
Sample records for hh hh hhh

  1. The HhH domain of the human DNA repair protein XPF forms stable homodimers. (United States)

    Das, Devashish; Tripsianes, Konstantinos; Jaspers, Nicolaas G J; Hoeijmakers, Jan H J; Kaptein, Robert; Boelens, Rolf; Folkers, Gert E


    The human XPF-ERCC1 protein complex plays an essential role in nucleotide excision repair by catalysing positioned nicking of a DNA strand at the 5' side of the damage. We have recently solved the structure of the heterodimeric complex of the C-terminal domains of XPF and ERCC1 (Tripsianes et al., Structure 2005;13:1849-1858). We found that this complex comprises a pseudo twofold symmetry axis and that the helix-hairpin-helix motif of ERCC1 is required for DNA binding, whereas the corresponding domain of XPF is functioning as a scaffold for complex formation with ERCC1. Despite the functional importance of heterodimerization, the C-terminal domain of XPF can also form homodimers in vitro. We here compare the stabilities of homodimeric and heterodimeric complexes of the C-terminal domains of XPF and ERCC1. The higher stability of the XPF HhH complexes under various experimental conditions, determined using CD and NMR spectroscopy and mass spectrometry, is well explained by the structural differences that exist between the HhH domains of the two complexes. The XPF HhH homodimer has a larger interaction interface, aromatic stacking interactions, and additional hydrogen bond contacts as compared to the XPF/ERCC1 HhH complex, which accounts for its higher stability.

  2. Structure-guided mutational analysis of the OB, HhH, and BRCT domains of Escherichia coli DNA ligase. (United States)

    Wang, Li Kai; Nair, Pravin A; Shuman, Stewart


    NAD(+)-dependent DNA ligases (LigAs) are ubiquitous in bacteria and essential for growth. LigA enzymes have a modular structure in which a central catalytic core composed of nucleotidyltransferase and oligonucleotide-binding (OB) domains is linked via a tetracysteine zinc finger to distal helix-hairpin-helix (HhH) and BRCT (BRCA1-like C-terminal) domains. The OB and HhH domains contribute prominently to the protein clamp formed by LigA around nicked duplex DNA. Here we conducted a structure-function analysis of the OB and HhH domains of Escherichia coli LigA by alanine scanning and conservative substitutions, entailing 43 mutations at 22 amino acids. We thereby identified essential functional groups in the OB domain that engage the DNA phosphodiester backbone flanking the nick (Arg(333)); penetrate the minor grove and distort the nick (Val(383) and Ile(384)); or stabilize the OB fold (Arg(379)). The essential constituents of the HhH domain include: four glycines (Gly(455), Gly(489), Gly(521), Gly(553)), which bind the phosphate backbone across the minor groove at the outer margins of the LigA-DNA interface; Arg(487), which penetrates the minor groove at the outer margin on the 3 (R)-OH side of the nick; and Arg(446), which promotes protein clamp formation via contacts to the nucleotidyltransferase domain. We find that the BRCT domain is required in its entirety for effective nick sealing and AMP-dependent supercoil relaxation.

  3. The HhH2/NDD domain of the Drosophila Nod chromokinesin-like protein is required for binding to chromosomes in the oocyte nucleus. (United States)

    Cui, Wei; Hawley, R Scott


    Nod is a chromokinesin-like protein that plays a critical role in segregating achiasmate chromosomes during female meiosis. The C-terminal half of the Nod protein contains two putative DNA-binding domains. The first of these domains, known as the HMGN domain, consists of three tandemly repeated high-mobility group N motifs. This domain was previously shown to be both necessary and sufficient for binding of the C-terminal half of Nod to mitotic chromosomes in embryos. The second putative DNA-binding domain, denoted HhH(2)/NDD, is a helix-hairpin-helix(2)/Nod-like DNA-binding domain. Although the HhH(2)/NDD domain is not required or sufficient for chromosome binding in embryos, several well-characterized nod mutations have been mapped in this domain. To characterize the role of the HhH(2)/NDD domain in mediating Nod function, we created a series of UAS-driven transgene constructs capable of expressing either a wild-type Nod-GFP fusion protein or proteins in which the HhH(2)/NDD domain had been altered by site-directed mutagenesis. Although wild-type Nod-GFP localizes to the oocyte chromosomes and rescues the segregation defect in nod mutant oocytes, two of three proteins carrying mutants in the HhH(2)/NDD domain fail to either rescue the nod mutant phenotype or bind to oocyte chromosomes. However, these mutant proteins do bind to the polytene chromosomes in nurse-cell nuclei and enter the oocyte nucleus. Thus, even though the HhH(2)/NDD domain is not essential for chromosome binding in other cell types, it is required for chromosome binding in the oocyte. These HhH(2)/NDD mutants also block the localization of Nod to the posterior pole of stage 9-10A oocytes, a process that is thought to facilitate the interaction of Nod with the plus ends of microtubules (Cui et al. 2005). This observation suggests that the Nod HhH2/NDD domain may play other roles in addition to binding Nod to meiotic chromosomes.

  4. Epitaxial growth of magnetoresistive (00h), (0hh), and (hhh) La2/3Sr1/3MnO3 thin films on (001)Si substrates (United States)

    Fontcuberta, J.; Bibes, M.; Martínez, B.; Trtik, V.; Ferrater, C.; Sánchez, F.; Varela, M.


    We show that suitable choice of the buffer heterostructure allows us to obtain epitaxial (00h), (0hh), and (hhh) La2/3Sr1/3MnO3 thin films on buffered Si(001) substrates. The magnetotransport properties are investigated. Irrespective of the film texture, it is found that the easy-magnetization direction lies within the film plane. The low-field magnetoresistance is mainly controlled by the in-plane misorientation of crystallites while differences associated with the distinct microstructure of the interfaces appear to have only a second-order effect.

  5. Numerical Simulations of HH 555

    CERN Document Server

    Kajdic, Primoz


    We present 3D gasdynamic simulations of the Herbig Haro object HH 555. HH 555 is a bipolar jet emerging from the tip of an elephant trunk entering the Pelican Nebula from the adjacent molecular cloud. Both beams of HH 555 are curved away from the center of the H II region. This indicates that they are being deflected by a side-wind probably coming from a star located inside the nebula or by the expansion of the nebula itself. HH 555 is most likely an irradiated jet emerging from a highly embedded protostar, which has not yet been detected. In our simulations we vary the incident photon flux, which in one of our models is equal to the flux coming from a star 1 pc away emitting 5x10^48 ionizing (i. e., with energies above the H Lyman limit) photons per second. An external, plane-parallel flow (a ``side-wind'') is coming from the same direction as the photoionizing flux. We have made four simulations, decreasing the photon flux by a factor of 10 in each simulation. We discuss the properties of the flow and we co...

  6. Ammonia downstream from HH 80 North (United States)

    Girart, Jose M.; Rodriguez, Luis F.; Anglada, Guillem; Estalella, Robert; Torrelles, Jose, M.; Marti, Josep; Pena, Miriam; Ayala, Sandra; Curiel, Salvador; Noriega-Crespo, Alberto


    HH 80-81 are two optically visible Herbig-Haro (HH) objects located about 5 minutes south of their exciting source IRAS 18162-2048. Displaced symmetrically to the north of this luminous IRAS source, a possible HH counterpart was recently detected as a radio continuum source with the very large array (VLA). This radio source, HH 80 North, has been proposed to be a member of the Herbig-Haro class since its centimeter flux density, angular size, spectral index, and morphology are all similar to those of HH 80. However, no object has been detected at optical wavelengths at the position of HH 80 North, possibly because of high extinction, and the confirmation of the radio continuum source as an HH object has not been possible. In the prototypical Herbig-Haro objects HH 1 and 2, ammonia emission has been detected downstream of the flow in both objects. This detection has been intepreted as a result of an enhancement in the ammonia emission produced by the radiation field of the shock associated with the HH object. In this Letter we report the detection of the (1,1) and (2,2) inversion transitions of ammonia downstream HH 80 North. This detection gives strong suppport to the interpretation of HH 80 North as a heavily obscured HH object. In addition, we suggest that ammonia emission may be a tracer of embedded Herbig-Haro objects in other regions of star formation. A 60 micrometer IRAS source could be associated with HH 80 North and with the ammonia condensation. A tentative explanation for the far-infrared emission as arising in dust heated by their optical and UV radiation of the HH object is presented.

