsiang-Hsi; Huang, Jian; Chou, Fang Cheng

    2014-02-01

    Hole-doped single crystals of misfit-layered cobaltate Bi2-xPbxSr2-zCo2Oy (x = 0-0.61, y = 8.28-8.62, and z = 0.01-0.22) have been successfully grown using the optical floating-zone method. Heavier hole doping has been achieved through both Pb substitution in the Bi site and the more effective Sr vacancy formation. The Co4+ : Co3+ ratio can be raised significantly from its original ˜1 : 1 to 4.5 : 1, as confirmed by iodometric titration. A spin-glass transition temperature of Tg ˜ 70 K is confirmed by ac susceptibility measurement when the Co4+ : Co3+ ratio becomes higher than 2 : 1, presumably owing to the significantly increased probability of triangular geometrical frustration among antiferromagnetically coupled localized Co4+ spins.

  13. Quasiparticle Scattering off Defects and Possible Bound States in Charge-Ordered YBa_{2}Cu_{3}O_{y}.

    Science.gov (United States)

    Zhou, R; Hirata, M; Wu, T; Vinograd, I; Mayaffre, H; Krämer, S; Horvatić, M; Berthier, C; Reyes, A P; Kuhns, P L; Liang, R; Hardy, W N; Bonn, D A; Julien, M-H

    2017-01-06

    We report the NMR observation of a skewed distribution of ^{17}O Knight shifts when a magnetic field quenches superconductivity and induces long-range charge-density-wave (CDW) order in YBa_{2}Cu_{3}O_{y}. This distribution is explained by an inhomogeneous pattern of the local density of states N(E_{F}) arising from quasiparticle scattering off, yet unidentified, defects in the CDW state. We argue that the effect is most likely related to the formation of quasiparticle bound states, as is known to occur, under specific circumstances, in some metals and superconductors (but not in the CDW state, in general, except for very few cases in 1D materials). These observations should provide insight into the microscopic nature of the CDW, especially regarding the reconstructed band structure and the sensitivity to disorder.

  14. Effects of Dăoyĭn Qìgōng in postpolio syndrome patients with cold intolerance

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Ramos

    2012-09-01

    Full Text Available Postpolio syndrome (PPS is characterized by progressive muscle weakness due to former infection with poliomyelitis and can be associated with other symptoms such as cold intolerance (CI. Dăoyĭn Qìgōng (DQ is a technique in Traditional Chinese Medicine that impacts the circulation of energy and blood. OBJECTIVE: It was to verify the effects of DQ in PPS patients complaining of cold intolerance. METHODS: Ten PPS patients were assessed using the visual analogue scale (VAS adapted for CI before and after intervention with DQ; patients practiced it in a sitting position for 40 minutes, 3 times per week over 3 consecutive months. Patients were reassessed three months after ceasing DQ. RESULTS: There was a statistically significant difference in local and systemic VAS-Cold both at the end of DQ training and three months past the end of this. CONCLUSION: The DQ technique ameliorated CI complaints in patients with PPS.

  15. CRM-tietojärjestelmän käyttöopas osana yrityksen asiakkuudenhallintaa : case: Fysioline Oy

    OpenAIRE

    Ilonen, Mikko

    2012-01-01

    Tämän opinnäytetyön aiheena on CRM-tietojärjestelmän käyttöopas osana yrityksen asiakkuudenhallintaa. Opinnäytetyön teoriaosuus käsittelee asiakkuudenhallintaa, CRM-tietojärjestelmiä ja CRM:n käyttöönottoa. Työn empiriaosuus muodostuu CRM-tietojärjestelmän käyttöoppaasta. CRM-tietojärjestelmän käyttöopas tehdään kohdeyritys Fysioline Oy:lle. Opinnäytetyön teoriaosuudessa selvitetään vastausta tutkimusongelmaan, miksi yrityksen tulee kiinnittää huomiota asiakkuudenhallintaan ja mitä hyötyä...

  16. Reinforced fluropolymer nanocomposites with high-temperature superconducting Bi2Sr2CaCu2Oy

    Science.gov (United States)

    Jayasree, T. K.

    2014-10-01

    Bismuth Strontium Calcium Copper Oxide (Bi2Sr2CaCu2Oy)/Polyvinylidene fluoride (PVDF) nanocomposite was prepared and their thermal properties were analyzed. The composite consists of the polyvinylidene fluoride (PVDF) as an insulating polymer matrix, and homogenously distributed Bismuth strontium calcium copperoxide (2212) nanoparticles. SEM data shows flaky grains of the superconductor coated and linked by polymer. Differential scanning calorimetry (DSC) results indicated that the melting point was not affected significantly by the addition of BSCCO. However, the addition of superconducting ceramic resulted in an extra melting peak at a lower temperature (145°C). Thermogravimetric analysis of the samples shows that the onset decomposition temperature of the PVDF matrix was decreased by the addition of SC filler.

  17. Matkustussäännön toteuttaminen ja kehittäminen - Case Norilsk Nickel Harjavalta Oy

    OpenAIRE

    Sihvonen, Aino

    2015-01-01

    Tämä opinnäytetyö tehtiin toimeksiantona Norilsk Nickel Harjavalta Oy:lle. Opinnäytetyön tarkoituksena oli tutkia toimeksiantajan matkustussäännön vahvuuksia ja puutteita. Tutkimustehtävänä oli selvittää, miten yhtiön henkilöstö kokee nykyisen matkustussäännön sekä mistä johtuu, että matkustusasioissa ilmenee erilaisia käytänteitä. Tutkimuksen tavoitteena oli luoda kehitysehdotuksia yhtiön matkustussääntöön. Matkustussäännön kehittämisellä pyritään kustannustehokkuuden ja ympäristönäkökulmien...

  18. ISO 14001 -standardin mukaisen ympäristöjärjestelmän luominen : case: Plastep Oy

    OpenAIRE

    Harju, Siiri

    2016-01-01

    Opinnäytetyön tavoitteena oli luoda kattavan ympäristökartoituksen sisältävä ISO 14001 -standardin mukainen ympäristöjärjestelmä Plastep Oy:lle. Lisäksi tarkoituksena oli suunnitella yrityksen ympäristönsuojelun tilaa mahdollisimman luotettavasti kuvaava ympäristömittari sekä tarkastella muovin ruiskuvaluyritykseen kohdistuvia tulevaisuuden näkymiä ympäristönsuojelun näkökulmasta. Opinnäytetyössä esitellään ISO 14001 -ympäristöjärjestelmä sekä kyseisen standardin sisältä...

  19. Mixed pinning landscape in nanoparticle-introduced YGdBa2Cu3Oy films grown by metal organic deposition

    Science.gov (United States)

    Miura, M.; Maiorov, B.; Baily, S. A.; Haberkorn, N.; Willis, J. O.; Marken, K.; Izumi, T.; Shiohara, Y.; Civale, L.

    2011-05-01

    We study the field (H) and temperature (T) dependence of the critical current density (Jc) and irreversibility field (Hirr) at different field orientations in Y0.77Gd0.23Ba2Cu3Oy with randomly distributed BaZrO3 nanoparticles (YGdBCO+BZO) and YBa2Cu3Oy (YBCO) films. Both MOD films have large RE2Cu2O5 (225) nanoparticles (˜80 nm in diameter) and a high density of twin boundaries (TB). In addition, YGdBCO+BZO films have a high density of BZO nanoparticles (˜25 nm in diameter). At high temperatures (T > 40 K), the superconducting properties, such as Jc, Hirr, and flux creep rates, are greatly affected by the BZO nanoparticles, while at low temperatures the superconducting properties of both the YBCO and YGdBCO+BZO films show similar field and temperature dependencies. In particular, while the Jc of YBCO films follow a power-law dependence (∝H-α) at all measured T, this dependence is only followed at low T for YGdBCO+BZO films. As a function of T, the YGdBCO+BZO film shows Jc(T,0.01T)~[1-(T/Tc)2]n with n ˜ 1.24 ± 0.05, which points to “δTc pinning.” We analyze the role of different types of defects in the different temperature regimes and find that the strong pinning of the BZO nanoparticles yields a higher Hirr and improved Jc along the c axis and at intermediate orientations at high T. The mixed pinning landscapes due to the presence of disorder of various dimensionalities have an important role in the improvement of in-field properties.

  20. The benefits of Outsourcing facility services when selecting right service provider for a hotel:Case Kämp Group Oy

    OpenAIRE

    Paudyal, Manoj; Acharya, Saroj

    2015-01-01

    This research paper examines about the outsourcing of facility services in the Kämp group of hotels. The scope of the study includes Facility Management, outsourcing facilities services, and the selection process of the service providers for a hotel. The research was carried at the hotels of Kämp group Oy in the Metropolitan Area of Helsinki. Facility management includes wide ranges of non-core functions such as Property management, real estates, design and technology. Activities such as secu...

  1. Massaräätälöityjen tuotteiden prosessin hallinta ja konfigurointi : Selvitystyö yritykselle Kera Group Oy

    OpenAIRE

    Saares, Sanna

    2017-01-01

    Opinnäytetyön aiheena oli selvittää, mikä ohjelmistokokonaisuus soveltuisi parhaiten terassituotteiden suunnittelun ja myynnin tueksi. Opinnäytetyö tehtiin Orimattilassa sijaitsevalle muovi- ja lasituotteisiin erikoistuneelle Kera Group Oy:lle. Tuotealueena olivat lasitetut valmisterassit, joita toimitetaan pientalojen yhteyteen. Vaikka valmiita terassityyppejä on rajattu määrä, joudutaan suurin osa tuotteista suunnittelemaan ja valmistamaan yksilöllisesti. Uuden tuotteen suunnittelu on ...

  2. Bilateral comparison between PTB and ENEA to check the performance of a commercial TDCR system for activity measurements

    International Nuclear Information System (INIS)

    Kossert, Karsten; Capogni, Marco; Nähle, Ole J.

    2014-01-01

    The only commercial TDCR counter from Hidex Oy (Finland), comprising three photomultiplier tubes, was tested at the two National Metrology Institutes (NMIs) PTB and ENEA. To this end, the two NMIs purchased a Hidex 300 SL TDCR counter (METRO version) each and carried out various tests at their laboratories. In addition, the two institutions agreed to organize a bilateral comparison in order to acquire information on the reproducibility of the results obtained with the counters. To achieve this, PTB prepared some 89 Sr liquid scintillation samples, which were first measured in various counters at PTB and then shipped to ENEA for comparative measurements. The aim of this paper is to summarize the findings on the counter characteristics and adjustments. In addition, the results of the bilateral comparison between PTB and ENEA are presented and the results from various commercial counters using the CIEMAT/NIST efficiency tracing and the TDCR method are discussed. - Highlights: • The TDCR counter from Hidex Oy was tested at PTB and ENEA. • The studies comprised linearity checks and investigation of adjustments. • A bilateral 89 Sr comparison was organized to compare two Hidex counters

  3. Decorative black TiCxOy film fabricated by DC magnetron sputtering without importing oxygen reactive gas

    Science.gov (United States)

    Ono, Katsushi; Wakabayashi, Masao; Tsukakoshi, Yukio; Abe, Yoshiyuki

    2016-02-01

    Decorative black TiCxOy films were fabricated by dc (direct current) magnetron sputtering without importing the oxygen reactive gas into the sputtering chamber. Using a ceramic target of titanium oxycarbide (TiC1.59O0.31), the oxygen content in the films could be easily controlled by adjustment of total sputtering gas pressure without remarkable change of the carbon content. The films deposited at 2.0 and 4.0 Pa, those are higher pressure when compared with that in conventional magnetron sputtering, showed an attractive black color. In particular, the film at 4.0 Pa had the composition of TiC1.03O1.10, exhibited the L* of 41.5, a* of 0.2 and b* of 0.6 in CIELAB color space. These values were smaller than those in the TiC0.29O1.38 films (L* of 45.8, a* of 1.2 and b* of 1.2) fabricated by conventional reactive sputtering method from the same target under the conditions of gas pressure of 0.3 Pa and optimized oxygen reactive gas concentration of 2.5 vol.% in sputtering gas. Analysis of XRD and XPS revealed that the black film deposited at 4.0 Pa was the amorphous film composed of TiC, TiO and C. The adhesion property and the heat resisting property were enough for decorative uses. This sputtering process has an industrial advantage that the decorative black coating with color uniformity in large area can be easily obtained by plain operation because of unnecessary of the oxygen reactive gas importing which is difficult to be controlled uniformly in the sputtering chamber.

  4. Electrochemically Obtained TiO2/CuxOy Nanotube Arrays Presenting a Photocatalytic Response in Processes of Pollutants Degradation and Bacteria Inactivation in Aqueous Phase

    Directory of Open Access Journals (Sweden)

    Magda Kozak

    2018-06-01

    Full Text Available TiO2/CuxOy nanotube (NT arrays were synthesized using the anodization method in the presence of ethylene glycol and different parameters applied. The presence, morphology, and chemical character of the obtained structures was characterized using a variety of methods—SEM (scanning electron microscopy, XPS (X-ray photoelectron spectroscopy, XRD (X-ray crystallography, PL (photoluminescence, and EDX (energy-dispersive X-ray spectroscopy. A p-n mixed oxide heterojunction of Ti-Cu was created with a proved response to the visible light range and the stable form that were in contact with Ti. TiO2/CuxOy NTs presented the appearance of both Cu2O (mainly and CuO components influencing the dimensions of the NTs (1.1–1.3 µm. Additionally, changes in voltage have been proven to affect the NTs’ length, which reached a value of 3.5 µm for Ti90Cu10_50V. Degradation of phenol in the aqueous phase was observed in 16% of Ti85Cu15_30V after 1 h of visible light irradiation (λ > 420 nm. Scavenger tests for phenol degradation process in presence of NT samples exposed the responsibility of superoxide radicals for degradation of organic compounds in Vis light region. Inactivation of bacteria strains Escherichia coli (E. coli, Bacillus subtilis (B. subtilis, and Clostridium sp. in presence of obtained TiO2/CuxOy NT photocatalysts, and Vis light has been studied showing a great improvement in inactivation efficiency with a response rate of 97% inactivation for E. coli and 98% for Clostridium sp. in 60 min. Evidently, TEM (transmission electron microscopy images confirmed the bacteria cells’ damage.

  5. Maa-analyysi liiketoiminnallisesta näkökulmasta tukemassa kansainvälistymisstrategiaa : Case: SuperApp Oy, Yhdysvallat

    OpenAIRE

    Laiho, Tea

    2016-01-01

    Tämä opinnäytetyö toteutettiin toimeksiantona lahtelaisen KIBS-palveluja eli osaamisintensiivisiä liike-elämän palveluja tarjoavan SuperApp Oy:n käyttöön. Tutkimuksen tavoitteena oli kartoittaa kohdemaan potentiaali kansainvälisen liiketoiminnan ja palveluyrityksen näkökulmasta. Tarkoituksena oli antaa case-yritykselle työkaluja ja avaimia, sen laajentaessa liiketoimintaansa tulevaisuudessa ulkomaille, erityisesti Yhdysvaltoihin. Tämä tutkimus käsittelee osaa kansainvälistymisstrategiaa varte...

  6. CRM-järjestelmän suunnittelu ja käyttöönotto myynnin strategiseksi työkaluksi : case: Stala Oy

    OpenAIRE

    Pirkkalainen, Markus

    2013-01-01

    Tämän opinnäytetyön aiheena on asiakkuudenhallinta- eli Customer Relationship Management(CRM)-järjestelmän suunnittelu ja käyttöönotto myynnin strategiseksi työkaluksi. Opinnäytetyön teoriaosuudessa tutkitaan asiakkuudenhallintaa, CRM-järjestelmiä ja CRM-järjestelmien suunnitteluun sekä käyttöönottoon liittyviä haasteita. Työn empiirinen osuus koostuu CRM-järjestelmän käyttöoppaasta kohdeyritys Stala Oy:n myyntitiimille. Tutkimusongelma vastaa kysymykseen, miksi yrityksen tulisi panostaa a...

  7. LASER APPLICATIONS AND OTHER TOPICS IN QUANTUM ELECTRONICS: Synthesis of bulk SiO2 : MxOy materials in a steady-state laser plume

    Science.gov (United States)

    Lebedev, V. F.

    1997-01-01

    An analysis was made of the conditions of existence of a two-component steady-state laser plume in atmospheric air. Such a plume is used in single-stage synthesis of bulk molten materials belonging to the SiO2 : MxOy system. Targets of the SiO2 : M type (metal foil and a silica glass rod) and doping elements with boiling points below and above the boiling point of silica glass are discussed. The regimes and efficiency of steady-state transfer of the dopants are considered. The efficiency of transfer of metal oxides during growth of samples with the aid of a cw CO2 laser is reported to be ~0.05, 0.4, and 0.75g min-1 kW-1 when the mass dopant concentration is ~8%, 20%, and 60% for the oxides of Ti, Cu, and Ni, respectively.

  8. Structure and Electrical Properties of NdBa2Cu3Oy Thin Films by Laser Ablation at Low Oxygen Partial Pressure

    DEFF Research Database (Denmark)

    Mozhaev, Peter B.; Mozhaeva, Julia; Khoryushin, Alexey

    2017-01-01

    in the film can be suppressed by an increase of the deposition temperature or by a decrease of the oxygen partial pressure during deposition. The presence of Nd/Ba disorder during deposition stimulates the introduction of oxygen into the growing film. A simple model is proposed for estimation of oxygen......A deposition process for NdBa2Cu3Oy thin films by laser ablation at decreased deposition temperature was developed using substitution of oxygen with argon in the chamber during deposition. A low deposition rate is the crucial factor to obtain high-quality NBCO films. The Nd/Ba cation disorder...... contents in the film using structural parameters measured with XRD techniques. Studies of the post-deposition annealing process showed ordering of the Nd/Ba sub-lattice and intense oxygen in- and out-diffusion. The temperature of the post-deposition annealing step should be chosen low enough (∼400 °C...

  9. Verkkokauppa osaksi B2B-yrityksen sähköistä liike-toimintaa : case: Capcons Technology Oy

    OpenAIRE

    Kaitarinne, Tomi; Hannula, Tuomo

    2010-01-01

    Tämän opinnäytetyön tarkoituksena on kuvata monipuolisesti B2B-verkkokaupan perustamisprosessi nykyaikaisin menetelmin ja uusimpien vaatimusten mukaisesti. Opinnäytetyön case-yrityksenä toimii Capcons Technology Oy, jonka verkko-kaupan perustamisprosessissa on tarkoitus soveltaa työssä käsiteltyjä asioita. Tavoitteena on, että yritys pystyy hyödyntämään opinnäytetyötä kattavasti verkko-kaupan perustamisen eri vaiheissa. Lisäksi tätä työtä voidaan hyödyntää myös muita B2B-verkkokauppoja perust...

  10. Käyttäjäystävällisen SharePoint 2013 -ohjeen laatiminen : Case VisualWeb Group Oy

    OpenAIRE

    Pynttäri, Henna

    2014-01-01

    Tässä toimintakeskeisessä opinnäytetyössä suunniteltiin ja toteutettiin VisualWeb Group Oy :n asiakkaille käyttäjäystävällinen ohje SharePoint 2013 -alustan käyttöön. Manuaali on suunnattu peruskäyttäjille, ja se sisältää ohjeet sellaisista toiminnoista, joita käyttäjä tarvitsee aloittaessaan SharePoint-alustan päälle rakennetun sivustonsa päivittämisen. Päätavoitteena oli laatia käyttöohjeesta mahdollisimman selkeä ja yksinkertainen, koska se on suunnattu käyttäjäryhmälle, jolla on vähän tai...

  11. Anisotropy of the Seebeck Coefficient in the Cuprate Superconductor YBa_{2}Cu_{3}O_{y}: Fermi-Surface Reconstruction by Bidirectional Charge Order

    Directory of Open Access Journals (Sweden)

    O. Cyr-Choinière

    2017-09-01

    Full Text Available The Seebeck coefficient S of the cuprate YBa_{2}Cu_{3}O_{y} is measured in magnetic fields large enough to suppress superconductivity, at hole dopings p=0.11 and p=0.12, for heat currents along the a and b directions of the orthorhombic crystal structure. For both directions, S/T decreases and becomes negative at low temperature, a signature that the Fermi surface undergoes a reconstruction due to broken translational symmetry. Above a clear threshold field, a strong new feature appears in S_{b}, for conduction along the b axis only. We attribute this feature to the onset of 3D-coherent unidirectional charge-density-wave modulations seen by x-ray diffraction, also along the b axis only. Because these modulations have a sharp onset temperature well below the temperature where S/T starts to drop towards negative values, we infer that they are not the cause of Fermi-surface reconstruction. Instead, the reconstruction must be caused by the quasi-2D bidirectional modulations that develop at significantly higher temperature. The unidirectional order only confers an additional anisotropy to the already reconstructed Fermi surface, also manifest as an in-plane anisotropy of the resistivity.

  12. Cadmium free high efficiency Cu2ZnSn(S,Se4 solar cell with Zn1−xSnxOy buffer layer

    Directory of Open Access Journals (Sweden)

    Md. Asaduzzaman

    2017-06-01

    Full Text Available We have investigated the simulation approach of a one-dimensional online simulator named A Device Emulation Program and Tool (ADEPT2.1 and the device performances of a thin film solar cell based on Cu2ZnSn(S,Se4 (CZTSSe absorber have been measured. Initiating with a thin film photovoltaic device structure consisting of n-ZnO:Al/i-ZnO/Zn1-xSnxOy (ZTO/CZTSSe/Mo/SLG stack, a graded space charge region (SCR and an inverted surface layer (ISL were inserted between the buffer and the absorber. The cadmium (Cd free ZTO buffer, a competitive substitute to the CdS buffer, significantly contributes to improve the open-circuit voltage, Voc without deteriorating the short-circuit current density, Jsc. The optimized solar cell performance parameters including Voc, Jsc, fill factor (FF, and efficiency (η were calculated from the current density-voltage curve, also known as J–V characteristic curve. The FF was determined as 73.17%, which in turns, yields a higher energy conversion efficiency of 14.09%.

  13. Review of the GPS deformation monitoring studies commissioned by Posiva Oy on the Olkiluoto, Kivetty and Romuvaara sites, 1994-2000

    International Nuclear Information System (INIS)

    Vermeer, M.

    2002-05-01

    This report reviews the work done by scientists from the Finnish Geodetic Institute at the three sites Olkiluoto, Kivetty and Romuvaara over the years 1994-2000, with a view to detecting and measuring possible local crustal movements by means of geodetic GPS. The work, which consisted of measurements, computations and analysis, was reported in seven technical reports of Posiva Oy. Reviewed was also the work related to the three permanent stations established in these three sites, which have operated as part of the twelve-station national FinnRef network. The conclusion was that on the whole, the work has been performed professionally using state of the art equipment, measurement and analysis techniques by competent and experienced personnel. A number of suggestions for improvement and future work are given, mainly concerning the way the modelling of atmospheric propagation effects was done and how that affects the scale of the network computation, a proposal for monitoring the absolute scale, as well as remarks concerning the regular re-measurement of reserve marker ties, and the importance of continuing monitoring for a full solar activity cycle. The importance of interdisciplinarity is stressed. This review report is an outcome of the Bedrock Movements Investigations Group which supports STUKs regulatory activities related to confirming site investigations at Olkiluoto. (orig.)

  14. A COMPARISON OF McC OY LARYNGOSCOPE AND MCGRATH VIDEO LARYNGOSCOPES FOR TRACHEAL INTUBATION IN PATIENTS WITH IMMOBILIZED CERVICAL SPINE

    Directory of Open Access Journals (Sweden)

    Annapurna Sarma

    2015-08-01

    Full Text Available INTRODUCTION : Expert airway management is the most essential requirement of an anesthesiologist . Difficult and failed intubation is the leading causes of anesthetic related morbidity and mortality. AIM OF STUDY: The purpose of this study was to compare the effectiveness of McCoy laryngoscope and McGrath video laryngoscope in tracheal intubation in patients using Manual in - line stabilization (MILS for cervical spine injury. MATERIALS AND METHODS : This study was condu cted in King George Hospital , Visakhapatnam, Andhra Pradesh on 60 patients aged 20 – 70, of American Society of Anesthesiologists physical status I – III, posted for elective surgery for cervical spine injury under general anesthesia. The patients were assigne d to two groups. One group was named as MC where McCoy laryngoscope was used, other group named as MG, where McGrath video laryngoscope was used for laryngoscopy during tracheal intubation . Two groups were compared on the basis of demogr aphic data, airway examination, comparison of visualization of vocal cords with McC oy laryngoscope and video laryngoscope and comparison of laryngoscope time. RESULTS: There was no significant difference between male and female sex. Most of the patients falls into Mallampati score I (60%, followed by score II and III (25 and 14% respectively. Statistically highly significant improvement in laryngoscope view was noted with video laryngoscope than with McCoy laryngoscope with Chi - square value=49.52; DF= 10; p - value=0.000(highl y significant. Statistically highly significant difference was seen in effective laryngoscopy time of McCoy and Video laryngoscope. CONCLUSION: We conclude McGrath video laryngoscope is superior to McCoy laryngoscope in terms of providing better intubatin g conditions in patients requiring MILS, though there is a little prolongation of effective laryngoscope time .

  15. Applied strain dependence of critical current and internal lattice strain for BaHfO_3-doped GdBa_2Cu_3O_y coated conductors

    International Nuclear Information System (INIS)

    Usami, Takashi; Yoshida, Yutaka; Ichino, Yusuke; Sugano, Michinaka; Machiya, Shutaro; Ibi, Akira; Izumi, Teruo

    2016-01-01

    The strain effect of REBa_2Cu_3O_y (REBCO: RE = Y, Gd, Sm)-coated conductors (CCs) on critical current (I_c) is one of the most fundamental factors for superconducting coil applications. In this study, we aim to clarify the effect of artificial pinning center shapes on the strain effect in BHO-doped GdBCO CCs. To achieve this, we fabricated a Pure-GdBCO CC, a BHO nanorod-doped GdBCO CC and a multilayered-GdBCO (ML-GdBCO) CC, and carried out bending tests. As the result, the strain dependence of I_c for each CC showed an upward convex and the peak strain of the BHO-doped GdBCO CC shifts towards the compressive strain independent of the BHO shapes. In addition, the strain sensitivity of I_c in the GdBCO CCs including BHO becomes smaller. To clarify the difference between the strain sensitivity of I_c and the peak strain among the CCs, we evaluated the residual strain and the slopes of the internal lattice strains against the applied tensile strain (β). From this measurement, the residual strains for the Pure-GdBCO CC and the ML-GdBCO CC were almost the same. In addition, there was no change in the β value between the Pure-GdBCO and ML-GdBCO CCs. These results suggest that the changes in peak strain and strain sensitivity were not related to the internal lattice strain. (author)

  16. Automotive shredder residue (ASR) and compact disc (CD) waste: options for recovery of materials and energy. Final report for study funded by Ekokem Oy Ab 2002

    Energy Technology Data Exchange (ETDEWEB)

    Zevenhoven, R.; Saeed, L.

    2002-07-01

    . Some implications of these are limitations on what types of waste may be landfilled or incinerated (for example, car tyres may not be landfilled any longer within EU member states, and especially on how ASR may be treated. Still, in Europe ASR is mostly disposed of on landfills, despite the high concentration of organic species that will take part in chemical and biological degradation processes; apparently ASR is to some extent biodegradable. At some places, ASR is incinerated or coincinerated with other wastes or fuel, which within the EU may be restricted by the Incineration of Waste Directive when considering ASR composition or requirements to flue gas emissions control. The aim of this study is to give an overview of what problem the ASR presents to modern society and what the options are for processing this waste into recovered products or materials, or energy, with a minimum of useless by-products for which landfilling is the only route. Not addressed in this work are waste car tyres or scrapped car tyres, sometimes referred to as tyre derived fuel (TDF), since for this waste stream several options for material, chemical, or energy recovery have been developed which also find use in Finland. Examples are co-firing in cement clinker production and road construction work. Important here are the role of the Finnish tyre recycling organisation Rengaskierraetys Oy and the use of waste tyres as alternative fuel at the cement plant of Finnsementti Oy at Parainen. 1.2 Compact disc (CD) waste Compact disc waste, especially those related to computer software are often disposed of with other waste electrical and electronic equipment (WEEE) fractions, if they don't end up in the wastes from households or offices. The structure and composition of CDs and DVDs is such that when these end up on landfills or in waste incinerators not much harm will be done. Nonetheless, looking at the sheer number of CDs and DVDs that are produced should trigger considerations on their end

  17. GLOBAALI PALKKAHALLINTO : CASE: Yritys Oy

    OpenAIRE

    Salo, Paula

    2017-01-01

    Kehittämistyössä tutkittiin globaalia palkkahallintoa, sen käsitettä, vaatimuksia ja globaalin palkkahallinnon käyttöönottoa kansainvälisesti toimivassa yrityksessä. Tavoitteena oli löytää keinoja, joilla kohdeyritys pääsee tavoitteisiinsa palkkahallinnon toteuttamisessa. Kehittämistyö tehtiin kevään 2016 ja kevään 2017 välisenä aikana haastatellen ja havainnoiden käynnissä olevaa palkkahallinnon projektia. Kehittämistyön teoreettisessa osuudessa käydään läpi ulkoistamisen syyt lyhyesti ...

  18. Marketing Plan for Urheiluareena Oy

    OpenAIRE

    Venables, Simon

    2013-01-01

    The role of marketing is an essential part of any enterprise. Marketing is the key element that seeks to meet customer’s demand for a good or service to the supply of the good or service. Without Marketing a customer would not know of the product that would satisfy their need or demand for a product. It is this connection of meeting the desires of the customers with the capabilities and competences of the business that is the very core of the strategic marketing process. These two key factors...

  19. Osatuloutusmenettelyn arviointia : case Konepaja Oy

    OpenAIRE

    Kaarnavaara, Anu

    2011-01-01

    Kirjanpidon perussääntöjä on suoriteperusteisuus: suoritteen vaihtaessa omistajaa suoritteen luovuttajalle vaihdanta tietää tuloa ja vastaanottajalle menoa. Osatuloutus on poikkeus tähän sääntöön. Siinä pääperiaatteena on suoritteen valmistumisasteeseen perustuva jaksottaminen, kun pitkän valmistusajan vaativan suoritteen tulo kirjataan tuotoksi. Tämän opinnäytetyön toimeksiantajana on laivateollisuudessa toimiva varsinaissuomalainen yritys, josta käytetään työssä nimeä Konepaja. Yri...

  20. Tek Millet, Tek Ses? Türk Konseyi Ülkelerinin Birleşmiş Milletler Genel Kurulu Oy Yakınlaşması, 1993-2011

    OpenAIRE

    Kaplan, Muhittin; Yuvacı, Abdullah; Amanov, Shatlyk

    2015-01-01

    Bu makale, CCTS veya Türk Konseyi olarak bilinen Türk Dili Konuşan Ülkeler İşbirliği Konseyi üyelerinin (Azerbaycan, Kazakistan, Kırgızistan ve Türkiye) Birleşmiş Milletler Genel Kurulundaki (UNGA) oylamalarda ne ölçüde uyumlu hareket ettiklerini incelemektedir. 1993 – 2011 dönemi Türk Konseyi ülkelerinin Birleşmiş Milletler Genel Kurulu oy yakınlaşması- nın analiz edildiği ve bunun tüm BM üyelerinin ortalamasıyla kıyaslandığı bu makalede, Türk Konseyi ülkelerinin dış politika meseleleriyle i...

  1. Part II: Oxidative Thermal Aging of Pd/Al2O3 and Pd/CexOy-ZrO2 in Automotive Three Way Catalysts: The Effects of Fuel Shutoff and Attempted Fuel Rich Regeneration

    Directory of Open Access Journals (Sweden)

    Qinghe Zheng

    2015-10-01

    Full Text Available The Pd component in the automotive three way catalyst (TWC experiences deactivation during fuel shutoff, a process employed by automobile companies for enhancing fuel economy when the vehicle is coasting downhill. The process exposes the TWC to a severe oxidative aging environment with the flow of hot (800 °C–1050 °C air. Simulated fuel shutoff aging at 1050 °C leads to Pd metal sintering, the main cause of irreversible deactivation of 3% Pd/Al2O3 and 3% Pd/CexOy-ZrO2 (CZO as model catalysts. The effect on the Rh component was presented in our companion paper Part I. Moderate support sintering and Pd-CexOy interactions were also experienced upon aging, but had a minimal effect on the catalyst activity losses. Cooling in air, following aging, was not able to reverse the metallic Pd sintering by re-dispersing to PdO. Unlike the aged Rh-TWCs (Part I, reduction via in situ steam reforming (SR of exhaust HCs was not effective in reversing the deactivation of aged Pd/Al2O3, but did show a slight recovery of the Pd activity when CZO was the carrier. The Pd+/Pd0 and Ce3+/Ce4+ couples in Pd/CZO are reported to promote the catalytic SR by improving the redox efficiency during the regeneration, while no such promoting effect was observed for Pd/Al2O3. A suggestion is made for improving the catalyst performance.

  2. Structure and charge transfer correlated with oxygen content for a Y0.8Ca0.2Ba2Cu3Oy (y = 6.84 6.32) system: a positron study

    Science.gov (United States)

    Cao, Shixun; Li, Lingwei; Liu, Fen; Li, Wenfeng; Chi, Changyun; Jing, Chao; Zhang, Jincang

    2005-05-01

    The structure and charge transfer correlated with oxygen content are studied by measuring the positron lifetime parameters of the Y0.8Ca0.2Ba2Cu3Oy system with a large range of oxygen content (y = 6.84-6.32). The local electron density ne is evaluated from the positron lifetime data. The positron lifetime parameters show a clear change around y = 6.50 where the compounds undergo the orthorhombic-tetragonal phase transition. The effect of ne and oxygen content on the structure, charge transfer and superconductivity are discussed. With the decrease of oxygen content y, O(4) tends to the Cu(1) site, causing carrier localization, and accordingly, the decrease of ne. This would prove that the localized carriers (electrons and holes) in the Cu-O chain region have great influence on the superconductivity by affecting the charge transfer between the reservoir layers and the conducting layers. The positron annihilation mechanism and its relation with superconductivity are also discussed.

  3. Part I: A Comparative Thermal Aging Study on the Regenerability of Rh/Al2O3 and Rh/CexOy-ZrO2 as Model Catalysts for Automotive Three Way Catalysts

    Directory of Open Access Journals (Sweden)

    Qinghe Zheng

    2015-10-01

    Full Text Available The rhodium (Rh component in automotive three way catalysts (TWC experiences severe thermal deactivation during fuel shutoff, an engine mode (e.g., at downhill coasting used for enhancing fuel economy. In a subsequent switch to a slightly fuel rich condition, in situ catalyst regeneration is accomplished by reduction with H2 generated through steam reforming catalyzed by Rh0 sites. The present work reports the effects of the two processes on the activity and properties of 0.5% Rh/Al2O3 and 0.5% Rh/CexOy-ZrO2 (CZO as model catalysts for Rh-TWC. A very brief introduction of three way catalysts and system considerations is also given. During simulated fuel shutoff, catalyst deactivation is accelerated with increasing aging temperature from 800 °C to 1050 °C. Rh on a CZO support experiences less deactivation and faster regeneration than Rh on Al2O3. Catalyst characterization techniques including BET surface area, CO chemisorption, TPR, and XPS measurements were applied to examine the roles of metal-support interactions in each catalyst system. For Rh/Al2O3, strong metal-support interactions with the formation of stable rhodium aluminate (Rh(AlO2y complex dominates in fuel shutoff, leading to more difficult catalyst regeneration. For Rh/CZO, Rh sites were partially oxidized to Rh2O3 and were relatively easy to be reduced to active Rh0 during regeneration.

  4. Standardization and estimation of gross alpha and beta activities for potable water samples in presence of TDS using TDCR based LSA (Hidex 300SL)

    International Nuclear Information System (INIS)

    Gupta, Anil; Lenka, P.; Sahoo, S.K.; Patra, A.C.; Jha, S.K.; Tripathi, R.M.

    2018-01-01

    Quality of water is important in environmental studies because of its daily use for human consumption and an important route of intake for various elements and radionuclides. Therefore radiological quality of drinking water must be ensured. The screening parameter to evaluate the radiological safety of potable water is by estimating gross alpha and gross beta activities with a limit of 0.5 Bq/l and 1 Bq/l respectively. These have been traditionally being done by radiochemical co-precipitation of alpha and beta emitters followed by counting by ZnS(Ag) counter for alpha and gas flow proportional counter for beta. Gross alpha estimation in water samples with high TDS by ZnS(Ag) is difficult and often leads to underestimation of result due to self-absorption of alpha within the residue. This study was carried out to standardize a method to provide rapid results by simultaneously estimating both gross alpha and gross beta activity in the presence of TDS with adequate sensitivity, minimum sample processing

  5. Digital Interior Design by Stailia Design Oy

    OpenAIRE

    Lindroos, Jaana

    2017-01-01

    The objective of the thesis work is to research and create a web based service in a field of interior design. With my project, I am hoping to find out whether this kind of web service in the field of interior design can work in general and that the process together with the actual order form on internet is smooth from both customer and company point of view. The company has interior design related services but none entirely executed on the web. The target is to create a totally new service/pr...

  6. Marketing plan and campaign for Riosol Oy

    OpenAIRE

    Toivonen, Kim

    2016-01-01

    The aim of this thesis was to create an efficient marketing plan and a working marketing campaign for the case company. The aspects of the marketing plan and campaign were adjusted to fit the company size, field of business and aims of the case company. To get a better view on the aspects of the marketing plan and campaign, theoretical frameworks are inspected, such as marketing mix, company stages and SWOT-analysis. This thesis consists of theoretical framework as well as practical implem...

  7. 3Oy SUPERCONDUCTOR IN BIPOLARON MODEL

    African Journals Online (AJOL)

    D. Mani Kongnine, A. Hamrita and K. Napo

    1 sept. 2016 ... ION supraconducteurs, le cuivre et l'oxygène jouent un rôle prépondéran supraconductivité. Pour le composé supraconducteur YBa2Cu3O (Y re sont à distinguer : le cuivre Cu(1) qui forme avec les atomes d'ox t le cuivre Cu(2) qui forme avec l'oxygène les plans CuO2 [1, 2]. la supraconductivité dans les ...

  8. Experiences of CFD simulations at Foster Wheeler Energia Oy`s Karhula R and D center

    Energy Technology Data Exchange (ETDEWEB)

    Hyppaenen, T. [Foster Wheeler Energia Oy, Karhula (Finland). Karhula R and D Center

    1996-12-31

    Karhula R and D Center is specialized in the research of solid fuel combustion based on circulating fluidized bed technology. Since the 1970`s, numerical models have been utilized in process development to enhance fundamental understanding of the technology. Both own and commercial computer models have been used. Until now, a special problem in circulating fluidized beds has been the modeling of dense phase multiphase flow, especially for industrial solid-fuel boilers. This has prevented the Karhula R and D Center from using commercial codes, and as a consequence, own modeling approaches have been necessary. This presentation describes some main points of the modeling activities in circulating fluidized bed boilers. (author)

  9. Universal Music Finland OY ruumid = Interiors of Universal Music Finland OY

    Index Scriptorium Estoniae

    2011-01-01

    Helsingis Merimiehenkatu 36D asuvate kontoriruumide sisekujundusest. Sisearhitekt Jan Skolimowski (KAMP Arhitektid OÜ), loetletud tema tehtud töid. Laudadele ja klaasseintele kantud graafika kaasautorid: Martin ja Marje Eelma (Tuumik Stuudio OÜ)

  10. Experiences of CFD simulations at Foster Wheeler Energia Oy`s Karhula R and D center

    Energy Technology Data Exchange (ETDEWEB)

    Hyppaenen, T [Foster Wheeler Energia Oy, Karhula (Finland). Karhula R and D Center

    1997-12-31

    Karhula R and D Center is specialized in the research of solid fuel combustion based on circulating fluidized bed technology. Since the 1970`s, numerical models have been utilized in process development to enhance fundamental understanding of the technology. Both own and commercial computer models have been used. Until now, a special problem in circulating fluidized beds has been the modeling of dense phase multiphase flow, especially for industrial solid-fuel boilers. This has prevented the Karhula R and D Center from using commercial codes, and as a consequence, own modeling approaches have been necessary. This presentation describes some main points of the modeling activities in circulating fluidized bed boilers. (author)

  11. Biotoxicity of TiO2 Nanoparticles on Raphidocelis subcapitata Microalgae Exemplified by Membrane Deformation

    Directory of Open Access Journals (Sweden)

    Merve Ozkaleli

    2018-02-01

    Full Text Available TiO2 nanoparticles (NPs, which are mainly used in consumer products (mostly cosmetics, have been found to cause ecotoxic effects in the aquatic environment. The green algae Raphidocelis subcapitata, as a representative of primary producers of the freshwater ecosystem, has been frequently used to study the effects of metal oxide NPs. An ecotoxicity study was conducted herein to investigate the effects of TiO2 NPs on survival and membrane deformation of algal cells. Five different concentrations of nano-TiO2 particles (1, 10, 50, 100 and 500 mg/L were prepared in synthetic surface water samples with five different water quality characteristics (pH 6.4–8.4, hardness 10–320 mg CaCO3/L, ionic strength 0.2–8 mM, and alkalinity 10–245 mg CaCO3/L. Results showed a significant increase in the hydrodynamic diameter of NPs with respect to both NP concentrations and ionic content of the test system. A soft synthetic freshwater system at pH 7.3 ± 0.2 appeared to provide the most effective water type, with more than 95% algal mortality observed at 50, 100 and 500 mg/L NP concentrations. At high exposure concentrations, increased malondialdehyde formations were observed. Moreover, due to membrane deformation, TEM images correlated the uptake of the NPs.