  7. A Jet Model of HH Objects (United States)

    Tenorio-Tagle, Guillermo; Rozyczka, Michal; Cantó, Jorge

    It is shown by means of two dimensional hydrodynamical simulations that Canto's model of HH objects does not lead to an entirely stationary flow. It causes both a stationary cylindrical shock (at the interaction place) and a fast moving region emitting an HH spectra. A coherent picture of these phenomena is here presented. The models account for "optical jet" structures embedded in a much larger (>0.1 pc) hydrodynamical jet at the tip of which an HH object should be found.

  8. Test of the triple Higgs boson form factor in $\\mu^-\\mu^+\\to HH$

    CERN Document Server

    Gounaris, G J


    We study the sensitivity of the process $\\mu^-\\mu^+\\to HH$ to the $q^2$-dependence of the $HHH$ form factor, which can reflect the Higgs boson structure, especially in the case of compositeness. We compute the Born and 1 loop SM contribution to this process. We then show how the $\\mu^-\\mu^+\\to HH$ polarized and unpolarized cross sections are modified by the presence of various types of anomalous contributions to the $HHH$ form factor, in particular Higgs constituents in the case of compositeness.

  9. H-H interactions in Pd

    DEFF Research Database (Denmark)

    Christensen, O. B.; Ditlevsen, Peter; Jacobsen, Karsten Wedel;


    A discussion of the H-H interactions in a metal is given. Based on self-consistent total-energy calculations within the local-density approximation for H2 in a homogeneous electron gas, we show that metallic electrons make the H-H interaction more repulsive than in vacuum. Using effective...... of the calculated energetics, the thermodynamical properties of various palladium hydrides are modeled....


    Energy Technology Data Exchange (ETDEWEB)

    Raga, A. C.; Rodriguez-Gonzalez, A.; Esquivel, A. [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Ap. 70-543, 04510 Mexico, D.F. (Mexico); Noriega-Crespo, A. [Spitzer Science Center, California Institute of Technology, CA 91125 (United States)


    We consider newly derived proper motions of the HH 34 jet to reconstruct the evolution of this outflow. We first extrapolate ballistic trajectories for the knots (starting from their present-day positions and velocities) and find that at {approx}1000 yr in the future most of them will merge to form a larger-mass structure. This mass structure will be formed close to the present-day position of the HH 34S bow shock. We then carry out a fit to the ejection velocity versus time reconstructed from the observed proper motions (assuming that the past motion of the knots was ballistic) and use this fit to compute axisymmetric jet simulations. We find that the intensity maps predicted from these simulations do indeed match reasonably well the [S II] structure of HH 34 observed in Hubble Space Telescope images.

  11. Luminosity Targets for FCC-hh

    CERN Document Server

    Zimmermann, F.; Buffat, X.; Schulte, D.


    We discuss the choice of target values for the peak and integrated luminosity of a future high-energy frontier circular hadron collider (FCC-hh). We review the arguments on the physics reach of a hadron collider. Next we show that accelerator constraints will limit the beam current and the turnaround time. Taking these limits into account, we derive an expression for the ultimate integrated luminosity per year, depending on a possible pile-up limit imposed by the physics experiments. We finally benchmark our result against the planned two phases of FCC-hh [1, 2, 3

  12. X-rays from HH 80, HH 81, and the Central Region

    CERN Document Server

    Pravdo, S H; Maeda, Y; Pravdo, Steven H.; Tsuboi, Yohko; Maeda, Yoshitomo


    We report detections of X-rays from HH 80 and HH 81 with the ACIS instrument on the Chandra X-ray Observatory. These are among the most luminous HH sources in the optical and they are now the most luminous known in X-rays. These X-rays arise from the strong shocks that occur when the southern extension of this bipolar outflow slams into the ambient material. There is a one-to-one correspondence between regions of high X-ray emission and high H? emission. The X-ray luminosities of HH 80 and HH 81 are 4.5 and 4.3 x 1031 erg s-1, respectively, assuming the measured low-energy absorption is not in the sources. The measured temperature of the HH plasma is not as large as that expected from the maximum velocities seen in the extended tails of the optical emission lines. Rather it is consistent with the ~106 K temperature of the ?narrow? core of the optical lines. There is no observed emission from HH 80 North, the northern extension of the bipolar flow, based upon a measurement of lower sensitivity. We imaged the c...

  13. Gemini-IFU Spectroscopy of HH 111 (United States)

    Cerqueira, A. H.; Vasconcelos, M. J.; Raga, A. C.; Feitosa, J.; Plana, H.


    We present new optical observations of the Herbig-Haro (HH) 111 jet using the Gemini Multi Object Spectrograph in its Integral Field Unit mode. Eight fields of 5\\prime\\prime × 3\\buildrel{\\prime\\prime}\\over{.} 5 have been positioned along and across the HH 111 jet, covering the spatial region from knot E to L in HH 111 (namely, knots E, F, G, H, J, K, and L). We present images and velocity channel maps for the [O i] 6300+6360, Hα, [N ii] 6548+6583, and [S ii] 6716+6730 lines, as well as for the [S ii] 6716/6730 line ratio. We find that the HH 111 jet has an inner region with lower excitation and higher radial velocity, surrounded by a broader region of higher excitation and lower radial velocity. Also, we find higher electron densities at lower radial velocities. These results imply that the HH 111 jet has a fast, axial region with lower velocity shocks surrounded by a lower velocity sheath with higher velocity shocks. Based on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the Science and Technology Facilities Council (United Kingdom), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).

  14. Ihog and Boi elicit Hh signaling via Ptc but do not aid Ptc in sequestering the Hh ligand. (United States)

    Camp, Darius; Haitian He, Billy; Li, Sally; Althaus, Irene W; Holtz, Alexander M; Allen, Benjamin L; Charron, Frédéric; van Meyel, Donald J


    Hedgehog (Hh) proteins are secreted molecules essential for tissue development in vertebrates and invertebrates. Hh reception via the 12-pass transmembrane protein Patched (Ptc) elicits intracellular signaling through Smoothened (Smo). Hh binding to Ptc is also proposed to sequester the ligand, limiting its spatial range of activity. In Drosophila, Interference hedgehog (Ihog) and Brother of ihog (Boi) are two conserved and redundant transmembrane proteins that are essential for Hh pathway activation. How Ihog and Boi activate signaling in response to Hh remains unknown; each can bind both Hh and Ptc and so it has been proposed that they are essential for both Hh reception and sequestration. Using genetic epistasis we established here that Ihog and Boi, and their orthologs in mice, act upstream or at the level of Ptc to allow Hh signal transduction. In the Drosophila developing wing model we found that it is through Hh pathway activation that Ihog and Boi maintain the boundary between the anterior and posterior compartments. We dissociated the contributions of Ptc from those of Ihog/Boi and, surprisingly, found that cells expressing Ptc can retain and sequester the Hh ligand without Ihog and Boi, but that Ihog and Boi cannot do so without Ptc. Together, these results reinforce the central role for Ptc in Hh binding in vivo and demonstrate that, although Ihog and Boi are dispensable for Hh sequestration, they are essential for pathway activation because they allow Hh to inhibit Ptc and thereby relieve its repression of Smo.

  15. IR diagnostics of embedded jets: velocity resolved observations of the HH34 and HH1 jets

    CERN Document Server

    Lopez, R Garcia; Giannini, T; Eislöffel, J; Bacciotti, F; Podio, L


    We present VLT-ISAAC medium resolution spectroscopy of the HH34 and HH1 jets. Our aim is to derive the kinematics and the physical parameters and to study how they vary with jet velocity. We use several important diagnostic lines such as [FeII] 1.644um, 1.600um and H2 2.122um. In the inner jet region of HH34 we find that both the atomic and molecular gas present two components at high and low velocity. The [FeII] LVC in HH34 is detected up to large distances from the source (>1000 AU), at variance with TTauri jets. In H2 2.122um, the LVC and HVC are spatially separated. We detect, for the first time, the fainter red-shifted counterpart down to the central source. In HH1, we trace the jet down to ~1" from the VLA1 driving source: the kinematics of this inner region is again characterised by the presence of two velocity components, one blue-shifted and one red-shifted with respect to the source LSR velocity. In the inner HH34 jet region, ne increases with decreasing velocity. Up to ~10" from the driving source,...

  16. Accretion and ejection properties of embedded protostars: the case of HH26, HH34 and HH46 IRS

    CERN Document Server

    Antoniucci, S; Giannini, T; Lorenzetti, D


    We present the results of a near-IR spectroscopic analysis on 3 young embedded sources (HH26IRS, HH34IRS and HH46IRS) belonging to different star-forming regions and displaying well developed jet structures. The aim is to investigate the source accretion and ejection properties and their connection. We used VLT-ISAAC spectra (R~9000, H and K bands) to derive in a self-consistent way parameters like the star luminosity, the accretion luminosity and the mass accretion rate. Mass loss rates have also been estimated from the analysis of different emission features. The spectra present several emission lines but no photospheric features in absorption, indicating a large veiling in H and K. We detected features commonly observed in jet-driving sources (HI,[FeII],H_2,CO) and also a number of emission lines due to permitted atomic transitions, like NaI and TiI. The NaI 2.2um doublet is observed along with CO(2-0) band-head emission, indicating a common origin in an inner gaseous disc heated by accretion. We find that...

  17. Proper motions of the HH 1 jet (United States)

    Raga, A. C.; Reipurth, B.; Esquivel, A.; Castellanos-Ramírez, A.; Velázquez, P. F.; Hernández-Martínez, L.; Rodríguez-González, A.; Rechy-García, J. S.; Estrella-Trujillo, D.; Bally, J.; González-Gómez, D.; Riera, A.


    We describe a new method for determining proper motions of extended objects, and a pipeline developed for the application of this method. We then apply this method to an analysis of four epochs of [S II] HST images of the HH 1 jet (covering a period of ≈20 yr). We determine the proper motions of the knots along the jet, and make a reconstruction of the past ejection velocity time-variability (assuming ballistic knot motions). This reconstruction shows an "acceleration" of the ejection velocities of the jet knots, with higher velocities at more recent times. This acceleration will result in an eventual merging of the knots in ≈450 yr and at a distance of ≈80'' from the outflow source, close to the present-day position of HH 1.

  18. Study of HH production at CMS

    CERN Document Server

    Francois, Brieuc Arnaud L


    The production of a pair of Higgs bosons provides a direct handle on the structure of the Higgs field potential. While the HH production within the SM is very small and essentially out of the experimental reach within the LHC Run I or II, several beyond SM theories foresee an enhancement that can be already probed with the available data. First searches for resonant and non-resonant Higgs pair production made using CMS Run II data will be presented.

  19. Infrasound Generation from the HH Seismic Hammer.

    Energy Technology Data Exchange (ETDEWEB)

    Jones, Kyle Richard


    The HH Seismic hammer is a large, "weight-drop" source for active source seismic experiments. This system provides a repetitive source that can be stacked for subsurface imaging and exploration studies. Although the seismic hammer was designed for seismological studies it was surmised that it might produce energy in the infrasonic frequency range due to the ground motion generated by the 13 metric ton drop mass. This study demonstrates that the seismic hammer generates a consistent acoustic source that could be used for in-situ sensor characterization, array evaluation and surface-air coupling studies for source characterization.

  20. Infrasound Generation from the HH Seismic Hammer.

    Energy Technology Data Exchange (ETDEWEB)

    Jones, Kyle Richard


    The HH Seismic hammer is a large, "weight-drop" source for active source seismic experiments. This system provides a repetitive source that can be stacked for subsurface imaging and exploration studies. Although the seismic hammer was designed for seismological studies it was surmised that it might produce energy in the infrasonic frequency range due to the ground motion generated by the 13 metric ton drop mass. This study demonstrates that the seismic hammer generates a consistent acoustic source that could be used for in-situ sensor characterization, array evaluation and surface-air coupling studies for source characterization.

  1. Fabry-Perot Observations of HH 1/2

    Directory of Open Access Journals (Sweden)

    A. Riera


    Full Text Available Presentamos nuevas observaciones Fabry-Perot del sistema HH1/2 en la l nea de H. Se han obtenidos los perfiles de las l neas, y los mapas de velocidad radial y de dispersi n de velocidades a partir de los canales de velocidad de los objetos HH 1 y HH 2. La distribuci on espacial de la velocidad radial de ambos objetos (HH 1, HH 2 presenta material desplazado al rojo hacia la fuente, y material desplazado al azul alej ndose de la fuente. Un modelo que contempla la presencia de emisi n directa+dispersada con tres condensaciones emisoras reproduce cualitativamente la distribuci n espacial de la velocidad radial y de la dispersi n de velocidades de HH 2.

  2. Multiepoch Radio Observations of the Exciting Sources of HH 212 and HH 119

    Directory of Open Access Journals (Sweden)

    R. Galván Madrid


    Full Text Available Presentamos observaciones de alta resolución angular (- 0.``3 hechas con el Very Large Array a 3.5 cm hacia las regiones de las fuentes excitadoras de dos sistemas Herbig-Haro: HH 212 en Orión y HH 119 en B335. Las observaciones fueron hechas durante tres épocas diferentes con el objetivo de medir posibles variaciones temporales rápidas (en la escala de una semana a un mes en las fuentes. En HH 212 detectamos, promediando las observaciones de las tres épocas, una fuente muy débil justo en la posición esperada para la fuente excitadora del sistema HH. La comparación con otras observaciones de radio de esta fuente indica variación temporal considerable en escala de años. En B335 detectamos en cada época al objeto previamente reportado por otros autores y nuestros resultados sugieren que esta fuente, un chorro térmico de radio, es variable en escalas de tiempo de un mes. Discutimos posibles explicaciones para esta rápida variabilidad.

  3. Diffuse ionizing radiation within HH jets

    Energy Technology Data Exchange (ETDEWEB)

    Esquivel, A.; Raga, A. C., E-mail:, E-mail: [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, Apartado Postal 70-543, 04510 Mexico D.F. (Mexico)


    We present numerical hydrodynamical simulations of a time-dependent ejection velocity precessing jet. The parameters used in our models correspond to a high excitation Herbig-Haro object, such as HH 80/81. We have included the transfer of ionizing radiation produced within the shocked regions of the jet. The radiative transfer is computed with a ray-tracing scheme from all the cells with an emissivity above a certain threshold. We show the development of a radiative precursor, and compare the morphology with a model without the diffuse radiation. Our simulations show that the morphology of the Hα emission is affected considerably if the diffuse ionizing radiation is accounted for. The predicted Hα position-velocity diagram (i.e., spatially resolved emission line profiles) from a model with the transfer of ionizing radiation has a relatively strong component at zero velocity, corresponding to the radiative precursor. Qualitatively similar 'zero velocity components' are observed in HH 80/81 and in the jet from Sanduleak's star in the Large Magellanic Cloud.