  12. Biotoxicity of TiO2 Nanoparticles on Raphidocelis subcapitata Microalgae Exemplified by Membrane Deformation

    Science.gov (United States)

    Ozkaleli, Merve; Erdem, Ayca

    2018-01-01

    TiO2 nanoparticles (NPs), which are mainly used in consumer products (mostly cosmetics), have been found to cause ecotoxic effects in the aquatic environment. The green algae Raphidocelis subcapitata, as a representative of primary producers of the freshwater ecosystem, has been frequently used to study the effects of metal oxide NPs. An ecotoxicity study was conducted herein to investigate the effects of TiO2 NPs on survival and membrane deformation of algal cells. Five different concentrations of nano-TiO2 particles (1, 10, 50, 100 and 500 mg/L) were prepared in synthetic surface water samples with five different water quality characteristics (pH 6.4–8.4, hardness 10–320 mg CaCO3/L, ionic strength 0.2–8 mM, and alkalinity 10–245 mg CaCO3/L). Results showed a significant increase in the hydrodynamic diameter of NPs with respect to both NP concentrations and ionic content of the test system. A soft synthetic freshwater system at pH 7.3 ± 0.2 appeared to provide the most effective water type, with more than 95% algal mortality observed at 50, 100 and 500 mg/L NP concentrations. At high exposure concentrations, increased malondialdehyde formations were observed. Moreover, due to membrane deformation, TEM images correlated the uptake of the NPs. PMID:29495534

  13. Strategic Planning of an International Trade Intermediary : Case Woodbe Oy

    OpenAIRE

    Matyushevskiy, Artem

    2016-01-01

    The intermediary company is a very important actor of supply chain because it facilitates trade between manufacturers and customers who cannot connect with each other because of physical, cultural or other obstacles. The facilitation of such kind gets even more important on international arena where cross-border obstacles can be tough. The current thesis is dedicated to strategic planning of a newly established intermediary business dealing with timber products being sold from Russia to Fi...

  14. Markkinoinnin strateginen suunnittelu : case: YogaROCKS Oy

    OpenAIRE

    Hiltunen, Antti

    2012-01-01

    Opinnäytetyön aiheena on strateginen markkinointisuunnitelma kaksi vuotta toimineelle liikunta-alan pienyritykselle. Työssä käsitellään markkinointisuunnitelman suurimmat osa-alueet yleisellä tasolla, mutta painopiste on uusilla markkinointitoimenpiteillä. Opinnäytetyön tutkimusongelmana on, miten luodaan tehokas markkinointisuunnitelma kaksi vuotta toimineelle yritykselle ja mitä se pitää sisällään. Työn tavoitteena on antaa yritykselle työkalut tehokkaan markkinointisuunnitelman toteutt...

  15. Vuorovaikutteisuus Valio Oy:n Facebook-sivuilla

    OpenAIRE

    Heikkinen, Sanna

    2014-01-01

    Tässä tutkimustyyppisessä ja laadullisessa opinnäytetyössä tutkitaan Valion Facebook-sivujen vuorovaikutteisuutta. Työ on rajattu käsittelemään ainoastaan yritysten Facebook-sivuilla tapahtuvaa kuluttajille suunnattua viestintää. Tavoitteena oli tutkia Valion Facebook-sivujen vuorovaikutteisuuden tilaa ja tarjota Valiolle keinoja ja vinkkejä, joiden avulle se voi parantaa vuorovaikutteisuutta Facebook-sivuillaan. Tavoitteena oli myös työn aiheen asiantuntijaksi kasvaminen. Työssä käydään ...

  16. Kehitysehdotusten tuottaminen palvelupolun parantamiseksi - Case Expert ASA Oy

    OpenAIRE

    Berg, Esa

    2011-01-01

    Kodintekniikka-alan kiristyvä kilpailutilanne ja maailmantalouden epävakaat ajat vaativat alalla toimivilta yrityksiltä keinoja löytää kilpailuetuja verrattuna muihin alan toimijoihin. Tämä tilanne johtaa siihen, että yritysten tulee entistä enemmän kiinnittää aitoa kiinnostusta asiakkaiden tarpeisiin ja toiveisiin, jotta yritys voisi palvella heitä paremmin. Tämän opinnäytetyön tavoitteena on ollut asiakkaan palvelupolun kehittämiseen tähtäävien kehitysideoiden tuottaminen Service ...

  17. Tehokkuutta liiketoimintaan asiakkuudenhallinnalla : case IdHAIR Finland Oy

    OpenAIRE

    Pesonen, Jaana

    2014-01-01

    Yksilöllisestä asiakaspalvelusta ja asiakkuuksien kehittämisestä on tullut nykypäivänä tärkeää yrityksille. Asiakkuuksia vaalimalla yritys pystyy kehittämään omaa arvoaan ja luomaan vahvempaa asemaa markkinoilla. Yrityksen on kannattavampaa pitää kiinni nykyisistä asiakkaistaan, kuin keskittyä uusien asiakkaiden hankkimiseen. Opinnäytteen tavoitteena oli selvittää miten case-yrityksessä voitaisiin hyödyntää asiakkuusjohtamista palveluprosessien tehostamisessa ja ka...

  18. Kohti palveluliiketoimintaa, palvelumuotoilulla palvelua teollisuusyritykselle. : Tapaus KiiltoClean Oy

    OpenAIRE

    Turpeinen, Pekka

    2017-01-01

    Suuret muutokset maailmassa vaikuttavat suomalaiseen yrityselämään. Näitä muutoksia ovat muun muassa globalisaatio ja teknologioiden nopea kehittyminen. Muutokseen vaikuttavat digitalisaation tuomat mahdollisuudet liiketoiminnalle, kuten asioiden internet, Internet of Things (IoT) ja keinoälyn kehitys. Yrityksen kilpailuetuihin tulisi löytää uusia keinoja. Kehitys on antanut yrityksille mahdollisuuden luoda asiakkailleen entistä vaivattomammin palveluita. Useimmat asiakkaat eivät hae enää tuo...

  19. Online Content Marketing Strategy : Case: Mediatalo Toimelias Oy

    OpenAIRE

    Popova, Ekaterina

    2014-01-01

    The purpose of the study was to get a deeper knowledge of content marketing concepts, its techniques, benefits, challenges and trends, and to create an online content marketing strategy and give clear guidelines to the case company on how to lead customers through the buying cycle. The data for this study were gathered from the various sources, particularly articles and books. The information concerned core concepts of content marketing, consumer behaviour, Internet channels, customer att...

  20. Oyster Larval Survival Counts from Probiotic OY15 Experiments

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Environmentally-friendly methods for controlling microbial pathogenesis in aquaculture with probiotic bacteria are becoming increasingly preferred over use of...

  1. Cisco Meraki -palvelun tuottaminen Businessforum Oy:n palvelutarjoamaan

    OpenAIRE

    Liski, Juhani

    2016-01-01

    Tässä työssä perehdyttiin pilvihallittuihin Meraki-kytkimiin ja tukiasemiin, näiden verkkohal-lintaan sekä näillä laitteilla langattoman verkon palvelun toteuttamiseen. Yleisesti tutustuttiin myös palveluihin, pilviteknologiaan ja langattomiin verkkoihin. Työn teoriaosuus avasi palvelua, tämän tuotteistamista, pilvipalveluja ja niiden mahdollisia hyötyjä yrityksille, Meraki-yrityksen historiaa ja heidän tuotteidensa pilvipohjaisuutta. Teoria-osuuden lopuksi avattiin langattomien verkkojen...

  2. CalCOFI Larvae Counts, Scientific Names OY to PI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  3. Liiketoimintasuunnitelma aloittavalle yritykselle : Tilitoimisto TiliEnna Oy

    OpenAIRE

    Rinne, Enna

    2015-01-01

    Opinnäytetyön tavoitteena oli luoda toimiva liiketoimintasuunnitelma perustettavalle tilitoimistolle. Tavoitteena oli luoda liiketoimintasuunnitelma, joka on toteutettavissa ja jonka avulla aloittava yrittäjä voi kiinnittää huomiota kaikkiin yrityksen perustamisen kannalta olennaisiin seikkoihin. Yrityksen perustaminen ei ole riskitöntä, eikä sitä kannata tehdä hetken mielijohteesta. Huolellisilla esivalmisteluilla ja riskit tiedostamalla, voi uuden yrityksen perustaminen parhaimmillaan tarjo...

  4. Tilitoimiston asiakkaiden hallinta Ovil Oy:ssä

    OpenAIRE

    Salo, Tiia

    2016-01-01

    Tämän toimintatutkimuksen tarkoitus oli kehittää asiakkuuksien hallintaa ja tutkia asiakkaiden arvoa sekä asiakkaiden säilyttämistä yrityksen muutostilanteessa. Asiakkuudella on kahdenlaista arvoa; faktuaalista ja evaluatiivista. Faktuaaliset arvot ovat nimensä mukaisesti faktoja ja siksi helposti määriteltäviä, esimerkiksi tuottoa tai liikevaihtoa. Evaluatiiviset arvot ovat nimensä mukaisesti arvioita ja siksi vaikeammin määriteltäviä. Evaluatiivisia arvoja ovat muun muassa tunnearvo ja...

  5. Developing of milled peat production control in Turveruukki Oy

    Energy Technology Data Exchange (ETDEWEB)

    Ljokkoi, R

    1985-01-01

    Control research on the production of milled peat has as its primary aim the ability to control the peat drying process under different weather and field conditions. Actual development work connected with production control was begun in 1982 with the clear aim of developing and applying in practice a monitoring adn control system complete with measuring equipment which would permit the drying process to be measured indirectly and weather forecasts to be used systematically in the planning of production at each individual peat site. During the 1984 production season development work reached the stage of experimental use. Experiences gained from trial use have been mainly positive and trial use of the manual system can be considered the first step in the application o the system. As regards the measuring technique, it is justified to say that an adequate technical level has already been attained and the correlation of the indirect measuring method with peat drying can be further improved by adjusting the location height of the evaporation meter. On the other hand, calculation of the length of the harvesting cycle requires further research, which from the point of view of practice must be orientated towards control of field conditions and changes in them during the production season. Although the application of the production control system is informative in nature, it is clearly of assistance when deciding how to carry out production. By means of this system iy id possible to achieve financial benefit in the form of lowered production costs and a larger harvest per hectare.

  6. Developing a Business Model for Lappeenrannan Teatterikiinteistö Oy

    OpenAIRE

    Korhonen, Kati

    2015-01-01

    This thesis develops a business model for a real estate company and a subsidiary of the City of Lappeenranta. The case company is relatively new and has not yet started its business operations. Lappeenranta city theatre will be situated in this real estate and the theatre location is unique in Finland and worldwide. The research problem was defined in the following way: What are the available business model options for a real estate company starting its business. Which of the available option...

  7. Telecommunication industry in Thailand as potential market for Abloy Oy

    OpenAIRE

    Hoffrén, Jenna

    2015-01-01

    The commission company made a decision to proceed with a market research about telecommunication industry in Thailand as a potential market. The telecommunication industry is fast growing and demanding market around the world. In several Asian countries, such as in Malaysia and Singapore, government has regulated that data protection on private and public data must be secured by telecommunication providers. There are many reasons which can cost major issues and damage for connections and for ...

  8. Chemical reactivities of the superconducting oxides, YBa2Cu3Oy and BiSrCaCu2Oy

    International Nuclear Information System (INIS)

    Toyama, Hisashi; Mizuno, Noritaka; Misono, Makoto

    1989-01-01

    The chemical reactivities of YBa 2 Cu 3 O y and BiSrCaCu 2 O y with various gases have been studied. It was found that large quantities of NO, CO, and NO 2 were rapidly absorbed (or intercalated) in the bulk of YBa 2 Cu 3 O y (T c : 90 K) at 573 K. The amount absorbed was in the order NO ∼ CO ∼ NO 2 > O 2 ∼ CO 2 > N 2 O ∼ 0. The amount for NO was more than two times the amount of YBa 2 Cu 3 O y in molar ratio and elongation by about 0.2 angstrom along c-axis was observed. NO absorbed was almost completely recovered as NO by the evacuation at 773 K. This absorption-desorption cycle proceeded reversively. The electronic resistivity at 573 K of YBa 2 Cu 3 O y increased upon the NO absorption and was restored by the evacuation at 773 K. CO was also absorbed rapidly accompanied by evolution of CO 2 . BiSrCaCu 2 O y did not absorb either NO or CO

  9. Photocatalytic degradation of tetracycline by Ti-MCM-41 prepared at room temperature and biotoxicity of degradation products

    Science.gov (United States)

    Zhou, Kefu; Xie, Xiao-Dan; Chang, Chang-Tang

    2017-09-01

    Ti-doped MCM-41 with different Si/Ti molar ratios was prepared at room temperature to degrade tetracycline antibiotics in aqueous solution. The Ti was doped into the skeleton structure of MCM-41. The photocatalytic activity of Ti-doped MCM-41 was investigated. The optimal catalyst had Si/Ti molar ratio of 25 and over 99% removal of oxytetracycline in 150 min, and the removal could maintain 98% after 5 reuses. Ions and soluble organic matters in natural water affected the degradation reaction when Ti-doped MCM-41 was used to treat simulated wastewater of chicken farms. The degradation products of oxytetracycline, tetracycline and chlortetracycline were detected by Escherichia coli DH5α and HPLC-MS/MS. No intermediate product with higher toxicity was detected.

  10. Solidification of Bi2Sr2Ca1Cu2Oy and Bi2Sr1.75Ca0.25CuOy

    International Nuclear Information System (INIS)

    Holesinger, T.G.; Miller, D.J.; Viswanathan, H.K.; Chumbley, L.S.

    1993-01-01

    The solidification processes for the compositions Bi 2 Sr 2 CaCu 2 O y (2212) and Bi 2 Sr 1.75 Ca 0.25 CuO y (2201) were determined as a function of oxygen partial pressure. During solidification in argon, the superconducting phases were generally not observed to form for either composition. In both cases, the solidus is lowered to approximately 750 degree C. Solidification of Bi 2 Sr 1.75 Ca 0.25 CuO y in Ar resulted in a divorced eutectic structure of Bi 2 Sr 2-x Ca x O y (22x) and Cu 2 O while solidification of Bi 2 Sr 2 CaCu 2 O y in Ar resulted in a divorced eutectic structure of Bi 2 Sr 3-x Ca x O y (23x) and Cu 2 O. Solidification of Bi 2 Sr 1.75 Ca 0.25 CuO y in O 2 resulted in large grains of 2201 interspersed with small regions containing the eutectic structure of 22x and CuO/Cu 2 O. Solidification of Bi 2 Sr 2 CaCu 2 O y in partial pressures of 1%, 20%, and 100% oxygen resulted in multiphase samples consisting of 2212, 2201, some alkaline-earth cuprates, and both divorced eutectic structures found during solidification in Ar. For both compositions, these latter structures can be attributed to oxygen deficiencies present in the melt regardless of the overpressure of oxygen. These eutectic structures are unstable and convert into the superconducting phases during subsequent anneals in oxygen. The formation process of the 2212 phase during solidification from the melt was determined to proceed through an intermediate state involving the 2201 phase

  11. Reductive mineralization of cellulose with vanadium, iron and tungsten chlorides and access to MxOy metal oxides and MxOy/C metal oxide/carbon composites.

    Science.gov (United States)

    Henry, Aurélien; Hesemann, Peter; Alauzun, Johan G; Boury, Bruno

    2017-10-15

    M x O y and M x O y /C composites (M=V, Fe and W) were obtained by mineralization of cellulose with several metal chlorides. Cellulose was used both as a templating agent and as an oxygen and a carbon source. Soluble chloride molecules (VOCl 3 and WCl 6 ) and a poorly soluble ionic chloride compound (FeCl 3 ) were chosen as metal oxide precursors. In a first time, primary metal oxide/cellulose composites were obtained via a thermal treatment by reacting urea impregnated filter paper with the corresponding metal chlorides in an autoclave at 150°C after 3days. After either pyrolysis or calcination steps of these intermediate materials, interesting metal oxides with various morphologies were obtained (V 2 O 5, V 2 O 3 , Fe 3 O 4 , WO 3, H 0.23 WO 3 ), composites (V 2 O 3 /C) as well as carbides (hexagonal W 2 C and WC, Fe 3 C) This result highlight the reductive role that can play cellulose during the pyrolysis step that allows to tune the composition of M x O y /C composites. The materials were characterized by FTIR, Raman, TGA, XRD and SEM. This study highlights that cellulose can be used for a convenient preparation of a variety of highly demanded M x O y and M x O y /C composites with original shapes and morphologies. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Relationship between vortex pinning properties and microstructure in Ba–Nb–O-doped YBa2Cu3Oy and ErBa2Cu3Oy films

    International Nuclear Information System (INIS)

    Haruta, Masakazu; Saura, Keisuke; Fujita, Natsuto; Ogura, Yuta; Ichinose, Ataru; Maeda, Toshihiko; Horii, Shigeru

    2013-01-01

    Highlights: •Y123 and Er123 films with Ba–Nb–O nanorods were prepared by PLD. •Nanorod morphology depended on growth temperature (T s ). •Nanorod morphology was different between the Y123 and Er123 with the same T s . •Distribution of local J c depended on nanorod morphology. -- Abstract: In-field J c s were improved by introducing Ba–Nb–O (BNO)-nanorods in YBa 2 Cu 3 O y (Y123) and ErBa 2 Cu 3 O y (Er123) films. Retention of J c against the magnetic field for the BNO-doped Er123 film was superior to that for the BNO-doped Y123 film. Sharp distribution of local critical current density originating from vortex pinning by nanorods with uniform morphology was demonstrated in the Er123 film. On the other hand, fluctuating microstructures of nanorods formed in the Y123 film prepared by the same deposition conditions. Moreover, different growth temperature dependences of nanorod morphology between the Y123 and Er123 films were clarified

  13. Uranium and radium activities in samples of aquifers of the main cities of the Estado de Chihuahua

    International Nuclear Information System (INIS)

    Villalba, L.; Colmenero S, L.; Montero C, M.E.

    2003-01-01

    The natural uranium is in four valence states +3, +4, +5 and +6 being the hexavalent state the more soluble, which plays an important role in the transport of the uranium in the environment. The high concentrations of uranium in water not only in near waters to uranium mines, but also are in some mineral waters or in waters that are extracted of deep wells as it happens in the State of Chihuahua, where the underground waters are the fundamental source of consumption. The radium is a disintegration product of the uranium, the radio content in water is considered the second source of natural radioactivity. The distribution of radium in water is in function of the uranium content present in the aquifer. It was determined the uranium and radium content in samples of underground water of the main cities of the State of Chihuahua according to their number of inhabitants. The extraction methods for uranium and sulfates precipitation of Ba-Ra by means of the addition of barium carriers for the radium were used. The measures of the activities of uranium and radium were carried out by means of a portable liquid scintillation detector trade mark Thiathler-OY HIDEX. The obtained results have demonstrated that the content of uranium and radium in dissolution are in most of the sampling wells above the permissible maximum levels that manage the Mexican regulations. The high contents of uranium and radio can be attributed since to the influence of the geologic substrate characteristic of the zone in the State of Chihuahua they exist but of 50 uranium deposits. (Author)

  14. Uranium and radium activities in samples of aquifers of the main cities of the Estado de Chihuahua; Actividades de uranio y radio en muestras de agua subterranea de las principales ciudades del Estado de Chihuahua

    Energy Technology Data Exchange (ETDEWEB)

    Villalba, L.; Colmenero S, L.; Montero C, M.E. [CIMAV, Av. Miguel de Cervantes Saavedra 120, 31109 Chihuahua (Mexico)]. e-mail: lourdes.villalba@cimav.edu.mx

    2003-07-01

    The natural uranium is in four valence states +3, +4, +5 and +6 being the hexavalent state the more soluble, which plays an important role in the transport of the uranium in the environment. The high concentrations of uranium in water not only in near waters to uranium mines, but also are in some mineral waters or in waters that are extracted of deep wells as it happens in the State of Chihuahua, where the underground waters are the fundamental source of consumption. The radium is a disintegration product of the uranium, the radio content in water is considered the second source of natural radioactivity. The distribution of radium in water is in function of the uranium content present in the aquifer. It was determined the uranium and radium content in samples of underground water of the main cities of the State of Chihuahua according to their number of inhabitants. The extraction methods for uranium and sulfates precipitation of Ba-Ra by means of the addition of barium carriers for the radium were used. The measures of the activities of uranium and radium were carried out by means of a portable liquid scintillation detector trade mark Thiathler-OY HIDEX. The obtained results have demonstrated that the content of uranium and radium in dissolution are in most of the sampling wells above the permissible maximum levels that manage the Mexican regulations. The high contents of uranium and radio can be attributed since to the influence of the geologic substrate characteristic of the zone in the State of Chihuahua they exist but of 50 uranium deposits. (Author)

  15. Biotoxicity of Mars soils: 2. Survival of Bacillus subtilis and Enterococcus faecalis in aqueous extracts derived from six Mars analog soils

    Science.gov (United States)

    Schuerger, Andrew C.; Ming, Doug W.; Golden, D. C.

    2017-07-01

    The search for an extant microbiota on Mars depends on exploring sites that contain transient or permanent liquid water near the surface. Examples of possible sites for liquid water may be active recurring slope lineae (RSL) and fluid inclusions in ice or salt deposits. The presence of saline fluids on Mars will act to depress the freezing points of liquid water to as low as ‒60 °C, potentially permitting the metabolism and growth of halophilic microorganisms to temperatures significantly below the freezing point of pure water at 0 °C. In order to predict the potential risks of forward contamination by Earth microorganisms to subsurface sites on Mars with liquid brines, experiments were designed to characterize the short-term survival of two bacteria in aqueous soil solutions from six analog soils. The term ''soil'' is used here to denote any loose, unconsolidated matrix with no implications for the presence or absence of organics or biology. The analog soils were previously described (Schuerger et al., 2012, Planetary Space Sci., 72, 91-101), and represented crushed Basalt (benign control), Salt, Acid, Alkaline, Aeolian, and Phoenix analogs on Mars. The survival rates of spores of Bacillus subtilis and vegetative cells of Enterococcus faecalis were tested in soil solutions from each analog at 24, 0, or ‒70 °C for time periods up to 28 d. Survival of dormant spores of B. subtilis were mostly unaffected by incubation in the aqueous extracts of all six Mars analogs. In contrast, survival rates of E. faecalis cells were suppressed by all soil solutions when incubated at 24 °C but improved at 0 and ‒70 °C, except for assays in the Salt and Acid soil solutions in which most cells were killed. Results suggest that Earth microorganisms that form spores may persist in liquid brines on Mars better than non-spore forming species, and thus, spore-forming species may pose a potential forward contamination risk to sites with liquid brines.

  16. Neem by-products in the fight against mosquito-borne diseases: Biotoxicity of neem cake fractions towards the rural malaria vector Anopheles culicifacies (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Balamurugan Chandramohan

    2016-06-01

    Conclusions: Overall, this study suggests that the methanolic fractions of neem cake may be considered as a new and cheap source of highly effective compounds against the rural malaria vector An. culicifacies.

  17. Characterization and biotoxicity of Hypnea musciformis-synthesized silver nanoparticles as potential eco-friendly control tool against Aedes aegypti and Plutella xylostella.

    Science.gov (United States)

    Roni, Mathath; Murugan, Kadarkarai; Panneerselvam, Chellasamy; Subramaniam, Jayapal; Nicoletti, Marcello; Madhiyazhagan, Pari; Dinesh, Devakumar; Suresh, Udaiyan; Khater, Hanem F; Wei, Hui; Canale, Angelo; Alarfaj, Abdullah A; Munusamy, Murugan A; Higuchi, Akon; Benelli, Giovanni

    2015-11-01

    Two of the most important challenges facing humanity in the 21st century comprise food production and disease control. Eco-friendly control tools against mosquito vectors and agricultural pests are urgently needed. Insecticidal products of marine origin have a huge potential to control these pests. In this research, we reported a single-step method to synthesize silver nanoparticles (AgNP) using the aqueous leaf extract of the seaweed Hypnea musciformis, a cheap, nontoxic and eco-friendly material, that worked as reducing and stabilizing agent during the biosynthesis. The formation of AgNP was confirmed by surface plasmon resonance band illustrated in UV-vis spectrophotometer. AgNP were characterized by FTIR, SEM, EDX and XRD analyses. AgNP were mostly spherical in shape, crystalline in nature, with face-centered cubic geometry, and their mean size was 40-65nm. Low doses of H. musciformis aqueous extract and seaweed-synthesized AgNP showed larvicidal and pupicidal toxicity against the dengue vector Aedes aegypti and the cabbage pest Plutella xylostella. The LC50 value of AgNP ranged from 18.14 to 38.23ppm for 1st instar larvae (L1) and pupae of A. aegypti, and from 24.5 to 38.23ppm for L1 and pupae of P. xylostella. Both H. musciformis extract and AgNP strongly reduced longevity and fecundity of A. aegypti and P. xylostella adults. This study adds knowledge on the toxicity of seaweed borne insecticides and green-synthesized AgNP against arthropods of medical and agricultural importance, allowing us to propose the tested products as effective candidates to develop newer and cheap pest control tools. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Larvicidal, Histopathological Efficacy of Penicillium daleae against Larvae of Culex quinquefasciatus and Aedes aegypti Plus Biotoxicity on Artemia nauplii a Non-target Aquatic Organism

    Directory of Open Access Journals (Sweden)

    C. Ragavendran

    2017-10-01

    Full Text Available Mosquitoes can transmit the terrible diseases to human beings. Soil-borne fungal products act as potential source for low-cost chemicals, used for developing eco-friendly control agents against mosquito-vector borne diseases. The prime aim of study was to check the larvicidal potential of fungus mycelia (by ethyl acetate solvent extract from Penicillium daleae (KX387370 against Culex quinquefasciatus and Aedes aegypti and to test the toxicity of brine shrimp Artemia nauplii, by observing the physiological activity. The ethyl acetate extract of P. daleae mycelia (after 15 days from Potato dextrose broth (PDB medium revealed better result with least LC50 and LC90 values of I-IV instars larvae of Cx. quinquefasciatus (LC50 = 127.441, 129.087, 108.683, and 93.521; LC90 = 152.758, 158.169, 139.091, and 125.918 μg/ml and Ae. aegypti (LC50 = 105.077, 83.943, 97.158, and 76.513; LC90 = 128.035, 106.869, 125.640, and 104.606 μg/ml respectively. At higher concentration (1000 μg/ml of extracts, mortality begins at 18 h of exposure and attained 100% mortality after 48 h exposure. Overall, the activity was depends on the dose and time of exposure to the extracts. The stereomicroscopic and histopathological analysis of Ae. aegypti and Cx. quinquefasciatus larvae treated with mycelium ethyl acetate extract showed complete disintegration of abdominal region, particularly the midgut and caeca, loss of cuticular parts and caudal hairs. Morphological characterization of the fungi was performed and taxonomically identified through 5.8s rDNA technique. The phylogenetic analysis of rDNA sequence was carried out to find out the taxonomic and the evolutionary sketch of isolate in relation to earlier described genus Penicillium. Behavior and swimming speed alteration was analyzed together with mortality. The results of the experiment indicates that swimming behavior recorder (SBR is a appropriate tool to detect individual swimming speed of the A. nauplii organisms, since the values have been obtained in accordance with control monitored results showed the 2.75 mm s-1 and after 24 h treated found to be 0.72 mm s-1, respectively. The extract-exposed to A. nauplii showed changes in body structures, i.e., intestine enlargement, eye formation, outer shell malformations and loss of antennae. In the present study, we aimed to investigate the toxicity of the ethyl acetate extract of P. daleae on A. nauplii larvae by performing the mortality, behavior and alterations in swimming responses. This is the first time report on the larvicidal efficacy of P. daleae ethyl acetate extract against Cx. quinquefasciatus and Ae. aegypti larvae.

  19. Biological Properties of Low-Toxicity PLGA and PLGA/PHB Fibrous Nanocomposite Implants for Osseous Tissue Regeneration. Part I: Evaluation of Potential Biotoxicity

    Directory of Open Access Journals (Sweden)

    Izabella Krucińska

    2017-11-01

    Full Text Available In response to the demand for new implant materials characterized by high biocompatibility and bioresorption, two prototypes of fibrous nanocomposite implants for osseous tissue regeneration made of a newly developed blend of poly(l-lactide-co-glycolide (PLGA and syntheticpoly([R,S]-3-hydroxybutyrate, PLGA/PHB, have been developed and fabricated. Afibre-forming copolymer of glycolide and l-lactide (PLGA was obtained by a unique method of synthesis carried out in blocksusing Zr(AcAc4 as an initiator. The prototypes of the implants are composed of three layers of PLGA or PLGA/PHB, nonwoven fabrics with a pore structure designed to provide the best conditions for the cell proliferation. The bioactivity of the proposed implants has been imparted by introducing a hydroxyapatite material and IGF1, a growth factor. The developed prototypes of implants have been subjected to a set of in vitro and in vivobiocompatibility tests: in vitro cytotoxic effect, in vitro genotoxicity and systemic toxicity. Rabbitsshowed no signs of negative reactionafter implantation of the experimental implant prototypes.

  20. Evolution des quasiparticules nodales du cuprate supraconducteur YBa2Cu3Oy en conductivite thermique

    Science.gov (United States)

    Rene de Cotret, Samuel

    Ce memoire presente des mesures de conductivite thermique sur les supraconducteurs YBCO et Tl-2201 afin de statuer sur la presence possible d'un point critique quantique (QCP) dans le diagramme de phase de cuprates. Ce point critique quantique serait a l'origine de la reconstruction de la surface de Fermi, d'un large cylindre de trous en de petites poches de trous et d'electrons. La conductivite thermique dans le regime T → 0 permet d'extraire une quantite purement electronique liee aux vitesses de Fermi et du gap, au noeud. Une discontinuite dans cette quantite pourrait signaler la traversee du dopage critique qui reconstruit la surface de Fermi. Plusieurs sondes experimentales distinguent une transition de phase ou un crossover a T* a temperature finie. D'autres sondes mettent en evidence une transition de phase sous l'effet d'un champ magnetique. La presence ou non de cet ordre, a temperature et champ magnetique nul questionne la communaute depuis plusieurs annees. Dans cette etude, nous detectons une variation brusque de kappa0/T a p = 0.18 dans YBCO et a p = 0.20 dans Tl-2201. Ces sauts sont interpretes comme un signe de la transition a temperature nulle et sont en faveur d'un QCP. Le manque de donnees d'un meme materiau a ces dopages ne permet pas de valider hors de tout doute l'existence d'un point critique quantique. Le modele theorique YRZ decrit aussi bien les donnees de conductivite thermique. Des pistes de travaux experimentaux a poursuivre sont proposees pour determiner la presence ou non du QCP de facon franche. Mots-cles : Supraconducteurs, cuprates, conductivite thermique, point critique quantique.

  1. Lanseeraussuunnitelma uudelle tuotteelle ja uusien asiakkaiden tavoittaminen : case: Skydda Suomi Oy

    OpenAIRE

    Leppänen, Laura

    2013-01-01

    Tämä opinnäytetyö käsittelee ruotsalaisen Guide käsinemerkin uuden CPN-käsinemalliston lanseerausta Suomessa. Tutkimuksen tavoitteena on kartoittaa markkinat uudelle tuotteelle, etsiä uusia asiakkaita sekä suunnitella lanseeraukselle toimenpiteet, jotka tukevat yrityksen myyntitavoitteita. Opinnäytetyö on tehty ruotsalaiseen B&B Tools konserniin kuuluvalle Skydda Suomelle. Tutkimuksen teoria on jaettu kahteen päälukuun. Ensimmäisessä pääluvussa käsitellään markkinointiviestintää ja toise...

  2. Mono-domain YBa2Cu3Oy superconductor fabrics prepared by an infiltration process

    International Nuclear Information System (INIS)

    Sudhakar Reddy, E.; Noudem, J.G.; Tarka, M.; Schmitz, G.J.

    2000-01-01

    A novel process for the fabrication of a new form of YBa 2 Cu 3 O y (123) superconducting material, with the dimensions of a thick film and the microstructure of a melt-textured single-domain bulk is described. The process allows the fabrication of 123 as a self-supporting fabric or as a thick film on various substrate materials. The process, which is generic and economical, uses commercially available Y 2 O 3 fabrics as a precursor material. The Y 2 O 3 cloth is infiltrated with barium cuprates and copper oxides from a liquid-phase source, then converted into Y 2 BaCuO 5 (211) phase and eventually to 123. The nucleation and growth of the 123 phase is controlled by seeding the cloth with an oriented heterogeneous MgO or Nd123 seed. Interesting application areas for the new form of the 123 mono-domain fabric are discussed. (author)

  3. Customer Relationship Management : Evaluating customer Relationship Management:case Lennol Oy

    OpenAIRE

    Ndila Mutua, Esther

    2011-01-01

    The objective of this thesis was to study the CRM of the Lennol Company which is a linen company situated in Finland, Jalasjärvi. The Company wanted to know if their CRM is effective and how they can make it more profitable for the company. The theoretical framework is constructed using materials on theories on Customer Relationship Management. This part consists of characteristics of effective CRM and benefit of CRM. The author also mentions the reasons for failure of CRM and also how busine...

  4. Palkanlaskennan ulkoistaminen tilitoimistolle : uuden asiakkaan palkkatietojen siirto SR-Yritystilit Oy:lle

    OpenAIRE

    Saarinen, Lasse

    2009-01-01

    Opinnäytetyön tarkoituksena on selvittää mitä, haasteita uuden asiakkaan palkanlaskennan aloittamiseen liittyy palkanlaskijan näkökulmasta ja palkanlaskennan ulkoistamisen syyt yrittäjän näkökulmasta. Teoriaosuudessa ensimmäiseksi käydään läpi palkkahallinto käsitteenä ja palkan määrityksen lähtökohdat sekä velvollisuudet palkkakirjanpidosta. Toiseksi määritellään käsite ulkoistaminen ja käsitellään ulkoistamisen hyödyt ja riskit. Lisäksi tarkastellaan tutkimuksia taloushallinnon ulkoista...

  5. Magnetic Composite Thin Films of FexOy Nanoparticles and Photocrosslinked Dextran Hydrogels

    International Nuclear Information System (INIS)

    Brunsen, Annette; Utech, Stefanie; Maskos, Michael; Knoll, Wolfgang; Jonas, Ulrich

    2012-01-01

    Magnetic hydrogel composites are promising candidates for a broad field of applications from medicine to mechanical engineering. Here, surface-attached composite films of magnetic nanoparticles (MNP) and a polymeric hydrogel (HG) were prepared from magnetic iron oxide nanoparticles and a carboxymethylated dextran with photoreactive benzophenone substituents. A blend of the MNP and the dextran polymer was prepared by mixing in solution, and after spin-coating and drying the blend film was converted into a stable MNP–HG composite by photocrosslinking through irradiation with UV light. The bulk composite material shows strong mobility in a magnetic field, imparted by the MNPs. By utilizing a surface layer of a photoreactive adhesion promoter on the substrates, the MNP–HG films were covalently immobilized during photocrosslinking. The high stability of the composite was documented by rinsing experiments with UV–Vis spectroscopy, while surface plasmon resonance and optical waveguide mode spectroscopy was employed to investigate the swelling behavior in dependence of the nanoparticle concentration, the particle type, and salt concentration. - Highlights: ► blending of iron oxide nanoparticles with photocrosslinkable carboxymethyldextran. ► UV irradiation of blend yields surface-attached, magnetic hydrogel films. ► film characterization by surface plasmon resonance/optical waveguide spectroscopy. ► swelling decreases with increasing nanoparticle content. ► swelling decreases with increasing NaCl salt concentration in the aqueous medium.

  6. Perception of Luxury in an E-Commerce Environment : Case: Wodens Group Oy

    OpenAIRE

    Hirvonen, Pauli

    2016-01-01

    The objective of this study was to discover the basis of the concept of luxury, and how this concept is perceived in a modern e-commerce environment in order to provide guidelines for the case company to achieve their goal of developing luxury brand and selling their products online. In the beginning of the process the company founders had certain visions and strategies considering the field of luxury markets, and the result of the study was either to set these assumptions as true or false, a...

  7. Magnetic properties of Nd-deficient manganites Nd0.9-xCaxMnOy

    International Nuclear Information System (INIS)

    Troyanchuk, I.O.; Khomchenko, V.A.; Pastushonok, S.N.; Novitsky, O.A.; Pavlov, V.I.; Szymczak, H.

    2006-01-01

    X-ray diffraction and magnetic studies of neodymium deficient Nd 0.9-x Ca x MnO y (0= 0.9 MnO y samples have been prepared in the 2.85= g -orbitals of manganese ions. Composition with y=2.85 is antiferromagnet with T N =85K, whereas for more oxidized Nd 0.9 MnO y samples a coexistence of antiferromagnetic and ferromagnetic phases is suggested. Low-temperature magnetic phase transition which is accompanied by a negative magnetization appearance has been found in the Nd 0.9 MnO 2.90 compound. Magnetic behavior of Nd 0.9-x Ca x MnO y (0.1= 1-x Ca x MnO 3 series. Properties of the Nd 0.9-x Ca x MnO y (0=< x=<0.4) solid solutions are in agreement with a hypothesis according to which a part of Nd ions can be substituted by Mn ions

  8. Highly clickable web banner ads for customers of Advertising Media Finland OY

    OpenAIRE

    Deresse, Filagot Gizaw

    2011-01-01

    The aim of this thesis is to do a research and suggest ways how “Advertising Media Finland OY” can provide high click through rates for its customer ads. The background information was based on the meeting with the commissionaire, it was decided that I should focus on banner advertising, colors, sizes, timing, product decision, and price. At the last chapter, I was to give campaign ideas and suggested some points based up on desktop research, e-books, books and journals. The main results t...