  4. HH-65A Dolphin digital integrated avionics (United States)

    Huntoon, R. B.


    Communication, navigation, flight control, and search sensor management are avionics functions which constitute every Search and Rescue (SAR) operation. Routine cockpit duties monopolize crew attention during SAR operations and thus impair crew effectiveness. The United States Coast Guard challenged industry to build an avionics system that automates routine tasks and frees the crew to focus on the mission tasks. The HH-64A SAR avionics systems of communication, navigation, search sensors, and flight control have existed independently. On the SRR helicopter, the flight management system (FMS) was introduced. H coordinates or integrates these functions. The pilot interacts with the FMS rather than the individual subsystems, using simple, straightforward procedures to address distinct mission tasks and the flight management system, in turn, orchestrates integrated system response.

  5. Integral Field Spectroscopy of HH 262: The Spectral Atlas

    CERN Document Server

    López, R; Sánchez, S F; Gómez, G; Estalella, R; Riera, A


    HH 262 is a group of emitting knots displaying an "hour-glass" morphology in the Halpha and [SII] lines, located 3.5' to the northeast of the young stellar object L1551-IRS5, in Taurus. We present new results of the kinematics and physical conditions of HH 262 based on Integral Field Spectroscopy covering a field of 1.5'x3', which includes all the bright knots in HH 262. These data show complex kinematics and significant variations in physical conditions over the mapped region of HH 262 on a spatial scale of <3". A new result derived from the IFS data is the weakness of the [NII] emission (below detection limit in most of the mapped region of HH 262), including the brightest central knots. Our data reinforce the association of HH 262 with the redshifted lobe of the evolved molecular outflow L1551-IRS5. The interaction of this outflow with a younger one, powered by L1551 NE, around the position of HH 262 could give rise to the complex morphology and kinematics of HH 262.

  6. A 3-mode, Variable Velocity Jet Model for HH 34 (United States)

    Raga, A.; Noriega-Crespo, A.


    Variable ejection velocity jet models can qualitatively explain the appearance of successive working surfaces in Herbig-Haro (HH) jets. This paper presents an attempt to explore which features of the HH 34 jet can indeed be reproduced by such a model.

  7. The IFIN-HH triple coincidence liquid scintillation counter

    CSIR Research Space (South Africa)

    Razdolescu, AC


    Full Text Available at IFIN-HH using a 3 H standard. The performances of the IFIN-HH TDCR counter was checked against the measurement results of the TDCR counters of CSIR NML (South Africa), RC (Poland) and LNHB (France). A set of ready-to-measure Ni-63 sources in liquid...

  8. IFIN - HH contribution at the Pierre Auger observatory (United States)

    Brancus, I. M.; Saftoiu, A.


    Since 2000, in collaboration with KIT, Germany, the research of Astroparticle Physics has developed in IFIN-HH Bucharest. Romanian researchers participated in large international experiments, KASCADE Grande and LOPES, for investigating cosmic rays. New experimental devices have been built in IFIN-HH Bucharest for measuring the cosmic ray muons. Based on the experience and results gained over that time, Romanian researchers became part of the Pierre Auger Collaboration, the largest complex experiment for the investigation of Extensive Air Showers. The contribution of IFIN-HH is focused on the studies of cosmic rays using radio antennae and the measuring of cosmic muons using detectors based on new technology.

  9. 2D Spectroscopy of HH588 Large-Scale Outflow (United States)

    Hovhannissian, Elena R.; Ogura, K.; Movsessian, Tigran A.; Magakian, Tigran Yu.; Nikogossian, Elena H.


    The HH588 flow is studied with multi-pupil spectrograph on the 2.6 m telescope of Byurakan observatory. The bright components of this flow are analyzed, using the maps of emission lines and radial velocities. The bipolar nature of this outflow is obvious from their radial velocities. The unusual feature of HH588 flow is its inclusion in the bright-rimmed cloud; thus, it can belong to so-called irradiated jets. It is worth to mention that all HH-objects studied here show a deceleration in the regions of interaction with the interstellar medium.

  10. X-rays from HH210 in the Orion nebula

    CERN Document Server

    Grosso, N; Getman, K V; Kästner, J H; Bally, J; McCaughrean, M J; Grosso, Nicolas; Feigelson, Eric D.; Getman, Konstantin V.; Kastner, Joel H.; Bally, John; Caughrean, Mark J. Mc


    We report the detection during the Chandra Orion Ultradeep Project (COUP) of two soft, constant, and faint X-ray sources associated with the Herbig-Haro object HH210. HH210 is located at the tip of the NNE finger of the emission line system bursting out of the BN-KL complex, northwest of the Trapezium cluster in the OMC-1 molecular cloud. Using a recent Halpha image obtained with the ACS imager on board HST, and taking into account the known proper motions of HH210 emission knots, we show that the position of the brightest X-ray source, COUP703, coincides with the emission knot 154-040a of HH210, which is the emission knot of HH210 having the highest tangential velocity (425 km/s). The second X-ray source, COUP704, is located on the complicated emission tail of HH210 close to an emission line filament and has no obvious optical/infrared counterpart. Spectral fitting indicates for both sources a plasma temperature of ~0.8 MK and absorption-corrected X-ray luminosities of about 1E30 erg/s (0.5-2.0 keV). These X...

  11. Optical imaging of L723: the structure of HH 223

    CERN Document Server

    López, R; Gómez, G; Riera, A


    We imaged the Lynds 723 dark nebula (L723) with the aim of studying the morphology of the Herbig-Haro object HH 223 and other line-emission nebula detected in the region. We obtained deep narrow-band images in the Halpha and [SII] lines and in the continuum nearby Halpha of a field of ~5' of the L723 dark nebula centered on HH 223. The Halpha and [SII] images reveal the detailed morphology of HH 223, unresolved in previous optical images. Both images show a quite complex knotty, wiggling structure embedded in a low-emission nebula. Comparison between the [SII] and Halpha fluxes of the knots are indicative of variations in the excitation conditions through HH 223. In addition, several other faint nebula are detected in Halpha a few arcmin to the SE and to the NW of HH 223, all of them lying projected onto the east-west pair of lobes of the quadrupolar CO outflow. Comparison between the Halpha and the continuum images confirms the HH-like nature of the Vrba object V83, while the Vrba objects V84 and V85 are ide...

  12. Solidification microstructure formation in HK40 and HH40 alloys (United States)

    Ding, Xian-fei; Liu, Dong-fang; Guo, Pei-liang; Zheng, Yun-rong; Feng, Qiang


    The microstructure formation processes in HK40 and HH40 alloys were investigated through JmatPro calculations and quenching performed during directional solidification. The phase transition routes of HK40 and HH40 alloys were determined as L → L + γ → L + γ + M7C3 → γ + M7C3 → γ + M7C3 + M23C6→ γ + M23C6 and L → L + δ → L + δ + γ→ L + δ + γ + M23C6 δ + γ + M23C6, respectively. The solidification mode was determined to be the austenitic mode (A mode) in HK40 alloy and the ferritic-austenitic solidification mode (FA mode) in HH40 alloy. In HK40 alloy, eutectic carbides directly precipitate in a liquid and coarsen during cooling. The primary γ dendrites grow at the 60° angle to each other. On the other hand, in HH40 alloy, residual δ forms because of the incomplete transformation from δ to γ. Cr23C6 carbide is produced in solid delta ferrite δ but not directly in liquid HH40 alloy. Because of carbide formation in the solid phase and no rapid growth of the dendrite in a non-preferential direction, HH40 alloy is more resistant to cast defect formation than HK40 alloy.