  9. Carbon Textile Decorated with Pseudocapacitive VC/Vx Oy for High-Performance Flexible Supercapacitors.

    Science.gov (United States)

    Van Lam, Do; Shim, Hyung Cheoul; Kim, Jae-Hyun; Lee, Hak-Joo; Lee, Seung-Mo

    2017-11-01

    It is demonstrated that, via V 2 O 5 coating by low temperature atomic layer deposition and subsequent pyrolysis, ubiquitous cotton textile can readily turn into high-surface-area carbon textile fully decorated with pseudocapacitive V x O y /VC widely usable as electrodes of high-performance supercapacitor. It is found that carbothermic reduction of V 2 O 5 (C + V 2 O 5 → C' + VC + CO/CO 2 (g)) leads to chemical/mechanical activation of carbon textile, thereby producing high-surface-area conductive carbon textile. In addition, sequential phase transformation and carbide formation (V 2 O 5 → V x O y → VC) occurred by carbothermic reduction trigger decoration of the carbon textile with redox-active V x O y /VC. Thanks to the synergistic effect of electrical double layer and pseudocapacitance, the supercapacitors made of the hybrid carbon textile exhibit far better energy density (over 30-fold increase) with excellent cycling stability than the carbon textile simply undergone pyrolysis. The method can open up a promising and facile way to synthesize hybrid electrode materials for electrochemical energy storages possessing advantages of both electrical double layer and pseudocapacitive material. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Perehdytys etätyössä : case Annanpura Oy:n perehdytyssuunnitelma

    OpenAIRE

    Kohomäki, Noora

    2013-01-01

    Opinnäytetyön tavoitteena oli laatia toimiva perehdytyssuunnitelma yritykselle, jonka työntekijät työskentelevät pääsääntöisesti kotoaan käsin. Etätyön perehdyttämisessä korostuvat riittävän viestinnän ja vuorovaikutuksen järjestäminen. Työn keskeisenä haasteena oli dialogisen perehdytyksen ja itsenäisesti suoritettavan etätyön yhdistäminen. Työn tavoitteena oli lisäksi selvittää, onnistuuko hiljaisen tiedon ja osaamisen siirtäminen etätyössä ja sen perehdytyksessä. Teoreettisessa viitekeh...

  11. Corrosion resistance of ZrNxOy thin films obtained by rf reactive magnetron sputtering

    International Nuclear Information System (INIS)

    Ariza, E.; Rocha, L.A.; Vaz, F.; Cunha, L.; Ferreira, S.C.; Carvalho, P.; Rebouta, L.; Alves, E.; Goudeau, Ph.; Riviere, J.P.

    2004-01-01

    The main aim of this work is the investigation of the corrosion resistance of single layered zirconium oxynitride, ZrN x O y , thin films in artificial sweat solution at ambient temperature. The films were produced by rf reactive magnetron sputtering, using a pure Zr target at a constant temperature of 300 deg. C. Two different sets of samples were produced. In the first set of films, the substrate bias voltage was the main variable, whereas in the second set, the flow rate of reactive gases (oxygen/nitrogen ratio) was varied. The control of the amount of oxygen allowed the film properties to be tailored from those of covalent zirconium nitride to those of the correspondent ionic oxide. The corrosion behaviour was evaluated by potentiodynamic polarization and Electrochemical Impedance Spectroscopy (EIS) tests. The analysis of EIS data provided detailed information of the corrosion processes occurring at the surface of the system throughout the immersion time. The modifications of the coating microstructure and/or chemical composition induced by the variation of the deposition parameters were also evaluated and correlated with the corrosion mechanisms occurring in each system

  12. Instrument evaluation no. 5. Wallac OY universal radiation survey meter type RD-8

    International Nuclear Information System (INIS)

    White, D.F.; Blundell, D.R.; Callowhill, K.; Iles, W.J.

    1976-05-01

    The Wallace RD-8 is a portable, battery-operated survey meter covering an exposure rate range from 0.01 mR/h to 300 R/h. The instrument was designed specifically for military and civil defence applications and is accordingly of particularly rugged construction and claimed to be both waterproof and shockproof. This instrument is unusual in that it has two internally mounted radiation detectors. An end-window GM tube is used to cover the range from 0.01 to 300 mR/h, and a GM tube covers the range from 0.01 to 300 R/h. Both tubes have energy compensation sheaths for the measurement of photon radiation in the forward direction. Only the first tube permits the measurement of β-radiation. The information is given under the following headings; Facilities and controls; radiation characteristics; electrical characteristics; environmental characteristics; mechanical characteristics; summary of performance; calibration procedure; conclusions. (U.K.)

  13. A study of YBa2Cu3-xSnxOy by positron lifetime spectrum

    International Nuclear Information System (INIS)

    Liu Fengqi; Liu Junzheng; Cheng Guosheng; Cao Shixun; Shang Jiaxiang; Zhang Jincang

    1995-01-01

    The positron lifetime spectra of the YBa 2 Cu 3-x Sn x O y system have been measured and the local electron density n e and vacancy concentration C v have been calculated as a function of Sn substitution x. The results show that a significant Sn-substitution dependence exists. For lower x( e has a big continual variation and for higher x(>0.8), it is level off with a value of about 5.6 x 10 23 cm -3 . But for C v a big anomalous change occurs between x = 0.8-1.0 and this may be attributed to the structural phase transition

  14. Positron annihilation study of YBa2Cu3Oy superconductors doped with SnO2

    International Nuclear Information System (INIS)

    Chen, A.; Zhi, Y.; Li Biaorong; Wang Shaojie

    1992-01-01

    The positron annihilation lifetime spectra of YBa 2 Cu 3 O y superconductors doped with SnO 2 were measured. The results indicate that the tin element substitutes for Cu(1) sites. A brief discussion is given based on the experimental results. (orig.)

  15. Positron and TSL-studies of superconducting ceramics YBa 2Cu3Oy for various y

    International Nuclear Information System (INIS)

    Aravin, L.G.; Bobolev, A.V.; Gustov, V.V.; Ryzhkov, A.I.; Shantarovich, V.P.; Vydrin, S.N.; Zainullin, R.N.

    1990-01-01

    The effect of oxygen content on the defectivity and structure of the high temperature superconductor YBa 2 Cu 3 O y (6.0 < y < 7.0) has been investigated using positron annihilation lifetime spectroscopy (LS) and thermally stimulated luminescence (TSL). Data analysis and comparison enabled a conclusion on positron trapping by metal (Ba,Cu) but not by oxygen vacancies (contrary to electrons). The trapping rate was sufficiently dependent on oxygen content in the sample. The transition range y between orthorombic (superconducting) and tetragonal (nonsuperconducting) phases was characterized by the increased content of not only oxygen but also metal (Ba,Cu) vacancies

  16. Flux pinning property in a single crystal NdBa2Cu3Oy superconductor

    International Nuclear Information System (INIS)

    Hasan, M.N.; Kurokawa, T.; Kiuchi, M.; Otabe, E.S.; Matsushita, T.; Chikumoto, N.; Machi, T.; Muralidhar, M.; Murakami, M.

    2005-01-01

    The critical current density J c and the apparent pinning potential U 0 * in a single crystal NdBa 2 Cu 3 O y superconductor which shows a broad peak effect are investigated by measuring a DC magnetization and its relaxation. The field-induced pinning mechanism does not explain the temperature dependence of peak field B p and dip field B d . The experimental results of J c and U 0 * are compared with the theoretical analysis based on the flux creep-flow model, taking the distribution of the flux pinning strength into account. The number of flux lines in the flux bundle (g 2 ), the most probable value of pinning strength (A m ) and distribution width (σ 2 ) are determined so that a good fit is obtained between the experimental and theoretical results. The behavior of these parameters is discussed in correspondence to the disorder transition of flux lines

  17. Influencing Brand Awareness Through Social Media : Case: BEdesign Oy in Facebook and Instagram

    OpenAIRE

    Sjöberg, Annette

    2017-01-01

    Consumers’ awareness of a brand is essential, as brand awareness is considered one of the main reasons that brand and its products are purchased. The use of social media has been regarded a great possibility for brands to increase global brand awareness, however, with continuously increasing competition for attention and fast commercializing social media, getting noticed has become challenging. The main purpose of this study was to use benchmarking to identify concrete actions that can be use...

  18. The exploitation of paid Facebook advertising in a small startup company: case study Prosauna Oy

    OpenAIRE

    Kuusijärvi, Susanna

    2015-01-01

    This paper examines the new modes of marketing through digital platforms offered by Facebook and Google. Marketing activities have undergone considerable changes through the growth of social media and digitalization. Companies are able to reach a huge audience through Facebook marketing and simultaneously it is considered to be a low cost form of promotion. The purpose of this thesis is to examine the benefits of the exploitation of paid Facebook ad-vertising and Google AdWords in a smal...

  19. Magnetic tunnel junctions with AlN and AlNxOy barriers

    International Nuclear Information System (INIS)

    Schwickert, M. M.; Childress, J. R.; Fontana, R. E.; Kellock, A. J.; Rice, P. M.; Ho, M. K.; Thompson, T. J.; Gurney, B. A.

    2001-01-01

    Nonoxide tunnel barriers such as AlN are of interest for magnetic tunnel junctions to avoid the oxidation of the magnetic electrodes. We have investigated the fabrication and properties of thin AlN-based barriers for use in low resistance magnetic tunnel junctions. Electronic, magnetic and structural data of tunnel valves of the form Ta (100 Aa)/PtMn (300 Aa)/CoFe 20 (20 Aa - 25 Aa)/barrier/CoFe 20 (10 - 20 Aa)/NiFe 16 (35 - 40 Aa)/Ta (100 Aa) are presented, where the barrier consists of AlN, AlN x O y or AlN/AlO x with total thicknesses between 8 and 15 Aa. The tunnel junctions were sputter deposited and then lithographically patterned down to 2 x 2μm 2 devices. AlN was deposited by reactive sputtering from an Al target with 20% - 35% N 2 in the Ar sputter gas at room temperature, resulting in stoichiometric growth of AlN x (x=0.50±0.05), as determined by RBS. TEM analysis shows that the as-deposited AlN barrier is crystalline. For AlN barriers and AlN followed by natural O 2 oxidation, we obtain tunnel magnetoresistance >10% with specific junction resistance R j down to 60Ωμm 2 . [copyright] 2001 American Institute of Physics

  20. Anticorrosive coating of SixOyCz on metallic substrates applied with the plasma CVD technique

    International Nuclear Information System (INIS)

    Perillo, P; Lasorsa, C; Versaci, R

    2006-01-01

    This work deals with the production of anticorrosive coatings of Si x O y C z on metallic substrates by PECVD (Plasma Enhanced Chemical Vapor Deposition) in a two layer coating, with a gaseous mixture using methyltrimethoxysilane (Z6070) with the contribution of O 2 and methane as reactive gases. The process involves two steps, the first with the substrate thermalized to 500 o C and the second step with the substrate at room temperature. In the first step the process is carried out with the mixture of O 2 and Z6070, in the second step methane is added to the mixture of the plasma forming gases. The coatings were carried out on AISI 410 stainless steel, AISI M2 steel, titanium and AA6061 aluminum substrates. This work presents the preliminary results of the electrochemical evaluation and the mechanical properties of the coating. Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS/ESCA ), and scanning electron microscopy were used for this study. Electrochemical techniques were used to study the reaction to the corrosion of the coatings. Potentiodynamic polarization curves were prepared in a solution of 5% H 2 SO 4 and in NaCl 0,1M. The tests were undertaken at room temperature. This process is presented as an alternative to the conventional immersion processes by the sol-gel method, which produces the polymerization of the reagent as a result of the effect of the oxygen from the environment, while the plasma process produces very different chemical reactions in the center of the plasma itself with coatings also different (CW)

  1. Competing charge, spin, and superconducting orders in underdoped YBa2Cu3Oy

    DEFF Research Database (Denmark)

    Hücker, M.; Christensen, Niels Bech; Holmes, A. T.

    2014-01-01

    order decreases with underdoping to TCDW~90 K in YBa2Cu3O6.44. Together with a weakened order parameter this suggests a competition between CDW and SDW orders. In addition, the CDW order in YBa2Cu3O6.44 shows the same type of competition with superconductivity as a function of temperature and magnetic...

  2. Synergy between TiO2 and CoxOy sites in electrocatalytic water decomposition

    NARCIS (Netherlands)

    Szyja, B.M.; van Santen, R.A.

    2015-01-01

    A computational study of the cooperative effect of a small four-atom Co oxide cluster supported on the TiO2 anatase (100) surface in the electrochemical water splitting reaction is presented. The results have been obtained including explicit solvent water molecules by means of Car-Parrinello MD

  3. Digitaalinen markkinointi kansainvälisesti : case: Free News of the World, NSD Oy

    OpenAIRE

    Welling, Tommi

    2014-01-01

    Tämän opinnäytetyön aiheena on digitaalinen markkinointi ja digitaalisen markkinoinnin suunnittelu. Opinnäytetyön tavoitteena oli tehdä digitaalinen markkinointisuunnitelma kansainvälisiä markkinoita varten uutissivustolle Free News of the World. Tässä opinnäytetyössä esitellään digitaalinen markkinointisuunnitelma, joka toteutettiin kesän 2013 aikana. Markkinointisuunnitelman lisäksi työssä on teoreettinen viitekehys, jossa käsitellään digitaalisen markkinoinnin käsitteistä sosiaalisen m...

  4. Rahoitusyhtiön tulevat asiakkaat : Case: Santander Consumer Finance Oy

    OpenAIRE

    Raevuori, Matti

    2014-01-01

    Finanssialan palvelut ovat perusominaisuuksiltaan varsin samankaltaisia. Tämän vuoksi asiakas arvioi yksittäisten tekijöiden sijasta kokonaisuutta, jonka hän palvelun valitessaan saa. Finanssialalla haasteena on lähestyä asiakasta hänen mielentilansa mukaisella tavalla. Yrityksen tulee tuntea asiakkaansa perinpohjaisesti ja paremmin kuin ennen on ollut tapana. Talouden kompuroidessa turvallisuutta lisäävien ratkaisujen tarve on lisääntynyt. Asiakkaat etsivät ratkaisuja. Nämä ratkaisut peilaav...

  5. Optical transparency and electrical conductivity of nonstoichiometric ultrathin InxOy films

    International Nuclear Information System (INIS)

    Joseph, Shay; Berger, Shlomo

    2011-01-01

    The effect of thickness and composition on the electrical conductivity and optical transparency, mainly in the infrared, of ultrathin In x O y films was studied. In x O y films 35-470 A thick with oxygen atomic fractions of ∼0.3 and ∼0.5 were prepared via dc magnetron sputtering. All films were polycrystalline, consisting of only the cubic bixbiyte phase of In 2 O 3 . The average grain size of the films increased from 30 to 95 nm as the film thickness increased. The weak dependence of the electrical conductivity on the frequency and the low activation energies for conduction, a few hundredths of an eV, provided an indication that free band conduction was the primary electrical conduction mechanism in the case of all ultrathin In x O y films. It was found that introducing a high degree of nonstoichiometry in the form of oxygen deficiency did not help improve the electrical conductivity, since not all vacancies contributed two free electrons for conduction and due to impurity scattering. The optical nature of these films, studied mainly by ellipsometry, was found to be dependent on the film's composition and thickness. In the infrared, the dielectric function of all In x O y films was consistent with the Drude model, inferring that the transparency loss in this region was a result of free charge carriers. In the visible however, In x O y films under 170 A, which had an oxygen atomic fraction of ∼0.5, were modeled by extending the Drude model to the shorter wavelengths. Films over 170 A, with the same composition, were modeled using the Cauchy dispersion model, meaning that no absorption was measured. These results indicate that, optically, under specific compositions, ultrathin In x O y films undergo a transition from metalliclike behavior to dielectric behavior with increasing film thickness. Using a figure of merit approach, it was determined that a nonstoichiometric 230 A thick In x O y film, with an oxygen atomic fraction of ∼0.3, had the best combination of conductivity and transparency, namely, absorption of less than 20% in the infrared, about 10% in the visible, and electrical resistance of only 230 Ω at 20 kHz. Such a film may be classified as a highly conductive transparent oxide even in the infrared.

  6. Infrared transparency and electrical conductivity of non-stoichiometric InxOy films

    International Nuclear Information System (INIS)

    Joseph, Shay; Berger, Shlomo

    2010-01-01

    In an effort to achieve both high infrared transparency and electrical conductivity, In x O y films having different oxygen atomic fractions, ranging from 0.27 to 0.6 were prepared. From AC electrical measurements it was determined that conductivity of In x O y films, having oxygen atomic fraction near 0.6, is governed by the hopping conduction mechanism via energy states located in the band gap. Conductivity of In x O y films having non-stoichiometric compositions was found to be governed by the free band conduction mechanism. The conduction activation energy was decreased from about 0.47 eV to about 0.02 eV as the deviation of the oxygen atomic fraction from the stoichiometric value of 0.6 was increased. The dielectric function of the films was determined by applying the Drude-Lorentz model to ellipsometric measurements in the infrared and visible wavelengths. In the visible range, the major source for optical transmission loss is interband absorption, which was modeled by the Lorentz model. In the infrared range, optical absorption was measured and attributed to the presence of free charge carriers according to the Drude model. Fitting the model to the optical measurements required a correction factor, which was correlated with the films polarizability. In order to determine the optimal tradeoff between optical transparency in the infrared and electrical conductivity, which were found to be affected mainly by the oxygen concentration in the films, a figure of merit parameter was established. It was found that by introducing non-stoichiometry in the form of oxygen deficiency, the electrical conductivity was improved by as much as two orders of magnitude while the infrared transparency was decreased by no more than 30% with respect to stoichiometric In 2 O 3 films.

  7. Doping effects of Fe ion on magnetic anisotropy of YBa2Cu3Oy

    International Nuclear Information System (INIS)

    Ugawa, T.; Horii, S.; Maeda, T.; Haruta, M.; Shimoyama, J.

    2013-01-01

    Highlights: •We clarified orientation effects of Fe-doped Y123 in modulated rotating fields. •Y123 showed two different hard magnetic axes due to twin microstructures. •The two hard magnetic axes in Fe-doped Y123 were [1 0 0] and [1 1 0] directions. •Magnetic anisotropy of the [1 1 0] grain was higher than that of the [1 0 0] grain. -- Abstract: We report magnetic alignment of YBa 2 (Cu 1−x Fe x ) 3 O y (Fe-doped Y123, x = 0–0.1) powders under modulated rotation magnetic fields (MRFs) and roles of Fe ion as a determination factor of magnetic anisotropy in Y123. The Fe-free and Fe-doped Y123 powder samples aligned in the MRF of 10 T showed two different orientation types of the hard axis in Y123 grains. From an X-ray rocking curve measurement for the magnetically aligned powder samples of the Fe-doped Y123, inplane magnetic anisotropy for Y123 grains with the hard axis parallel to the [1 1 0] direction was found to be higher than that for Y123 grains with the hard axis parallel to the [0 1 0] direction

  8. Wood Roasted Restaurants Oy:n kanta-asiakasjärjestelmä : Kehittämissuunnitelma

    OpenAIRE

    Lehtelä, Riikka

    2010-01-01

    Ravintola-alan yritysten välillä vallitsee nykypäivänä kova kilpailu asiakkaista, ja asiakkaat vaativat palveluilta yhä enemmän. Menestyäkseen näissä olosuhteissa on liikeyrityksen kehitettävä toimintaansa jatkuvasti. Tutkimuksellinen kehittämistyö on tärkeä väline yrityksen toiminnan kehittämisessä ja sitä voidaan soveltaa monilla eri osa-alueilla. Tässä opinnäytetyössä tutkimuksellinen kehittämistyö kohdistui yrityksen asiakassuhteisiin. Asiakassuhdemarkkinointia voidaan toteuttaa kolmella...

  9. Developing a customer-centric digital marketing communication strategy : Commissioner Salusfin Oy

    OpenAIRE

    Lokteva, Daria

    2015-01-01

    The present study relates to the field of digital marketing communication. The purpose of the study is to create a customer-centric digital marketing communication strategy for Salusfin, a technological start-up company in need of an effective digital strategy. The key issue of the study is to provide an insight on how digital marketing communication tools can fulfil the needs and benefit the company while adding value for the customers. The research questions addressed in the study are 1. Wh...

  10. Sede central de la Compañía Neste Oy Finlandia

    Directory of Open Access Journals (Sweden)

    Castrén, -

    1980-08-01

    Full Text Available This complex, with a volume of 190,000 m2 is made up of three buildings that have different characteristics: - one 90 m tower used for offices, with the upper two floors for technical installations: - One two storey building with several social areas: living quarters for watchkeepers and service staff, restaurant, teaching centre and clinic; - a three storey car-park with capacity for 500 vehicles. The structural system chosen for the tower was a metal structure with light weight concrete forgings. This has been a pioneer work in Finland regarding both the metal construction and high buildings.

    Este complejo, con un volumen total de 190.000 m2 está formado por tres edificios de características diferentes: — una torre de 90 m destinada a oficinas, con las dos plantas superiores para instalaciones técnicas: — un edificio de dos plantas con diversas áreas sociales: viviendas para vigilantes y personal de servicio, restaurante, centro de enseñanza y clínica: — un aparcamiento de tres plantas con plazas para 500 vehículos. El sistema estructural elegido para la torre fue el de una estructura metálica con forjados de hormigón aligerado. Esta obra ha sido pionera en Finlandia, tanto en el campo de la construcción metálica, como en el de edificios de gran altura.

  11. Commensurability oscillations in NdBa2Cu3Oy single crystals

    Indian Academy of Sciences (India)

    Postfach 3640, 76021 Karlsruhe, Germany. 2Technical ... the vortices are placed between the CuO2 layers, but the energy necessary for the elastic ... Two Nd123 crystals from the same batch were investigated: FK, twinned, transition tem-.

  12. Persuasive Digital Advertising in Online Advertisement : Case Company: MarkPrint Oy

    OpenAIRE

    Do, Quang Huy

    2015-01-01

    The past decades have seen an unpreceded growth in digital advertising over its budget, efficiency and effectiveness. Since 2003, marketers’ spending on online advertisement worldwide has increased by roughly $1 billion over its previous business quarter. Return-on-Investment for digital advertisement triples traditional ones in numerous areas while the cost of operating online is among the most economical means to reach audiences. Thus, the aim of this thesis is to provide a theoretical foun...

  13. Titanium oxynitrate (TiNxOy) coating for use in thermal solar energy converters

    International Nuclear Information System (INIS)

    Lasorsa, C; Dilalla, N; Perillo, P; Morando, P.J; Versaci, R; Lucio, R

    2008-01-01

    This work deals with the production of titanium oxynitrate (TiN x O y ) coatings on metallic substrates. Because of its high resistance to high temperatures, titanium oxynitrate (TiN xO y) is a good material for the production of thermal solar energy converters. The surfaces should possess such qualities as high absorbance (α) of solar radiation (range 0.3 μm ≤λ≤2 μm) and low thermal emittance (ε) in the range of λ≥ 2 μm. The coatings should retain optical qualities temperatures greater than 300 o C. These coatings were made using the PECVD (Plasma Enhanced Chemical Vapor Deposition) technique in a single layer coating, with a gaseous mixture using titanium isopropoxide with an air contribution of reactive gas. The process is developed in one stage, with the substrate thermalized at 750 o C and without y BIAS potential. The coatings were carried out on AISI 410 stainless steel and AISI M2 steel substrates. This work presents the preliminary results of the coating's chemical composition, structure and optical and mechanical properties. Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS/ESCA) and scanning electron microscopy were used in these studies

  14. Proposing a project for building an e-commerce website for Ryijypalvelu-RP Oy

    OpenAIRE

    Sotkov, Ilya

    2014-01-01

    The thesis describes the development of a project proposal report for building an e-commerce website for a small textile firm based in Helsinki, Finland. The aim of the study is to determine how small businesses that are currently not highly involved in e-commerce should approach developing an e-commerce website in order to maximize the positive impact of selling on the Internet. The study combined the use of action research and qualitative research methodologies by developing a project p...

  15. Observation of weakly adsorbed oxygen on Y5Ba6Cu11Oy

    International Nuclear Information System (INIS)

    Kao, Sendjaja; Ng, K.Y.S.

    1992-01-01

    In the Y-Ba-Cu-O compound, several investigators have observed superconductivity-like phenomena at higher temperatures, some even reaching zero resistance at 250 K. Huang et al. reported an observation of sharp resistivity drops, at least four orders of magnitude at ca. 230 K, in one annealed sample of Eu 1 Ba 2 Cu 3 O 6+x . But the resistance drop disappeared after thermal cycling, although the correlated magnetic anomalies observed in their magnetic measurements persisted for many thermal cycles. Recently, Chen et al reported that the superconductivity-like transition at a temperature above 200 K in their mixed-phase YBaCuO persisted for 29 thermal cycles. The samples were treated by a low-temperature (50-70C) oxygenation process and enclosed in oxygen environment during electrical and magnetic measurements. They also found that this higher-temperature transition could not survive thermal cycling when the sample was in helium atmosphere. The role oxygen plays in their observations is not clear, but they speculated that weakly bonded oxygen atom/atoms are responsible for the high-temperature phase. This observation of T c > 200 K in oxygen environment is recently confirmed by Schonberger et al. in highly oriented multiphase Y-Ba-Cu-O thin film. Here, the authors observed, for the first time, adsorption of weakly bonded oxygen at low temperature (≤250C) by a Y 5 Ba 6 Cu 11 O y sample, using thermogravimetric analysis. The resulting oxygen enriched phase in the surface layers may be attributed to the observation of a superconductivity-like transition at above 200 K

  16. Properties of porous FeAlOy/FeAlx ceramic matrix composite ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 36; Issue 7. Properties of porous FeAlO/FeAl ceramic matrix composite influenced by mechanical activation of FeAl powder. V Usoltsev S Tikhov A Salanov V Sadykov G Golubkova O Lomovskii. Volume 36 Issue 7 December 2013 pp 1195-1200 ...

  17. Magnetoresistivity and microstructure of YBa2Cu3Oy prepared using planetary ball milling

    International Nuclear Information System (INIS)

    Hamrita, A.; Ben Azzouz, F.; Madani, A.; Ben Salem, M.

    2012-01-01

    Superconducting properties of YBa 2 Cu 3 O y prepared using planetary ball milling were studied. Y-deficient YBa 2 Cu 3 O y nanoparticles are embedded in the superconducting matrix. Ball milled sample exhibits a large magnetoresistivity in weak magnetic fields at 77 K. We have studied the microstructure and the magnetoresistivity of polycrystalline YBa 2 Cu 3 O y (YBCO or Y-123 for brevity) embedded with nanoparticles of Y-deficient YBCO, generated by the planetary ball milling technique. Bulk samples were synthesized from a precursor YBCO powder, which was prepared from commercial high purity Y 2 O 3 , Ba 2 CO 3 and CuO via a one-step annealing process in air at 950 °C. After planetary ball milling of the precursor, the powder was uniaxially pressed and subsequently annealed at 950 °C in air. Phase analysis by X-ray diffraction (XRD), granular structure examination by scanning electron microscopy (SEM), microstructure investigation by transmission electron microscopy (TEM) coupled with energy dispersive X-ray spectroscopy (EDXS) were carried out. TEM analyses show that nanoparticles of Y-deficient YBCO, generated by ball milling, are embedded in the superconducting matrix. Electrical resistance as a function of temperature, ρ(T), revealed that the zero resistance temperature, T co , is 84.5 and 90 K for the milled and unmilled samples respectively. The milled ceramics exhibit a large magnetoresistance in weak magnetic fields at liquid nitrogen temperature. This attractive effect is of high significance as it makes these materials promising candidates for practical application in magnetic field sensor devices.

  18. Implementation of customer relationship management and its advantages : Case company Forchem Oy

    OpenAIRE

    Puiseva, Maiju

    2014-01-01

    The purpose of this thesis was to bring out the key issues of the concept of customer relationship management and study its implementation and advantages in the case company. The topic of the thesis was assigned by the case company. Their objective was to understand customer relationship management better and to develop it to be one of the business processes. Theoretical part of the thesis studied customer service and customer relationship management and the importance of those. Theoretica...

  19. Markkinoinnin tuloksellisuuden mittaaminen Koivumäen Kartano Oy:ssä

    OpenAIRE

    Kielenniva, Jonna

    2015-01-01

    Markkinoinnin tuloksellisuutta ei vielä perusteellisesti ymmärretä eikä siitä ole juurikaan tutkittua tietoa. Kuitenkin markkinoinnin tehokkuuden merkitys on viime aikoina huomattu ja yritykset kiinnittävät siihen nykyään enemmän huomiota. Markkinoinnin tuloksellisuuden mittaaminen on vaikeaa, jonka vuoksi harvat yritykset tutkivat omaa markkinointiaan tuloksellisuuden näkökulmasta. Tämän opinnäytetyön aiheena on markkinoinnin tuloksellisuuden mittaaminen Kuopiossa sijaitsevassa ravintola...

  20. Influence of calcium on transport properties, band spectrum and superconductivity of YBa2Cu3Oy and YBa1.5La0.5Cu3Oy·

    International Nuclear Information System (INIS)

    Gasumyants, V.E.; Vladimirskaya, E.V.; Patrina, I.B.

    1994-01-01

    The comparative investigation of transport phenomena in Y 1-x Ca x Ba 2 Cu 3 O y (0 y>6.87 and 6.73 1-x Ca x Ba 1.5 La 0.5 Cu 3 O y (0 y>6.96) and YBa 2-x La x Cu 3 O y (0 2 Cu 3 O y · . The results obtained suggest that Ca gives rise to some peculiarities in band spectrum of this compound

  1. Recycling of wood products. Final report of the preliminary study project partly financed by the Finnish Wood Research Oy; Puutuotteiden kierraetys. Finnish Wood Research Oy:n osarahoittaman esiselvityshankkeen loppuraportti

    Energy Technology Data Exchange (ETDEWEB)

    Pirhonen, I.; Heraejaervi, H.; Saukkola, P.; Raety, T.; Verkasalo, E., Email: henrik.herajarvi@metla.fi

    2011-07-01

    The objective of this preliminary study was to clarify the present state of recycling of wood in Finland and Europe. In the work the control measures of recycling were examined. In Finland there will be a total amount of 850 000 tons of waste wood per year. Of this amount 670 000 tons is from construction and demolishing of buildings. Burning the wood to energy is technically and economically the most reasonable use of waste wood in Finland and in several other European countries where there is a long heating season. A lot of work has been done to find new ways of utilization. The objective of the European Union to increase the use of renewable natural resources in the energy production creates an additional demand to all kinds of wood, including waste wood. The waste legislation of Finland and EU is directing to recycling, not restricting it. Furthermore, the systems to try to create markets for products containing recycled materials are under development. In the future it is expected that the legislation is tightening and the burning of waste wood is no longer calculated as acceptable recycling. Other ways to utilize wood waste should then already be developed. Furthermore, the development and introduction of new recycling methods are of important significance also when marketing wood and wood products. The recycling should be taken into consideration already at the planning stage of the building

  2. Surface characterization of superconductive Nd1Ba2Cu3Oy thin films using scanning probe microscopes

    International Nuclear Information System (INIS)

    Ting, W.; Badaye, M.; Itti, R.; Morishita, T.; Koshizuka, N.; Tanaka, S.

    1996-01-01

    Recently, superconductive Nd 1 Ba 2 Cu 3 O y (Nd123) thin films with high superconducting transition temperature (T c ) have been successfully fabricated at the authors institute employing the standard laser ablation method. In this paper, they report parts of the results of surface characterization of the Nd123 thin films using an ultrahigh vacuum scanning tunneling microscope/spectroscopy (UHV-STM/STS) and an atomic force microscope (AFM) system operated in air. Clear spiral pattern is observed on the surfaces of Nd123 thin films by STM and AFM, suggesting that films are formed by two-dimensional island growth mode at the final growing stage. Contour plots of the spirals show that the step heights of the spirals are not always the integer or half integer numbers of the c-axis parameter of the structure. This implies that the surface natural termination layer of the films may not be unique. Surface atomic images of the as-prepared Nd123 thin films are obtained employing both STM and AFM. STS measurements show that most of the surfaces are semiconductive, or sometimes even metallic. The results of STS measurements together with the fact that they are able to see the surface atomic images using scanning probe microscopes suggest that exposure to air does not cause serious degradation to the as-prepared surfaces of Nd123 thin films

  3. Effect of Co content on magnetic and optical properties of Zn1−xCoxOy nanorods

    International Nuclear Information System (INIS)

    Chen, Jia-Hong; Lin, Yow-Jon; Chang, Hsing-Cheng; Chen, Ya-Hui; Horng, Lance; Chang, Chia-Chi

    2013-01-01

    Highlights: ► The magnetic and optical properties of Zn 1−x Co x O y nanorods were studied. ► The ferromagnetic properties arise from the replacement of Zn by Co and defects. ► A link between the magnetization, nanorod sizes and defects was established. - Abstract: The effect of Co content on the magnetic and optical properties of Zn 1−x Co x O y nanorods have been investigated in this study. X-ray diffraction, energy dispersive spectrometer, photoluminescence and ferromagnetism measurements were used to characterize the Zn 1−x Co x O y nanorods. It is shown that the ferromagnetic properties arise from the replacement of Zn by Co in the ZnO lattice. Combining with photoluminescence and scanning electron microscopic results, a direct link between the magnetization, nanorod sizes and acceptor defects of Zn 1−x Co x O y nanorods was established.

  4. Yrityksen strateginen suunnittelu ja tulevaisuuden näkökulmat yritysjohtamisessa : Liiketoimintastrategia yritykselle Lemmikkieläinliike Tarantella Oy

    OpenAIRE

    Siren, Elina

    2011-01-01

    Pk-yrityksissä liiketoiminnan strateginen suunnittelu ja säännöllinen toimintaympäristössä tapahtuvien muutosten tutkiminen jäävät usein liian pienelle huomiolle, vaikka vain suunnitelmallisella liiketoiminnalla pystytään takaamaan yritysten kasvu ja tulevaisuus alalla kuin alalla. Opinnäytetyön aiheena on liiketoimintastrategian luominen franchise pohjalla toimivalle lemmikkieläinliikkeelle. Ensin työssä esitellään itse yritys ja sen takana oleva franchise-ketju. Esittelyjen jälke...

  5. A novel process for textured thick film YBa2Cu3Oy coated conductors based on a constitutional gradients principle

    International Nuclear Information System (INIS)

    Reddy, E Sudhakar; Tarka, M; Noudem, J G; Goodilin, E A; Schmitz, G J

    2005-01-01

    A new method for the processing of textured YBa 2 Cu 3 O y (Y 123) thick film stripes on metallic tapes is discussed. The process involves the texturing of Y123 grains by a localized directional solidification method by creating constitutional gradients along the width of the precursor Y 2 BaCuO 5 (Y 211) stripe during an infiltration and growth process. The differences in the solidification temperatures of different rare earth 123 compounds were utilized to generate the constitutional gradients. The sample configuration involves printed lines of light (Nd) and heavy (Yb) rare earth compounds on either side of an airbrushed Y211 stripe underneath a liquid phase (barium cuprates) layer. The higher peritectic temperature (T p ) Nd regions serve as nucleating sites for Y123 grains nucleated in the adjacent Y211 stripes and the constitutional gradients produced due to the diffusion of respective rare earth ions between the Nd and Yb regions, typically of 200 K cm -1 in the region, induce a driving force for the directional growth of the nucleated grains. The solidification is analogous to that in a typical Bridgman furnace in applied high temperature gradients. The process, being independent of growth rate parameter and texture of the underlying substrate, is suitable for the fabrication of long length thick film conductors by a wind and react process in simple box type furnaces

  6. Observation of bias-dependent noise sources in a TiOx/TiOy bipolar resistive switching frame

    International Nuclear Information System (INIS)

    Hyung Kim, Joo; Rahm Lee, Ah; Cheol Bae, Yoon; Ho Baek, Kwang; Sik Im, Hyun; Pyo Hong, Jin

    2014-01-01

    We report the conduction features associated with the evolution of oxygen ions (or vacancies) under bias for a TiO x (oxygen ion-rich)/TiO y (oxygen ion-deficient) bi-layer cell by identifying low-frequency noise sources. It is believed that a low resistance state enhances the formation of conductive filaments exchanging electrons through a nearest-neighbor hopping process, while a high resistance state (HRS) emphasizes the rupture of conductive filaments inside the insulating TiO x layer and a reduction/oxidation reaction at the oxide interfaces. The high resolution transmission electron microscope images of as-grown and HRS cells are also discussed

  7. Interaction between molten corium UO2+x-ZrO2-FeOy and VVER vessel steel

    International Nuclear Information System (INIS)

    Bechta, S. V.; Granovsky, V. S.; Khabensky, V. B.; Krushinov, E. V.; Vitol, S. A.; Sulatsky, A. A.; Gusarov, V. V.; Almiashev, V. I.; Lopukh, D. B.; Bottomley, D.; Fischer, M.; Piluso, P.; Miassoedov, A.; Tromm, W.; Altstadt, E.; Fichot, F.; Kymalainen, O.

    2010-01-01

    In case of in-vessel corium retention during a severe accident in a light water reactor, weakening of the vessel wall and deterioration of the vessel steel properties can be caused both by the melting of the steel and by its physicochemical interaction with corium. The interaction behavior has been studied in medium-scale experiments with prototypic corium. The experiments yielded data for the steel corrosion rate during interaction with UO 2+x -ZrO 2 -FeO y melt in air and steam at different steel surface temperatures and heat fluxes from the corium to the steel. It has been observed that the corrosion rates in air and steam atmosphere are almost the same. Further, if the temperature at the interface increases beyond a certain level, corrosion intensifies. This is explained by the formation of liquid phases in the interaction Zone. The available experimental data have been used to develop a correlation for the corrosion rate as a function of temperature and heat flux. (authors)

  8. A study on the superconducting properties of YBa2Cu9-xNbxOy thin films

    International Nuclear Information System (INIS)

    Srinivas, S.; Bhatnagar, A.K.; Pinto, R.

    1994-01-01

    Effect of niobium substitution at the copper site in YBa 2 Cu 9 O 7-x was studied in thin film form. The films were deposited by laser ablation technique using the targets of the YBa 2 Cu 3-x Nb x O y where x = 0.0, 0.025, 0.05, 0.1, 0.2, 0.4, 0.8 and 1.0 under identical deposition conditions on SrTiO 9 substrates. Films were characterized by XRD, resistivity, I-V and J c measurements. Films made from x = 0.025 and 0.05 concentrations of Nb substituted targets showed relatively improved superconducting properties compared to that of undoped films. The best 7 realized for x = 0.025 Nb concentration was 1.8 x 10 σ A/cm 2 and for 0.05 Nb concentration it was 3.2x10 σ A/cm 2 at 77K. However, degradation of the superconducting properties, with the increase of x ≥ 0.1 Nb concentration and drastic suppression and complete loss of superconductivity was noticed for x ≥ 0.4. The growth of impurity phase YBa 2 NbO 6 for x = 0.1 and above of Nb concentration was noticed from XRD patterns. However, the site occupancy of Nb could not be confirmed from these studies

  9. Material studies in the frame of CLIC Accelerating structures production conducted within the Mechanics program together with Metso Oy

    CERN Document Server

    Nurminen, Janne

    2012-01-01

    MeChanICs (Marie Curie Linking Industry to CERN) is an Industry to Academia Partnership and Pathways (IAPP) platform for precision manufacturing knowledge exchange bringing together five Finnish manufacturing companies with Helsinki Insitute of Physics (HIP) and CERN. The scientific objective of MeChanICs project is to contribute to the manufacturing RTD of CLIC enabling technologies. The focus is on the design, materials, machining, brazing and assembly of A CLIC accelerating structure. This study deals with the materials work package of the program and wants to explore the following items: 1) producing copper accelerating structures for CLIC from raw copper powder by near net shape hot isostatic pressing (HIP). 2) The feasibility to use HIP diffusion bonding of the accelerator structures as a function of surface quality and applied temperature and pressure. 3) Brazing for CLIC AS auxiliary systems, like water cooling or damping manifolds, to the disc stack by coating one of the brazing partners with an enab...