  13. The precession of the HH 111 flow in the infrared

    CERN Document Server

    Noriega-Crespo, A; Lora, V; Stapelfeldt, K R; Carey, S J


    We present Spitzer IRAC images of the HH 111 outflow, that show a wealth of condensations/knots in both jet and counterjet. Studying the positional distribution of these knots, we find very suggestive evidence of a mirror symmetric pattern in the jet/counterjet flow. We model this pattern as the result of an orbital motion of the jet source around a binary companion. From a fit of an analytic, ballistic model to the observed path of the HH 111 system, we find that the motion in a binary with two approx. 1 Msolar stars (one of them being the HH 111 source), in a circular orbit with a separation of approx. 186 AU would produce the mirror symmetric pattern seen in the outflow.

  14. Structure and Biological Roles of Sinorhizobium fredii HH103 Exopolysaccharide (United States)

    Acosta-Jurado, Sebastián; Soto, María J.; Margaret, Isabel; Crespo-Rivas, Juan C.; Sanjuan, Juan; Temprano, Francisco; Gil-Serrano, Antonio; Ruiz-Sainz, José E.; Vinardell, José M.


    Here we report that the structure of the Sinorhizobium fredii HH103 exopolysaccharide (EPS) is composed of glucose, galactose, glucuronic acid, pyruvic acid, in the ratios 5∶2∶2∶1 and is partially acetylated. A S. fredii HH103 exoA mutant (SVQ530), unable to produce EPS, not only forms nitrogen fixing nodules with soybean but also shows increased competitive capacity for nodule occupancy. Mutant SVQ530 is, however, less competitive to nodulate Vigna unguiculata. Biofilm formation was reduced in mutant SVQ530 but increased in an EPS overproducing mutant. Mutant SVQ530 was impaired in surface motility and showed higher osmosensitivity compared to its wild type strain in media containing 50 mM NaCl or 5% (w/v) sucrose. Neither S. fredii HH103 nor 41 other S. fredii strains were recognized by soybean lectin (SBL). S. fredii HH103 mutants affected in exopolysaccharides (EPS), lipopolysaccharides (LPS), cyclic glucans (CG) or capsular polysaccharides (KPS) were not significantly impaired in their soybean-root attachment capacity, suggesting that these surface polysaccharides might not be relevant in early attachment to soybean roots. These results also indicate that the molecular mechanisms involved in S. fredii attachment to soybean roots might be different to those operating in Bradyrhizobium japonicum. PMID:25521500

  15. FCC-hh Hadron Collider - Parameter Scenarios and Staging Options

    CERN Document Server

    Benedikt, Michael; Schulte, Daniel; Zimmermann, F; Syphers, M J


    FCC-hh is a proposed future energy-frontier hadron collider, based on dipole magnets with a field around 16 T installed in a new tunnel with a circumference of about 100 km, which would provide proton collisions at a centre-of-mass energy of 100 TeV, as well as heavy-ion collisions at the equivalent energy. The FCC-hh should deliver a high integrated proton-proton luminosity at the level of several 100 fb−1 per year, or more. The challenges for operating FCC-hh with high beam current and at high luminosity include the heat load from synchrotron radiation in a cold environment, the radiation from collision debris around the interaction region, and machine protection. In this paper, starting from the FCC-hh design baseline parameters we explore different approaches for increasing the integrated luminosity, and discuss the impact of key individual pa- rameters, such as the turnaround time. We also present some injector considerations and options for early hadron-collider operation.

  16. Optical spectroscopy of HH-exciting stars from scattered light continua (United States)

    Cohen, M.; Dopita, M. A.; Schwartz, R. D.


    Optical spectra of the reflected light continua visible in parts of several Herbig-Haro objects are presented. HH 100 unmistakably scatters the chromospheric spectrum of a strong emission-line T Tau star. HH 48S also reflects a T Tau stellar spectrum, as perhaps do HH 24 and HH 55, but less convincingly. HH 55 reveals photospheric absorption features too, corresponding to an M3.5 T Tau star. The continuum in HH 120 (= CG 30 HH) is unclassifiable while that in HH 46A has dimmed considerably (by a factor of order 20) although, only 7 yr ago, it clearly reflected a strong-line T Tau spectrum. It is concluded that at least some of the stars that excite Herbig-Haro nebulae, even when those stars are not directly visible, pass through a strong-line T Tau phase, and can undergo abrupt and dramatic changes in visual luminosity.

  17. First results for a FCC-hh ring optics design

    CERN Document Server

    Chance, Antoine; Payet, Jacques; Alemany Fernandez, Reyes; Holzer, Bernhard; Schulte, Daniel


    The first order considerations of the optics for the FCC-hh ring are presented. The arc cell is generated taking into account some general considerations like the whole circumference, maximum gradients and lengths of the elements in the cell. The integration of the insertion regions started. Three types of Dispersion Suppressors (DIS) are studied. The sensitivity of the arc parameters to these layout considerations is studied in more detail. An alternative layout is shown as well.

  18. MOS Mapping of the NIR Outflow HH 223 (United States)

    López, R.; Acosta-Pulido, J. A.; Estalella, R.; Gómez, G.; García-Lorenzo, B.


    The Multi-Object-Spectroscopy (MOS) mode of LIRIS was used to map the near-IR stellar outflow HH 223, in the dark cloud Lynds 723 (L723). HH 223 spatially coincides with the east-west component of the L723 quadrupolar CO outflow. The radio continuum source SMA2, towards the center of the quadrupolar CO outflow, hides the YSO that seems to power both the near-IR and the CO outflows. To map the S-shaped, near-IR emission of HH 223, extending ˜ 5', an appropriate mask was designed, with 16 rectangular slitlets. J, H and K-band spectra (R ˜eq 2500) were obtained through the mask. The kinematics of the neutral (H2) and ionized ([FeII]) gas outflow was derived from these data. The results confirm that both the near-IR and the CO outflows have a common driving source. To our knowledge, this is the first use of the MOS-LIRIS observing mode with the mask designed ad hoc to fit several extended, nonaligned targets.

  19. Interpreting the proper motions of the HH 34S bowshock

    Directory of Open Access Journals (Sweden)

    A. C. Raga


    Full Text Available Reipurth et al. (2002 han obtenido movimientos propios muy detallados del choque a proa HH 34S usando imágenes obtenidas con el Hubble Space Telescope (HST. Encontramos que estos movimientos propios pueden ser usados para reconstruir la velocidad de choque y la velocidad más allá de HH 34S en función de posición. De este ejercicio, obtenemos velocidades de choque en el intervalo de 60 a 120 km s1, lo cual concuerda con determinaciones previas basadas en el análisis de cocientes y perfiles de líneas de emisión. También deducimos la presencia de un flujo con velocidades de 200 km s1 más allá de HH 34S, el cual se extiende hasta 10 a cada lado del eje del sistema. Interpretamos este flujo como la estela dejada por eventos de eyección previos, y mostramos que una simulación numérica de una eyección con dependencia temporal logra reproducir las propiedades de este flujo en una forma convincente.


    Energy Technology Data Exchange (ETDEWEB)

    Riaz, B. [Max-Planck-Institut für Extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Whelan, E. T. [Institute für Astronomie und Astrophysik, Eberhard Karls University Tuebingen, Sand 1, D-72076 Tübingen (Germany)


    We have identified a new externally irradiated Herbig–Haro (HH) jet, HH 1158, within ∼2 pc of the massive OB type stars in the σ Orionis cluster. At an L{sub bol} ∼ 0.1 L{sub ⊙}, HH 1158 is the lowest luminosity irradiated HH jet identified to date in any cluster. Results from the analysis of high-resolution optical spectra indicate asymmetries in the brightness, morphology, electron density, velocity, and the mass outflow rates for the blue and redshifted lobes. We constrain the position angle of the HH 1158 jet at 102° ± 5°. The mass outflow rate and the mean accretion rate for HH 1158 using multiple diagnostics are estimated to be (5.2 ± 2.6) × 10{sup −10} M{sub ⊙} yr{sup −1} and (3.0 ± 1.0) × 10{sup −10} M{sub ⊙} yr{sup −1}, respectively. The properties for HH 1158 are notably similar to the externally irradiated HH 444–HH 447 jets previously identified in σ Orionis. In particular, the morphology is such that the weaker jet beam is tilted toward the massive stars, indicating a higher extent of photo-evaporation. The high value for the Hα/[S ii] ratio is also consistent with the ratios measured in other irradiated jets, including HH 444–HH 447. The presence of an extended collimated jet that is bipolar and the evidence of shocked emission knots make HH 1158 the first unique case of irradiated HH jets at the very low-luminosity end, and provides an opportunity to learn the physical properties of very faint HH jet sources.

  1. Synchrotron radiation backgrounds for the FCC-hh experiments

    CERN Document Server

    Collamati, Francesco; Burkhardt, Helmut; Kersevan, Roberto


    In this paper we present a detailed analysis of the Synchrotron Radiation emitted by the 50 TeV protons of the FCC-hh in the last bending and quadrupole magnets upstream of the interaction region. We discuss the characteristics of this radiation in terms of power, flux, photon spectrum and fans with and without crossing angle for comparison. We mainly focus our study on the fraction of photons that may hit the detector, with a full tracking in GEANT4 that simulates the interaction within the central beam pipe.

  2. Beam-beam studies for FCC-hh

    CERN Document Server

    Barranco Garcia, Javier; Buffat, Xavier; Furuseth, Sondre Vik


    The Future Circular Collider hadron-hadron (FCC-hh) design study is currently exploring different IR design possibilities including round and flat optics or different crossing schemes. The present study intends to evaluate each scenario from the beam-beam effects point of view. In particular the single particle long term stability to maximize beam lifetimes and luminosity reach is used to quantify the differences. The impact of strong head on interactions on the beam quality and lifetime is addressed by means of GPU accelerated simulations code featuring a weak-strong 6-dimensional beam-beam interaction.

  3. An Extremely Bright Echo Associated With SN 2002hh

    CERN Document Server

    Welch, D L; Campbell, Amy; Barlow, M J; Sugerman, Ben E K; Meixner, Margaret; Bank, S H R


    We present new, very late-time optical photometry and spectroscopy of the interesting Type II-P supernova, SN 2002hh, in NGC 6946. Gemini/GMOS-N has been used to acquire visible spectra at six epochs between 2004 August and 2006 July, following the evolution of the SN from age 661 to 1358 days. Few optical spectra of Type II supernovae with ages greater than one year exist. In addition, g'r'i' images were acquired at all six epochs. The spectral and photometric evolution of SN 2002hh has been very unusual. Measures of the brightness of this SN, both in the R and I bands as well as in the H-alpha emission flux, show no significant fading over an interval of nearly two years. The most straightforward explanation for this behavior is that the light being measured comes not only from the SN itself but also from an echo off of nearby dust. Echoes have been detected previously around several SNe but these echoes, at their brightest, were ~8 mag below the maximum brightness of the SN. At V~21 mag, the putative echo ...

  4. Models for the Infrared Cavity of HH 46/47 (United States)

    Raga, A. C.; Noriega-Crespo, A.; Gonzalez, R. F.; Velazquez, P. F.


    We have modeled the limb-brightened cavity seen in the new Spitzer Space Telescope IR images of the southwest lobe of HH 46/47 as the bow shock driven by an outflow from a young, low-mass star. We present models in which the outflow is a perfectly collimated, straight jet, models in which the jet precesses, and finally a model in which the outflow takes the form of a latitude-dependent wind. We study cases in which the outflow moves into a constant-density cloud and into a stratified cloud. We find that the best agreement with the observed cavity is obtained for the precessing jet in a stratified cloud. However, the straight jet (traveling in a stratified cloud) also gives cavity shapes close to the observed one. The latitude-dependent wind model that we have computed gives cavity shapes that are substantially wider than the observed cavity. We therefore conclude that the cavity seen in the Spitzer observations of the southwest lobe of the HH 46/47 outflow do not seem to imply the presence of a latitude-dependent wind, as it can be modeled successfully with a perfectly collimated jet model.

  5. HH 1158: The lowest luminosity externally irradiated Herbig-Haro jet

    CERN Document Server

    Riaz, B


    We have identified a new externally irradiated Herbig-Haro (HH) jet, HH 1158, within ~2 pc of the massive OB type stars in the sigma Orionis cluster. At an Lbol ~ 0.1 Lsun, HH 1158 is the lowest luminosity irradiated HH jet identified to date in any cluster. Results from the analysis of high-resolution optical spectra indicate asymmetries in the brightness, morphology, electron density, velocity, and the mass outflow rates for the blue and red-shifted lobes. We constrain the position angle of the HH 1158 jet at 102+/-5 degree. The mass outflow rate and the mean accretion rate for HH 1158 using multiple diagnostics are estimated to be (5.2 +/- 2.6) x 10^(-10) Msun/yr and (3.0 +/- 1.0) x 10^(-10) Msun/yr, respectively. The properties for HH 1158 are notably similar to the externally irradiated HH 444 -- HH 447 jets previously identified in sigma Orionis. In particular, the morphology is such that the weaker jet beam is tilted towards the massive stars, indicating a higher extent of photo-evaporation. The high v...

  6. Spitzer spectral line mapping of the HH211 outflow

    DEFF Research Database (Denmark)

    Dionatos, Odyssefs; Nisini, Brunella; Cabrit, Sylvie;


    Aims: We employ archival Spitzer slit-scan observations of the HH211 outflow in order to investigate its warm gas content, assess the jet mass flux in the form of H2 and probe for the existence of an embedded atomic jet. Methods: Detected molecular and atomic lines are interpreted by means......-structure lines of S, Fe+, and Si+. H2 is detected down to 5" from the source and is characterized by a "cool" T~300K and a "warm" T~1000 K component, with an extinction Av ~ 8 mag. The amount of cool H2 towards the jet agrees with that estimated from CO assuming fully molecular gas. The warm component is well...

  7. $H^{+}H^{-}$ Pair Production at the Large Hadron Collider

    CERN Document Server

    Barrientos-Bendezu, A A


    We study the pair production of charged Higgs bosons at the CERN Large Hadron Collider in the context of the minimal supersymmetric extension of the standard model. We compare the contributions due to qq-bar annihilation at the tree level and gg fusion, which proceeds at one loop. At small or large values of tan(beta), H^+H^- production proceeds dominantly via bb-bar annihilation, due to Feynman diagrams involving neutral CP-even Higgs bosons and top quarks, which come in addition to the usually considered Drell-Yan diagrams. In the case of gg fusion, the squark loop contributions may considerably enhance the well-known quark loop contributions.