  10. Crystal structure and superconductivity of YBa2(Cu1-xFex)3Oy prepared by various heat treatments

    International Nuclear Information System (INIS)

    Katsuyama, Shigeru; Kosuge, Koji; Ueda, Yutaka

    1989-01-01

    The heat treatments of (a) slow cooling from 850 C in O 2 gas, which is an ordinary one, (b) quenching into liq. N 2 from 930 C in air followed by oxidation below 400 C in O 2 gas and (c) heating at 800 C in N 2 gas followed by oxidation below 400 C in O 2 gas stabilize the orthorhombic phase up to x=0.02, 0.04 and 0.12, respectively. The extension of the orthorhombic region seems to be due to the change of ratio of Fe1 to Fe2 and clustering for Fe ions in the Cu1-0 planes, which has been deduced from the results of 57 Fe Moessbauer measurements etc. The order of T c of the samples with the same iron concentration prepared by the above heat treatments is T c (c) T c (a) T c (b). The experimental results seem to show that one-dimensional Cu1-0 chains play a very important role in superconductivity as well as the two-dimensional Cu2-0 planes

  11. Positron lifetime studies of Bi2Sr2CaCu2Oy-xFx superconductors

    International Nuclear Information System (INIS)

    Shi Zhiqiang; Chao Xixu; Wu Lingyun

    1994-01-01

    The positron lifetime was measured as a function of doped F content for Bi 2 Sr 2 CaCu 2 O y-x F x superconductor. Combined with the measurement of critical temperature T c , the sites where F substituted for O and the change of electronic structures caused by local substitution of F in the samples were studied

  12. Creating a marketing channels strategy for European market entry: a case study for eloSpaces Oy

    OpenAIRE

    Babanina, Daria

    2016-01-01

    This thesis is produced as a case study for eloSpaces, Finnish-Chinese startup company based in Espoo, Finland. eloSpaces develops a unique capsule for people to do the focus work and enjoy privacy. The home market for eloSpaces is China and their current aim is to enter also European market in the nearest future. Therefore, the main objective for thesis was to identify the shortest and most efficient market entry strategy for the full product launch in Europe with highest impact on profits. ...

  13. Intergranular phase of the Si3 N4 hot pressed with Mg O/Y2 O3

    International Nuclear Information System (INIS)

    Costa, Celio A.; Todd, Judith A.

    1997-01-01

    Monolithic and composite Si 3 N 4 hot-pressed with 3% Mgo or 6% Y 2 O 3 were analyzed with X-ray diffraction and transmission electron microscopy. The results showed materials to be composed of β-Si 3 N 4 grains and an intergranular phase which was partially crystalline and partially amorphous. For the materials sintered with Mg O, the identification of the intergranular phase was not conclusive. For the materials sintered with Y 2 O 3 . It was observed that the amount of intergranular crystalline phase decreased as whiskers were added to the material and the intergranular crystalline part had a crystallographic structure similar to yttrium-silicon-oxide-nitride family. (author)

  14. Flux pinning properties of ErBa2Cu3Oy thin films with BaZrO3 nanorods

    International Nuclear Information System (INIS)

    Haruta, M; Fujiyoshi, T; Sueyoshi, T; Dezaki, K; Ichigosaki, D; Miyahara, K; Miyagawa, R; Mukaida, M; Matsumoto, K; Yoshida, Y; Ichinose, A; Horii, S

    2006-01-01

    ErBa 2 Cu 3 O y (ErBCO) thin films with BaZrO 3 (BZO) nanorods were prepared by a PLD method for an enhancement of the critical current density J c . The values of J c for the ErBCO thin film containing 1.5 wt% BZO (Er15) in magnetic fields are higher than those for the ErBCO thin film containing 0.5 wt% BZO (Er05). The peaks of J c have been observed in the angular dependence of J c in both the films when the magnetic field is applied parallel to the c-axis. It has been found that the peak is attributed to the flux pinning by BZO nanorods oriented parallel to the c-axis. The vortex glass-liquid transition temperature T g and the pinning parameter m were derived by fitting observed electric transport properties to the theoretical expression based on the percolation transition model. The value of T g of Er15 is higher than that of Er05. This result indicates that the vortex glass phase extends to a higher temperature region on increasing the fraction of BZO. The peak of m has been found in the magnetic field dependence. This fact is probably due to matching the density of BZO nanorods with that of fluxoids, which was confirmed by TEM observations

  15. Two-year Facebook strategy to increase brand aware-ness and fan engagement. Case: Finlayson Oy

    OpenAIRE

    Rasinen, Beda

    2016-01-01

    During the last few years social media has not only become a channel in which we can connect and share with our family and friends, but it has grown to be one of the most cost efficient and effective marketing channels around. However, it is no longer enough for companies to just show up. To use the channels to their full potential, well designed strategies must be devised and applied. This study looks into one of the tools of perhaps the most current marketing methodology; inbound market...

  16. The thermal investigations in Y1Ba2CuxOy (1.5 ≥ x ≥ 9) ceramics

    International Nuclear Information System (INIS)

    Szasz, A.; Hajdu, J.; Kojnok, J.; Krasser, W.

    1989-01-01

    The dynamic behavior and concentration of oxygen in high-T c superconducting ceramics like YBaCuO is of great importance. In the present paper the authors investigate thermal effects in high T c materials in wide range of copper concentrations at high temperatures, where oxygen diffusion and chemical processes take place. Electronic structure investigations using SXS measurements have been performed simultaneously using the same set of samples

  17. Co-operative energy transfer in Yb3+-Er3+ co-doped SrGdxOy upconverting phosphor

    Science.gov (United States)

    Kumar, Ashwini; Pathak, Trilok K.; Dhoble, S. J.; . Terblans, J. J.; Swart, H. C.

    2018-04-01

    Upconversion nanoparticles (UCNPs) have shown considerable interest in many fields; however, low upconversion efficiency of UCNPs is still the most severe limitation of their applications. Yb3+ and Er3+ co-doped SrGd4O7/Gd2O3(SGO) upconversion (UC) phosphors were synthesized by a modified co-precipitation process. The UC properties were investigated by direct excitation with a 980 nm laser. It was observed that the as prepared materials showed relatively strong green emission, while upon the incorporation of the Er3+ ion, there was an increase in the upconversion luminescence intensity for the red component. The effect of different doping concentration of Er3+on the emission spectra and X-ray diffraction patterns of the UC materials have also been studied. The luminescence lifetimes and Commission Internationale de L'Eclairage coordinates for these as prepared samples were determined to understand the energy transfer (ET) mechanisms occurring between Yb3+ and Er3+ in the SGO host matrix. The UC luminescence intensity as a function of laser pump power was monitored and it was confirmed that the UC process in SGO:Yb3+/Er3+is a two-photon absorption process. The findings reported here are expected to provide a better approach for understanding of the ET mechanisms in the oxide based Yb3+/Er3+ co-doped UC phosphors. This study might be helpful in precisely defined applications where optical transitions are essential criterion and this can be easily achieved by smart tuning of the emission properties of Yb3+/Er3+ co-doped UC phosphors.

  18. Structural Defects of Silver Hollandite, Ag(x)Mn8O(y), Nanorods: Dramatic Impact on Electrochemistry.

    Science.gov (United States)

    Wu, Lijun; Xu, Feng; Zhu, Yimei; Brady, Alexander B; Huang, Jianping; Durham, Jessica L; Dooryhee, Eric; Marschilok, Amy C; Takeuchi, Esther S; Takeuchi, Kenneth J

    2015-08-25

    Hollandites (OMS-2) are an intriguing class of sorbents, catalysts, and energy storage materials with a tunnel structure permitting one-dimensional insertion and deinsertion of ions and small molecules along the c direction. A 7-fold increase in delivered capacity for Li/AgxMn8O16 electrochemical cells (160 versus 23 mAh/g) observed upon a seemingly small change in silver content (x ∼1.1 (L-Ag-OMS-2) and 1.6 (H-Ag-OMS-2)) led us to characterize the structure and defects of the silver hollandite material. Herein, Ag hollandite nanorods are studied through the combined use of local (atomic imaging, electron diffraction, electron energy-loss spectroscopy) and bulk (synchrotron based X-ray diffraction, thermogravimetric analysis) techniques. Selected area diffraction and high resolution transmission electron microscopy show a structure consistent with that refined by XRD; however, the Ag occupancy varies significantly even within neighboring channels. Both local and bulk measurements indicate a greater quantity of oxygen vacancies in L-Ag-OMS-2, resulting in lower average Mn valence relative to H-Ag-OMS-2. Electron energy loss spectroscopy shows a lower Mn oxidation state on the surface relative to the interior of the nanorods, where the average Mn valence is approximately Mn(3.7+) for H-Ag-OMS-2 and Mn(3.5+) for L-Ag-OMS-2 nanorods, respectively. The higher delivered capacity of L-Ag-OMS-2 may be related to more oxygen vacancies compared to H-Ag-OMS-2. Thus, the oxygen vacancies and MnO6 octahedra distortion are assumed to open the MnO6 octahedra walls, facilitating Li diffusion in the ab plane. These results indicate crystallite size and surface defects are significant factors affecting battery performance.

  19. High performance batch production of LREBa2Cu3Oy using novel thin film Nd-123 seed

    International Nuclear Information System (INIS)

    Muralidhar, M.; Suzuki, K.; Fukumoto, Y.; Ishihara, A.; Tomita, M.

    2011-01-01

    A batch production for fabrication of LREBa 2 Cu 3 O y (LRE: Sm, Gd, NEG) 'LRE-123' pellets are developed in air and Ar-1% O 2 using a novel thin film Nd-123 seeds grown on MgO crystals. The SEM and XRD results conformed that the quality and orientation of the seed crystals are excellent. On the other hand, new seeds can withstand temperatures >1100 deg. C, as a result, the cold seeding process was applied even to grow Sm-123 material in Air. The trapped field observed in the best 45 mm single-grain puck of Gd-123 was in the range of 1.35 T and 0.35 T at 77.3 K and 87.3 K, respectively. The average trapped field at 77.3 K in the 24 mm diameter NEG-123 samples batch lies between 0.9 and 1 T. The maximum trapped field of 1.2 T was recorded at the sample surface. Further, the maximum trapped field of 0.23 T at 77 K was recorded in a sample with 16 mm diameter of Sm-123 with 3 mol% BaO 2 addition. As a result we made more then 130 single grain pucks within a couple of months. Taking advantage of the single grain batch processed material, we constructed self-made chilled levitation disk, which was used on the open day of railway technical research Institute. More then 150 children stood on the levitation disk and revel the experience of levitation. The present results prove that a high-performance good-quality class of LREBa 2 Cu 3 O y material can be made by using a novel thin film Nd-123 seeds.

  20. Melt processing of the Bi2Sr2CaCu2Oy superconductor in oxygen and argon atmospheres

    International Nuclear Information System (INIS)

    Holesinger, T.G.; Miller, D.J.; Chumbley, L.S.

    1992-08-01

    Solidification and subsequent annealing of Bi 2 Sr 2 CaCu 2 O y (2212) in oxygen and argon atmospheres were investigated in order to identify alternative processing routes for controlling microstructures and superconducting properties. In addition to 2212, several other phases formed on cooling in O 2 and did not disappear upon subsequent annealing. Crystallization in Ar resulted in a divorced eutetic structure of Bi 2 Sr 3-x Ca x O y and Cu 2 O/CuO. The superconductor was formed on subsequent anneals. Samples melted in Ar and then annealed generally possessed a more uniform microstructure compared with samples that were melted in oxygen and annealed. Compositional measurements of the 2212 phase suggest that CaO segregation in the melt may be minimized with an overall composition such as Bi 2.15 Sr 2 Ca 0.85 Cu 2 O y

  1. Effect of PECVD SiNx/SiOy Nx –Si interface property on surface passivation of silicon wafer

    International Nuclear Information System (INIS)

    Jia Xiao-Jie; Zhou Chun-Lan; Zhou Su; Wang Wen-Jing; Zhu Jun-Jie

    2016-01-01

    It is studied in this paper that the electrical characteristics of the interface between SiO y N x /SiN x stack and silicon wafer affect silicon surface passivation. The effects of precursor flow ratio and deposition temperature of the SiO y N x layer on interface parameters, such as interface state density Di t and fixed charge Q f , and the surface passivation quality of silicon are observed. Capacitance–voltage measurements reveal that inserting a thin SiO y N x layer between the SiN x and the silicon wafer can suppress Q f in the film and D it at the interface. The positive Q f and D it and a high surface recombination velocity in stacks are observed to increase with the introduced oxygen and minimal hydrogen in the SiO y N x film increasing. Prepared by deposition at a low temperature and a low ratio of N 2 O/SiH 4 flow rate, the SiO y N x /SiN x stacks result in a low effective surface recombination velocity (S eff ) of 6 cm/s on a p-type 1 Ω·cm–5 Ω·cm FZ silicon wafer. The positive relationship between S eff and D it suggests that the saturation of the interface defect is the main passivation mechanism although the field-effect passivation provided by the fixed charges also make a contribution to it. (paper)

  2. Establishing an online store in the furniture retail business : Case study of Lähdesmäki Oy

    OpenAIRE

    Kareno, Justus

    2013-01-01

    This thesis describes the process of establishing an online store for a Finnish furniture retailer. The development of electronic commerce as a means of business is introduced as the force driving furniture retailers to establish an online presence. The theory of electronic commerce is presented and analyzed in terms of differences compared to sales via a conventional store. The development of electronic furniture retailing is analyzed by researching furniture retailers in Finland and th...

  3. Changes and development of product line : Case: P. Rotola-Pukkila Oy's products, furniture trends and competitors

    OpenAIRE

    Rotola-Pukkila, Ida

    2016-01-01

    The purpose of this thesis is to study what kinds of changes and developments have been done in furniture manufacturer P. Rotola-Pukkila Oy’s Timantti and Laatupaneeli products and colour options between the years 1970−2016. Another objective is to study the trends on furniture and interior design field, as well as to study how the company’s products compete on the market. Concepts related to company’s history, products, collections and colour options as well as the history of furniture f...

  4. Equilibrium Structures and Absorption Spectra for SixOy-nH2O Molecular Clusters using Density Functional Theory

    Science.gov (United States)

    2017-05-04

    active vibrational modes. In these studies the DFT calculations were implemented using the computer program GAUSSIAN09 (G09) [11]. The present study also...Cartesian   direction .  The  first  derivatives  of  the  dipole  moment  with  respect  to   atomic  positions... Toyota , R. Fukuda, J. Hasegawa, M. Ishida, T. Nakajima, Y. Honda, O. Kitao, H. Nakai, T. Vreven, J. A. Montgomery, Jr., J. E. Peralta, F. Ogliaro

  5. Self-organized nickel nanoparticles on nanostructured silicon substrate intermediated by a titanium oxynitride (TiNxOy) interface

    Science.gov (United States)

    Morales, M.; Droppa, R., Jr.; de Mello, S. R. S.; Figueroa, C. A.; Zanatta, A. R.; Alvarez, F.

    2018-01-01

    In this work we report an experimental approach by combining in situ sequential top-down and bottom-up processes to induce the organization of nanosized nickel particles. The top-down process consists in xenon ion bombardment of a crystalline silicon substrate to generate a pattern, followed by depositing a ˜15 nm titanium oxynitride thin film to act as a metallic diffusion barrier. Then, metallic nanoparticles are deposited by argon ion sputtering a pure nickel target, and the sample is annealed to promote the organization of the nickel nanoparticles (a bottom-up process). According to the experimental results, the surface pattern and the substrate biaxial surface strain are the driving forces behind the alignment and organization of the nickel nanoparticles. Moreover, the ratio between the F of metallic atoms arriving at the substrate relative to its surface diffusion mobility determines the nucleation regime of the nickel nanoparticles. These features are presented and discussed considering the existing technical literature on the subject.

  6. Density and superconducting properties of metal-sheathed YBa2Cu3Oy ceramic processed by hydrostatic extrusion

    International Nuclear Information System (INIS)

    Karpov, M.I.; Korzhov, V.P.; Artamoshin, A.V.; Prokopenko, V.M.

    1994-01-01

    Brittle materials can be deformed without cracking and rupturing using hydrostatic extrusion, which provides the greatest pore annihilation in powder-processed materials and allows large degrees of one-step deformation, which is favorable for texturing. Earlier, a casting slip prepared by mixing a starting powder of Y-based ceramic with an organic binder was conventionally extruded to produce a wire 150 μm in diameter. After special sintering, the critical-current density in the material attained a few hundred amperes per square centimeter at 77 K, and the wire could be rolled into a winding ≥0.3 m in diameter. Hydrostatic extrusion of an assembly composed of Y-based ceramic in a bimetallic Nb/Cu tube 30 mm in diameter was used to produce rods 6 mm in diameter; drawing of these rods yielded samples of wire 2 to 3 mm in diameter. It was shown that the extrusion pressure and strain substantially influence the yield of the rupture-free wire. No signs of rupturing, cracking, or necking were observed in wire extruded at pressures ≤700 MPa and degrees of deformation ≤50%. A pronounced instability of the hydrostatic extrusion, the appearance of defects, and even the rupture of the rods were caused by an increase in the pressure up to 2000 MPa and in the degree of one-step deformation up to 80%. In this work, the authors focus on the possibility of producing thin YBa 2 Cu 3 O y superconductors using only hydrostatic extrusion. They determined the parameters for the hydrostatic extrusion of the metal-sheathed YBa 2 Cu 3 O y ceramic to a diameter of 3 mm or to a rectangular cross section. Effects of the ceramic core, and of the reduction coefficient on superconducting-transition parameters and the critical-current density of the ceramic were examined

  7. Virtuaalisten 3D-vaatteiden myyntikonsepti sosiaalisessa peliympäristössä : Case Sulake Corporation Oy

    OpenAIRE

    Luostarinen, Niina

    2015-01-01

    Toimeksiantaja kehittää parhaillaan uutta sosiaalista virtuaalipelikonseptia, jolle opinnäytetyö tehdään. Projekti on vielä salainen, joten projektiin viitataan nimellä projekti x (uusi virtuaalimaailmakonsepti). Työn tavoitteena on luoda virtuaalisten tuotteiden myyntikonsepti sosiaaliseen peliympäristöön. Opinnäytetyön aihe valikoitui omien kiinnostusten kohteideni ja toimeksiantajayrityksen meneillään olevan kehitystyön pohjalta. Tutkimusmenetelminä ovat pelitestausvideoiden analysoint...

  8. Sexual Difference and Decolonization. : Oyĕwùmí and Irigaray in Dialogue about Western Culture

    NARCIS (Netherlands)

    Coetzee, Azille; Halsema, Annemie

    In this paper we aim at showing the potential of cross-continental dialogues for a decolonizing feminism. We relate the work of one of the major criticasters of the Western metaphysical patriarchal order, Luce Irigaray, to the critique of the colonial/modern gender system by the Nigerian feminist

  9. Understanding the Composition Dependence of the Fragility of AgI-Ag2O-MxOy Glassy Systems

    International Nuclear Information System (INIS)

    Aniya, M

    2011-01-01

    It has been reported that the fragility in the AgI-Ag 2 O-M x O y (M = B, Ge, P, Mo) system is determined by Ag 2 O-M x O y and does not depend on the amount of AgI. This is an interesting result and provides a hint to understand the nature of the glassy state of these materials. However, the origin of such behavior has not been sufficiently discussed. In the present report a model for the above behavior is presented. According to the model, the behavior arises from the solid like nature of the network formed by Ag 2 O-M x O y and the liquid like AgI which flow between the networks. The model is consistent with the structural model of superionic glasses proposed previously.

  10. Effect of 14N ion irradiation on Bi2Sr2CaCu2Oy superconductors

    International Nuclear Information System (INIS)

    Sharma, M.L.; Ashwini Kumar, P.K.; Sarkar, S.K.; Virdi, G.S.; Rup, R.

    1993-01-01

    The effect of 14 N ion irradiation on a bulk Bi 2 Sr 2 CaCu 2 O y high-T c superconducting system has been studied. The incident energy was kept at 150 keV and the irradiation dose varied between 1 x 10 11 cm -2 and 1 x 10 16 cm -2 . It has been observed that the resistive transition occurs at lower temperatures for the irradiated specimens and the width (10-90% transition) of the superconducting transition decreases. Scanning transmission electron microscopy and x-ray diffraction (XRD) studies were carried out to evaluate the change in surface microstructure and XRD peak intensities due to irradiation. The results are discussed in the light of the similarity of atomic sizes of N and O atoms. (author)

  11. Biotoxic impact of heavy metals on growth, oxidative stress and morphological changes in root structure of wheat (Triticum aestivum L.) and stress alleviation by Pseudomonas aeruginosa strain CPSB1.

    Science.gov (United States)

    Rizvi, Asfa; Khan, Mohd Saghir

    2017-10-01

    Rapid industrialization and uncontrolled metal discharge into environment is a global concern for crop production. Metal tolerant bacterium isolated from chilli rhizosphere was identified as Pseudomonas aeruginosa by 16S rDNA sequence analysis. Pseudomonas aeruginosa tolerated high concentrations of Cu (1400 μg ml -1 ), Cd (1000 μg ml -1 ) and Cr (1000 μg ml -1 ). Pseudomonas aeruginosa CPSB1 produced multiple plant growth promoting biomolecules in the presence and absence of metals. Strain CPSB1 solubilized P at 400 μg ml -1 of Cd, Cr and Cu. The strain was positive for indole-3-acetic acid (IAA), siderophores, hydrogen cyanide (HCN), ammonia (NH 3 ) and 1-aminocyclopropane-1-carboxylate (ACC) deaminase when grown with/without metals. The phytotoxic effects on wheat increased with increasing Cd, Cr and Cu rates. The P. aeruginosa CPSB1 inoculated wheat in contrast had better growth and yields under Cu, Cd and Cr stress. The root dry biomass of inoculated plants was enhanced by 44, 28 and 48% at 2007 mg Cu kg -1 , 36 mg Cd kg -1 and 204 mg Cr kg -1 , respectively. The bioinoculant enhanced number of spikes, grain and straw yields by 25, 17 and 12%, respectively. Pseudomonas aeruginosa CPSB1 significantly declined the levels of catalase (CAT), glutathione reductase (GR) and superoxide dismutase SOD), proline and malondialdehyde (MDA), and reduced metal uptake by wheat. The study demonstrated that P. aeruginosa CPSB1 possessed plant growth promoting potentials, showed metal tolerance capability and had ability to counteract deleterious metal impacts. Due to these, P. aeruginosa CPSB1 could be used as bioinoculant for enhancing wheat production even in metal contaminated soils. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Growth of Sr1-xNdxCuOy thin films by rf-magnetron sputtering and pulsed-laser deposition

    International Nuclear Information System (INIS)

    Sugii, N.; Ichikawa, M.; Kuba, K.; Sakurai, T.; Iamamoto, K.; Yamauchi, H.

    1992-01-01

    This paper reports on Sr 1- x Nd x CuO y thin films grown on SrTiO 3 substrates by rf-magnetron sputtering and pulsed-laser deposition. The sputter-deposited film with x=0 has an infinite-layer structure whose lattice constants are: a=0.390 nm and c=0.347 nm. When x is larger than 0.1, the films contain a phase of the Sr 14 Cu 24 O 41 structure. The laser-deposited films of Sr 1- x Nd x CuO y with x ≥ 0.075 were single phase of the infinite-layer structure. The lattice parameter c decreased and the lattice parameter a increased, as the Nd content, x, increased. The films with x=0.10 and 0.125 exhibited superconducting onset temperatures around 26 K. Weak Meissner signals were observed for these films at temperatures below 30 K

  13. Preparation and physical properties of polycrystalline (Bi1-xPbx)2Sr2Ca2Cu3Oy high Tc superconductors

    International Nuclear Information System (INIS)

    Awan, M.S.; Maqsood, M.; Mirza, S.A.; Yousaf, M.; Maqsood, A.

    1995-01-01

    (Bi 1-x Pb x ) 2 Sr 2 Ca 2 Cu 3 O y (x = 0.3) high critical transition temperature (T c ) superconductors are synthesized by the solid-state reaction method in polycrystalline form. X-ray diffraction (XRD) studies, direct current (dc) electrical resistivity measurements, scanning electron microscopic (SEM) studies, critical current density measurements and zero-field alternating current (ac) susceptibility measurements are performed to investigate the physical changes, structural changes, and magnetic behavior of the superconducting samples. X-ray diffraction studies show that a high T c phase exists with orthorhombic symmetry in the specimen. According to the XRD data, the lattice parameters of the high T c phase were determined as a = 0.537(1) nm, b = 0.539(1) nm, and c = 3.70(1) nm. The compound exhibits a superconducting transition at 106 ± 1 K for zero resistance. The ac susceptibility measurements in zero field confirm the dc electrical resistivity results; hence both support the XRD results. The particle size and structural changes as a function of the cold-pressing and aging effect are also reported

  14. Direct observation of interlayer Josephson vortices in heavily Pb-doped Bi2Sr2CaCu2Oy by scanning superconducting quantum interference device microscopy

    International Nuclear Information System (INIS)

    Kasai, Junpei; Hasegawa, Tetsuya; Okazaki, Noriaki; Koinuma, Hideomi; Nakayama, Yuri; Shimoyama, Jun-ichi; Kishio, Kohji; Motohashi, Teruki; Matsumoto, Yuji

    2006-01-01

    Josephson vortices trapped in cross-sectional edge surfaces of Pb 0.6 Bi 1.4 Sr 2 CaCu 2 O y has been directly observed by using a scanning superconducting quantum interference device (SQUID) microscope. The magnetic field distribution B z around each vortex is substantially anisotropic, compared with the usual vortex in the ab-plane, and is extended over 100 μm toward the in-plane direction. By fitting a theoretical B z function to experimental ones, c-axis penetration depth λ c was estimated to be 11.2 ±0.7 μm, which is in good agreement with the literature value, 12.6 μm, obtained from the Josephson plasma edge frequency. (author)

  15. Specific features of acoustic properties of ceramic Bi1.4Pb0.6Ca2Sr2Cu3Oy

    International Nuclear Information System (INIS)

    Gajduk, A.L.; Fil', V.D.; Burma, N.G.

    1991-01-01

    Anomalies of sound velocity and attenuation, as well as of heat capacity are revealed in the Pb-stabilized Bi ceramics of the composition 2-2-2-3 atare 60 K, which are interpreted as the second-order phase transition. The sensitivity of the anomalies to the quenched magnetic flux is indicative of the magnetic nature of the transition. Similar features also observed at the same temperature in the 1-2-3* type superconducting systems

  16. Venäläinen tytäryritys suomalaisessa konsernitilinpäätöksessä - Case Inlook Oy

    OpenAIRE

    Romanova, Julia

    2009-01-01

    Työn keskeisin käsite on konsernin tilinpäätöstietojen yhdisteleminen ja tilinpäätöskäytäntö. Tilinpäätöskäytäntö voidaankin ajatella taloudellisen kommunikoinnin välineenä – taloudelli-sena kielenä. Kielen tehtävänä on kiteyttää informaatio tai ajatukset merkkeihin, jotka ym-märretään tietyssä kirjanpitoympäristössä samalla tavalla. Ongelmana on se, että taloudelli-nen kieli sisältää paljon kulttuurille ominaisia asioita, mikä tekee jokaisesta eri kirjanpitoym-päristön taloudellisesta kieles...

  17. Electron microscopic in situ study of phase and defect formation in Bi2Sr2CaCu2Oy single crystals in heating

    International Nuclear Information System (INIS)

    Goncharov, V.A.; Ignat'eva, E.Yu.; Osip'yan, Yu.A.; Suvorov, Eh.V.

    1997-01-01

    The nonthermal effect of electron irradiation on generating of new phases and structural defects has been uncovered during the investigation of structural variations of monocrystals Bi 2 Sr 2 CaCu 2 O y on heating in situ. The stability of the modulated structure and the package defects to heating under the electron beam action and in the absence of the irradiation has been studied

  18. Preparation of FexCe1-xOy solid solution and its application in Pd-only three-way catalysts

    Institute of Scientific and Technical Information of China (English)

    Jianqiang Wang; Meiqing Shen; Jun Wang; Mingshan Cui; Jidong Gao; Jie Ma; Shuangxi Liu

    2012-01-01

    FeOx-CeO2 mixed oxides with increasing Fe/(Ce+Fe) atomic ratio (1-20 mol%) were prepared by sol-gel method and characterized by X-ray powder diffraction (XRD),Brunauer-Emmett-Teller (BET) and Hydrogen temperature-programmed reduction (H2-TPR) techniques.The dynamic oxygen storage capacity (DOSC) was investigated by mass spectrometry with CO/O2 transient pulses.The powder XRD data following Rietveld refinement revealed that the solubility limit of iron oxides in the CeO2 was 5 mol% based on Fe/(Ce+Fe).The lattice parameters experienced a decrease followed by an increase due to the influence of the maximum solubility limit of iron oxides in the CeO2.TPR analysis revealed that Fe introduction into ceria strongly modified the textual and structural properties,which influenced the oxygen handling properties.DOSC results revealed that Ce-based materials containing Fe oxides with multiple valences contribute to the majority of DOSC.The kinetic analysis indicated that the calculated apparent kinetic parameters obey the compensation effect.The three-way catalytic performance for Pd-only catalysts based on the Fe doping support exhibited the redundant iron species separated out of the CeO2 and interacted with the ceria and Pd species on the surface,which seriously influenced the catalytic properties,especially after hydrothermal aging treatment.

  19. On the role of Fe3+ ions in FexOy/C catalysts for hydrogen production from the photodehydrogenation of ethanol

    International Nuclear Information System (INIS)

    Galindo-Hernández, Félix; Wang, Jin-An; Chen, Lifang; Bokhimi, Xim; Gómez, Ricardo; Pérez-Larios, Alejandro; Nava Entzana, Noel

    2013-01-01

    Graphical abstract: In Fe x O y /C photocatalyts important effect of Fe 3+ ions in the photodehydrogenation of the ethano was noticed. -- Highlights: • Iron oxides supported on carbon are photoactive catalysts. • Photoactivity in dehydrogenation of ethanol depends of the amount of Fe 3+ ions present in the catalysts. • The capacity of UV–vis absorbance by the Fe x O y /C catalysts is significantly dependent of the amount of Fe 3+ ions. • A maximum of rate constant, K = 2125 μmol h −1 , was obtained from the sample with 30 wt% Fe. -- Abstract: Fe x O y /C photocatalysts at different iron content were prepared by the incipient wet impregnation method and calcined at 773 K. The photocatalysts were characterized by means of nitrogen adsorption–desorption isotherms, surface fractal dimension, non-local density functional theory, X-ray diffraction, Rietveld refinement and UV–vis spectroscopy. The photocatalytic activity was evaluated using the photodehydrogenation of ethanol as a model reaction for the production of hydrogen. The specific surface areas of Fe x O y /C substrates, with 15, 20 and 30 wt% iron content, diminished from 638 to 490 m 2 /g, as the iron content increased. X-ray diffraction analysis showed that iron oxides coexist as wustite and magnetite in samples with Fe contents of 15 and 20 wt%; for sample with 30 wt% Fe, wustite, magnetite and hematite phases were observed. The photophysical, textural and structural properties were modified by the hematite phase formed by thermal treatment. The Rietveld refinements denoted changes in occupancy of Fe 3+ and Fe 2+ in Fe x O y crystallites. A relationship between the Fe 3+ ions content and the reactivity for the hydrogen production from the photodehydrogenation of ethanol (from 1360 to 2125 μmol h −1 ), was evidenced

  20. The superconductivity of Bi1.7Pb0.3Sr2-xAgxCa2Cu3Oy

    International Nuclear Information System (INIS)

    Yu, Y.

    1995-01-01

    It was discovered that the critical current density of BiSrCaCuO can be increased by cladding wires of this material with silver. Part of the cladding process is thermal annealing to 920 C. Although the empirical effects of this processing are well established, the effect of silver doping on T c and the structure of the lattice is not very clear. We studied this problem by substitution of Ag for Sr in BiSrCaCuO. The result reveals that T c0 of the sample increased to 99 K. (orig.)

  1. Superconducting Cd and Ca doped 123 phase in Cdo.8Ba2(Y0.7Ca0.4) Cu3.5Oy

    International Nuclear Information System (INIS)

    Balchev, N.; Kovachev, V; THOMAS, J.; BIEGER, W.; Konstantinov, K.; Kunev, B.

    1999-01-01

    A new Cd-containing superconductor with nominal composition of Cd 0.8 Ba 2 (Y 0.7 Ca 0.4 ) Cu 3.5 O y and T c = 80 K was synthesized and investigated. The obtained XRD pattern shows that the dominating phase is an orthorhombic 123. It was shown that the presence of Cd and Ca facilitates the 123 phase formation. The results of the EDX analysis on SEM and TEM have shown that the distribution of the Cd and Ca in the samples is inhomogeneous. The two elements enter the 123 phase in most of the investigated crystals and form a new Cd-Ba-Y-Ca-Cu-O superconducting compound

  2. Ultrahigh vacuum STM/STS studies of the Bi-O surface in Bi2Sr2CuOy single crystals

    International Nuclear Information System (INIS)

    Ikeda, Kazuto; Tomeno, Izumi; Takamuku, Kenshi; Yamaguchi, Koji; Itti, Rittaporn; Koshizuka, Naoki

    1992-01-01

    Scanning tunneling microscopic and spectroscopic studies were made on cleaved surfaces of Bi 2 Sr 2 CuO y single crystals using an ultrahigh-vacuum scanning tunneling microscope (UHV-STM). The modulation structures of the Bi-O surface were observed at room temperature with atomic resolution. The tunneling spectra showed electronic gap structures similar to those observed for the Bi-O surface of superconducting Bi-2212 single crystals. This suggests that superconductivity is not directly related to the electronic structure observed in the Bi-O plane. (orig.)

  3. Inducing phase decomposition and superconductivity of Bi2Sr2CaCu2Oy single crystals treated in sulphur atmosphere at low temperature

    International Nuclear Information System (INIS)

    Chen, Q.W.; China Univ. of Science and Technology, Hefei, AH; Wu, W.B.; Qian, Y.T.; China Univ. of Science and Technology, Hefei, AH; Wang, L.B.; Li, F.Q.; Zhou, G.E.; Chen, Z.Y.; Zhang, Y.H.

    1995-01-01

    As it has been pointed out, phase decomposition which may be hard to be detected in a polycrystalline system and is likely to correlate with changes in both oxygen content and microstructure, has been observed frequently in annealed single crystals especially at higher temperatures (> 500 C). This is still an open question to some degree because the mechanism of phase decomposition is very complex and is dominated by the composition of the Bi-2212 phase, the condition of heat treatment, and the atmosphere. Hence, inducing oxygen loss at low temperature to avoid the evaporation of Bi atoms and other undetected structure changes which would occur at higher temperature annealing undoubtedly provides important information about the relationship between oxygen loss and phase decomposition, as well as the relationship between oxygen content and superconductivity. In this note, we report on the results of treatments of Bi 2 Sr 2 CaCu 2 O y single crystals in sulphur atmosphere at 160 C. (orig.)

  4. Water-vapor-enhanced growth of Ge-GeOx core-shell nanowires and Si1-xGexOy nanowires

    International Nuclear Information System (INIS)

    Hsu, T-J; Ko, C-Y; Lin, W-T

    2007-01-01

    The effects of moist Ar on the growth of Ge-GeO x core-shell nanowires (Ge-GeO x NWs) and Si 1-x Ge x O y nanowires (SiGeONWs) on Si substrates without adding a metal catalyst via the carbothermal reduction of GeO 2 powders at 1100 deg. C were studied. No significant nanowires were grown in dry Ar at a flow rate of 100-300 sccm until a bit of water in the range of 0.5-2 ml was loaded into the furnace. More water suppressed the growth of nanowires because of the exhaustion of more graphite powder. The growth of Ge-GeO x NWs and SiGeONWs follows the vapor-solid and vapor-liquid-solid processes, respectively. The present study showed that the water vapor serves as an oxidizer as well as a reducer at 1100 deg. C in enhancing the growth of SiGeONWs and Ge-GeO x NWs, respectively. The growth mechanisms of Ge-GeO x NWs and SiGeONWs are also discussed

  5. Design and Synthesis of novel CuxGeOy/Cu/C nanowires by in situ chemical reduction process with highly reversible capacity for Lithium Batteries

    International Nuclear Information System (INIS)

    Wang, Linlin; Zhang, Xiaozhu; Peng, Xia; Tang, Kaibin

    2015-01-01

    The synthesis and use of ternary metal oxides/metal particles/carbon hybrids, especially 1D naowires composed of MGeO 3 /M/C hybrids for energy storage, remains very few reports. In this work, 1D Cu x GeO y /Cu/C NWs (x < 1, y < 3) were successfully prepared by a simple method involving chemical reduction process and simultaneous carbon coating. It was found that through the polydopamine(PDA)-assisted chemical reduction process performed on the CuGeO 3 NWs, the phase partially transformed to a mixture of crystalline Cu (∼70 nm) and amorphous Cu x GeO y NWs with carbon coating, but the nanowire-shaped morphology was maintained. Electrochemical measurements showed that the Cu x GeO y /Cu/C NWs exhibited a stable reversible capacity of ∼900 mA h g −1 after 100 cycles. Even at 800 mA g −1 , it also exhibited excellent high rate capacity of 350 mA h g −1 . The newly generated Cu x GeO y @Cu@CNWs exhibit enhanced cycle stability with high lithium-storage capability compared to that of the as-preparedCuGeO 3 NWs. (*) The in situ-synthesized Cu nanoparticles, amorphous state and carbon coating might play an important role in activating and enhancing the reversibility of the conversion reaction of Cu x GeO y . In addition, this effective synthetic method might provide the methodology for the development of other ternary metal oxides/metal particles/carbon hybrids materials for energy storage.

  6. Phase chemistry and microstructure evolution in silver-clad (Bi2-xPbx)Sr2Ca2Cu3Oy filaments

    International Nuclear Information System (INIS)

    Luo, J.S.; Merchant, N.; Maroni, V.A.; Escorcia-Aparicio, E.; Gruen, D.M.; Tani, B.S.; Riley, G.N. Jr.; Carter, W.L.

    1992-08-01

    The reaction kinetics and mechanism that control the conversion of (Bi,Pb) 2 Sr 2 CaCu 2 O z (Bi-2212) + alkaline earth cuporates to (Bi, Pb) 2 Sr 2 Ca 2 Cu 3 O y (Bi-2223) in silver-clad wires were investigated as a function of equilibration temperature and time at a fixed oxygen partial pressure (7.5% O 2 ). Measured values for the fractional conversion of Bi-2223 versus time have been evaluated based on the Avrami equation. SEM and TEM studies of partially and fully converted wires have revealed that (1) the growth of Bi-2223 is two-dimensional and controlled by a diffusion process, (2) liquid phases are present during part of the Bi-2212 -> Bi-2212 conversion, and (3) segregation of the second phases occurs in early time domains of the reaction

  7. Application of ferrous-chromate and idometric titration for the determination of copper oxidation states in the superconductor YBa2Cu3Oy

    International Nuclear Information System (INIS)

    Oku, Masaoki; Kimura, Jin; Hosoya, Minoru; Takada, Kunio; Hirokawa, Kichinosuke

    1988-01-01

    Oxidation-reduction titration methods, Fe 2+ -Cr 2 O 7 2- and I - -S 2 O 3 2- , were applied to the determination of the oxidation state of copper in the superconductor YBa 2 Cu 3 O y and related compounds. The former method presented problems in the sample dissolution and titration steps. The dissolution of the sample in low concentrations of Fe 2+ -phosphoric acid and Fe 2+ -perchloric acid takes place in two steps, the oxidation of Fe 2+ to Fe 3+ and the liberation of oxygen gas, when the liberation results in low analytical values for Cu 3+ . In addition the coexistence of cuprous ion and acids induces the oxidation of ferrous ion by dissolved oxygen and air. The problems were resolved by dissolution in 0.1 mol/l Fe 2+ -phosphoric acid and titration in an argon atmosphere. The latter method gave good results by controlling the amounts of potassium chloride, the concentration of acetic acid, and by elimination of the dissolved oxygen in acetic acid solution. The results of the two titration methods coincided with each other. (orig.)

  8. Magnetic, electrical and structural properties of the Re-doped ruthenocuprate Ru1−xRexSr2GdCu2Oy

    International Nuclear Information System (INIS)

    Corredor, L.T.; Albino Aguiar, J.; Landínez Téllez, D.A.; Pureur, P.; Mesquita, F.; Roa-Rojas, J.

    2015-01-01

    Highlights: • We investigated the effect of the dilution of magnetic Ru sub-lattice of RuSr 2 GdCu 2 O 8 . • We synthesized the doped compound Rui x Re x Sr 2 GdCu 2 O y , for 3%, 6%, 9% and 12% Re. • Re would affect the electron coupling: just 3 and 6% samples were superconductor. • Superconductivity emergence strongly affects magnetic properties of 3 and 6% samples. • A weak ferromagnetic component is consistent with a globally antiferromagnetic system. - Abstract: Despite the discovery of new superconductors classes, high-Tc oxides continue to be a current topic, because of their complex phase diagrams and doping-dependant effects (allowing one to investigate the interaction between orbitals), as well as structural properties such as lattice distortion and charge ordering, among many others. Ruthenocuprates are magnetic superconductors in which the magnetic transition temperature is much higher than the critical superconducting temperature, making them unique compounds. With the aim of investigating the dilution of the magnetic Ru sub-lattice, we proposed the synthesis of the Ru 1−x Re x Sr 2 GdCu 2 O y ruthenocuprate-type family, adapting the known two-step process (double perovskite + CuO) by directly doping the double perovskite, thus obtaining the perovskite compound Sr 2 GdRu 1−x Re x O y , which represents a new synthesis process to the best of our knowledge. Our samples were structurally characterized through X-ray diffraction, and the patterns were analysed via Rietveld refinement. A complete magnetic characterization as a function of temperature and applied field, as well as transport measurements were carried out. We discuss our results in the light of the two-lattice model for ruthenocuprates, and a relation between RuO 2 (magnetic) and CuO 2 (superconductor) sub-lattices can clearly be observed

  9. Effects of calcium doping on the superconducting properties of top-seeded melt growth processed Y1.5Ba2-xCaxCu3Oy superconductors

    International Nuclear Information System (INIS)

    Park, S.D.; Kim, H.J.; Park, B.J.; Han, Y.H.; Jun, B.-H.; Lee, J.S.; Kim, C.-J.

    2011-01-01

    We study effects of calcium doping in melt processed Y123 superconductors. We examine a superconducting transition temperature and current density. A transition temperature and current density decreases by calcium doping. Calcium doping leads to coarseing of Y211 particles. Y211 refining effect by CeO 2 is disappreared by calcium doping. The effect of calcium doping on the superconducting properties of top seeded melt growth (TSMG) processed Y 1.5 Ba 2-x Ca x Cu 3 O y superconductors was studied in terms of calcium content (X ca ). YBa 2-x Ca x Cu 3 O 7-δ (X ca = 0, 0.005, 0.01, 0.02, 0.04, 0.1, 0.3) powders were synthesized by the powder calcination method. YBa 2-x Ca x Cu 3 O 7-δ powders were mixed with 0.25 mole Y 2 O 3 powder and 1 wt.% CeO 2 as Y 2 BaCuO 5 (Y211) refiner, and finally made into Y 1 . 5 Ba 2-x Ca x Cu 3 O y (Y1.5) + 1 wt.% CeO 2 composition. The single Y123 growth on the top surface was observed up to X ca = 0.1, while the multiple Y123 growth was observed at X ca ≥ 0.1. The superconducting transition temperature (T c ) and critical current density (J c ) of TSMG processed Y1.5 samples were inversely proportional to X ca . The Y211 size increased with increasing X ca due to the enhancement of Y211 coarsening by calcium doping. No Y211 refining effect by CeO 2 was observed in the calcium doped samples. The T c and J c decrease by calcium doping are likely to be due to the calcium incorporation with the Y123 lattice and formation of coarse Y211 particles.

  10. High-temperature electrical properties of the Bi2.1Sr1.9(Ca1-xYx)Cu2Oy solid solution

    International Nuclear Information System (INIS)

    Hong, Byungsun; Mason, T.O.

    1993-01-01

    By a combination of conventional physical property measurements and high temperature electrical property studies, the solid solution limit, transport parameters, and potential defect regimes of the Bi 2.1 Sr 1.9 (Ca 1 - x Y x )Cu 2 O y solid solution were established. A continuous solid solution extends to x = 0.7 or 0.8. The electrical properties indicate that the product of the hole density-of-states and mobility for semiconducting compositions is approximately an order of magnitude smaller than for the other p-type superconducting cuprates. A pronounced drop in hole concentration accompanies the tetragonal-to-orthorhombic transition at x = 0.5, where after superconductivity disappears. The electrical properties also indicate that a composition x ≥ 0.7 is the appropriate ''reference'' compound for the solid solution series. Upon doping this yttrium-rich insulating composition with calcium, holes are introduced. With increased calcium content (decreased yttrium content) the system exhibits several defect regimes reminiscent of the behavior in the La 2 - x AE x CuO 4 (AE = Sr or Ba) system. Oxygen defects (interstitial and vacancies) are believed to play an important role in the defect structure

  11. Seebeck and Nernst effects in the mixed state of YBa2Cu3Oy single crystals: A probe for the scattering rate of quasiparticles

    International Nuclear Information System (INIS)

    Sato, Y.; Terasaki, I.; Tajima, S.

    1996-01-01

    Transport properties under a temperature gradient were investigated in the mixed state of YBa 2 Cu 3 O y single crystals. The ratio of the Seebeck coefficient S xx to the resistivity ρ xx , which is proportional to the thermal current, exhibits a remarkable magnetic field dependence. This implies that the quasiparticles driven by the temperature gradient are scattered by vortices to reduce their lifetime. Quantitative investigation for the H dependence of S xx /ρ xx reveals the lifetime enhancement of the quasiparticle below T c . copyright 1996 The American Physical Society

  12. Effect of annealing temperature on structural and electrical properties of high-κ YbTixOy gate dielectrics for InGaZnO thin film transistors

    International Nuclear Information System (INIS)

    Pan, Tung-Ming; Chen, Fa-Hsyang; Hung, Meng-Ning

    2015-01-01

    This paper describes the effect of annealing temperature on the structural properties and electrical characteristics of high–κ YbTi x O y gate dielectrics for indium–gallium–zinc–oxide (IGZO) thin-film transistors (TFTs). X-ray diffraction, x-ray photoelectron spectroscopy and atomic force microscopy were used to study the structural, chemical and morphological features, respectively, of these dielectric films annealed at 200, 300 and 400 °C. The YbTi x O y IGZO TFT that had been annealed at 400 °C exhibited better electrical characteristics, such as a small threshold voltage of 0.53 V, a large field-effect mobility of 19.1 cm 2 V −1 s −1 , a high I on /I off ratio of 2.8 × 10 7 , and a low subthreshold swing of 176 mV dec. −1 , relative to those of the systems that had been subjected to other annealing conditions. This result suggests that YbTi x O y dielectric possesses a higher dielectric constant as well as lower oxygen vacancies (or defects) in the film. In addition, the instability of YbTi x O y IGZO TFT was studied under positive gate-bias stress and negative gate-bias stress conditions. (paper)

  13. Structural and electrical characteristics of high-κ ErTixOy gate dielectrics on InGaZnO thin-film transistors

    International Nuclear Information System (INIS)

    Chen, Fa-Hsyang; Her, Jim-Long; Shao, Yu-Hsuan; Li, Wei-Chen; Matsuda, Yasuhiro H.; Pan, Tung-Ming

    2013-01-01

    In this paper, we investigated the structural properties and electrical characteristics of high-κ ErTi x O y gate dielectrics on indium-gallium-zinc oxide thin-film transistors (IGZO TFTs). We used X-ray diffraction, X-ray photoelectron spectroscopy, and atomic force microscopy to investigate the structural and morphological features of these dielectric films after they had been subjected to annealing at various temperatures. The high-κ ErTi x O y IGZO TFT device annealed at 400 °C exhibited better electrical characteristics in terms of a large field-effect mobility (8.24 cm 2 /V-s), low threshold voltage (0.36 V), small subthreshold swing (130 mV/dec), and high I on/off ratio(3.73 × 10 6 ). These results are attributed to the reduction of the trap states and oxygen vacancies between the ErTi x O y film and IGZO active layer interface during high-temperature annealing in oxygen ambient. The reliability of voltage stress also can be improved by the oxygen annealing at 400 °C. - Highlights: • ErTi x O y InGaZnO thin-film transistors (TFT). • Structural and electrical properties of the TFT were investigated. • TFT device annealed at 400 °C exhibited better electrical characteristics. • Reliability of TFT device can be improved by annealing at 400 °C

  14. High dielectric constant PrYxOy sensing films electrolyte-insulator-semiconductor pH-sensor for the detection of urea

    International Nuclear Information System (INIS)

    Wu, Min-Hsien; Lee, Cheng-Da; Pan, Tung-Ming

    2009-01-01

    In this paper, we describe the structural and sensing properties of high-k PrY x O y sensing films deposited on Si substrates through reactive co-sputtering. Secondary ion mass spectrometry and atomic force microscopy were employed to analyze the compositional and morphological features of these films after annealing at various temperatures. The electrolyte-insulator-semiconductor (EIS) device incorporating a PrY x O y sensing membrane that had been annealed at 800 o C exhibited good sensing characteristics, including a high sensitivity (59.07 mV pH -1 in solutions from pH 2 to 12), a low hysteresis voltage (2.4 mV in the pH loop 7 → 4 → 7 → 10 → 7), and a small drift rate (0.62 mV h -1 in the buffer solution at pH 7). The PrY x O y EIS device also showed a high selective response towards H + . This improvement can be attributed to the small number of crystal defects and the large surface roughness. In addition, the enzymatic EIS-based urea biosensor incorporating a high-k PrY x O y sensing film annealed at 800 o C allowed the potentiometric analysis of urea, at concentrations ranging from 1 to 16 mM, with a sensitivity of 9.59 mV mM -1 .

  15. Structural Properties and Sensing Performance of CeYxOy Sensing Films for Electrolyte-Insulator-Semiconductor pH Sensors.

    Science.gov (United States)

    Pan, Tung-Ming; Wang, Chih-Wei; Chen, Ching-Yi

    2017-06-07

    In this study we developed CeY x O y sensing membranes displaying super-Nernstian pH-sensitivity for use in electrolyte-insulator-semiconductor (EIS) pH sensors. We examined the effect of thermal annealing on the structural properties and sensing characteristics of the CeY x O y sensing membranes deposited through reactive co-sputtering onto Si substrates. X-ray diffraction, atomic force microscopy, and X-ray photoelectron spectroscopy revealed the structural, morphological, and chemical features, respectively, of the CeY x O y films after their annealing at 600-900 °C. Among the tested systems, the CeY x O y EIS device prepared with annealing at 800 °C exhibited the highest sensitivity (78.15 mV/pH), the lowest hysteresis voltage (1.4 mV), and the lowest drift rate (0.85 mV/h). Presumably, these annealing conditions optimized the stoichiometry of (CeY)O 2 in the film and its surface roughness while suppressing silicate formation at the CeY x O y -Si interface. We attribute the super-Nernstian pH-sensitivity to the incorporation of Y ions in the Ce framework, thereby decreasing the oxidation state Ce (Ce 4+  → Ce 3+ ) and resulting in less than one electron transferred per proton in the redox reaction.

  16. For the Good of All : Integrating corporate social responsibility into the business strategy of small and medium sized enterprises in Finland: CASE: Oy Vallila Interior Ab

    OpenAIRE

    Anttila, Hannele

    2010-01-01

    Corporate social responsibility (CSR) can be defined as a concept that includes simultaneous fulfilment of a company’s economic, legal, ethical and philanthropic responsibilities, as well as companies integrating social and environmental concerns in their business operations and in their interaction with their stakeholders on a voluntary basis. The purpose of this dissertation is to investigate CSR from the perspective of small and medium sized enterprises (SMEs), more specifically from t...

  17. Dependence of critical current properties on growth temperature and doping level of nanorods in PLD-YBa2Cu3Oy films

    International Nuclear Information System (INIS)

    Fujita, N.; Haruta, M.; Ichinose, A.; Maeda, T.; Horii, S.

    2013-01-01

    Highlights: •We fabricated Y123 films with Ba–Nb–O nanorods at various growth temperatures. •Irreversibility lines depended on growth temperature and doping level of Ba–Nb–O. •Nanorod morphology was drastically changed by growth temperature (T s ). •Its T s dependence of the matching field was different from that for Er123 + Ba–Nb–O. -- Abstract: The vortex-Bose-glass-like irreversibility lines (ILs) emerged for 2.5 and 5.0 at.% Ba–Nb–O (BNO)-doped YBa 2 Cu 3 O y films deposited by PLD using Nd:YAG-laser. The ILs strongly depended on growth temperature (T s ) in addition to the doping level of BNO. The vortex glass region was expanded with increasing T s or doping level of BNO. Drastic change of the nanorod morphology from short and bended nanorods to long and linear nanorods with increasing T s was clarified. Moreover, it was found that T s -dependent ILs were quite different from our previous results in BNO-doped ErBa 2 Cu 3 O y films

  18. Growth temperature dependence of flux pinning properties in ErBa2Cu3Oy thin films with nano-rods

    International Nuclear Information System (INIS)

    Haruta, M.; Sueyoshi, T.; Fujiyoshi, T.; Mukaida, M.; Kai, H.; Matsumoto, K.; Mele, P.; Maeda, T.; Horii, S.

    2011-01-01

    Nano-rods were introduced into ErBa 2 Cu 3 O y thin films to improve J c . Pinning properties depended on the growth temperature of the films. Morphology of nano-rods was affected by the growth temperature. The growth temperature is important to achieve high in-field J c 's. Irreversibility lines and distributions of local critical current density (J cl ) based on the percolation transition model were affected by the growth temperature (T s ) in 3.5 wt.%-BaNb 2 O 6 -doped ErBa 2 Cu 3 O y thin films. The vortex-Bose-glass-like state appeared by the introduction of nano-rods, and this vortex state was affected by T s . The shape and width of the J cl distribution strongly depended on T s . These results are probably caused by variations of the density and the growth direction for nano-rods reflecting T s . The growth temperature is an important factor to achieve higher critical current properties under magnetic fields for coated conductors of rare-earth-based cuprates with nano-rods.

  19. Density and critical current of metal-sheathed superconducting YBa2Cu3Oy ceramics deformed by hydroextrusion and subsequent drawing-rolling

    International Nuclear Information System (INIS)

    Karpov, M.I.; Korzhov, V.P.; Gnesin, B.A.; Snegirev, A.A.

    1994-01-01

    The critical-current density j c in ceramic superconductors is strongly dependent on texture, which is determined by the orientation of ceramic grains with respect to the specimen axes and by the misalignment between grains. Y ceramics with prolate grains aligned parallel to the long axis of the specimen were obtained by melt solidification. Such ceramics exhibited j c = 18500 A/cm 2 at 77 K in zero magnetic field. Texturing was also achieved by rolling Ag-sheathed powder of superconducting ceramics. This method ensured critical current densities (2-7) x 10 3 A/cm 2 in Y, Bi, and Tl ceramics. In flat ceramic samples, the grains of a superconducting phase were oriented in such a way that the crystallographic c axis was perpendicular to the rolling plane. In this work, the authors studied the effect of rolling deformation on the current-carrying capacity j c and density p of metal-sheathed YBa 2 Cu 3 O y ceramics that were first subjected to hydroextrusion and drawing at ∼20, 550, and 700 degrees C. The data obtained for j c and p were compared with the texture factor

  20. Synthesis of nanolayers hydroxo-(SnxOyHz) and heteropoly-(HxPWyOz) compounds of hybrid-type on silica surfaces by successive ionic layer deposition method

    International Nuclear Information System (INIS)

    Tolstoy, V.P.; Gulina, L.B.; Korotchenkov, G.S.; Brynsari, V.I.

    2004-01-01

    We determined the synthesis conditions for successive ionic layer deposition of the Sn 16 (OH) x PW 19 O y ·nH 2 O nanolayers on silica surfaces. The synthesized layers were characterized using UV-Vis and FTIR absorption spectroscopies, X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD), scanning electron microscopy (SEM), and atomic force microscopy (AFM). On heating the as-synthesized layers to 200-500 deg. C in air, incorporated water evaporate, while M-OH groups are condensed and concentration of the W-O-W and W-O-Sn bonds increase. The layers have amorphous agglomerate-like structure. The agglomerate size is from 20 to 100 nm. Upon heating to 600 deg. C, the size insignificantly increases, the agglomerate form being practically unchanged. The data obtained allow conclusion that the layers present a hybrid compound consisting of fragments of isopoly-(Sn x O y H z ) and heteropoly-(H x PW y O z ) compounds

  1. Contribution of thickness dependent void fraction and TiSixOy interlayer to the optical properties of amorphous TiO2 thin films

    International Nuclear Information System (INIS)

    Zhang, Fan; Zhang, Rong-Jun; Zheng, Yu-Xiang; Xu, Zi-Jie; Zhang, Dong-Xu; Wang, Zi-Yi; Yu, Xiang; Chen, Liang-Yao

    2013-01-01

    The optical properties of TiO 2 thin films prepared by electron beam evaporation were studied by spectroscopic ellipsometry and analyzed quantitatively using effective medium approximation theory and an effective series capacitance model. The refractive indices of TiO 2 are essentially constant and approach to those of bulk TiO 2 for films thicker than 40 nm, but drop sharply with a decrease in thickness from 40 to 5.5 nm. This phenomenon can be interpreted quantitatively by the thickness dependence of the void fraction and interfacial oxide region. The optical band gaps calculated from Tauc law increase with an increase of film thickness, and can be attributed to the contribution of disorder effect. - Highlights: • Amorphous TiO 2 thin films fabricated on Si substrate by electron beam evaporation • The refractive index and band gap are obtained from spectroscopic ellipsometry. • The refractive index decreases with decreasing film thickness. • Effective medium approximation theory and effective series capacitance model introduced • A band gap increases gradually with an increase in film thickness

  2. Substitutions in cation Nd/Ba subsystem in thin films of high-temperature superconductor NdBa2Cu3Oy

    International Nuclear Information System (INIS)

    Mozhaev, P.B.; Komissinskij, F.V.; Ivanov, Z.G.; Ovsyannikov, G.A.

    2000-01-01

    Thin films of the Nd 1+x Ba 2-x Cu 3 O y (NBCO) high-temperature superconductor with various neodymium and barium ratio are obtained through the method of combined laser spraying of targets with different elements composition. The films with neodymium excess (x >0) had low density of particles on the surface and roughness, however the critical temperature decreased with growth of x. The films with barium excess (x z particles. The NbCO structure and superconducting properties demonstrate strong dependence on the conditions of the films saturation with oxygen [ru

  3. High-quality elliptical iron glycolate nanosheets: selective synthesis and chemical conversion into FexOy nanorings, porous nanosheets, and nanochains with enhanced visible-light photocatalytic activity

    Science.gov (United States)

    Tong, Guoxiu; Liu, Yun; Wu, Tong; Ye, Yucheng; Tong, Chaoli

    2015-10-01

    This paper describes an original and facile polyol-mediated solvothermal synthesis of elliptical iron glycolate nanosheets (IGNSs) combined with precursor thermal conversion into γ-Fe2O3 and α-Fe2O3/γ-Fe2O3 porous nanosheets (PNSs), α-Fe2O3 nanochains (NCs), and elliptical Fe3O4 nanorings (NRs). The IGNSs were produced via the oxidation-reduction and co-precipitation reactions in the presence of iron(iii) salts, ethylene glycol, polyethylene glycol, and ethylenediamine. Control over Fe3+ concentration, temperature, and time can considerably modulate the size and phase of the products. The IGNSs can be transformed to γ-Fe2O3 and α-Fe2O3/γ-Fe2O3 PNSs, α-Fe2O3 NCs, and elliptical Fe3O4 NRs by heat treatment under various annealing temperatures and ambiences. The PNSs and NCs exhibited high soft magnetic properties and coercivity, respectively. Visible-light photocatalytic activity toward RhB in the presence of H2O2 by PNSs and NCs was phase-, SBET, size-, porosity-, and local structure-dependent, following the order: α-Fe2O3 NCs > α-Fe2O3/γ-Fe2O3 PNSs > γ-Fe2O3 PNSs > IGNSs. In particular, α-Fe2O3/γ-Fe2O3 PNSs possessed significantly enhanced photocatalytic activity with good recyclability and could be conveniently separated by an applied magnetic field because of high magnetization. We believe that the as-prepared α-Fe2O3/γ-Fe2O3 PNSs have potential practical use in waste water treatment and microwave absorption.This paper describes an original and facile polyol-mediated solvothermal synthesis of elliptical iron glycolate nanosheets (IGNSs) combined with precursor thermal conversion into γ-Fe2O3 and α-Fe2O3/γ-Fe2O3 porous nanosheets (PNSs), α-Fe2O3 nanochains (NCs), and elliptical Fe3O4 nanorings (NRs). The IGNSs were produced via the oxidation-reduction and co-precipitation reactions in the presence of iron(iii) salts, ethylene glycol, polyethylene glycol, and ethylenediamine. Control over Fe3+ concentration, temperature, and time can considerably modulate the size and phase of the products. The IGNSs can be transformed to γ-Fe2O3 and α-Fe2O3/γ-Fe2O3 PNSs, α-Fe2O3 NCs, and elliptical Fe3O4 NRs by heat treatment under various annealing temperatures and ambiences. The PNSs and NCs exhibited high soft magnetic properties and coercivity, respectively. Visible-light photocatalytic activity toward RhB in the presence of H2O2 by PNSs and NCs was phase-, SBET, size-, porosity-, and local structure-dependent, following the order: α-Fe2O3 NCs > α-Fe2O3/γ-Fe2O3 PNSs > γ-Fe2O3 PNSs > IGNSs. In particular, α-Fe2O3/γ-Fe2O3 PNSs possessed significantly enhanced photocatalytic activity with good recyclability and could be conveniently separated by an applied magnetic field because of high magnetization. We believe that the as-prepared α-Fe2O3/γ-Fe2O3 PNSs have potential practical use in waste water treatment and microwave absorption. Electronic supplementary information (ESI) available: Fig. S1: XPS spectra of the typical precursor samples. (a) Survey spectrum and deconvolution of (b) C 1s peak, (c) Fe 2p3/2 peak, and (d) O 1s peak. Fig. S2: SEM images of the precursor samples formed under various conditions. Fig. S3: TGA and DSC curves of the typical precursor samples under air and N2; Fig. S4: SEM images of the sintered samples under N2 at (a) 300 °C, (b) 600 °C, and (c) 700 °C for 2 h; Fig. S5: SEM images of the sintered samples under N2 at 300 °C for (a) 10 min, (b) 30 min, and (c) 1 h. Table S1: Summary of photocatalytic properties of Fe2O3 and its composites. See DOI: 10.1039/c5nr03689e

  4. Stable self-compliance resistive switching in AlOδ/Ta2O5−x/TaOy triple layer devices

    International Nuclear Information System (INIS)

    Wu, Huaqiang; Li, Xinyi; Huang, Feiyang; Yu, Zhiping; Qian, He; Chen, An

    2015-01-01

    Stable self-compliance property was observed in the AlO δ /Ta 2 O 5−x /TaO y triple-layer resistive random access memory structure. The impact of AlO δ barrier layer was studied with different thicknesses. Endurance of more than 10 10 cycles and data retention for more than 3 h at 125 °C were demonstrated. All the measurements were carried out without external current compliance and no hard breakdown was observed. Systematic analysis reveals the self-compliance property is due to the built-in series resistance of the thin AlO δ barrier layer. A model is proposed to explain this self-compliance property. (paper)

  5. Investigation of the phase equilibria and phase transformations associated with the Bi2Sr2CaCu2Oy superconductor

    International Nuclear Information System (INIS)

    Holesinger, T.

    1993-01-01

    The solid solution region and reaction kinetics of the Bi 2 Sr 2 CaCu 2 O y (2212) superconductor were examined as a function of temperature and oxygen partial pressure. Crystallization studies from the glassy and molten states were undertaken to determine the phase transformation and kinetics associated with the formation of 2212 and other competing phases. Crystallization of nominal 2212 glasses was found to proceed in two steps with the formation of Bi 2 Sr 2-x Ca x CuO y (2201) and Cu 2 O followed by Bi 2 Sr 3-x Ca x O y , CaO, and SrO. The 2212 phase converts from the 2201 phase with increasing temperatures. However, its formation below 800 C was kinetically limited. At 800 C and above, a nearly full conversion to the 2212 phase was achieved after only one minute although considerably longer anneal times were necessary for the system to reach equilibrium. In low oxygen partial pressures, the solidus is reduced to approximately 750 C. Solidification studies revealed an eutectic structure separating the incongruently melting 2212/2201 phases at high oxygen partial pressures from the congruently melting Bi 2 Sr 3-x Ca x O y (23x) and Bi 2 Sr 2-x Ca x O y (22x) phases present at low oxygen partial pressures. During solidification in various oxygen partial pressures, the separation of CaO in the melt and the initial crystallization of alkaline-earth cuprates leaves behind a Bi-rich liquid from which it is impossible to form single-phase 2212. Hence, significant amounts of 2201 were also present in these samples. These problems could be reduced by melt processing in inert atmospheres. Bulk 2212 material produced in this manner was found to possess high transition temperatures, high intergranular critical current densities below 20K, and modest critical current densities at 77K

  6. Exciton generation/dissociation/charge-transfer enhancement in inorganic/organic hybrid solar cells by robust single nanocrystalline LnPxOy (Ln = Eu, Y) doping.

    Science.gov (United States)

    Jin, Xiao; Sun, Weifu; Chen, Zihan; Wei, Taihuei; Chen, Chuyang; He, Xingdao; Yuan, Yongbiao; Li, Yue; Li, Qinghua

    2014-06-11

    Low-temperature solution-processed photovoltaics suffer from low efficiencies because of poor exciton or electron-hole transfer. Inorganic/organic hybrid solar cell, although still in its infancy, has attracted great interest thus far. One of the promising ways to enhance exciton dissociation or electron-hole transport is the doping of lanthanide phosphate ions. However, the underlying photophysical mechanism remains poorly understood. Herein, by applying femtosecond transient absorption spectroscopy, we successfully distinguished hot electron, less energetic electron, hole transport from electron-hole recombination. Concrete evidence has been provided that lanthanide phosphate doping improves the efficiency of both hot electron and "less energetic" electron transfers from donor to acceptor, but the hole transport almost remains unchanged. In particular, the hot electron transfer lifetime was shortened from 30.2 to 12.7 ps, that is, more than 60% faster than pure TiO2 acceptor. Such improvement was ascribed to the facts that the conduction band (CB) edge energy level of TiO2 has been elevated by 0.2 eV, while the valence band level almost remains unchanged, thus not only narrowing the energy offset between CB levels of TiO2 and P3HT, but also meanwhile enlarging the band gap of TiO2 itself that permits one to inhibit electron-hole recombination within TiO2. Consequently, lanthanide phosphate doped TiO2/P3HT bulk-heterojunction solar cell has been demonstrated to be a promising hybrid solar cell, and a notable power conversion efficiency of 2.91% is therefore attained. This work indicates that lanthanide compound ions can efficiently facilitate exciton generation, dissociation, and charge transport, thus enhancing photovoltaic performance.

  7. Growth of high quality Bi2Sr2CaCu2Oy single crystals by the modified vertical Bridgman method

    International Nuclear Information System (INIS)

    Nagashima, O.; Tanaka, H.; Echizen, Y.; Kishida, S.

    2004-01-01

    We grew Bi 2 Sr 2 CaCu 2 O y (Bi-2212) single crystals by the modified vertical Bridgman (VB) method, and investigated their characteristics in order to clarify the optimum growth conditions for obtaining high-quality Bi-2212 single crystals. The Bi-2212 single crystals were grown changing pulling rates or using starting materials after pre-treatments. We found that the superconducting critical temperature (T c ) of the single crystal prepared at a slow growth rate of 0.25 mm/h was about 88 K and that the single crystals were a Bi-2212 single phase. Moreover, the single crystals grown using the starting materials pre-treated in Ar and O 2 atmospheres, had the T c of about 88 and 86 K, respectively. In addition, both of single crystals were Bi-2212 single phase

  8. Isomers of (Ca0.1La0.9)(Ba1.65La0.35)Cu3Oy Superconductor Having Different Tc

    International Nuclear Information System (INIS)

    Knizhnik, A.; Reisner, G.M.; Men, A.; Eckstein, Y.

    1998-01-01

    (Ca 0.1 La 0.9 )(Ba 1.65 La 0.35 )Cu 3 O y is a YBCO like superconductor but tetragonal for any y, i.e. without ordered chains. Its T c vs y plot has no intermediate plateau and is a nearly straight line in the under doped region. Different oxygen contents were obtained by oxygenation at various temperatures under 1 atm O 2 followed by quench in liquid nitrogen. This type of oxygenation leads to samples where the oxygen content corresponds to the thermodynamic equilibrium with the gas phase because the form of attaining the oxygenation temperature (Tom higher or lower temperature) and time (over 10h) of oxygenation do not change y and Tc. Changing of the firing temperature (we used the usual carbonate-oxide preparation which included 3 firings in powder, pelletization, sintering and oxygenation) changes Tc at the same y. The increase of the firing temperature by 40 deg C increases T c by 7-10K while y remains unchanged. Increases of the temperature of sintering virtually do not change T c which shows that low and high Tc compounds are formed during the first stages of preparation and that there is no thermodynamic equilibrium between them. The low Tc compounds cannot be transformed into high Tc ones by raising the temperature

  9. Diagnóstico y cinética de plasmas de NxOy y aire a baja presión. Aplicaciones atmosféricas

    Science.gov (United States)

    Tanarro Onrubia, Isabel

    Los procesos cinéticos que tienen lugar en plasmas de óxidos de nitrógeno y de aire presentan relevancia en diferentes campos de investigación como son los relativos al control de contaminantes atmosféricos emitidos en procesos de combustión, a su formación en las superficies de las naves supersónicas y los vehículos espaciales al entrar en la atmósfera, o a su presencia en la ionosfera terrestre. En general, los fenómenos que tienen lugar en sistemas tan alejados del equilibrio termodinámico como los plasmas luminiscentes, son capaces de originar determinadas especies intermedias y productos finales de reacción a temperaturas y presiones mucho menores que las de otros procedimientos físico-químicos; y hacen posible reproducir y caracterizar en laboratorio ciertas especies inestables y mecanismos primordiales de la alta atmósfera. Por otra parte, las técnicas de resolución temporal aplicadas a plasmas modulados en amplitud resultan notablemente más sensibles que las medidas estacionarias para estimar la relevancia de los distintos mecanismos elementales o incluso para determinar sus constantes de velocidad. En este trabajo se presenta un estudio espectroscópico y espectrométrico comparativo de plasmas de óxidos de nitrógeno y de aire a baja presión (0.001-1 mbar) generados en descargas de cátodo hueco continuas o moduladas, y se propone un modelo cinético único y relativamente sencillo, que explica satisfactoriamente los comportamientos observados en todos ellos. Dicho modelo se basa en la resolución de un sistema de ecuaciones diferenciales dependientes del tiempo, que incluye los mecanismos elementales de disociación e ionización de los precursores y los productos, reacciones homogéneas entre especies atómicas, iónicas y moleculares, y reacciones heterogéneas. Al abordar estos sistemas, se constata una gran carencia de datos experimentales o teóricos sobre secciones eficaces o constantes de velocidad para las reacciones de disociación e ionización por impacto electrónico a bajas energías (<10 eV). Por consiguiente, en el presente trabajo, se proponen las constantes de reacción para varios de estos procesos. Los mecanismos considerados, así como las especies encontradas en estos plasmas, son muy similares a los que tienen lugar en las regiones D y E de la ionosfera terrestre (˜ 80-150 km de altitud), y su estudio en el laboratorio puede contribuir a la interpretación de los datos obtenidos in situ con satélites y sondas.

  10. Sensitive warfarin sensor based on cobalt oxide nanoparticles electrodeposited at multi-walled carbon nanotubes modified glassy carbon electrode (CoxOyNPs/MWCNTs/GCE)

    International Nuclear Information System (INIS)

    Gholivand, Mohammad Bagher; Solgi, Mohammad

    2017-01-01

    In this work, cobalt oxide nanoparticles were electrodeposited on multi-walled carbon nanotubes modified glassy carbon electrode (MWCNTs/GCE) to develop a new sensor for warfarin determination. The modified electrodes were characterized by cyclic voltammetry, scanning electron microscopy (SEM) along with energy dispersive x-ray spectroscopy (EDS), and electrochemical impedance spectroscopy (EIS). The presence of cobalt oxide nanoparticles on the electrode surface enhanced the warfarin accumulation and its result was the improvement in the electrochemical response. The effect of various parameters such as pH, scan rate, accumulation potential, accumulation time and pulse amplitude on the sensor response were investigated. Under optimal conditions, the differential pulse adsorptive anodic stripping voltammetric (DPASV) response of the modified electrode was linear in the ranges of 8 nM to 50 μM and 50 μM to 800 μM with correlation coefficients greater than 0.998. The limit of detection of the proposed method was 3.3 nM. The proposed sensor was applied to determine warfarin in urine and plasma samples.

  11. Value creation in a micro software development company. Understanding the company business model and market place to boost growth: Kumea Oy

    OpenAIRE

    Pallaskari, Antti; Piras, Silvia

    2014-01-01

    The objective of this thesis was to find out the case company’s overall advantages in the market in which it operates and explore the financial viability of employment for all founders. The intention was to study how the company delivers values and how the customers perceive the company services and products; to find out the customers’ expectations and comprehend what channels could better deliver the company’s values. The purpose was to discover the business volume required to have all fo...

  12. [Space-time water monitoring system at the Iriklinsk hydroelectric power station].

    Science.gov (United States)

    Deriabin, D G; Poliakov, E G; Priakhina, A A; Karimov, I F

    2002-01-01

    The Microbiosensor B 17677 F test system was applied to make a space-time monitoring of the biotoxicity of water used for production and everyday purposes at the Iriklinsk hydroelectric power station (IHEPS) and to identify the leading causes determining the biotoxicity of tested samples. There were seasonal variations in the biotoxicity with the maximum in spring and with minimum in winter and spring and a relationship of the spring rise in the biotoxicity to water pH changes. There was also an association of the certain values of the biotoxicity of industrial water with the concentration of petroleum products that are major pollutants at the IHEPS. The datum points that characterize the maximum level of technogenic exposure were identified.

  13. ORF Alignment: NC_005303 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available phytoplasma OY-M] ... Length = 73 ... Query: 1 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAG...PVDKF 60 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAGPVDKF Sbjct: 1 ... MKANIHPQFETVEVSCATCGKQHPIGTTVTSIKIETCSNCHPFYTGAQTFVVKAGPVDKF 60 ...

  14. ORF Alignment: NC_005303 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available phytoplasma OY-M] ... Length = 91 ... Query: 5 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRN...VLPQF 64 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRNVLPQF Sbjct: 1 ... YDLVKAPIITELTNKLIERQNKYTFKVAKTANKVEIKKALESIFQVKVLSVNTRNVLPQF 60 ...

  15. Novel nano-calcium phosphate generation to improve cell activity in bone restructuring

    CSIR Research Space (South Africa)

    Wepener, I

    2010-01-01

    Full Text Available This presentation addresses the replacement and repair of bone. There are four types of biomaterials; namely biotoxic, bioinert, bioactive and ioresorbable. The most abundant inorganic mineral in bone is hydroxyapatite, which is a good candidate...

  16. A new family of NxOy pyridine-containing macrocycles: synthesis and characterization of their Y(III), Ln(III), Zn(II), and Cd(II) coordination compounds

    International Nuclear Information System (INIS)

    Lodeiro, C.; Bastida, R.; Bertolo, E.; Rodriguez, A.

    2004-01-01

    Reaction between 2,6-bis(2-formylphenoxymethyl)pyridine and N,N-bis(3-aminopropyl)methylamine or tris(2-aminoethyl)amine has been used as the starting point for the synthesis of seven oxa-aza macrocyclic ligands, five of them never reported previously. They all feature different pendant arms, which provide a wide range of coordination possibilities. The Schiff base macrocycles L 1 and L 4 and their reduced ligands L 2 and L 5 are derived from 2,6-bis(2-formylphenoxymethyl)pyridine and tris(2-aminoethyl)amine or N,N-bis(3-aminopropyl)methylamine, respectively. The reaction of L 1 with salicylaldehyde forms L 3 , which features an imine bond in the pendant arm. The ligand L 5 has been the precursor for the pendant-armed L 6 and L 7 , by alkylation of the free NH groups with methyl-imidazole or methyl-indole. By a template or a nontemplate approach, we have synthesized different mono- and dinuclear complexes with Y(III), Ln(III), Zn(II), and Cd(II) cations. Both the free macrocyclic ligands and their corresponding metal complexes have been characterized by microanalysis, IR, UV-vis, 1 H and 13 C NMR spectroscopy, FAB mass spectrometry, MS electrospray, and conductivity measurements. (author)

  17. Mechanism of a strong rise of Tc due to the calcium doping in Y1-xCaxBa2Cu2.8Zn0.2Oy

    International Nuclear Information System (INIS)

    Martynova, O.A.; Potapov, D.V.; Gasumyants, V.E.; Vladimirskaya, E.V.

    2011-01-01

    Highlights: → Calcium is observed to restore superconductivity in Y 1-x Ca x Ba 2 Cu 2.8 Zn 0.2 O y . → Parameters of the band spectrum and charge-carrier system are determined. → The calcium doping is shown to give a noticeable contribution to the DOS function. → The mechanism of calcium effect on T c in doped YBa 2 Cu 3 O y is discussed. - Abstract: The normal-state transport properties and the critical temperature, T c , for three series of Y 1-x Ca x Ba 2 Cu 2.8 Zn 0.2 O y (x = 0-0.2) samples with different oxygen content have been investigated and discussed in comparison with results for other calcium-doped YBa 2 Cu 3 O y . We have observed the calcium doping to restore the superconductivity in the YBa 2 Cu 3 O y system even in case of the preliminary T c suppression by the direct destruction of the CuO 2 planes due to a preliminary doping by zinc. The T c value rises strongly with increasing calcium content and this rise becomes faster for the oxygen-reduced series. Based on a narrow-band model, the parameters of the band spectrum structure and the charge-carrier system in the normal state were determined from the analysis of the thermopower temperature dependences in order to reveal the mechanism of the T c rise under the Ca influence. It is shown that the T c increase in Y 1-x Ca x Ba 2 Cu 2.8 Zn 0.2 O y is related to the direct Ca ions effect. The mechanism of the calcium influence on the T c value is discussed with respect to the Ca-induced conduction band modification. The calcium doping in Y 1-x Ca x Ba 2 Cu 2.8 Zn 0.2 O y is shown to give a noticeable contribution to the density-of-states function leading to a strong rise in its value at the Fermi level that results in a restoration of the superconducting properties.

  18. Internal friction and elastic modulus of NdxY1-xBa2Cu3Oy (x 0.0-1.0) at 200 kHz near the orthorhombic-to-tetragonal phase transition

    International Nuclear Information System (INIS)

    Inagaki, M.

    2000-01-01

    The internal friction and Young's modulus of a series of superconductors Nd x Y 1-x Ba 2 Cu 3 O y (x = 0.0-1.0) were measured over the temperature range from 300 to 1050 K using a 200 kHz LiNbO3 piezoelectric composite oscillator. Anelastic relaxation peaks due to oxygen migration were observed at about 850 K. The minimum Young's modulus, which is related to the orthorhombic-to-tetragonal phase transition, was also observed near this temperature. The temperature at the minimum Young's modulus decreased with an increase in the neodymium composition. In contrast, the internal friction peak temperature showed an unsystematic shift with an increase in x, while changes of the average cell structure exhibited a linear relationship when plotted versus the average ionic radius for trivalent rare-earth ions with the coordination number eight. (author)

  19. Esimiesten ja henkilöstöpalveluiden välinen viestintä : Case: Jyväskylän Ammattikorkeakoulu Oy, henkilöstöpalvelut

    OpenAIRE

    Oinonen, Tuomas

    2012-01-01

    Tiivistelmä Työn tavoitteena oli selvittää Jyväskylän ammattikorkeakoulun esimiesten ja henkilöstöpalveluiden välisen viestinnän nykytila, mahdolliset ongelmat viestinnässä, viestintäkanavat sekä lähitulevaisuu-den näkemykset ja odotukset viestintään liittyen. Tarkoituksena oli löytää mahdollisia kehitettäviä osa-alueita sisäisessä viestinnässä näiden kahden ryhmän välillä ja antaa kehitysehdotuksia niihin. Työn teoriaosuudessa käsiteltiin viestinnän merkitys, sisäistä viestintää ja s...