    Energy Technology Data Exchange (ETDEWEB)

    Raga, A. C.; Castellanos-Ramírez, A. [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, Ap. 70-543, 04510 D.F., México (Mexico); Reipurth, Bo; Chiang, Hsin-Fang [Institute for Astronomy, University of Hawaii at Manoa, Hilo, HI 96720 (United States); Bally, J., E-mail: [Center for Astrophysics and Space Astronomy, University of Colorado, UCB 389, Boulder, CO 80309 (United States)


    We present new Hubble Space Telescope (HST) narrow band images of the bright Herbig–Haro (HH) objects HH 1 and 2 in the light of the Hα, Hβ, [O i] 6300, [O ii] 3726+28, [O iii] 5007 and [S ii] 6716+30 emission lines. The resulting emission and line ratio maps give an improved picture of the physical structure of these HH objects, showing the presence of spatially limited, high excitation/ionization ridges. We find that HH 1 has a morphology that could be interpreted in terms of a single, asymmetric bow shock, and that many of the clumps of HH 2 fall in two bow-shaped structures of different excitations. We also construct two-line ratio plots showing clear trends, which are much simpler than the highly complex spatial distributions of the emission, and are therefore interesting for testing shock models of HH objects (we only present a comparison with previously published, steady plane-parallel shock models). We have also used the temperature-sensitive [O i]/[S ii] line ratio to evaluate the temperature range and to obtain temperature maps of HH 1 and 2. We find that this line ratio picks out emitting regions with temperatures ≈10{sup 4} K, except along the leading edges of the HH 1 and 2 bow shocks (in which temperatures of ∼3 → 5 × 10{sup 4} K are obtained)

  9. The prevalence of anxiety and depression in patients with or without hyperhidrosis (HH). (United States)

    Bahar, Rayeheh; Zhou, Pingyu; Liu, Yudan; Huang, Yuanshen; Phillips, Arlie; Lee, Tim K; Su, Mingwan; Yang, Sen; Kalia, Sunil; Zhang, Xuejun; Zhou, Youwen


    There are conflicting data about the correlation between hyperhidrosis (HH) and anxiety and depression. We sought to determine the prevalence of anxiety and depression in patients with or without HH. We examined 2017 consecutive dermatology outpatients from Vancouver, British Columbia, Canada, and Shanghai, China, using Patient Health Questionnaire-9 and Generalized Anxiety Disorder-7 scales for anxiety and depression assessments. Multivariable logistic regression analysis was performed to evaluate if the impact of HH on anxiety and depression is dependent on demographic factors and diagnoses of the patients' presenting skin conditions. The prevalence of anxiety and depression was 21.3% and 27.2% in patients with HH, respectively, and 7.5% and 9.7% in patients without HH, respectively (P value anxiety and depression. Multivariable analysis showed that HH-associated increase in anxiety and depression prevalence is independent of demographic factors and presenting skin conditions. The data from the questionnaires relied on the accuracy of patients' self-reports. Both single variant and multivariable analyses showed a significant association between HH and the prevalence of anxiety and depression in a HH severity-dependent manner. Copyright © 2016 American Academy of Dermatology, Inc. Published by Elsevier Inc. All rights reserved.

  10. Synthetic Small Molecule Inhibitors of Hh Signaling As Anti-Cancer Chemotherapeutics (United States)

    Maschinot, C.A.; Pace, J.R.; Hadden, M.K.


    The hedgehog (Hh) pathway is a developmental signaling pathway that is essential to the proper embryonic development of many vertebrate systems. Dysregulation of Hh signaling has been implicated as a causative factor in the development and progression of several forms of human cancer. As such, the development of small molecule inhibitors of Hh signaling as potential anti-cancer chemotherapeutics has been a major area of research interest in both academics and industry over the past ten years. Through these efforts, synthetic small molecules that target multiple components of the Hh pathway have been identified and advanced to preclinical or clinical development. The goal of this review is to provide an update on the current status of several synthetic small molecule Hh pathway inhibitors and explore the potential of several recently disclosed inhibitory scaffolds. PMID:26310919

  11. A Hh-driven gene network controls specification, pattern and size of the Drosophila simple eyes. (United States)

    Aguilar-Hidalgo, Daniel; Domínguez-Cejudo, María A; Amore, Gabriele; Brockmann, Anette; Lemos, María C; Córdoba, Antonio; Casares, Fernando


    During development, extracellular signaling molecules interact with intracellular gene networks to control the specification, pattern and size of organs. One such signaling molecule is Hedgehog (Hh). Hh is known to act as a morphogen, instructing different fates depending on the distance to its source. However, how Hh, when signaling across a cell field, impacts organ-specific transcriptional networks is still poorly understood. Here, we investigate this issue during the development of the Drosophila ocellar complex. The development of this sensory structure, which is composed of three simple eyes (or ocelli) located at the vertices of a triangular patch of cuticle on the dorsal head, depends on Hh signaling and on the definition of three domains: two areas of eya and so expression--the prospective anterior and posterior ocelli--and the intervening interocellar domain. Our results highlight the role of the homeodomain transcription factor engrailed (en) both as a target and as a transcriptional repressor of hh signaling in the prospective interocellar region. Furthermore, we identify a requirement for the Notch pathway in the establishment of en maintenance in a Hh-independent manner. Therefore, hh signals transiently during the specification of the interocellar domain, with en being required here for hh signaling attenuation. Computational analysis further suggests that this network design confers robustness to signaling noise and constrains phenotypic variation. In summary, using genetics and modeling we have expanded the ocellar gene network to explain how the interaction between the Hh gradient and this gene network results in the generation of stable mutually exclusive gene expression domains. In addition, we discuss some general implications our model may have in some Hh-driven gene networks.

  12. A spitzer space telescope study of SN 2002hh: An infrared echo from a type llP supernova

    DEFF Research Database (Denmark)

    Meikle, W. P. S.; Mattila, S.; Gerardy, C. L.;


    Stars: Supernovae: General, supernovae: individual (NGC 6946), Stars: Supernovae: Individual: Alphanumeric: SN 2002hh Udgivelsesdato: May 22......Stars: Supernovae: General, supernovae: individual (NGC 6946), Stars: Supernovae: Individual: Alphanumeric: SN 2002hh Udgivelsesdato: May 22...

  13. Pancreatic stellate cells contribute pancreatic cancer pain via activation of sHH signaling pathway. (United States)

    Han, Liang; Ma, Jiguang; Duan, Wanxing; Zhang, Lun; Yu, Shuo; Xu, Qinhong; Lei, Jianjun; Li, Xuqi; Wang, Zheng; Wu, Zheng; Huang, Jason H; Wu, Erxi; Ma, Qingyong; Ma, Zhenhua


    Abdominal pain is a critical clinical symptom in pancreatic cancer (PC) that affects the quality of life for PC patients. However, the pathogenesis of PC pain is largely unknown. In this study, we show that PC pain is initiated by the sonic hedgehog (sHH) signaling pathway in pancreatic stellate cells (PSCs), which is activated by sHH secreted from PC cells, and then, neurotrophic factors derived from PSCs mediate the pain. The different culture systems were established in vitro, and the expression of sHH pathway molecules, neurotrophic factors, TRPV1, and pain factors were examined. Capsaicin-evoked TRPV1 currents in dorsal root ganglion (DRG) neurons were examined by the patch-clamp technique. Pain-related behavior was observed in an orthotopic tumor model. sHH and PSCs increased the expression and secretion of TRPV1, SP, and CGRP by inducing NGF and BDNF in a co-culture system, also increasing TRPV1 current. But, suppressing sHH pathway or NGF reduced the expression of TRPV1, SP, and CGRP. In vivo, PSCs and PC cells that expressed high levels of sHH could enhance pain behavior. Furthermore, the blockade of NGF or TRPV1 significantly attenuated the pain response to mechanical stimulation compared with the control. Our results demonstrate that sHH signaling pathway is involved in PC pain, and PSCs play an essential role in the process greatly by inducing NGF.

  14. ALMA Observations of the HH 46/47 Molecular Outflow

    CERN Document Server

    Arce, Hector G; Corder, Stuartt; Garay, Guido; Noriega-Crespo, Alberto; Raga, Alejandro C; Cabrit, Sylvie


    The morphology, kinematics and entrainment mechanism of the HH 46/47 molecular outflow were studied using new ALMA Cycle 0 observations. Results show that the blue and red lobes are strikingly different. We argue that these differences are partly due to contrasting ambient densities that result in different wind components having a distinct effect on the entrained gas in each lobe. A 29-point mosaic, covering the two lobes at an angular resolution of about 3", detected outflow emission at much higher velocities than previous observations, resulting in significantly higher estimates of the outflow momentum and kinetic energy than previous studies of this source, using the CO(1-0) line. The morphology and the kinematics of the gas in the blue lobe are consistent with models of outflow entrainment by a wide-angle wind, and a simple model may describe the observed structures in the position-velocity diagram and the integrated intensity map. The red lobe exhibits a more complex structure, and there is evidence tha...