  20. Study of Pt–Rh/CeO2–ZrO2–MxOy (M = Y, La)/Al2O3 three-way catalysts

    International Nuclear Information System (INIS)

    Jiaxiu, Guo; Zhonghua, Shi; Dongdong, Wu; Huaqiang, Yin; Maochu, Gong; Yaoqiang, Chen

    2013-01-01

    CeO 2 –ZrO 2 –M x O y (M = Y; La) mixed oxides, prepared by co-precipitation method and characterized by Brunauer-Emmett-Teller (BET), X-ray diffraction (XRD), Raman spectra (RM) and oxygen pulse reaction, were comparatively investigated to elucidate the combinational effects of Y and/or La oxide promoters on the catalytic activity and anti-aging performance of monolithic cordierite honeycomb catalysts with low Pt and Rh content. The catalytic activities, water-gas shift (WGS) and steam reforming reaction (SR) were studied under a simulated gas mixture. The catalysts were also characterized by H 2 -temperature-programmed reduction (H 2 -TPR) and O 2 -temperature-programmed desorption (O 2 -TPD). The results showed that the prepared CeO 2 –ZrO 2 –M x O y oxides have a face-centered cubic fluorite structure and are nanosize. La 3+ ions can significantly improve thermal stability and efficiently retard CeO 2 –ZrO 2 crystal sintering and growth. Doped CeO 2 –ZrO 2 with Y 3+ and La 3+ has 105 and 60 m 2 /g surface area and 460 and 390 μmol/g OSC before and after aging. The T 50 of fresh Pt–Rh/CZYL/LA is 170 °C for CO, 222 °C for C 3 H 8 and 189 °C for NO, and shift to 205, 262 and 228 °C after hydrothermal aging, which are better than those of Pt–Rh/CZY/LA or Pt–Rh/CZL/LA. WGS and SR are relate to the OSC of oxygen storage materials and absorbed oxygen species on the catalyst surface and affect the three-way catalytic activities of catalysts. The reductive property of noble metals and the dissociatively adsorbed O 2 on the surface of catalysts are closely related to the catalytic activities.

  1. Processing of single- and multi-domain YBa2Cu3Ox bulk materials for levitation applications by Nd1+xBa2-xCu3Oy seeding

    International Nuclear Information System (INIS)

    Todt, V.R.

    1995-01-01

    Melt processing of YBa 2 Cu 3 O x (Y123) is a well established technique to produce materials for levitation applications. We report our new results on the melt-processing of Y123. To achieve materials with high levitation forces we utilize a seeding technique using Nd 1+x Ba 2-x Cu 3 O y- seeds (Nd123). Two different kinds of Nd13-seeds, one plate-shaped and the other cube-shaped, were developed and used for this study. The microstructures of the levitators depended strongly on the type of the seeding material used and on the seeding geometry. We were able to produce large single domains as well as materials containing five domains with three different c-axis orientations. Levitation forces up to 8.2 N for samples with a diameter of about 18 mm were found for the multi-domain samples, which is well within the area of the levitation forces measured for the single domain materials

  2. Askel lähempänä yhteisöllisyyttä : Sosiaalisen median hyödyntäminen Tampereen Messut Oy:n markkinointiviestinnässä

    OpenAIRE

    Sievola, Tuija

    2011-01-01

    Sosiaalinen media on kaikkialla ja sitä on erityisesti yrityksen vaikea sivuuttaa. Sosiaalinen media tarjoaa uusia mahdollisuuksia yrityksen markkinointiviestintään. Siitä on tullut yksi markkinointiviestinnän väline. Sosiaalisen median työkaluja voi käyttää hyödyksi niin viestinnässä kuin asiakaspalvelussakin. Sosiaalisen median työkalut muuttuvat jatkuvasti. Samalla, kun toisia tulee, toiset häviävät. Haastavan sosiaalisesta mediasta tekee mukana pysyminen. Sosiaalinen media tarjoaa kui...

  3. New Method of Preparation of Isomers of the (Ca0.1La0.9)(Ba1.6.5La0.35)Cu3Oy Superconductor with Predicted Maximal Tc

    International Nuclear Information System (INIS)

    Knizhnik, A.; Reisner, G.M.; Men, A.; Eckstein, Y.

    1998-01-01

    The 123 superconductor (Ca 0.1 La 0.9 )(Ba 1.6.5 La 0.35 )Cu 3 O y (c) has been prepared by the usual carbonate-oxide method. After oxygenation to the optimal oxygen doping of y=7.135, the maximal T c =57K. We prepared (c) also via reaction (1): 0.75La(La 0.25 Ba 1.75 )Cu 3 O 6.782 +0.25Ca 0.4 La 0.6 (La 0.65 Ba 1.35 )Cu 3 O 6.806 + 0.033O 2 (Ca 0. 1La 9 )(Ba 1.65 La 0.35 )Cu 3 ) 6.854 (1) The initial reagents are also superconductors. The first (a) has a maximal T c =57K, second (b) - 81K. In reference [1] we have shown that several isomers having the same general formula (c), may exist each having different ratios of the follow- ing possible unit cells: LaBa 2 Cu 3 O y , La(BaLa)Cu 3 O y , LaLa 2 Cu 3 O y , CaBa 2 Cu 3 O y , Ca(BaLa)Cu30 , CaLa2Cu30 . These isomers are formed at different temperatures of the preparation of (c) by carbonate-oxide method [1]. After the formation of compound (c) has been completed, further heating, even to higher temperatures, cannot change one isomer into another. Thus, there is no equilibrium between the (c) isomers and, if there also is no equilibrium in the cases of both isomers (a) and (b), then reaction (1) should not change the ratio of the unit cells. Each cell (i), which is present in (a) in concentration q i (a), should be present in (c) in concentration 0.75q i (a); analogously, each cell (i) which is present in (b) in concentration q i (b) should be present in (c) in concentration 0.25q i (b). According to the cluster component method, [2], T cmax = Σq i T i , where T i is T cmax of such a hypothetical sample, which contains cells (i) only. Thus the expected T cmax of (c), prepared via reaction (1), is: Σ0.75q i (a)T i + Σ0.25q i (b)T i = 0.75 x 57 + 0.25 x 81 = 63K, i.e. higher by 6 degrees than the T cmax of (c) prepared by the usual method. We studied reaction (1) via X-ray diffraction. XRD spectra showed that the intensity of the reagents peaks decrease with the time of the reaction and after 100 hours at 950 deg C only peaks of (c) remain (having the same width as the peaks of (c) prepared via the usual method). After oxygenation to the optimal oxygen doping (y = 7.137) we found that its maximal T c was 63K as predicted. This research was supported by the Israel Science Foundation administered by the Israel Academy of Sciences and Humanities and by the Center of Absorption in Science, Ministry of Immigrant Absorption, State of Israel

  4. Cost effectiveness of pomalidomide in patients with relapsed and refractory multiple myeloma in Sweden.

    Science.gov (United States)

    Borg, Sixten; Nahi, Hareth; Hansson, Markus; Lee, Dawn; Elvidge, Jamie; Persson, Ulf

    2016-05-01

    Multiple myeloma (MM) patients who have progressed following treatment with both bortezomib and lenalidomide have a poor prognosis. In this late stage, other effective alternatives are limited, and patients in Sweden are often left with best supportive care. Pomalidomide is a new anti-angiogenic and immunomodulatory drug for the treatment of MM. Our objective was to evaluate the cost effectiveness of pomalidomide as an add-on to best supportive care in patients with relapsed and refractory MM in Sweden. We developed a health-economic discrete event simulation model of a patient's course through stable disease and progressive disease, until death. It estimates life expectancy, quality-adjusted life years (QALYs) and costs from a societal perspective. Effectiveness data and utilities were taken from the MM-003 trial comparing pomalidomide plus low-dose dexamethasone with high-dose dexamethasone (HIDEX). Cost data were taken from official Swedish price lists, government sources and literature. The model estimates that, if a patient is treated with HIDEX, life expectancy is 1.12 years and the total cost is SEK 179 976 (€19 100), mainly indirect costs. With pomalidomide plus low-dose dexamethasone, life expectancy is 2.33 years, with a total cost of SEK 767 064 (€81 500), mainly in drug and indirect costs. Compared to HIDEX, pomalidomide treatment gives a QALY gain of 0.7351 and an incremental cost of SEK 587 088 (€62 400) consisting of increased drug costs (59%), incremental indirect costs (33%) and other healthcare costs (8%). The incremental cost-effectiveness ratio is SEK 798 613 (€84 900) per QALY gained. In a model of late-stage MM patients with a poor prognosis in the Swedish setting, pomalidomide is associated with a relatively high incremental cost per QALY gained. This model was accepted by the national Swedish reimbursement authority TLV, and pomalidomide was granted reimbursement in Sweden.

  5. Rapid method for determining Sr-89 and Sr-90 using Cherenkov and proportional counting; Schnellmethode zur Bestimmung von SR-89 und SR-90 durch Cerenkov- und Proportionalzaehlermessungen

    Energy Technology Data Exchange (ETDEWEB)

    Lange, S.; Wende, C.; Schwokowski, R.; Alisch-Mark, M.; Abraham, A.; Heinrich, T. [Staatliche Betriebsgesellschaft fuer Umwelt und Landwirtschaft, Radebeul (Germany)

    2016-07-01

    A rapid method for determining Sr-89 and Sr-90 in water, milk and biological samples has been developed and tested. After sample preparation strontium is separated by extraction chromatography using Sr resin. Eluate is divided and transfered to LSC vial and filter paper by SrCO{sub 3} precipitation. A Hidex 300 SL TDCR liquid scintillation counter and Thermo Fisher low level proportional counter have been used. Chemical yield of Sr-85 tracer is determined by Gamma spectroscopy. Uncertainty budget, decision threshold and detection limit are calculated in accordance with GUM and ISO 11929.

  6. 75 FR 49447 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Snapper-Grouper Fishery off the...

    Science.gov (United States)

    2010-08-13

    ... vessels. Depending on the physical structure of a fish's mouth and the way that they take bait, the circle... until modified. OY at equilibrium would be 2,425,000 lb (1,099,961 kg) whole weight. The proposed action... set F OY at a level equivalent to 85 percent F 40%SPR such that OY at equilibrium equals 2,196,000 lb...

  7. B2B-verkkokaupan markkinointiviestintäsuunnitelma

    OpenAIRE

    Luoma, Hanna

    2015-01-01

    Opinnäytetyön aiheena oli luoda markkinointiviestintäsuunnitelma Yritys Oy:n kehitteillä olevalle verkkokaupalle. Työn tavoitteena oli markkinointiviestintäsuunnitelman avulla selvittää miten Yritys Oy:n B2B-verkkokauppa saadaan osaksi myyntitoimia ja miten se mahdollisimman tehokkaasti tuodaan asiakkaiden tietoisuuteen. Yritys Oy on vuonna 2003 perustettu perheyritys, jonka toiminta on kiinnitystekniikan tukkumyynti alan ammattilaisille. Yritys Oy:llä on useampi toimipiste ympäri Suomea...

  8. ORF Alignment: NC_005303 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... phytoplasma OY-M] ... Length = 97 ... Query: 5 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANV...YYTILSDDPTVLKLTEE 64 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANVYYTILS...DDPTVLKLTEE Sbjct: 1 ... AERLSSLIQKELVLINDVIQDEQIGYINLTDVKVTKDLSFANVYYTILSDDPTVLKLTEE 60 ...

  9. ORF Alignment: NC_005303 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... protein [Onion yellows phytoplasma OY-M] ... Length = 102 ... Query: 2 ... LNNIQLIGRITHDPEKQYINS...NNEQIPKIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY 61 ... LNNIQLIGRITHDPEKQYINSNNEQIP...KIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY Sbjct: 1 ... LNNIQLIGRITHDPEKQYINSNNEQIPKIDFQLAVNQTKDKVQYIPCVVFRTQAENFHKY 60 ...

  10. Pretreatment and preheating of scrap; Tarkastelu koskien romun esikaesittely- ja esikuumennusmenetelmiae

    Energy Technology Data Exchange (ETDEWEB)

    Hooli, P.; Hanni, J. [Outokumpu Oy Tornion Tehtaat, Tornio (Finland)

    1990-12-31

    As a background for this study has been those demands for scrap treatments and transportation, which are coming with increasing production of melting shop of Outokumpu Oy`s Tornio works and also problems caused by snow among productionrate. Different pretreatment-, transport-, and preheatingmethods and some alternatives has been studied to arrange those as a functioning complete. Also very exact plannings for some pretreatmentmethods has been made. From preheatingmethods some methods, which are concerned to be effective and possible in the future has been studied. In addition those parameters, which are involved to the effectivity of preheating process in melting shop of Outokumpu Oy`s Tornio works has been examined.

  11. 78 FR 39700 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Snapper-Grouper Fishery off the...

    Science.gov (United States)

    2013-07-02

    ... this rule is to provide socio-economic benefits to snapper-grouper fishermen and communities that... councils to prevent overfishing and to achieve, on a continuing basis, the OY for federally managed fish... fishery managers to end overfishing of stocks while achieving OY from the fishery, and to minimize bycatch...

  12. Finskii grafitsheskii beton teper takzhe i v Estonii / Mait Eelrand

    Index Scriptorium Estoniae

    Eelrand, Mait

    2007-01-01

    Graafilise betooni meetodi arendas 1990. aastate lõpul välja soome sisearhitekt Samuli Naamanka, tehnoloogia on patenteerinud tema asutatud firma Graphic Concrete Oy. AS E-Betoonelement kasutas graafilise betooni tehnoloogiat esimesena Rakveres büroohoone fassaadi kujundamiseks. Kommenteerivad Graphic Concrete Oy tegevdirektor H. Lanningu ja K. Meus AS-st E-Betoonelement

  13. Soomlaste graafiline betoon nüüd ka Eestis / Mait Eelrand

    Index Scriptorium Estoniae

    Eelrand, Mait

    2007-01-01

    Graafilise betooni meetodi arendas 1990. aastate lõpul välja soome sisearhitekt Samuli Naamanka, tehnoloogia on patenteerinud tema asutatud firma Graphic Concrete Oy. AS E-Betoonelement kasutas graafilise betooni tehnoloogiat esimesena Rakveres büroohoone fassaadi kujundamiseks. Kommenteerivad Graphic Concrete Oy tegevdirektor H. Lanningu ja K. Meus AS-st E-Betoonelement

  14. Emerging trends in chemical separations with liquid membranes: an overview

    International Nuclear Information System (INIS)

    Shukla, J.P.

    1997-01-01

    It can be concluded that varied configurations of liquid membranes (LMs) will definitely play an important role in metal separations particularly in situations where other conventional chemical separation techniques fail to deliver goods. Potential areas include decontamination of biotoxic/ radioactive wastes, recovery of precious and strategic metals from lean/ extremely dilute solutions, add on to existing units, hydrometallurgy, etc

  15. Effects of aluminum on root growth and absorption of nutrients by ...

    African Journals Online (AJOL)

    Aluminum (Al) is a biotoxic which often influences the absorption of nutrients by plants in strongly acidic soils. In this experiment, the effect of Al on root growth, absorption of macronutrients; phosphorus (P), potassium (K), calcium (Ca), magnesium (Mg) and micronutrients; iron (Fe), manganese (Mn), copper (Cu) and zinc ...

  16. Heterogeneic dynamics of the structures of multiple gene clusters in two pathogenetically different lines originating from the same phytoplasma.

    Science.gov (United States)

    Arashida, Ryo; Kakizawa, Shigeyuki; Hoshi, Ayaka; Ishii, Yoshiko; Jung, Hee-Young; Kagiwada, Satoshi; Yamaji, Yasuyuki; Oshima, Kenro; Namba, Shigetou

    2008-04-01

    Phytoplasmas are phloem-limited plant pathogens that are transmitted by insect vectors and are associated with diseases in hundreds of plant species. Despite their small sizes, phytoplasma genomes have repeat-rich sequences, which are due to several genes that are encoded as multiple copies. These multiple genes exist in a gene cluster, the potential mobile unit (PMU). PMUs are present at several distinct regions in the phytoplasma genome. The multicopy genes encoded by PMUs (herein named mobile unit genes [MUGs]) and similar genes elsewhere in the genome (herein named fundamental genes [FUGs]) are likely to have the same function based on their annotations. In this manuscript we show evidence that MUGs and FUGs do not cluster together within the same clade. Each MUG is in a cluster with a short branch length, suggesting that MUGs are recently diverged paralogs, whereas the origin of FUGs is different from that of MUGs. We also compared the genome structures around the lplA gene in two derivative lines of the 'Candidatus Phytoplasma asteris' OY strain, the severe-symptom line W (OY-W) and the mild-symptom line M (OY-M). The gene organizations of the nucleotide sequences upstream of the lplA genes of OY-W and OY-M were dramatically different. The tra5 insertion sequence, an element of PMUs, was found only in this region in OY-W. These results suggest that transposition of entire PMUs and PMU sections has occurred frequently in the OY phytoplasma genome. The difference in the pathogenicities of OY-W and OY-M might be caused by the duplication and transposition of PMUs, followed by genome rearrangement.

  17. Online classified advertising - Business needs in the US market : Case: FiareAds web platform

    OpenAIRE

    Tulea, Diana

    2013-01-01

    This Bachelor’s thesis was conducted for Fiare Oy, which offers web platforms for online classified advertising as a service. Fiare Oy intended to grow internationally, develop its US market share and possibly open an office in the US. The objective of this thesis was to shed light on the business needs in the US market and give recommendations for actions to Fiare Oy. The thesis project started on 4 October 2012 and ended on 17 September 2013. The literature consulted for this study rela...

  18. MM-rallin vaikutus Toyotan brändiin

    OpenAIRE

    Laurila, Heini

    2017-01-01

    Tämän insinöörityön tarkoituksena oli selvittää, millainen vaikutus MM-ralliin palaamisella on Toyotan brändiin Suomessa. Insinöörityö toteutettiin yhteistyössä Suomen Toyotan ja Lexuksen maahantuojayrityksen, Toyota Auto Finland Oy:n sekä AKK Sports Oy:n kanssa. AKK Sports Oy on vastuussa vuosittaisen Suomen MM-ralliosakilpailun, Neste Rallin, järjestämisestä. Tutkimuksen taustatyönä tutustuttiin ensin brändejä ja markkinointia koskevaan kirjallisuuteen. Sen lisäksi käytiin läpi Toyotan ...

  19. KYLÄKAUPPAKETJUN LIIKETOIMINTASUUNNITELMAN PERUSTA

    OpenAIRE

    Rantala, Miki

    2013-01-01

    Tämän opinnäytetyön tarkoitus oli laatia Gimmefive Oy:lle kyläkauppaketjun liiketoimintasuunnitelman perusta. Gimmefive Oy hallinnoi kahta kyläkauppaa Kymenlaakson alueella. Tarkoitus oli tutkia ja tehdä kehitysehdotuksia asioista, joissa vaatimukset kasvavat liiketoiminnan laajentuessa ketjutasolle. Tavoitteena oli saada Gimmefive Oy:lle suunnitelma siitä, miten sen kannattaa lähteä toteuttamaan ja kehittämään liiketoimintaa kyläkauppaketjun toimintaympäristössä, koska kyläkauppojen lukumäär...

  20. Nuclear waste management programme 2003 for the Loviisa and Olkiluoto nuclear power plants

    International Nuclear Information System (INIS)

    2002-09-01

    A joint company Posiva Oy founded by nuclear energy producing Teollisuuden Voima Oy (TVO) and Fortum Power and Heat Oy coordinates the research work of the companies on nuclear waste management in Finland. In Posiva's Nuclear Waste Management Programme 2003, an account of the nuclear waste management measures of TVO and Fortum is given as required by the sections 74 and 75 of the Finnish Nuclear Energy Degree. At first, nuclear waste management situation and the programme of activities are reported. The nuclear waste management research for the year 2003 and more generally for the years 2003-2007 is presented

  1. Protecting the endangered lake salmon

    International Nuclear Information System (INIS)

    Soimakallio, H.; Oesch, P.

    1997-01-01

    In addition to the Ringed Seal, the labyrinthine Saimaa lake system created after the Ice Age also trapped a species of salmon, whose entire life cycle became adapted to fresh water. In order to improve the living conditions of this lake salmon which - like the ringed seal - is today classified as an endangered species, an intensive research programme has been launched. The partners include the Finnish Game and Fisheries Research Institute, fishing and environmental authorities and - in collaboration with UPM-Kymmene Oy and Kuurnan Voima Oy - the IVO subsidiary Pamilo Oy

  2. Air Power for Patton’s Army

    Science.gov (United States)

    2002-01-01

    TROYES 04-T7S•9LIE MANS - .. IoY-35 oA-39 • ORLEANS OY4 NIANTES TOURS IRE uOWs *SOURSES gYg9 OY-50 PIEVERS OY-4 LE GREU30T ,LA EI.LE F R A N C E 50 0 50...moving forward rapidly against Melun, Louviers, and Troyes , they anticipated the highly mobile campaign would soon move beyond Paris to the German...while the XX Corps reached Melun and the XI1 Corps captured Troyes . In the increasingly distant west, VIII Corps as promised, launched its long-awaited

  3. Protecting the endangered lake salmon

    Energy Technology Data Exchange (ETDEWEB)

    Soimakallio, H.; Oesch, P. [ed.

    1997-11-01

    In addition to the Ringed Seal, the labyrinthine Saimaa lake system created after the Ice Age also trapped a species of salmon, whose entire life cycle became adapted to fresh water. In order to improve the living conditions of this lake salmon which - like the ringed seal - is today classified as an endangered species, an intensive research programme has been launched. The partners include the Finnish Game and Fisheries Research Institute, fishing and environmental authorities and - in collaboration with UPM-Kymmene Oy and Kuurnan Voima Oy - the IVO subsidiary Pamilo Oy

  4. Study of the total uranium in underground water in the city of Jimenez, Chihuahua; Estudio del uranio total en agua subterranea en la Ciudad de Jimenez, Chihuahua

    Energy Technology Data Exchange (ETDEWEB)

    Renteria V, M. [Centro de Investigacion de Materiales Avanzados (CIMAV), Av. Miguel de Cervantes Saavedra 120, 31109 Chihuahua (Mexico)]. e-mail: marusia.renteria@cimav.edu.mx

    2004-07-01

    Samples of water of wells in the city of Jimenez, Chihuahua were analyzed, and its were determined the content of total uranium. It was used the technique of extraction of uranium from water adding Bis ( 2- ethylexyl) phosphate and scintillating Beta plate Hi safe, and the measures of the activities were carried out in the portable scintillation detector Thiathler- O Y HIDEX. The obtained interval of concentrations was 0.12 to 0.26 Bq/l that it is finds below the maximum permissible limits that it manages the Mexican regulation. It was found a significant correlation among the concentration of uranium and those total solid dissolved present in the samples. (Author)

  5. Optimization of cocktail volume in estimation of Tritium activity using liquid scintillation spectrometer

    International Nuclear Information System (INIS)

    Kumaravel, S.; Narashimha Nath, V.; Prashanth Kumar, M.; Sunil, C.N.; Raghunath, T.; Bera, Utpal; Ramakrishna, V.; Nair, B.S.K.; Ganesh, G.; Tripathi, R.M.

    2016-01-01

    Liquid Scintillation Spectrometers (LSS) are widely used for the estimation of Tritium in Nuclear Industry and Environmental labs to find out the Tritium concentration. The main component used for the detection of tritium is the liquid scintillation cocktail composed of different chemicals. To reduce the radioactive chemical wastes and the cost of liquid scintillation cocktails the use of as small volume of cocktail as possible is required. Typically, 1 ml of the aqueous sample is added with 5 ml of the liquid scintillation cocktail in a 20 ml low potassium glass. In this study, suitability of the combination of I ml aqueous sample with 2.5 ml cocktail in a 7 ml low potassium glass vial using a HIDEX 300 SL TDCR LSS was carried out instead of the other combination

  6. Study of the total uranium in underground water in the city of Jimenez, Chihuahua

    International Nuclear Information System (INIS)

    Renteria V, M.

    2004-01-01

    Samples of water of wells in the city of Jimenez, Chihuahua were analyzed, and its were determined the content of total uranium. It was used the technique of extraction of uranium from water adding Bis ( 2- ethylexyl) phosphate and scintillating Beta plate Hi safe, and the measures of the activities were carried out in the portable scintillation detector Thiathler- O Y HIDEX. The obtained interval of concentrations was 0.12 to 0.26 Bq/l that it is finds below the maximum permissible limits that it manages the Mexican regulation. It was found a significant correlation among the concentration of uranium and those total solid dissolved present in the samples. (Author)

  7. Comparison of triple to double coincidence ratio and Quench Parameter External methods for the determination of 3H efficiency by liquid scintillation counting

    International Nuclear Information System (INIS)

    Nisti, M.B.; Saueia, C.H.R.; Mazzilli, B.P.

    2013-01-01

    The aim of this study is to determine the tritium efficiency by liquid scintillation counting using two methodologies, Quench Parameter External (QPE) and Triple to Double Coincidence Ratio (TDCR), and to compare the results. The equipment used was the HIDEX model 300-SL Liquid Scintillation Counter, composed of three photomultipliers coupled with coincidence pulses, discrimination level and Mikro Win 2000 software. The efficiency varied from 0.028 to 0.706 cps dps -1 for QPE and from 0.061 to 0.703 cps dps -1 for TDCR. Different efficiencies were obtained using both methods, in the range from 459 to 572 quenching, above this range the efficiencies were similar. The verification of the efficiencies was performed by participating in the Intercomparison National Program (PNI). (author)

  8. Esilinastus väge täis "Mina olin siin" / Kutt Kommel

    Index Scriptorium Estoniae

    Kommel, Kutt

    2008-01-01

    Rene Vilbre noortefilm "Mina olin siin", mille aluseks on Sass Henno romaan "Mina olin siin. Esimene arest" : operaator Mait Mäekivi : osades Rasmus Kaljujärv, Hele Kõre jt : Amrion Productions - Helsinki-filmi OY 2008

  9. Millest unistad ja kelleks tahad saada, ilus poiss? / Kati Murutar

    Index Scriptorium Estoniae

    Murutar, Kati, 1967-

    2008-01-01

    Rene Vilbre noortefilm "Mina olin siin", mille aluseks on Sass Henno romaan "Mina olin siin. Esimene arest" : osades Rasmus Kaljujärv, Hele Kõre, Tambet Tuisk, Jaan Rekkor : Amrion Productions - Helsinki-filmi OY

  10. Parimad Eesti Flakes toolid

    Index Scriptorium Estoniae

    2007-01-01

    ELKE Mööbli, Eesti Sisearhitektide Liidu ja Piiroinen OY korraldatud Flakes toolide Eesti kujunduskonkursi tulemused: I preemia - Heino Prunsvelt, II - Kadi Hektor, III - Andres Labi. Piironen OÜ eripreemiad - Andres Lember, Gerly Grünbaum, Kaarin Kokk

  11. Helsingi ehitab : lõppes Musiikkitalo konkurss / Ingrid Lillemägi

    Index Scriptorium Estoniae

    Lillemägi, Ingrid

    2000-01-01

    Helsingi uue kontserdimaja nn. Musiikkitalo rahvusvahelisest arhitektuurikonkursist, mille võitsid arhitektid Ola Laiho, Mikko Pulkkinen ja Marko Kivistö arhitektuuribüroost Laiho, Pulkkinen & Raunio OY

  12. 75 FR 38030 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2010-07-01

    ... disruption to summer fisheries, as no additional restrictions to fishery management measures are necessary at... impacts within the lowered yelloweye rockfish OY in accordance with the court's order; makes routine in...

  13. Alkogol v Estonii - ne kazhdomu po pletshu / Andrei Akulistõi

    Index Scriptorium Estoniae

    Akulistõi, Andrei

    2005-01-01

    Onistari senine tegevjuht Oleg Kraizmer lahkus ettevõttest, aastatel 2001-2004 jõudis alkoholitootja 60 miljonilise kahjumini. Oleg Kraizmer jätkab firma Saimaa Beverages Oy Ltd ekspordiosakonna juhina

  14. Soomlase disainitud tool sai preemia

    Index Scriptorium Estoniae

    2005-01-01

    Isku OY disaineri Tapio Anttila loodud tool Haiku sai rahvusvahelisel disainikonkursil ADEX 2004 mööbli kategoorias Adex Silveri preemia. Mullu sai sama tool Chicago arhitektuuri- ja disainimuuseumi preemia Good Design Award

  15. CMS rewards its best suppliers with the Crystal Award

    CERN Document Server

    Patrice Loiez

    2002-01-01

    A. Ingman of the Finnish company Outokumpu Pori Oy, F. Krähenbuhl of the Swiss firm Nexans Suisse and M. Niemerski of the American company Plascore receive the highest distinction in the CMS supplier awards - the Crystal Award.

  16. Acute toxicity and genotoxicity of fermented traditional medicine oyaksungi-san

    Directory of Open Access Journals (Sweden)

    Hwayong Park

    2017-06-01

    Conclusion: As a whole, no acute toxicity or genotoxicity were observed in all the assays examined. Therefore, fermented OY is considered to be a safe material that can be used for development of complementary and alternative medicine using bioconversion.

  17. LHV kinnitab Soome laenuturul kanda / Silvia Kruusmaa ; kommenteerinud Raul Malmstein

    Index Scriptorium Estoniae

    Kruusmaa, Silvia

    2010-01-01

    LHV sai Soome finantsinspektsioonilt loa hakata osutama piiriüleseid teenuseid Soomes, pank sõlmis Luottotalo Fenno Oy-ga laenuportfelli ostulepingu, omandades ligikaudu 12 500 eraisiku laenulepingud

  18. Narva Elektrijaamade renoveerimine - projekti ettevalmistus, teostus ja tulemused / Mati Uus

    Index Scriptorium Estoniae

    Uus, Mati

    2005-01-01

    2001. a. sõlmis AS Narva Elektrijaamad tarnelepingu Soome firmaga Foster Wheeler Energia OY kahe energiaploki kompleksseks renoveerimiseks. Lepingu maksumus oli 244 miljonit eurot ning ühe ploki ehitusaeg 30 kuud

  19. Polumilliardnõi spor budut reshat v Londone / Artur Tooman

    Index Scriptorium Estoniae

    Tooman, Artur, 1971-

    2006-01-01

    Soome peatöövõtja Foster Wheeler Energia OY nõuab rahvusvahelise arbitraazhi kaudu Eesti Energialt 38 miljonit eurot, tegemist on Narva Elektrijaamade energiablokkide renoveerimise lepingu ja selle täitmisel tekkinud vaidlusega

  20. Automation of library system: A study of John Harris library ...

    African Journals Online (AJOL)

    Information Technologist (The) ... and querying library records, maintains defaulting patrons overdue fines account while the OPAC empl oy ... The automated system generates reports necessary for an informed management decision making.

  1. 50 CFR 600.330 - National Standard 5-Efficiency.

    Science.gov (United States)

    2010-10-01

    ...) Efficiency. In theory, an efficient fishery would harvest the OY with the minimum use of economic inputs such... techniques of harvesting, processing, or marketing, and should avoid creating strong incentives for excessive...

  2. Mise-a-la-masse surveys at Olkiluoto, 2006

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2007-02-01

    Suomen Malmi Oy conducted Mise-a-la-masse surveys at Olkiluoto site in Eurajoki during November and December 2006. The surveys are a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included field work, data processing and technical raporting. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. Data is delivered digitally in xyz-format. (orig.)

  3. Proof-of-Concept Prototyping for Observis Platform

    OpenAIRE

    Ekimov, Victor

    2012-01-01

    Observis Oy is a start-up company first appeared in January 2011. The company is building up a measurement platform that is open and easy to connect. It helps measurement device suppliers, system and service providers, and analyzing services to found and combine each other’s products to create more value to the end customers. Observis Oy intends to develop a platform for integration with other services in order to provide management functionality in environmental field of business. Platform i...

  4. Laatu- ja validointitoiminta elintarviketeollisuudessa

    OpenAIRE

    Vanhatalo, Heidi

    2017-01-01

    Opinnäytetyö laadittiin Zeus Tech Oy:n toimeksiannosta. Zeus Tech Oy tuottaa validointi-, mittaus-, testaus- ja laadunvarmistuspalveluja lääke- ja bioteollisuuden, sekä elintarviketeollisuuden alojen toimijoille. Tarkoituksena oli selvittää laatu- ja validointitoiminnan kehittämiskohteita elintarviketeollisuudessa. Opinnäytetyön teoriaosuudessa käsitellään laatua, laadunvalvontaa ja -hallintaa, sekä validointia elintarviketeollisuudessa. Työn kokeellisessa osuudessa luotiin kyselytutkimus...

  5. How can companies build and maintain trust in social media?

    OpenAIRE

    Donchev, Mihail

    2012-01-01

    In the PR and Communications industry there has been a dramatic shift in the effectiveness of bought channels vs. earned media. The client of this research project, Miltton Oy has developed its PR and Communications business by focusing on earned media models successfully over the last 10 years. Miltton sees social media as the fastest growing earned media channel. Miltton Oy has expressed interest in finding how corporations can better use social media in corporate communications. While...

  6. Creating Service Concepts for Finnish Elderly Care : Case: Virtual Interactive Care Service

    OpenAIRE

    Nwagu, Promise

    2016-01-01

    This thesis looks at creating service concept by evaluating the research project of Virtual Interactive Care Service. The research project was initiated and implemented by the author together with Hovi Group Oy and Suomen kotilääkäripalvelu Oy. The goal was to provide a virtual care service business that uses interactive and stimulating activities to improve the wellbeing of elderly people in Finland. The study employed qualitative research method by reviewing existing works particularly...

  7. Technology of Furniture Production

    OpenAIRE

    Danilova, Kseniia

    2016-01-01

    Manufacturing of furniture is one of the main processes of timber utilization. Furniture of Timberica Oy brand is made by special technology which does not allow use aggressive chemicals that can be harmful to humans, in wood processing. The furniture is made of Karelian "white" pine. Company's headquarters are located in Finland, its specialists improve and carefully controlled manufacturing process at the furniture factory in Karelia. Timberica Oy has produced furniture since 1998. They...

  8. GOF ON THE GO -myymäläkonseptin suunnittelu

    OpenAIRE

    Myllylä, Tiina

    2014-01-01

    Suunnittelin opinnäytetyönäni lahtelaiselle Great Outfit Oy:lle uudenlaisen GOF ON THE GO -myymäläkonseptin, heidän visuaalisen markkinointinsa työkaluksi. Great Outfit Oy on tunnettu erikoismateriaaleista, kuten turkiksesta, nahasta ja alpakan villasta valmistetuista muoti- ja sisustustuotteista. Yrityksen palveluihin kuuluvat myös erikoismateriaaliosaamista vaativat alihankintatyöt ja yhteistyö sisustusalan ammattilaisten kanssa. Suunnittelemani myymäläkonseptin erikoisuutena o...

  9. Study and analysis of how to optimize marketing & sales of a b-to-b company for the target group

    OpenAIRE

    Kauppila, Kasper

    2014-01-01

    Study and analysis of how to optimize the marketing & sales strategy of a b-to-b company for the target group. Case study for Green Fortune Plantwall Oy. This thesis is a case study of Green Fortune Plantwall Oy. The objective of this thesis is to study and analyze how to optimize the current marketing and sales strategy of a small b-to-b company for its target group (i.e. architects and interior designers).

  10. Acute toxicity and genotoxicity of fermented traditional medicine oyaksungi-san

    OpenAIRE

    Hwayong Park; Youn-Hwan Hwang; Jin Yeul Ma

    2017-01-01

    Background: The traditional medicine oyaksungi-san (OY) has been prescribed in East Asia for hundreds of years for the treatment of stroke, paralysis, and ataxia. OY also has therapeutic effects on arthralgia, myalgia, and rheumatoid arthritis, and recent studies have shown its protective effects against apoptosis of hippocampal cells and its anti-inflammatory effects on the peripheral blood cells of patient with cerebral infarction. Many studies have explored the use of traditional medicine ...

  11. Fiscal 1975 Sunshine Project research report. Research on safety technology for hydrogen energy systems; 1975 nendo suiso energy system ni okeru hoan gijutsu ni kansuru chosa kenkyu seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1976-05-01

    Important notices and problems on the safety for hydrogen gas were analyzed. Analysis was made on hydrogen gas property, flammability, explosivility, bio-toxicity, equipment, storage, transport, leakage, fire, technology and education for safety management, and quality and analysis of products. Study was also made on the relation between the above items and every domestic or overseas standard. Important notices and problems on the safety for liquid hydrogen were analyzed. Analysis was made on liquid hydrogen property, liquefaction and refining equipment, transport, storage, materials concerned, bio-toxicity, leakage, fire fighting technique, and safety management. Among them, such problems are pointed out from the viewpoint of accident prevention, as O-P conversion, refining of hydrogen gas for liquefaction, selection of structural materials, hydrogen embrittlement, layout of various equipment and devices, explosion-proof electric devices, and leakage detection. Research on effective fire fighting and fire preventive measures against hydrogen leakage and diffusion from tanks or piping are also in demand. (NEDO)

  12. The positive relationship between ocean acidification and pollution.

    Science.gov (United States)

    Zeng, Xiangfeng; Chen, Xijuan; Zhuang, Jie

    2015-02-15

    Ocean acidification and pollution coexist to exert combined effects on the functions and services of marine ecosystems. Ocean acidification can increase the biotoxicity of heavy metals by altering their speciation and bioavailability. Marine pollutants, such as heavy metals and oils, could decrease the photosynthesis rate and increase the respiration rate of marine organisms as a result of biotoxicity and eutrophication, facilitating ocean acidification to varying degrees. Here we review the complex interactions between ocean acidification and pollution in the context of linkage of multiple stressors to marine ecosystems. The synthesized information shows that pollution-affected respiration acidifies coastal oceans more than the uptake of anthropogenic carbon dioxide. Coastal regions are more vulnerable to the negative impact of ocean acidification due to large influxes of pollutants from terrestrial ecosystems. Ocean acidification and pollution facilitate each other, and thus coastal environmental protection from pollution has a large potential for mitigating acidification risk. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Assessment of zerovalent iron for stabilization of chromium, copper, and arsenic in soil

    International Nuclear Information System (INIS)

    Kumpiene, Jurate; Ore, Solvita; Renella, Giancarlo; Mench, Michel; Lagerkvist, Anders; Maurice, Christian

    2006-01-01

    Stabilization of soil contaminated with trace elements is a remediation practice that does not reduce the total content of contaminants, but lowers the amounts of mobile and bioavailable fractions. This study evaluated the efficiency of Fe to reduce the mobility and bioavailability of Cr, Cu, As and Zn in a chromated copper arsenate (CCA)-contaminated soil using chemical, biochemical and biotoxicity tests. Contaminated soil was stabilized with 1% iron grit. This treatment decreased As and Cr concentrations in leachates (by 98% and 45%, respectively), in soil pore water (by 99% and 94%, respectively) and in plant shoots (by 84% and 95%, respectively). The stabilization technique also restored most of analyzed soil enzyme activities and reduced microbial toxicity, as evaluated by the BioTox TM test. After stabilization, exchangeable and bioaccessible fractions of Cu remained high, causing some residual toxicity in the treated soil. - Zerovalent iron effectively reduces mobility and bioavailability of As and Cr, but does not adequately stabilize Cu

  14. Studies of nitride- and oxide-based materials as absorptive shifters for embedded attenuated phase-shifting mask in 193 nm

    Science.gov (United States)

    Lin, Cheng-ming; Chang, Keh-wen; Lee, Ming-der; Loong, Wen-An

    1999-07-01

    Abstract-Five materials which are PdSixOy, CrAlxOy, SiNx, TiSixNy, and TiSixOyNz as absorptive shifters for attenuated phase-shifting mask in 193 nm wavelength lithography are presented. PdSixOy films were deposited by dual e-gun evaporation. CrAlxOy, TiSixNy and TiSixOyNz films were formed by plasma sputtering and SiNx films were formed with LPCVD. All of these materials are shown to be capable of achieving 4 percent - 15 percent transmittance in 193 nm with thickness that produce a 180 degrees phase shift. Under BCl3:Cl2 equals 14:70 sccm; chamber pressure 5 mtorr and RF power 1900W, the dry etching selectivity of TiSixNy over DQN positive resist and fused silica, were found to be 2:1 and 4,8:1 respectively. An embedded layer TiSixNy with 0.5 micrometers line/space was successfully patterned.

  15. Nanomaterials and the environmental risk: is there some room left for ethics and law?

    Science.gov (United States)

    Byk, Christian

    2011-01-01

    How legitimate may be the concern posed by the nanotechnologies for health and environment,this effort for reaching a better knowledge of the biotoxicity of nanomaterials is not enough. As Pr Didier Sicard noted, we believe that the ethical reflection should not be the good conscience that may help science in getting rid of social fears. But the ethical reflection is there also to discuss taboo issues in the perspective of a better societal understanding.

  16. Microbial diversity and ecotoxicity of sediments 3 years after the Jiaozhou Bay oil spill.

    Science.gov (United States)

    Gao, Wei; Yin, Xiaofei; Mi, Tiezhu; Zhang, Yiran; Lin, Faxiang; Han, Bin; Zhao, Xilong; Luan, Xiao; Cui, Zhisong; Zheng, Li

    2018-05-09

    In 2013, the "Qingdao oil pipeline explosion" released an estimated 2000 tons of oil into the environment. Sediment samples were collected from ten sites in Jiaozhou Bay and Shilaoren Beach to evaluate the influence of the spilled oil on the benthic environment 3 years after the oil spill accident. The compositions of oil, bacterial diversity and biotoxicity were examined in this study. The results showed that the concentration of total petroleum hydrocarbons (TPHs) peaked near the oil leak point and gradually decreased along the coastline, ranging from 21.5 to 133.2 μg/g. The distribution of polycyclic aromatic hydrocarbons (PAHs) was correlated with TPH, and naphthalenes were dominant in the 20 detected PAHs. The bacterial diversities in seriously polluted and slightly polluted sediments were completely different. As degrading bacteria, Alcanivorax and Lutibacter were the main genera at the oil-polluted sites. The analysis of biotoxicity by the luminescent bacteria method showed great differences among the polluted sites, the control site in Jiaozhou Bay, and the non-polluted site outside of Jiaozhou Bay. The biotoxicity also peaked at the site near the oil leak point. These results indicate that the oil spill that occurred 3 years ago still affects the environment and impacts the bacterial communities in the sediments.

  17. Rock stress measurements. Preparatory stage of the equipment development project

    International Nuclear Information System (INIS)

    Mononen, S.; Hakala, M.; Mikkola, P.

    2002-01-01

    In recent years the rock stress measurement methods used in Finland have been overcoring and hydraulic fracturing. There have been mainly two companies involved in these measurements, namely Suomen Malmi Oy (Smoy) and SwedPower AB. Smoy has done measurements for mines and for rock engineering projects, whereas SwedPower AB has mainly been involved in nuclear waste disposal investigations and conducted hydraulic fracturing measurements in deep boreholes. Smoy together with its partners started in February 2001 a project named JTM, which was a preliminary stage for a future project, which aims to develop a device most suitable for rock stress measurements in Finland. The partners in the project were HUT Rock Engineering, Posiva Oy, Saanio and Riekkola Oy, Gridpoint Finland Oy and Geopros Oy. Tekes, the National Technology Agency, provided almost half of the project funding. In the management group of the project were Pekka Mikkola (chairman) and Tero Laurila from Smoy, Pekka Saerkkae and Sakari Mononen (full-time researcher) from HUT, Aimo Hautojaervi (Posiva Oy), Erik Johansson (Saanio and Riekkola Oy), Matti Hakala (Gridpoint Finland Oy) and Heikki Haemaelaeinen (Geopros Oy). The aim of the JTM-project was to find out the needs for the development of a device most suitable for rock stress measurements in Finnish mines and rock engineering projects. During the project work was done to find out the range of rock stress measurement devices available, to find out the needs for measurements, and to get acquainted to the measurements done in Scandinavia. Also a report of the most suitable methods for Finnish rock conditions was done based on literature and on interviews of rock stress experts. Based on all the information collected during the project a clear picture of the needs for rock stress measurements in Finland could be formed and a preliminary plan of a future project was done. The aim of the suggested project is to build a device based on hydraulic fracturing

  18. Characterization of Nα-Fmoc-protected dipeptide isomers by electrospray ionization tandem mass spectrometry (ESI-MS(n)): effect of protecting group on fragmentation of dipeptides.

    Science.gov (United States)

    Ramesh, M; Raju, B; Srinivas, R; Sureshbabu, V V; Vishwanatha, T M; Hemantha, H P

    2011-07-30

    A series of positional isomeric pairs of Fmoc-protected dipeptides, Fmoc-Gly-Xxx-OY/Fmoc-Xxx-Gly-OY (Xxx=Ala, Val, Leu, Phe) and Fmoc-Ala-Xxx-OY/Fmoc-Xxx-Ala-OY (Xxx=Leu, Phe) (Fmoc=[(9-fluorenylmethyl)oxy]carbonyl) and Y=CH(3)/H), have been characterized and differentiated by both positive and negative ion electrospray ionization ion-trap tandem mass spectrometry (ESI-IT-MS(n)). In contrast to the behavior of reported unprotected dipeptide isomers which mainly produce y(1)(+) and/or a(1)(+) ions, the protonated Fmoc-Xxx-Gly-OY, Fmoc-Ala-Xxx-OY and Fmoc-Xxx-Ala-OY yield significant b(1)(+) ions. These ions are formed, presumably with stable protonated aziridinone structures. However, the peptides with Gly- at the N-terminus do not form b(1)(+) ions. The [M+H](+) ions of all the peptides undergo a McLafferty-type rearrangement followed by loss of CO(2) to form [M+H-Fmoc+H](+). The MS(3) collision-induced dissociation (CID) of these ions helps distinguish the pairs of isomeric dipeptides studied in this work. Further, negative ion MS(3) CID has also been found to be useful for differentiating these isomeric peptide acids. The MS(3) of [M-H-Fmoc+H](-) of isomeric peptide acids produce c(1)(-), z(1)(-) and y(1)(-) ions. Thus the present study of Fmoc-protected peptides provides additional information on mass spectral characterization of the dipeptides and distinguishes the positional isomers. Copyright © 2011 John Wiley & Sons, Ltd.

  19. The role of phytoplankton in the modulation of dissolved and oyster cadmium concentrations in Deep Bay, British Columbia, Canada

    International Nuclear Information System (INIS)

    Cassis, David; Lekhi, Priyanka; Pearce, Christopher M.; Ebell, Nadene; Orians, Kristin; Maldonado, Maria T.

    2011-01-01

    We previously identified dissolved cadmium (Cd diss ) as the main source of this metal in cultured Pacific oysters, Crassostrea gigas, in Deep Bay, British Columbia, Canada (Lekhi et al., 2008). Total suspended particulate Cd (Cd part ) was not found to be a significant source of oyster Cd (Cd oys ), with Cd part > 20 μm negatively correlated with Cd oys concentration. High phytoplankton abundance in spring and summer was hypothesized to reduce Cd oys indirectly by drawing down Cd diss and increasing oyster growth. In the present study we expanded on these results by examining specifically how the phytoplankton community composition modulates both Cd diss and Cd oys concentrations in Deep Bay. Based on calculations of nutrients and Cd diss drawdown, phytoplankton accounted for approximately 90% of the overall summer reduction in Cd diss in the bay. Diatoms were the dominant phytoplankton group, being correlated negatively with Cd oys and positively with Cd part . This suggests that diatom growth mediates the transfer of Cd from the dissolved to the particulate phase, resulting in lower Cd oys . Spring blooms and sporadic harmful algal blooms may mediate a large flux of Cd part to the sediments. Thus, phytoplankton act as a sink, rather than a source, of Cd to oysters in Deep Bay and have a crucial role in the seasonality of Cd oys by reducing the concentration of Cd diss during the summer. Based on environmental variables, two descriptive models for annual Cd oys concentrations were developed using multiple linear regression. The first model (R 2 = 0.870) was created to explain the maximum variability in Cd oys concentrations throughout the year, while the second (R 2 = 0.806) was based on parameters that could be measured easily under farm conditions. Oyster age heavily affected both models, with the first model being secondarily affected by temperature and the second one being more sensitive to changes in salinity. - Highlights: → Phytoplankton and

  20. The role of phytoplankton in the modulation of dissolved and oyster cadmium concentrations in Deep Bay, British Columbia, Canada

    Energy Technology Data Exchange (ETDEWEB)

    Cassis, David, E-mail: dcassis@telus.net [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Lekhi, Priyanka [Department of Chemistry, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Pearce, Christopher M. [Pacific Biological Station, Fisheries and Oceans Canada, Nanaimo, BC, Canada V9T 6N7 (Canada); Ebell, Nadene [Ministry of Agriculture, Nanaimo, BC, Canada V9T 6J9 (Canada); Orians, Kristin [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Department of Chemistry, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada); Maldonado, Maria T. [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC, Canada V6T 1Z3 (Canada)

    2011-09-15

    We previously identified dissolved cadmium (Cd{sub diss}) as the main source of this metal in cultured Pacific oysters, Crassostrea gigas, in Deep Bay, British Columbia, Canada (Lekhi et al., 2008). Total suspended particulate Cd (Cd{sub part}) was not found to be a significant source of oyster Cd (Cd{sub oys}), with Cd{sub part} > 20 {mu}m negatively correlated with Cd{sub oys} concentration. High phytoplankton abundance in spring and summer was hypothesized to reduce Cd{sub oys} indirectly by drawing down Cd{sub diss} and increasing oyster growth. In the present study we expanded on these results by examining specifically how the phytoplankton community composition modulates both Cd{sub diss} and Cd{sub oys} concentrations in Deep Bay. Based on calculations of nutrients and Cd{sub diss} drawdown, phytoplankton accounted for approximately 90% of the overall summer reduction in Cd{sub diss} in the bay. Diatoms were the dominant phytoplankton group, being correlated negatively with Cd{sub oys} and positively with Cd{sub part}. This suggests that diatom growth mediates the transfer of Cd from the dissolved to the particulate phase, resulting in lower Cd{sub oys}. Spring blooms and sporadic harmful algal blooms may mediate a large flux of Cd{sub part} to the sediments. Thus, phytoplankton act as a sink, rather than a source, of Cd to oysters in Deep Bay and have a crucial role in the seasonality of Cd{sub oys} by reducing the concentration of Cd{sub diss} during the summer. Based on environmental variables, two descriptive models for annual Cd{sub oys} concentrations were developed using multiple linear regression. The first model (R{sup 2} = 0.870) was created to explain the maximum variability in Cd{sub oys} concentrations throughout the year, while the second (R{sup 2} = 0.806) was based on parameters that could be measured easily under farm conditions. Oyster age heavily affected both models, with the first model being secondarily affected by temperature and the

  1. Photocatalytic ozonation of terephthalic acid: a by-product-oriented decomposition study.

    Science.gov (United States)

    Fuentes, Iliana; Rodríguez, Julia L; Poznyak, Tatyana; Chairez, Isaac

    2014-11-01

    Terephthalic acid (TA) is considered as a refractory model compound. For this reason, the TA degradation usually requires a prolonged reaction time to achieve mineralization. In this study, vanadium oxide (VxOy) supported on titanium oxide (TiO2) served as a photocatalyst in the ozonation of the TA with light-emitting diodes (LEDs), having a bandwidth centered at 452 nm. The modified catalyst (VxOy/TiO2) in combination with ozone and LEDs improved the TA degradation and its by-products. The results obtained by this system were compared with photolysis, single ozonation, catalytic ozonation, and photocatalytic ozonation of VxOy/TiO2 with UV lamp. The LED-based photocatalytic ozonation showed almost the same decomposition efficiency of the TA, but it was better in comparison with the use of UV lamp. The oxalic acid accumulation, as the final product of the TA decomposition, was directly influenced by either the presence of VxOy or/and the LED irradiation. Several by-products formed during the TA degradation, such as muconic, fumaric, and oxalic acids, were identified. Besides, two unidentified by-products were completely removed during the observed time (60 min). It was proposed that the TA elimination in the presence of VxOy/TiO2 as catalyst was carried out by the combination of different mechanisms: molecular ozone reaction, indirect mechanism conducted by ·OH, and the surface complex formation.

  2. Strong Photoluminescence Enhancement of Silicon Oxycarbide through Defect Engineering

    Directory of Open Access Journals (Sweden)

    Brian Ford

    2017-04-01

    Full Text Available The following study focuses on the photoluminescence (PL enhancement of chemically synthesized silicon oxycarbide (SiCxOy thin films and nanowires through defect engineering via post-deposition passivation treatments. SiCxOy materials were deposited via thermal chemical vapor deposition (TCVD, and exhibit strong white light emission at room-temperature. Post-deposition passivation treatments were carried out using oxygen, nitrogen, and forming gas (FG, 5% H2, 95% N2 ambients, modifying the observed white light emission. The observed white luminescence was found to be inversely related to the carbonyl (C=O bond density present in the films. The peak-to-peak PL was enhanced ~18 and ~17 times for, respectively, the two SiCxOy matrices, oxygen-rich and carbon-rich SiCxOy, via post-deposition passivations. Through a combinational and systematic Fourier transform infrared spectroscopy (FTIR and PL study, it was revealed that proper tailoring of the passivations reduces the carbonyl bond density by a factor of ~2.2, corresponding to a PL enhancement of ~50 times. Furthermore, the temperature-dependent and temperature-dependent time resolved PL (TDPL and TD-TRPL behaviors of the nitrogen and forming gas passivated SiCxOy thin films were investigated to acquire further insight into the ramifications of the passivation on the carbonyl/dangling bond density and PL yield.

  3. Zeolite-Y entrapped Ru(III and Fe(III complexes as heterogeneous catalysts for catalytic oxidation of cyclohexane reaction

    Directory of Open Access Journals (Sweden)

    Chetan K. Modi

    2017-02-01

    Full Text Available Catalysis is probably one of the greatest contributions of chemistry to both economic growth and environmental protection. Herein we report the catalytic behavior of zeolite-Y entrapped Ru(III and Fe(III complexes with general formulae [M(VTCH2·2H2O]+-Y and [M(VFCH2·2H2O]+-Y [where, VTCH = vanillin thiophene-2-carboxylic hydrazone and VFCH = vanillin furoic-2-carboxylic hydrazone] over the oxidation of cyclohexane forming cyclohexanone and cyclohexanol. The samples were corroborated by various physico-chemical techniques. These zeolite-Y based complexes are stable and recyclable under current reaction conditions. Amongst them, [Ru(VTCH2⋅2H2O]+-Y showed higher catalytic activity (41.1% with cyclohexanone (84.6% selectivity.

  4. SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

    Energy Technology Data Exchange (ETDEWEB)

    Hakulin, H [ed.

    1997-12-31

    The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

  5. 3D-mainosvideo teollisuusyritykselle : Case: Leppäkosken Lämpö

    OpenAIRE

    Utriainen, Sari

    2015-01-01

    Toimeksiantajana opinnäytetyölle toimi biolämmitysjärjestelmiä valmistava ja markkinoiva Ariterm Oy. Tavoitteena oli tuottaa messu- ja markkinointikäyttöön 3D-mainosvideo Ariterm Oy:n toimittamasta, elokuussa 2014 käyttöönotetusta Leppäkosken Lämpö Oy:n pellettilämpölaitoksesta. Opinnäytetyössä käsiteltiin 3D-mallien hyödyntämistä eri teollisuuden aloilla sekä tutustuttiin 3D-mainosvideoprojektissa käytettyihin ohjelmistoihin ja teollisuuden 3D-suunnitteluohjelmien eri tiedostomuotoihin se...

  6. SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

    Energy Technology Data Exchange (ETDEWEB)

    Hakulin, H. [ed.

    1996-12-31

    The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

  7. Suitability of Haestholmen Loviisa for final disposal of spent fuel. Preliminary study; Loviisan Haestholmenin soveltuvuus kaeytetyn polttoaineen loppusijoitukseen. Esiselvitys

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    Based on the amendment of the Nuclear Energy Act the spent nuclear fuel of Imatran Voima Oy (IVO) will be disposed of in Finland instead of returning it to Russia. After Teollisuuden Voima Oy (TVO) and IVO had founded a joint company Posiva Oy the work IVO started in 1995 was brought together with the ongoing research programme for final disposal of spent fuel and extended to a feasibility study. The feasibility study was launched in the beginning of 1996. The geological evaluation was mainly based on the previous investigations at the island. For this study the complementary geological mapping has been carried out at the Haestholmen and on the surrounding area with a radius of 20 km. (49 refs.).

  8. Impact of solvent mixture on iron nanoparticles generated by laser ablation

    Science.gov (United States)

    Chakif, M.; Prymak, O.; Slota, M.; Heintze, E.; Gurevich, E. L.; Esen, C.; Bogani, L.; Epple, M.; Ostendorf, A.

    2014-03-01

    The present work reveals the structural and magnetic properties of iron oxide (FexOy) nanoparticles (NPs) prepared by femtosecond laser ablation. The FexOy-NPs were produced in solutions consisting of different ratios of water and acetone. Laser ablation in water yields agglomerates and that in acetone yields chain structures whereas that in water/acetone show a mixture of both. We observe significant fabrication dependent properties such as different crystallinities and magnetic behaviors. The structural characterization shows a change from iron (Fe) to a FexOy state of the NPs which depends on the solution composition. Furthermore, transmission electron microscopy measurements exhibit a broad particle size distribution in all samples but with significant differences in the mean sizes. Using magnetic measurements we show that nanoparticles fabricated in pure acetone have lower coercive fields which come along with a smaller mean particle size and therefore increasing superparamagnetic behavior.

  9. The Role of III-V Substrate Roughness and Deoxidation Induced by Digital Etch in Achieving Low Resistance Metal Contacts

    Directory of Open Access Journals (Sweden)

    Florent Ravaux

    2017-06-01

    Full Text Available To achieve low contact resistance between metal and III-V material, transmission-line-model (TLM structures of molybdenum (Mo were fabricated on indium phosphide (InP substrate on the top of an indium gallium arsenide (InGaAs layer grown by molecular beam epitaxy. The contact layer was prepared using a digital etch procedure before metal deposition. The contact resistivity was found to decrease significantly with the cleaning process. High Resolution Transmission & Scanning Electron Microscopy (HRTEM & HRSTEM investigations revealed that the surface roughness of treated samples was increased. Further analysis of the metal-semiconductor interface using Energy Electron Loss Spectroscopy (EELS showed that the amount of oxides (InxOy, GaxOy or AsxOy was significantly decreased for the etched samples. These results suggest that the low contact resistance obtained after digital etching is attributed to the combined effects of the induced surface roughness and oxides removal during the digital etch process.

  10. Manufacture, delivery and marketing of wood pellets

    International Nuclear Information System (INIS)

    Huhtanen, T.

    2001-01-01

    Wood pellet is a cheap fuel, the use of which can easily bee automated. Pellet heating can be carried out with a stoker or a pellet burner, which can be mounted to oil and solid fuels boiler or to solid fuel boilers. Vapo Oy delivers wood pellet to farms and detached houses via Agrimarket stores. Vapo Oy delivers pellets to large real estates, municipalities, industry, greenhouses and power plants directly as bulk. The pellets are delivered either by trailers or lorries equipped with fan-operated unloaders. The use of wood pellets is a suitable fuel especially for real estates, the boiler output of which is 20 - 1000 kW. Vapo Oy manufactures wood pellets of cutter chips, grinding dust and sawdust. The raw material for Ilomantsi pellet plant is purchased from the province of North Karelia. The capacity of pelletizing plant is 45 000 t of pellets per year, half of which is exported mainly to Sweden and Denmark

  11. Geophysical borehole logging of the boreholes KR23 extension, KR29 and KR29b at Olkiluoto 2004

    International Nuclear Information System (INIS)

    Lahti, M.; Heikkinen, E.

    2005-04-01

    Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR23 extension, KR25b, KR29 and KR29b at the Olkiluoto site in Eurajoki during October 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

  12. Meteorological data and update of climate statistics of Olkiluoto 2005 - 2006

    International Nuclear Information System (INIS)

    Ikonen, A.T.K.

    2007-10-01

    In this working report the data of some routine field observations of Posiva Oy and automatic measurements of the Olkiluoto nuclear power plant weather station owned and operated by Teollisuuden Voima Oy is published for further reference. The data reported here covers observations in 2005-2006. First, a concise description of data acquisition methods and handling is provided. Thereafter the actual data is presented in the appendices. Weather measurements (e.g. temperature, wind speed and direction, humidity) and snow and ground frost observations are reported. (orig.)

  13. Growth Hacking for Startups : How Growth Hacking can utilised for growing startups

    OpenAIRE

    Lee, Jin

    2016-01-01

    In the era of start-ups, many failed to put out their prototypes or products to the market due to lack of funds or experience in marketing. Growth Hacking is a tool that start-ups can benefit from if they learn what Growth Hacking is and how to implement it. The aim of this thesis is to explore what Growth Hacking is and how to implement it for the commissioner CubiCasa Oy. A couple of Growth Hacking tactics are used for CubiCasa Oy and the process of implementation and findings are rec...

  14. Servicenow-tietämyskannan käyttöönotto ja kehitys

    OpenAIRE

    Juvonen, Mikko

    2013-01-01

    Tämän opinnäytetyön tavoitteena oli tutkia ja kehittää ServiceNow-palvelunhallintaohjelmistoa Kaisanet Oy:lle sopivaksi. ServiceNow-ohjelmistosta on Kaisanetille erinäisiä hyötyjä. Se nopeuttaa vikailmoitusten ja palvelu-pyyntöjen ratkaisuaikoja, parantaa ratkaisujen laatua ja tekee ratkaisuista tehokkaampia. Näin ollen samalla henkilöstöllä saadaan ratkaistua suurempi määrä ongelmia ja vikailmoituksia. Ohjelmisto kasvattaa yleisesti Kaisanet Oy:n it-toiminnan laatua ja parantaa sen tehokkuut...

  15. IMS-järjestelmän käyttäminen ammattikeittiöiden ilmanvaihdossa

    OpenAIRE

    Marttinen, Olli

    2017-01-01

    Opinnäytetyön tilaajana toimii Jeven Oy. Jeven Oy on vuonna 1989 perustettu mikkeliläinen ammattikeittiöiden ilmanvaihtoon erikoistunut yritys. Opinnäytetyön tavoitteena oli selvittää IMSjärjestelmän käyttömahdollisuus ammattikeittiöiden ilmanvaihdossa sekä vaikutukset lämmöntalteenottojärjestelmään. Opinnäytetyön lähtökohtana oli tutustua erityyppisiin ja kokoisiin ammattikeittiöihin. Kohteiksi valikoituivat Pohjois-Karjalan Keskussairaala (PKSSK) Joensuussa, Ravintola Talli Mikkelissä j...

  16. Improvements of high temperature properties of iron ore agglomerate

    Energy Technology Data Exchange (ETDEWEB)

    Lilius, K R [Helsinki Univ. of Technology, Otaniemi (Finland). Materials Science and Rock Engineering

    1997-12-31

    This final report is about research done in 1992-94 in the framework of Jernkontoret project JK 2131/92, at Helsinki University of Technology, Finland. The aim of this study was the investigation of reduction of magnetite and wuestite in different reduction conditions and influence of doping of CaO and MgO thereon. Project participants were: Jernkontoret (Stockholm), Fundia Wire Oy (Koverhar), Rautaruukki Oy (Raahe), SSAB Oxeloesund AB (Oxeloesund), SSAB Tunnplaat AB (Luleaa), LKAB (Malmberget), Royal School of Technology (Stockholm), Luleaa University of Technology (Luleaa) and Helsinki University of Technology (Espoo) SULA 2 Research Programme; 12 refs.

  17. Geophysical borehole logging of the boreholes KR23 extension, KR29 and KR29b at Olkiluoto 2004

    Energy Technology Data Exchange (ETDEWEB)

    Lahti, M. [Suomen Malmi Oy, Espoo (Finland); Heikkinen, E. [JP-Fintact Oy, Vantaa (Finland)

    2005-04-15

    Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR23 extension, KR25b, KR29 and KR29b at the Olkiluoto site in Eurajoki during October 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

  18. TEHDASPROSESSIN 3D-MALLINNUS, PROSESSI- JA LAITEKUVAUS

    OpenAIRE

    Huhtala, Aki

    2010-01-01

    Opinnäytetyö tehtiin tilauksesta AkkuSer Oy:lle. Tarkoituksena oli kartoittaa tehdasprosessi, selvittää laitetiedot ja luoda 3D-malli tehdasprosessista. Prosessin toiminta kuvattiin. Selvitettiin, miten prosessi eteni ja millä tavoin AkkuSer Oy kierrättää ongelma jätettä. Selitetään, mitkä ovat prosessin lähtökohdat ja mitä tuotteita prosessissa syntyi. Tämän lisäksi mitattiin kuljettimien sekä taajuusmuuttajatoimisten kuljettimien pyörimisnopeuksia. Tehdasprosessi kuvattiin Visual Compon...

  19. Tiedonkeruujärjestelmän kehitys ja käyttöönotto

    OpenAIRE

    Uusitalo, Jarkko

    2007-01-01

    Tämän opinnäytetyön tavoitteena oli kehittää Rauman Akku Oy:n tiedonkeruujärjestelmää. Uusi viivakoodijärjestelmä on joustavampi ja helpompi käyttää kuin vanha systeemi. Lisäksi viivakoodijärjestelmä poistaa virheet manuaalisesta tiedonsyötöstä ja nopeuttaa tiedon siirtoa. Kehitys siis korvaa vanhan systeemin viivakoodijärjestelmällä. Vaihtoehtoina oli viivakoodi ja saattomuisti, mutta jälkimmäinen olisi ollut liian hankala toteuttaa. Syy tälle kehityshakuisuudelle on se, että Rauman Akku Oy ...

  20. Intranetin rakentaminen yritykselle

    OpenAIRE

    Uronen, Mikko

    2013-01-01

    Tämän opinnäytetyön tavoitteena oli rakentaa intranet Lahti Precision Oy:lle. Lahti Precision Oy on suurin punnitusalan yritys Suomessa. Asiakkaina sillä on lasiteollisuus, laasti- ja tasoiteteollisuus. Yrityksen vanhempi intranet-toteutus ei palvellut kunnolla yrityksen henkilökuntaa ja aiheutti tehottomuutta asioiden hoidossa. Yritys halusi myös siirtää intranetin toimimaan omaan lähiverkkoonsa. Yritys oli valinnut käytettäväksi SharePoint Foundation 2010 alustan, jolla intranet oli tar...

  1. 24 Pesulan seurantaohjelmisto

    OpenAIRE

    Lumme, Tristan

    2017-01-01

    Insinöörityö tehtiin 24 Pesula Oy:n projektista, joka suoritettiin Helsingissä. Projektin tarkoituksena oli luoda sovellus listaamaan yrityksen toimipisteiden koneet ja niiden käyttökerrat automatisoidusti tietokantaan. 24 Pesula Oy on vuonna 1999 perustettu yritys ja Suomen ainoa itsepalvelupesulaketju. Aikaisemmin koneiden käytönseuranta hoidettiin siten, että käyttödata haettiin paikan päältä lukemalla yksittäisten koneiden lokitiedot. Yrityksen koneissa käytettiin myös Atmelin modifio...

  2. Geophysical borehole logging of the boreholes KR37, KR37B and KR38, at Olkiluoto 2005

    International Nuclear Information System (INIS)

    Majapuro, J.

    2006-03-01

    Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR37, KR37b and KR38 at the Olkiluoto site in Eurajoki during September and October 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

  3. Myymäläkalusteen tuotekehitys

    OpenAIRE

    Mehto, Elsa

    2015-01-01

    Pikval Oy on suomalainen myymäläkalusteiden suunnittelija ja valmistaja Jyväskylän Vaaja-koskella, Keski-Suomessa. Digitalisoitumista ja myymälän kiinnittämistä osaksi verkkokaup-paa on pidetty mahdollisena vaihtoehtona edistää kaupan toimintaa ja asiakaspalvelua suoraan myymälässä. Tähän markkinarakoon Pikval Oy on tarttunut tarjoamillaan Digital Signage -myymäläkalusteilla. Digital Signage -tuotteet ovat mainostamiseen ja asiakkaan informoimiseen soveltuvia näyttöjä, jotka on suunniteltu os...

  4. Improvements of high temperature properties of iron ore agglomerate

    Energy Technology Data Exchange (ETDEWEB)

    Lilius, K.R. [Helsinki Univ. of Technology, Otaniemi (Finland). Materials Science and Rock Engineering

    1996-12-31

    This final report is about research done in 1992-94 in the framework of Jernkontoret project JK 2131/92, at Helsinki University of Technology, Finland. The aim of this study was the investigation of reduction of magnetite and wuestite in different reduction conditions and influence of doping of CaO and MgO thereon. Project participants were: Jernkontoret (Stockholm), Fundia Wire Oy (Koverhar), Rautaruukki Oy (Raahe), SSAB Oxeloesund AB (Oxeloesund), SSAB Tunnplaat AB (Luleaa), LKAB (Malmberget), Royal School of Technology (Stockholm), Luleaa University of Technology (Luleaa) and Helsinki University of Technology (Espoo) SULA 2 Research Programme; 12 refs.

  5. Geophysical logging and imaging of shallow drillholes ONK-PP262 and ONK-274 at Olkiluoto in 2010

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-11-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP262 and ONK-PP274 at ONKALO in the investigation niche ONK-TKU-4 (Hydco) in May and in December 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  6. Geophysical borehole logging of the boreholes KR30, KR31, KR31b, KR32, KR33, KR33b and KR24 Upper Part, at Olkiluoto 2005

    International Nuclear Information System (INIS)

    Majapuro, J.

    2005-12-01

    Suomen Malmi Oy conducted geophysical borehole logging of the boreholes KR30, KR31, KR31B, KR32, KR33, KR33B and KR24 upper part at the Olkiluoto site in Eurajoki during December 2004, January, February and September 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality in the appendices. The raw and processed data are delivered digitally in WellCAD and Excel format. (orig.)

  7. CRM-ohjelmiston käyttöönotto tilitoimistossa

    OpenAIRE

    Kempas, Mervi

    2013-01-01

    Opinnäytetyössä selvitettiin, mitä Pretax Pohjois-Karjala Oy:n tulisi ottaa huomioon CRM-ohjelmiston käyttöönotossa. Asiakashallinta eli Customer Relationship Management on osa asiakaslähtöistä liiketoimintamallia. Yrityksen liiketoiminta saadaan asiakaslähtöiseksi CRM-ohjelmiston avulla. CRM-ohjelmisto tarjoaa paljon mahdollisuuksia hyödynnettäväksi liiketoiminnassa. Tutkimuskohteena käytettiin Pretax Jyväskylä Oy:tä, jossa CRM-ohjelmisto oli otettu alkuvuodesta 2013 käyttöön. Tutkimustu...

  8. Microsoft Hololens -applikaation toteuttaminen

    OpenAIRE

    Pesu, Joel

    2017-01-01

    Opinnäytetyö tehtiin Valve Group Oy:lle. Opinnäytetyön tarkoituksena oli toteuttaa Valve Group Oy:n asiakkaalle Nokia Oyj:lle Microsoft Hololens-applikaatio Barcelona Mobile World Congress 2017 -messuille demotarkoitukseen. Applikaatio toteutettiin käyttäen pelimoottori Unityä, 3D-mallinnusohjelma Blenderiä ja 3D-mallien maalausohjelmaa Substance Painteria. Opinnäytetyön teoriaosuus keskittyy sovelluksessa käytetyn mixed realityn kehityshistoriaan. Esiteltyjä tekniikoita ovat virtual reality ...

  9. Konto-eriste

    OpenAIRE

    Kananoja, Tomi

    2010-01-01

    Työn tarkoitus oli määrittää Konto Oy:n kehittämälle turve-eristeelle optimaalinen lämmönjohtavuus ja ääneneristävyys. Hankkeessa olivat yhteistyössä Konto Oy, TAMK:n Tutkimus & Kehitysosasto sekä opiskelijoita. Tutkimukset omalta osaltani jakautuivat Tampereen teknillisen yliopiston laboratoriokokeisiin lämmönjohtavuudesta ja Tampereen ammattikorkeakoulun tiloissa tapahtuvaan koputuskokeeseen. Työ oli kokonaisuudessaan mielenkiintoinen. Yhteyttä pidettiin monen eri tahon kanssa, ja voidaan s...

  10. Biomass CFB gasifier connected to a 350 MW{sub t}h steam boiler fired with coal and natural gas - THERMIE demonstration project in Lahti in Finland

    Energy Technology Data Exchange (ETDEWEB)

    Palonen, J. [Foster Wheeler Energia Oy, Varkaus (Finland). Varkaus Global New Products

    1997-12-31

    The successful experience in developing the advanced Foster Wheeler Energi Oy`s (former Ahlstroem Pyropower) Circulating Fluidized Bed combustion system subsequently led to the development of the CFB gasification technology in the early 1980s. The driving force for the developing work was the dramatic increase in oil price during the oil crises. The primary advantage of CFB gasification technology is that the it enables the substitution of expensive fuels e.g. oil or gas with cheap solid fuels. These cheap fuels are typically different types of waste woods, bark or other biofuels. In the CFB gasifier these solid fuels are converted to gaseous fuel which can be used instead of other expensive fuels. In some cases this also solves a waste disposal problem, providing a secondary economic and environmental benefit. Foster Wheeler Energia Oy has supplied four commercial scale atmospheric CFB gasifiers in the mid 80s to the pulp and paper industry with capacities from 17 to 35 MW based on fuel input. These applications utilize waste wood as feedstock and the units are still successfully operation today. Lahden Laempoevoima Oy is a Finnish power company producing power and district heat for the city of Lahti. The company is 50 % owned by the city of Lahti and 50 % by Imatran Voima Oy, which is the largest utility power company in Finland. Lahden Laempoevoima Oy operates the Kymijaervi power plant locating nearby the city of Lahti in Southern Finland. To keep the energy prices as low as possible, Lahden Laempoevoima is continuously looking for the most economical fuel sources, and simultaneously, trying to improve the environmental acceptability of the energy production. At the moment, about 300 GWh/a different type of biofuels and refuse fuels are available in the Lahti area. On an annual basis, the available amount of biofuels and refuse fuels is enough to substitute for about 15 % of the fuels burned in the main boiler equalling max 30 % of coal. The aim in this Lahden

  11. Meteorological data at Olkiluoto in period of 2002-2004

    International Nuclear Information System (INIS)

    Ikonen, A.T.

    2005-07-01

    In this working report the data of some routine field observations of Posiva Oy and automatic measurements of the Olkiluoto nuclear power plant weather station owned and operated by Teollisuuden Voima Oy is published for further reference. The data reported here covers observations from 2002 to 2004. First, a concise description of data acquisition methods and handling is provided. Thereafter the actual data is presented in the appendices. Weather measurements (e.g. temperature, wind speed and direction, humidity) and snow, ground frost and ditch flow rate observations are reported. (orig.)

  12. Aquabuoy Wave Energy Converter

    DEFF Research Database (Denmark)

    Vicinanza, Diego; Margheritini, Lucia; Frigaard, Peter

    The work reported here is part of the contract agreement between the Finavera Renewables Ocean Energy Ltd. and the Department of Civil Engineering Hydraulics and Coastal Engineering Laboratory to instrument a model in scale 1:10 to prototype of the AquaBuOY (AB) wave energy converter and to analyse...... its performances in real sea testing in Nissum Bredning, Denmark. This report is part of Fineveras contribution to ForskEl project no 6435 “AquaBuOY skala 1:10 forsøg I Nissum Bredning”....

  13. Biomass CFB gasifier connected to a 350 MW{sub t}h steam boiler fired with coal and natural gas - THERMIE demonstration project in Lahti in Finland

    Energy Technology Data Exchange (ETDEWEB)

    Palonen, J [Foster Wheeler Energia Oy, Varkaus (Finland). Varkaus Global New Products

    1998-12-31

    The successful experience in developing the advanced Foster Wheeler Energi Oy`s (former Ahlstroem Pyropower) Circulating Fluidized Bed combustion system subsequently led to the development of the CFB gasification technology in the early 1980s. The driving force for the developing work was the dramatic increase in oil price during the oil crises. The primary advantage of CFB gasification technology is that the it enables the substitution of expensive fuels e.g. oil or gas with cheap solid fuels. These cheap fuels are typically different types of waste woods, bark or other biofuels. In the CFB gasifier these solid fuels are converted to gaseous fuel which can be used instead of other expensive fuels. In some cases this also solves a waste disposal problem, providing a secondary economic and environmental benefit. Foster Wheeler Energia Oy has supplied four commercial scale atmospheric CFB gasifiers in the mid 80s to the pulp and paper industry with capacities from 17 to 35 MW based on fuel input. These applications utilize waste wood as feedstock and the units are still successfully operation today. Lahden Laempoevoima Oy is a Finnish power company producing power and district heat for the city of Lahti. The company is 50 % owned by the city of Lahti and 50 % by Imatran Voima Oy, which is the largest utility power company in Finland. Lahden Laempoevoima Oy operates the Kymijaervi power plant locating nearby the city of Lahti in Southern Finland. To keep the energy prices as low as possible, Lahden Laempoevoima is continuously looking for the most economical fuel sources, and simultaneously, trying to improve the environmental acceptability of the energy production. At the moment, about 300 GWh/a different type of biofuels and refuse fuels are available in the Lahti area. On an annual basis, the available amount of biofuels and refuse fuels is enough to substitute for about 15 % of the fuels burned in the main boiler equalling max 30 % of coal. The aim in this Lahden

  14. Linjasaneerauksen työvaiheiden yhteensovituksen vaikutus linja-aikatauluun

    OpenAIRE

    Luomala, Joni

    2017-01-01

    Opinnäytetyössä käsitellään perinteistä putkiremonttia, sen aikataulua ja aikataulun yhteensovittamisen vaikutusta lopulliseen linja-aikatauluun. Opinnäytetyö tehtiin pääkaupunkiseudulla toimivalle talotekniikkaurakointiyritykselle LVIS-Hokka Oy:lle. Opinnäytetyössä perehdytään tarkemmin 1960–70-luvulla rakennettujen kerrostalojen perinteiseen putkiremonttiin ja siinä tehtäviin työvaiheisiin. Työssä on esitelty LVI-, sähkö ja rakennustöiden laajuus huoneistoittain yhden LVIS-Hokka Oy:n li...

  15. Lahden seudun vapaa-ajan matkailu ja markkinointitoimenpiteet

    OpenAIRE

    Ranki, Arto

    2011-01-01

    Opinnäytetyön tarkoituksena on tutkia Lahden seudun markkinoinnin ja markkinointiviestintätoimenpiteiden vaikuttavuutta vapaa-ajan matkailijoihin. Työn tarkoituksena on myös luoda uusi markkinoinnin mittaamisen työkalu Lahti Travel Oy:lle. Opinnäytetyön tutkimusongelmana on selvittää Lahden seudun markkinointitoimenpiteiden laatua, huomioarvoa ja onnistuneisuutta. Työelämälähtöisen opinnäytetyön yhteistyökumppani on Lahti Travel Oy, joka vastaa pääosin Lahden seudun matkailupalveluiden myynni...

  16. Optical imaging of the boreholes KR37, KR37B and KR38 at Olkiluoto 2005

    International Nuclear Information System (INIS)

    Majapuro, J.

    2006-02-01

    Suomen Malmi Oy conducted optical imaging surveys of the boreholes KR37, KR37B and KR38 at the Olkiluoto site in Eurajoki during September 2005. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and preliminary processing of the images. The report describes the field operation, equipment as well as processing procedures and shows the obtained results and their quality through example images. The raw and processed data are delivered digitally in WellCAD format. The images are also attached to the appendix CD of this report in Adobe Acrobat PDF-format. (orig.)

  17. Optical imaging of borehole PR10 at Olkiluoto 2006

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2007-03-01

    Suomen Malmi Oy carried out optical imaging of borehole PR10 at Olkiluoto site in Eurajoki during December 2006. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and the data processing. This report describes the field operation, the equipment as well as the processing procedures and shows the obtained results and their quality. The raw and processed data are delivered digitally in WellCAD and PDF format. (orig.)

  18. Odoon ja Jaspersoft Studion integrointi

    OpenAIRE

    Iivonen, Kalle

    2015-01-01

    Opinnäytetyö tehtiin toimeksiantona EM Systems Oy:lle. EM Systems Oy on turkulainen yritys, joka tekee asiakkailleen Odoo-toiminnanohjausjärjestelmäpaketteja ja muita tiedonhallinnan ratkaisuja. He halusivat selvittää kuinka helppoa ja hyödyllistä on yhdistää Jaspersoftin raportointiohjelmisto Odoo-toiminnanohjausjärjestelmän kanssa. Työ sisälsi Jaspersoft Studion, joka on raporttien suunnitteluohjelma, yhdistämisen Odoo-toiminnanohjausjärjestelmän tietokantaan. Yhdistäminen vaati PostgreS...

  19. Pakkaustarvikkeiden imuohjauksen suunnittelu ja toteutus kiintokalustetehtaassa

    OpenAIRE

    Kiviahde, Juho

    2015-01-01

    Opinnäytetyö on tehty Mellano Oy:lle. Yritys on Suomen johtava kiintokalusteiden valmistaja. Yrityksellä on toimipisteet Lapinlahdella ja Pieksämäellä. Tämä opinnäytetyö tehtiin Mellano Oy Pieksämäen tehtaalle. Opinnäytetyön tavoitteena oli suunnitella ja toteuttaa pakkausmateriaalien imuohjausjärjestelmä käyttäen kanban- kortti menetelmää sekä suunnitella ja toteuttaa pakkausmateriaalien varastointi uudelleen. Työ toteutettiin selvittämällä lähtötilanne, opiskelemalla imuohjauksen t...

  20. Täyteaineiden painatusominaisuudet

    OpenAIRE

    Takkinen, Annemari

    2013-01-01

    Opinnäytetyö oli Nordkalk Oy:n teettämä ja työn tavoitteena oli tarkastella uudentyyppisten täyteaineiden vaikutuksia painatusominaisuuksiin. Työssä tutkittiin neljää eri täyteainetta yhdellä täyttöasteella. Opinnäytetyö painottui offset-painomenetelmän painettavuusominaisuuksien tutkimiseen. Työn kokeellinen osa on luottamuksellista aineistoa. This thesis was comissioned from Nordkalk Oy. The aim of the thesis was to research how new fillers affect printing properties. In this thesis four...

  1. Summary report - development of laboratory tests and the stress- strain behaviour of Olkiluoto mica gneiss

    Energy Technology Data Exchange (ETDEWEB)

    Hakala, M.; Heikkilae, E. [Helsinki Univ. of Technology, Espoo (Finland). Lab. of Rock Engineering

    1997-05-01

    This work summarizes the project aimed at developing and qualifying a suitable combination of laboratory tests to establish a statistically reliable stress-strain behaviour of the main rock types at Posiva Oy`s detailed investigation sites for disposal of spent nuclear fuel. The work includes literature study of stress-strain behaviour of brittle rock, development and qualification of laboratory tests, suggested test procedures and interpretation methods and finally testing of Olkiluoto mica gneiss. The Olkiluoto study includes over 130 loading tests. Besides the commonly used laboratory tests, direct tensile tests, damage controlled tests and acoustic emission measurements were also carried out. (orig.) (54 refs.).

  2. Geophysical logging and imaging of characterisation drillholes ONK-KR13, ONK-KR14 and ONK-KR15

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-08-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of drillholes ONK-KR13, ONK-KR14 and ONK-KR15 at ONKALO in June-July 2010 and in March 2011. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  3. Pretreatment and preheating of scrap. Tarkastelu koskien romun esikaesittely- ja esikuumennusmenetelmiae

    Energy Technology Data Exchange (ETDEWEB)

    Hooli, P.; Hanni, J. (Outokumpu Oy Tornion Tehtaat, Tornio (Finland))

    1990-01-01

    As a background for this study has been those demands for scrap treatments and transportation, which are coming with increasing production of melting shop of Outokumpu Oy's Tornio works and also problems caused by snow among productionrate. Different pretreatment-, transport-, and preheatingmethods and some alternatives has been studied to arrange those as a functioning complete. Also very exact plannings for some pretreatmentmethods has been made. From preheatingmethods some methods, which are concerned to be effective and possible in the future has been studied. In addition those parameters, which are involved to the effectivity of preheating process in melting shop of Outokumpu Oy's Tornio works has been examined.

  4. Katsastustoiminnan lisääminen korjaamopalveluihin

    OpenAIRE

    Kuonanoja, Tuomo

    2015-01-01

    Opinnäytetyön aiheena oli selvittää ja suunnitella, kuinka katsastustoiminta voidaan liittää osaksi Pärnäisen korjaamo Oy:n palveluita. Pärnäisen korjaamo Oy on monimerkkikorjaamo, jonka palveluihin kuuluvat kattavasti kevyiden ajoneuvojen huolto ja korjaus- sekä puhdistustyöt. Katsastustoiminnan on määrä lisätä palveluiden monipuolisuutta mahdollistaen kevyiden ajoneuvojen määräaikais- ja valvontakatsastamisen sekä korjaamisen samassa paikassa. Katsastustoiminnan aloittamista varten teht...

  5. Assessment of heavy metals in loose deposits in drinking water distribution system.

    Science.gov (United States)

    Liu, Quanli; Han, Weiqiang; Han, Bingjun; Shu, Min; Shi, Baoyou

    2018-06-09

    Heavy metal accumulation and potential releases from loose deposits in drinking water distribution system (DWDS) can have critical impacts on drinking water safety, but the associated risks have not been sufficiently evaluated. In this work, the potential biological toxicity of heavy metals in loose deposits was calculated based on consensus-based sediment quality guidelines, and the effects of some of the main water quality parameters, such as the pH and bicarbonate and phosphate content, on the release behaviors of pre-accumulated heavy metals were investigated. The results showed that heavy metals (Cu, As, Cr, Pb, and Cd) significantly accumulated in all the samples, but the contents of the heavy metals were multiple magnitudes lower than the Fe and Mn contents. The potential biotoxicity of As and Cu was relatively high, but the biotoxicity of Cd was negligible. The water quality can significantly influence the release of heavy metals from loose deposits. As the pH increased from 7.0 to 9.0, the release of As and Cr obviously increased. The release of As, Cu, Pb, and Cr also accelerated with the addition of phosphate (from 1 to 5 mg/L). In contrast to the trends for the pH and phosphate, variations in the bicarbonate content did not have a significant influence on the release of As and Cr. The release ratios of heavy metals in the samples were very low, and there was not a correlation between the release rate of the heavy metals in the loose deposits and their potential biotoxicity.

  6. Antibacterial polymer coatings.

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Mollye C.; Allen, Ashley N.; Barnhart, Meghan; Tucker, Mark David; Hibbs, Michael R.

    2009-09-01

    A series of poly(sulfone)s with quaternary ammonium groups and another series with aldehyde groups are synthesized and tested for biocidal activity against vegetative bacteria and spores, respectively. The polymers are sprayed onto substrates as coatings which are then exposed to aqueous suspensions of organisms. The coatings are inherently biocidal and do not release any agents into the environment. The coatings adhere well to both glass and CARC-coated coupons and they exhibit significant biotoxicity. The most effective quaternary ammonium polymers kills 99.9% of both gram negative and gram positive bacteria and the best aldehyde coating kills 81% of the spores on its surface.

  7. Assessment of Sr-90 in water samples: precision and accuracy

    Energy Technology Data Exchange (ETDEWEB)

    Nisti, Marcelo B.; Saueia, Cátia H.R.; Castilho, Bruna; Mazzilli, Barbara P., E-mail: mbnisti@ipen.br, E-mail: chsaueia@ipen.br, E-mail: bcastilho@ipen.br, E-mail: mazzilli@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2017-11-01

    The study of artificial radionuclides dispersion into the environment is very important to control the nuclear waste discharges, nuclear accidents and nuclear weapons testing. The accidents in Fukushima Daiichi Nuclear Power Plant and Chernobyl Nuclear Power Plant, released several radionuclides in the environment by aerial deposition and liquid discharge, with various level of radioactivity. The {sup 90}Sr was one of the elements released into the environment. The {sup 90}Sr is produced by nuclear fission with a physical half-life of 28.79 years with decay energy of 0.546 MeV. The aims of this study are to evaluate the precision and accuracy of three methodologies for the determination of {sup 90}Sr in water samples: Cerenkov, LSC direct method and with radiochemical separation. The performance of the methodologies was evaluated by using two scintillation counters (Quantulus and Hidex). The parameters Minimum Detectable Activity (MDA) and Figure Of Merit (FOM) were determined for each method, the precision and accuracy were checked using {sup 90}Sr standard solutions. (author)

  8. Annual review of the Institute of Plasma Physics, Nagoya University, for fiscal 1987

    International Nuclear Information System (INIS)

    Akaishi, K.; Midzuno, Y.; Namba, C.

    1988-01-01

    During the past three years, the Institute acquired 47ha of land for the new site in Toki City. The new plan of a large helical system which will be undertaken in the Toki site has been developed by a special committee under the Ministry of Education, Science and Culture. After the 11th IAEA Conference held in Kyoto last autumn, the Institute started under the new organization in order to concentrate effort to the comprehensive study on toroidal confinement including the design study of the large herical system. The new organization and the related research program in this fiscal year were torus projects (NTX/JIPP T-11U tokamak, compact helical system, advanced torus experiment), RF heating, plasma and fusion technologies, theory and computer simulation, various centers and others. This report presents the summary of these research subjects. Nagoya torus experiment (NTX) and helical island diverter experiment (HIDEX) using the JIPP T-11U device, the compact helical system of Torsatron/Heliotron type, the RF system for fast wave current drive and ion Bernstein wave heating experiments in JIPP T-11U, wall-plasma interaction, NBI heating, the development of a long pulse positive ion source and a high current negative ion source, tritium diffusion and so on are reported. (K.I.)

  9. Assessment of Sr-90 in water samples: precision and accuracy

    International Nuclear Information System (INIS)

    Nisti, Marcelo B.; Saueia, Cátia H.R.; Castilho, Bruna; Mazzilli, Barbara P.

    2017-01-01

    The study of artificial radionuclides dispersion into the environment is very important to control the nuclear waste discharges, nuclear accidents and nuclear weapons testing. The accidents in Fukushima Daiichi Nuclear Power Plant and Chernobyl Nuclear Power Plant, released several radionuclides in the environment by aerial deposition and liquid discharge, with various level of radioactivity. The 90 Sr was one of the elements released into the environment. The 90 Sr is produced by nuclear fission with a physical half-life of 28.79 years with decay energy of 0.546 MeV. The aims of this study are to evaluate the precision and accuracy of three methodologies for the determination of 90 Sr in water samples: Cerenkov, LSC direct method and with radiochemical separation. The performance of the methodologies was evaluated by using two scintillation counters (Quantulus and Hidex). The parameters Minimum Detectable Activity (MDA) and Figure Of Merit (FOM) were determined for each method, the precision and accuracy were checked using 90 Sr standard solutions. (author)

  10. On-line gross alpha radiation monitoring of natural waters with extractive scintillating resins

    International Nuclear Information System (INIS)

    Hughes, Lara; De Vol, T.A.

    2003-01-01

    Extractive scintillating resins, which are used to simultaneously separate and quantify radioactivity in aqueous solutions, were developed for low-level alpha radiation monitoring of natural waters. Resins were investigated with bis(2-ethylhexyl)methane-diphosphonic acid (H 2 DEH[MDP], Dipex[reg]) extractant, which has a strong affinity for tri-, tetra- and hexavalent actinides in dilute acids. Extractive scintillating resins were manifested (1) as a mixed bed of scintillating resin and extraction chromatographic resin and (2) by diffusing the organic fluor 2-(1-naphtyl)-5-phenyloxazole into macroporous polystyrene chromatographic resin, then coating with H 2 DEH[MDP], or by coating H 2 DEH[MDP] on scintillating polyvinyltoluene beads. The scintillation light was detected with a modified Hidex Triathler to allow for continuous flow measurements. The average detection efficiencies were 51.7±2.6% and 65.8±10.1% for natural uranium and 241 Am, respectively, for the extractant coated scintillator. The resin was stable for solution flow of up to 1000 ml resulting in rapid real-time quantification of natural uranium in groundwater down to 30 μg/ml

  11. Environmental effects on underwater optical transmission

    Science.gov (United States)

    Chu, Peter C.; Breshears, Brian F.; Cullen, Alexander J.; Hammerer, Ross F.; Martinez, Ramon P.; Phung, Thai Q.; Margolina, Tetyana; Fan, Chenwu

    2017-05-01

    Optical communication/detection systems have potential to get around some limitations of current acoustic communications and detection systems especially increased fleet and port security in noisy littoral waters. Identification of environmental effects on underwater optical transmission is the key to the success of using optics for underwater communication and detection. This paper is to answer the question "What are the transfer and correlation functions that relate measurements of hydrographic to optical parameters?" Hydrographic and optical data have been collected from the Naval Oceanographic Office survey ships with the High Intake Defined Excitation (HIDEX) photometer and sea gliders with optical back scattering sensor in various Navy interested areas such as the Arabian Gulf, Gulf of Oman, east Asian marginal seas, and Adriatic Sea. The data include temperature, salinity, bioluminescence, chlorophyll-a fluorescence, transmissivity at two different wavelengths (TRed at 670 nm, TBlue at 490 nm), and back scattering coefficient (bRed at 700 nm, bBlue at 470 nm). Transfer and correlation functions between the hydrographic and optical parameters are obtained. Bioluminescence and fluorescence maxima, transmissivity minimum with their corresponding depths, red and blue laser beam peak attenuation coefficients are identified from the optical profiles. Evident correlations are found between the ocean mixed layer depth and the blue and red laser beam peak attenuation coefficients, bioluminescence and fluorescence maxima in the Adriatic Sea, Arabian Gulf, Gulf of Oman, and Philippine Sea. Based on the observational data, an effective algorithm is recommended for solving the radiative transfer equation (RTE) for predicting underwater laser radiance.

  12. Mina olin siin. Kus siis täpselt? / Donald Tomberg

    Index Scriptorium Estoniae

    Tomberg, Donald

    2008-01-01

    Rene Vilbre noortefilm "Mina olin siin", mille aluseks on Sass Henno romaan "Mina olin siin. Esimene arest", osades Rasmus Kaljujärv, Hele Kõre, Tambet Tuisk, Jaan Rekkor : Amrion Productions - Helsinki-filmi OY. Artikli lõpus R. Vilbre filmograafia

  13. Elcoteq lõpetas aasta esmakordselt kahjumis / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2002-01-01

    Soome elektroonikakontserni Elcoteq Network OY eelmise aasta käive vähenes turu üldise madalseisu ja Ericssoniga koostöö vähenemise tõttu 15,8% ning ettevõte lõpetas aasta esmakordselt kahjumis

  14. Álvaro de Oyon. Un príncipe de la libertad

    Directory of Open Access Journals (Sweden)

    Alberto Montezuma Hurtado

    1969-07-01

    Full Text Available Yo guardo mis dudas sobre la verdadera personalidad y los propósitos del célebre Álvaro de Oyón, que fuera ahorcado y sometido enseguida a terrible destazamiento en la muy noble Villa de Popayán, el día tres de noviembre de 1553.

  15. Underground rock storage concepts for natural gas and LPG in Finland

    International Nuclear Information System (INIS)

    Saerkkae, P.

    1990-01-01

    Natural gas storage concepts are developed in Finland for both deep, unlined rock storages and cryogenic lined, near-surface storages. For butane and propane, Neste Oy has two unlined rock storages in Porvoo. Up to now, experiences are good on storage of LPG in rock temperature and higher than hydrostatic pressure. (author). 3 refs, 8 figs

  16. Sibeliuse Akadeemia, Helsingi Linnaorkester ja Raadio Sümfooniorkester saavad ühe katuse alla / Reet Marttila

    Index Scriptorium Estoniae

    Marttila, Reet

    2004-01-01

    16. XI otsustati, et Helsingi Musiikkitalo ehitamine käivitub aastal 2005 ja lõpeb hiljemalt 2010. 2000. a. toimunud arhitektuurikonkursi võitsid Turu arhitektid Marko Kivistö, Ola Laiho ja Mikko Pulkkinen (LPR-arkkitehdit OY). Akustik Yasuhisa Toyota

  17. Äripäev : Hiiumaa edukaim ettevõte on Dale LD AS / Urmas Lauri

    Index Scriptorium Estoniae

    Lauri, Urmas, 1956-

    2006-01-01

    Hiiumaa ettevõtete pingereas esimeseks tõusnud Dale LD AS-i tegevjuhi Tiit Asumetsa sõnul andis suurt efekti firma käibesse ja kasumisse Soome firmaga Ensto OY sõlmitud koostööleping. Lisa: Hiiumaa ettevõtete TOP aastal 2005

  18. Walnut and almond oil screw-press extraction at industrial scale: Effects of process parameters on oil yield and quality

    Directory of Open Access Journals (Sweden)

    M. L. Martínez

    2018-01-01

    Full Text Available Walnut and almond kernels are highly nutritious mainly due to their high oil contents. In this study, 32 factorial experimental designs were used to optimize processes for oil extraction by screw-pressing at industrial scale. Experimental designs included seed moisture content (SMC, and restriction die (RD as the main processing parameters. Theoretical models were scanned against experimental data in order to optimize oil extraction conditions. The response variables analyzed were oil yield (OY, fine solid content (FC in oil, and oil quality parameters. Fitted models for OY indicated maximum predicted values similar to the highest experimental values. Walnut oil extractions showed a maximum OY (84.5 ± 2.3 % at 7.21% SMC, and 10 mm RD. For almond kernels, maximum OY (71.9 ± 3.5% was obtained at 9.42% SMC, and 12 mm RD. Chemical quality parameters from both oils were in the ranges stated in Codex (FAO/WHO standards for virgin (non-refined oils.

  19. The geology of the Olkiluoto area

    International Nuclear Information System (INIS)

    Anttila, P.; Paulamaeki, S.; Lindberg, A.; Paananen, M.; Koistinen, T.; Front, K.; Pitkaenen, P.

    1992-12-01

    Teollisuuden Voima Oy (TVO) is preparing for the final disposal of spent nuclear fuel from the Olkiluoto nuclear power plant deep in the Finnish bedrock. An area close to the power plant at Olkiluoto, Eurajoki, was one of the five areas selected in 1987 for the preliminary site investigations. A summary of the geological conditions at the Olkiluoto site is presented in the report

  20. 77 FR 26238 - Fisheries of the United States; National Standard 1 Guidelines

    Science.gov (United States)

    2012-05-03

    ... this work, a number of issues regarding the application of the NS1 Guidelines were identified that may.... Further guidance on how OY should be specified to balance the multiple considerations in mixed-stock.... Under the MSA, stocks that have a life cycle of approximately 1 year and stocks subject to international...

  1. Curcumin and normal functioning of joints: evaluation of a health claim pursuant to Article 13(5) of Regulation (EC) No 1924/2006

    DEFF Research Database (Denmark)

    Sjödin, Anders Mikael

    2017-01-01

    Following an application from Suomen Terveysravinto Oy, submitted for authorisation of a health claim pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of Finland, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion...

  2. Akadeemikust ettevõtja võitleb viirustega / Kaire Talviste

    Index Scriptorium Estoniae

    Talviste, Kaire, 1979-

    2012-01-01

    Molekulaarbioloog Mart Ustavi tööst bioloogiliste ravimite väljatöötamisel. HIV1/AIDS vaktsiini väljatöötamisest FIT Biotech Oy Eesti filiaalis a-tel 2000-2011. M. Ustavi biotehnoloogia firma Icosagen Grupp tehnoloogilistest arendustest

  3. Pärjatud disaintool Haiku

    Index Scriptorium Estoniae

    2005-01-01

    Isku OY disaineri Tapio Anttila loodud tool Haiku pälvis rahvusvahelisel disainikonkursil ADEX 2004 (Award for Design Excellence) mööblikategoorias Adex Silver preemia. Eestis jõuab tool müüki maikuus, tooli valmistatakse kasest ja pöögist

  4. Fazer tahab kaaperdada Eesti Pagari tuntuimat kaubamärki / Eda-Liis Kann

    Index Scriptorium Estoniae

    Kann, Eda-Liis, 1979-

    2005-01-01

    Oy Karl Fazer Ab esitas patendiametile taotluse uute kaubamärkide registreerimiseks, mis on aga väga sarnased Eesti Pagari Õnne sarja toodete pakenditel olevate kujunditega ja mille värvikombinatsioonid langevad toonide lõikes kokku

  5. Eesti firma hakkab koostöös soomlastega välja töötama Ebola viiruse ravimit / Joosep Värk

    Index Scriptorium Estoniae

    Värk, Joosep

    2014-01-01

    Eesti biotehnoloogiafirma Icosagen hakkab koos Soome ettevõtte FIT Biotech Oy'ga välja töötama Ebola viiruse vastast vaktsiini, arendustöös osaleb professor Andres Meritsa juhtimisel ka Tartu Ülikooli Tehnoloogiainstituudi rakendusviroloogia labor. Vestlusest Tartu Ülikooli biomeditsiinitehnoloogia professori Mart Ustaviga

  6. Tartu teadlased aitavad välja mõelda Ebola-vastast vaktsiini / Aime Jõgi

    Index Scriptorium Estoniae

    Jõgi, Aime, 1958-

    2014-01-01

    Eesti biotehnoloogiafirma Icosagen hakkab koos Soome ettevõtte FIT Biotech Oy'ga välja töötama Ebola viiruse vastast vaktsiini, arendustöös osaleb ka Tartu Ülikooli Tehnoloogiainstituudi rakendusviroloogia labor

  7. 78 FR 12012 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of...

    Science.gov (United States)

    2013-02-21

    ... recreational shallow-water grouper (SWG) fixed seasonal closure, which are in place to prevent overfishing of... the Gulf gag and other SWG resources and prevent overfishing from the stocks in the SWG complex. DATES... regional fishery management councils to prevent overfishing and achieve, on a continuing basis, OY from...

  8. 50 CFR 648.55 - Framework adjustments to management measures.

    Science.gov (United States)

    2010-10-01

    ... prevent overfishing on a continuing basis, as required by National Standard 1 of the Magnuson-Stevens Act... expected to achieve OY and prevent overfishing on a continuing basis, the PDT shall recommend to the... overfishing on a continuing basis. When making the status determination in the SAFE Report, the PDT shall...

  9. 76 FR 22345 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of...

    Science.gov (United States)

    2011-04-21

    ... effective January 1, 2011, and implement interim measures to reduce overfishing of gag in the Gulf of Mexico... effect of this proposed rule is to reduce overfishing of the gag resource in the Gulf. DATES: Written... to prevent overfishing and achieve, on a continuing basis, the optimum yield (OY) from federally...

  10. 76 FR 65662 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Coastal Migratory Pelagic...

    Science.gov (United States)

    2011-10-24

    ... mackerel, and cobia. The intent of this rule is to specify ACLs for species not undergoing overfishing... overfishing, ACLs and AMs must be established at a level that prevents overfishing and helps to achieve OY... mechanism for specifying ACLs at a level such that overfishing does not occur in a fishery and AMs to...

  11. 78 FR 46897 - Fisheries of the Northeastern United States; Atlantic Herring Fishery; Framework Adjustment 2 and...

    Science.gov (United States)

    2013-08-02

    ... CONTACT: Carrie Nordeen, Fishery Policy Analyst, (978) 281-9272, fax (978) 281-9135. SUPPLEMENTARY... overfishing limit (OFL), acceptable biological catch (ABC), annual catch limit (ACL), optimum yield (OY... uncertainty buffer between ABC and the stock-wide ACL, while giving the fleet some flexibility in choosing...

  12. 76 FR 11737 - Fisheries of the Northeastern United States; Monkfish; Amendment 5

    Science.gov (United States)

    2011-03-03

    ... Policy Analyst, (978) 281-9103; fax: (978) 281-9135. SUPPLEMENTARY INFORMATION: Background The monkfish... (MSY), optimum yield (OY), overfishing limits (OFL), acceptable biological catch (ABC), ACLs, and... catches approach the proposed ABC, while the SFMA is less vulnerable. Amendment 5 also proposes measures...

  13. 75 FR 5537 - Fisheries of the Northeastern United States; Atlantic Mackerel, Squid, and Butterfish Fisheries...

    Science.gov (United States)

    2010-02-03

    ...://www.nero.noaa.gov . FOR FURTHER INFORMATION CONTACT: Carrie Nordeen, Fishery Policy Analyst, 978-281... of the initial optimum yield (IOY), allowable biological catch (ABC), domestic annual harvest (DAH... Year Specifications Loligo Illex Mackerel Butterfish Max OY 32,000 24,000 N/A 12,175 [[Page 5538

  14. Structure and properties of (Sr, Ca)CuO2-BaCuO2 superlattices grown by pulsed laser interval deposition

    NARCIS (Netherlands)

    Koster, Gertjan; Verbist, Karen; Rijnders, Augustinus J.H.M.; Rogalla, Horst; van Tendeloo, Gustaav; Blank, David H.A.

    2001-01-01

    We report on the preparation of CuBa2(SrxCa1¿x)nCun¿1Oy compounds by fabrication of (Ba,Sr,Ca)CuO2 superlattices with pulsed laser deposition (PLD). A technique called interval deposition is used to suppress multi-level or island growth resulting in high-quality superlattice structures. Both, the

  15. 77 FR 28308 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of...

    Science.gov (United States)

    2012-05-14

    ... end overfishing of stocks and to minimize bycatch and bycatch mortality to the extent practicable. Status of the Gray Triggerfish Stock The last Southeast Data, Assessment, and Review (SEDAR) benchmark... achieve, on a continuing basis, the optimum yield (OY) from federally managed fish stocks. These mandates...

  16. 76 FR 11857 - Magnuson-Stevens Fishery Conservation and Management Act Provisions; Fisheries of the...

    Science.gov (United States)

    2011-03-03

    .... The pollock peer-reviewed benchmark stock assessment review (Stock Assessment Workshop, or SAW, 50... overfishing, rebuild overfished stocks, achieve optimum yield (OY), and minimize the economic impact of... Management Act (Magnuson-Stevens Act). This action would revise the biological reference points and stock...

  17. 76 FR 23041 - Magnuson-Stevens Fishery Conservation and Management Act Provisions; Fisheries of the...

    Science.gov (United States)

    2011-04-25

    ... updated peer-reviewed benchmark stock assessment conducted in July 2010 (Stock Assessment Workshop, or SAW..., including preventing overfishing, rebuilding overfished stocks, achieving optimum yield (OY), and minimizing... revises the biological reference points and stock status for pollock, updates annual catch limits (ACLs...

  18. The effect of O2 in a humid O2/N2/NOx gas mixture on NOx and N2O remediation by an atmospheric pressure dielectric barrier discharge

    DEFF Research Database (Denmark)

    Teodoru, Steluta; Kusano, Yukihiro; Bogaerts, Annemie

    2012-01-01

    A numerical model for NxOy remediation in humid air plasma produced with a dielectric barrier discharge at atmospheric pressure is presented. Special emphasis is given to NO2 and N2O reduction with the decrease of O2 content in the feedstock gas. A detailed reaction mechanism including electronic...

  19. Inheritance of DNA methylation in DH and its backcrossed lines of ...

    African Journals Online (AJOL)

    Jane

    2011-08-01

    Aug 1, 2011 ... (Chen and Li, 2004). Salmon et al. .... M primer. MSAP bands. CTGCAG. Figure 2. A flowchart showing the MSAP method. ..... Doyle JJ, Doyle JL (1990). .... Yoon DB, Kang KH, Kim HJ, Ju HG, Kwon SJ, Suh JP, Jeong OY, Ahn.

  20. Eesti - Soome turismikaubamaja -5%

    Index Scriptorium Estoniae

    2006-01-01

    Turismikonverentsil "Eesti - Soome turismikaubamaja -5%" analüüsiti Eesti ja Soome vahelisi turismivõimalusi ning seati sihte edaspidiseks. Ülevaade Reilika Lelovi (Turismimaailm OÜ), Pauli Santala (Finnish Consulting Group), Tarja Vaakanaineni (Tallink Finland Vice Managing), Ain Hinsbergi (Turismimaailm OÜ), Jari Auraneni (Go Finland Oy) ja Mikko Saviko (The Baltic Guide) ettekannetest

  1. Synthetic Platelets: Intravenous Infusible Nanoparticles to Promote Hemostasis and Survival Following Liver Injury in Swine

    Science.gov (United States)

    2014-08-12

    measurements confirm the hydrodynamic diameter of the pru·ticles to be closer to 450 nm and the zeta potential to be -30 mY. The NME confirms the...ional studies. Brie Oy, the lefi lobe of the liver is iso lated and hemisected followed by c losure o f’the cavit y and quantification of blood loss

  2. Test manufacture of the canister insert 135

    International Nuclear Information System (INIS)

    Raiko, H.

    2005-10-01

    This report describes the insert-manufacturing test of a disposal canister for spent nuclear fuel that was made by Metso Foundries Jyvaeskylae Oy, in June 2004 on contract for Posiva Oy. The test manufacture was a part of the co-operation development programme of encapsulation technology between SKB AB and Posiva Oy. Insert casting was specified according to the current manufacturing specifications of SKB. The canister insert was of BWR-type with integral bottom. This was the second trial manufacture of this type of insert in Finland and, in total, the third test manufacture of insert by Metso Foundries Jyvaeskylae Oy. The result fulfilled all the requirements but the material mechanical properties of the cast material. The measured ultimate strength and elongation at rupture were lower than specified in the upper part of the cast. The reason for this was revealed in the metallurgical investigation of the cast material. The cast contained slag (dross). Avoiding the dross formation will be the most demanding challenge of the forthcoming development of the cast procedure. (orig.)

  3. RELATIONSHIP OF AMEBOCYTES AND TERRESTRIAL ELEMENTS TO ADULT SHELL DEPOSITION IN EASTERN OYSTERS

    Science.gov (United States)

    Fisher, William S. Submitted. Relationship of Amebocytes and Terrestrial Elements to Adult Shell Deposition in Eastern Oysters. J. Shellfish Res. 30 p. (ERL,GB 1197). Freshwater runoff contains terrestrial elements from geological deposits that may be vital to eastern oys...

  4. Karm betoon, roheline kanjon : STAKES-i ja Senati kinnisvara büroo, Lintulahdenkuja 4, Sörnäinen, Helsingi = Office Facilities for the National Research and Development Centre for Welfare an Health (STAKES) and Senate Properties / Mikko Heikkinen,

    Index Scriptorium Estoniae

    Heikkinen, Mikko

    2004-01-01

    Senati kinnisvarafirma valis oma peakorteri asukohaks endise lao. Samas ehitati STAKES-i uus hoone. Projekteerija: Heikkinen-Komonen OY. Autorid Mikko Heikkinen, Markku Komonen. Sisekujundus: Suunnittelupalvelut (STAKES), Heikkinen-Komonen (Senat). Maastikukujundus: Byman & Ruokonen. Valmis 2002. I korruse plaan, välis- ja sisevaated

  5. 50 CFR Table 1b to Part 660... - 2009, Harvest Guidelines for Minor Rockfish by Depth Sub-groups (weights in metric tons)

    Science.gov (United States)

    2010-10-01

    ... population in the California Current ecosystem, a non-quantitative assessment was conducted in 2007. The... 50 percent of the 2008 ABC and OY values. The stock is expected to remain at its current equilibrium... catcher/processors, 60.0 mt for motherships, and 105.0 mt for shore-based. r Canary rockfish—A canary...

  6. 50 CFR Table 1c to Part 660... - 2009, Open Access and Limited Entry Allocations by Species or Species Group (weights in metric tons)

    Science.gov (United States)

    2010-10-01

    ... population in the California Current ecosystem, a non-quantitative assessment was conducted in 2007. The... 50 percent of the 2008 ABC and OY values. The stock is expected to remain at its current equilibrium... fishery: 85.0 mt for catcher/processors, 60.0 mt for motherships, and 105.0 mt for shore-based. r/ Canary...

  7. Norra Orkla otsib teed Idaturule / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2004-01-01

    Ülevaade Norra börsiettevõtte Orkla tegevusest toiduainetööstuses ja meedia valdkonnas, välisinvesteeringutest Baltimaade ettevõtetesse ning eesmärkidest laieneda Ida-Euroopa turgudele Põhjamaade suurima kartulikrõpsude tootja Chips OY 79,6% aktsiate ostmise kaudu. Lisad: Orkla ostab tuntud krõpsuvalmistaja

  8. Nanoscale Cross-Point Resistive Switching Memory Comprising p-Type SnO Bilayers

    KAUST Repository

    Hota, Mrinal Kanti; Hedhili, Mohamed N.; Wang, Qingxiao; Melnikov, Vasily; Mohammed, Omar F.; Alshareef, Husam N.

    2015-01-01

    Reproducible low-voltage bipolar resistive switching is reported in bilayer structures of p-type SnO films. Specifically, a bilayer homojunction comprising SnOx (oxygen-rich) and SnOy (oxygen-deficient) in nanoscale cross-point (300 × 300 nm2

  9. Effect of annealing treatments on normal state resistivity of YBa 2 ...

    African Journals Online (AJOL)

    Samples of YBa2(Cu1-xTix)3Oy superconductor with x=0.00 , 0.01, 0.03 have been prepared by solide state reaction method. The effect of annealing treatments on normal electrical resistivity has been done using the bipolaron model. The results of this study show the increase of localized charge when the dopant content ...

  10. Tallink kaalub müüki pandud Silja Line'i ostu / Priit Rajalo

    Index Scriptorium Estoniae

    Rajalo, Priit, 1975-

    2005-01-01

    Soome Silja Oy AB omanikfirma Sea Containers otsustas 2. novembril Silja Line'i müüki panna, kuna laevafirma kasumlikkus on järsult vähenenud. Tallink Grupi finantsdirektori Janek Stalmeistri sõnul on Tallinki võimalikku ostuhuvi Silja Line'i vastu vara veel kommenteerida. Lisa: Silja laevad

  11. Ryntäys Viroon jatkuu / Eeva-Riitta Seies

    Index Scriptorium Estoniae

    Seies, Eeva-Riitta

    2002-01-01

    Soome kontsern Vapo ostis ASi Tootsi Turvas enamusaktsiad. Soome ettevõte Fit Biotech ostis Tartu biotehnoloogiaettevõtte Quattromed ja Soome toiduainetetööstuse ettevõte Saarioinen Oy Eesti tütarfirma omandas üle 66-protsendilise osaluse valmistoidufirmas Meleco AS

  12. Kumu Kunstimuuseum / Pekka Vapaavuori, Pia Sabelström, Pille Lausmäe

    Index Scriptorium Estoniae

    Vapaavuori, Pekka, 1962-

    2006-01-01

    II ja V korruse plaan, 2 välis- ja 5 sisevaadet; fotod: Kaido Haagen; projekteerija: Arkkitehtitoimisto Vapaavuori OY, 7 kaasautorit loetletud; sisekujundus: P. Sabelström; mööbel: P. Lausmäe, maastik: DIA Arhitektuur

  13. Kundas hoitakse Eesti vedelkütuse varusid / Raivo Raigna

    Index Scriptorium Estoniae

    Raigna, Raivo

    2006-01-01

    Eesti vedelkütusevarude hoiustamise hanke üks võitjaid on Soome firma Baltic Tank OY, mis on Baltic Tank AS-i emafirma. Kunda sadamas asuvas Baltic Tanki AS-i terminalis hoitakse Eesti riigi diislikütuse tagavara

  14. 77 FR 15915 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Comprehensive Annual Catch Limit...

    Science.gov (United States)

    2012-03-16

    ... Amendment, which includes a final environmental impact statement (FEIS), a regulatory flexibility analysis... proposed rule for the Comprehensive ACL Amendment specific to a revised allowable biological catch (ABC... equal to both the OY and the allowable biological catch (ABC). This final rule specifies an ACL for...

  15. Integrated natural gas pipeline control and customer service system of Gasum; Le systeme integre de controle des canalisations de gaz et de service au consommateur chez Gasum

    Energy Technology Data Exchange (ETDEWEB)

    Aho, J.; Manty, O.; Ahlnas, B. [Gasul Oy (Finland)

    2000-07-01

    Due to the rapid development of the information technology, ageing is not the only driving force for replacing old computer systems with more sophisticated ones. The Finnish natural Gas company, Gasum Oy, has recently taken into use a new control and monitoring system for natural gas pipeline. A special customer service system, developed by Gasum Oy, is closely connected to monitoring system. It provides up-to-date information to all customers of Gasum Oy. The information is layered in three confidential levels: general information, operational data and invoicing information. The system is operating interactively in confidential Extranet. Inside Gasum Oy to meet the needs of departments outside the control room, a new GID system is developed. GID is a way to present pipeline process data and its further modifications with a very user-friendly interface based on geographical map. The system is based on data warehouse architecture and it is working on company's Intranet. This makes it possible to present various secrecy level information based on user ID. Gasum's new SCADA is not only the base for operating the pipeline, but it also provides lot of vital information to other systems serving different user groups within natural gas business in Finland. (authors)

  16. Pärnu maanteele kerkib Tallinna suurim korterelamu Osten Tor

    Index Scriptorium Estoniae

    2004-01-01

    Tallinnas Pärnu mnt. ja Tondi t. ristmikule kerkib 2006. a. alguseks 15-korruseline torniga äri- ja eluhoone. Hoone jaoks Soomes korraldatud arhitektuurikonkursi võitis Mutanen-Samninen-Vaarna OY ideekavand. Edasine projekteerimistöö toimub Eesti büroos KPME OÜ. Ehituse peatöövõtja: SRV Ehituse AS

  17. Exports of Finnish wind power technology gaining momentum

    International Nuclear Information System (INIS)

    2005-01-01

    In the 1990s, Finnish companies in the wind power sector focused on supplying advanced components and materials. This capability has now extended to cover entire turbines and wind farms. Winwind Oy, based in northern Finland, has developed a new type of solution for the export market, combining the advantages of modem direct drives with those of traditional high-speed gear systems

  18. Lepingud kahe väikelaeva ehitamiseks

    Index Scriptorium Estoniae

    2006-01-01

    Veeteede Amet sõlmis lepingud Uusikaupunki Työvene OY-ga kahe väikelaeva ehitamiseks, laevade ehitamine on osa ERDFi (European Regional Development Foundation) kaasfinantseeritavast projektist "Emajõe, Narva jõe ja Peipsi-Lämmijärve veeteede kaasajastamine ning eelduste loomine ohutu veeliikluse tagamiseks rekonstrueeritud veeteedel"

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 401 - 450 of 479 ... Vol 28, No 2 (2010), Proximate and sensory properties of fruit juice produced from varieties of watermelon (Citrullus lanatus). Abstract. O.Y Eziaghighala, M.O ... Vol 28, No 1 (2010), Quality Characteristics of bread made from Wheat and Fluted Pumpkin seed flour, Abstract. H.O Agu, J.A Ukonze, K.A ...

  20. Paroc - tulepüsivad paneelid

    Index Scriptorium Estoniae

    1998-01-01

    Partek Paroc OY/Ab Panels System on Soome tööstuskontserni Partek tütarettevõte, mis tegeleb kaasaegsete tulepüsivate Paroc-paneelide tootmisega. Paroc-paneelidest, mida kasutatakse tööstus-, tootmis- ja laohoonete ehitamisel (fassaadid, tuuletõkke seinad, laed).