  15. The intriguing giant bow shocks near HH 131

    CERN Document Server

    wang, M; Wang, H; Yang, J; Chen, J; wang, Min; Noumaru, Junichi; Wang, Hongchi; Yang, Ji; Chen, Jiansheng


    Using the High Dispersion Spectrograph at the Subaru Telescope, echelle spectra of two giant arcs, i.e. nebulosities Cw and L associated with HH 131 in Orion are presented. Typical emission lines of Herbig-Haro objects have been detected towards Cw. With the 2.16 m telescope of National Astronomical Observatories, spectra of Nebu. C, L and K are obtained, which also show strong [SII]6717/6731, H$\\alpha$ and [NII]6583 emission lines. Position-velocity distributions of Cw and L are analyzed. The fastest radial velocity of Cw is V_r ~ -18.0 km/s. When the flow at L goes to the south, it slows down. The fastest radial velocity of L has been observed of -45.0 km/s and the slowest value is about -18.3 km/s. The similarity of the velocities and their positional connection indicate that Cw and L are physically associated. The entire flow tends to become less excited and less ionized when going further to the south (i.e., from Nebu. K, L to C). The electron densities of all the observed nebulosities are low (n_e ~ 10^...

  16. Comparative evaluation of H&H and WFNS grading scales with modified H&H (sans systemic disease): A study on 1000 patients with subarachnoid hemorrhage. (United States)

    Aggarwal, Ashish; Dhandapani, Sivashanmugam; Praneeth, Kokkula; Sodhi, Harsimrat Bir Singh; Pal, Sudhir Singh; Gaudihalli, Sachin; Khandelwal, N; Mukherjee, Kanchan K; Tewari, M K; Gupta, Sunil Kumar; Mathuriya, S N


    The comparative studies on grading in subarachnoid hemorrhage (SAH) had several limitations such as the unclear grading of Glasgow Coma Scale 15 with neurological deficits in World Federation of Neurosurgical Societies (WFNS), and the inclusion of systemic disease in Hunt and Hess (H&H) scales. Their differential incremental impacts and optimum cut-off values for unfavourable outcome are unsettled. This is a prospective comparison of prognostic impacts of grading schemes to address these issues. SAH patients were assessed using WFNS, H&H (including systemic disease), modified H&H (sans systemic disease) and followed up with Glasgow Outcome Score (GOS) at 3 months. Their performance characteristics were analysed as incremental ordinal variables and different grading scale dichotomies using rank-order correlation, sensitivity, specificity, positive predictive value, negative predictive value, Youden's J and multivariate analyses. A total of 1016 patients were studied. As univariate incremental variable, H&H sans systemic disease had the best negative rank-order correlation coefficient (-0.453) with respect to lower GOS (p H&H sans systemic disease had the greatest adjusted incremental impact of 0.72 (95% confidence interval (CI) 0.54-0.91) against a lower GOS as compared to 0.6 (95% CI 0.45-0.74) and 0.55 (95% CI 0.42-0.68) for H&H and WFNS grades, respectively. In multivariate categorical analysis, H&H grades 4-5 sans systemic disease had the greatest impact on unfavourable GOS with an adjusted odds ratio of 6.06 (95% CI 3.94-9.32). To conclude, H&H grading sans systemic disease had the greatest impact on unfavourable GOS. Though systemic disease is an important prognostic factor, it should be considered distinctly from grading. Appropriate cut-off values suggesting unfavourable outcome for H&H and WFNS were 4-5 and 3-5, respectively, indicating the importance of neurological deficits in addition to level of consciousness.


    Energy Technology Data Exchange (ETDEWEB)

    Arce, Hector G. [Department of Astronomy, Yale University, P.O. Box 208101, New Haven, CT 06520-8101 (United States); Mardones, Diego; Garay, Guido [Departamento de Astronomia, Universidad de Chile, Casilla 36-D, Santiago (Chile); Corder, Stuartt A. [Joint ALMA Observatory, Av. Alonso de Cordova 3107, Vitacura, Santiago (Chile); Noriega-Crespo, Alberto [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Raga, Alejandro C. [Instituto de Ciencias Nucleares, UNAM, Ap. 70-543, 04510 D.F. (Mexico)


    The morphology, kinematics, and entrainment mechanism of the HH 46/47 molecular outflow were studied using new ALMA Cycle 0 observations. Results show that the blue and red lobes are strikingly different. We argue that these differences are partly due to contrasting ambient densities that result in different wind components having a distinct effect on the entrained gas in each lobe. A 29 point mosaic, covering the two lobes at an angular resolution of about 3'', detected outflow emission at much higher velocities than previous observations, resulting in significantly higher estimates of the outflow momentum and kinetic energy than previous studies of this source, using the CO(1-0) line. The morphology and the kinematics of the gas in the blue lobe are consistent with models of outflow entrainment by a wide-angle wind, and a simple model describes the observed structures in the position-velocity diagram and the velocity-integrated intensity maps. The red lobe exhibits a more complex structure, and there is evidence that this lobe is entrained by a wide-angle wind and a collimated episodic wind. Three major clumps along the outflow axis show velocity distribution consistent with prompt entrainment by different bow shocks formed by periodic mass ejection episodes which take place every few hundred years. Position-velocity cuts perpendicular to the outflow cavity show gradients where the velocity increases toward the outflow axis, inconsistent with outflow rotation. Additionally, we find evidence for the existence of a small outflow driven by a binary companion.


    Energy Technology Data Exchange (ETDEWEB)

    Raga, A. C.; Rodriguez-Gonzalez, A. [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Ap. 70-543, 04510 D.F. (Mexico); Noriega-Crespo, A.; Carey, S. J. [SPITZER Science Center, California Institute of Technology, CA 91125 (United States); Lora, V. [Astronomisches Rechen-Institut Zentrum fuer Astronomie der Universitaet Heidelberg, Moenchhofstr. 12-14, 69120 Heidelberg (Germany); Stapelfeldt, K. R. [Jet propulsion Laboratory, California Institute of Technology, MS 183-900, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)


    We study archival HST [S II] 6716+30 and H{alpha} images of the HH 34 outflow, taken in 1998.71 and in 2007.83. The {approx}9 yr time baseline and the high angular resolution of these observations allow us to carry out a detailed proper-motion study. We determine the proper motions of the substructure of the HH 34S bow shock (from the [S II] and H{alpha} frames) and of the aligned knots within {approx}30'' from the outflow source (only from the [S II] frames). We find that the present-day motions of the knots along the HH 34 jet are approximately ballistic, and that these motions directly imply the formation of a major mass concentration in {approx}900 yr, at a position similar to the one of the present-day HH 34S bow shock. In other words, we find that the knots along the HH 34 jet will merge to form a more massive structure, possibly resembling HH 34S.

  19. Molecular observations of HH34 - Does NH3 accurately trace dense molecular gas near young stars? (United States)

    Davis, C. J.; Dent, W. R. F.


    Single-dish observations in HCO(+) J = 4-3 are presented of the regions around HH34 and around HH34IRS. The former is one of the best examples of the association between Herbig-Haro shocks, optical jets, and young stellar objects. The HCO(+) and CS maps peak toward the outflow source HH34IRS and suggest the presence of a hot dense molecular core. The NH3 is confined to a peak about 4-0 arcsec east of HH34IRS and to a ridge which extends in a north-south direction and peaks about 20 arcsec south of the end of the optical jet. Thus, the NH3 observations do not trace the underlying gas density and temperature in this outflow source. Toward HH34IRS the NH3 column density is less by a factor of about 10 than toward the NH3 peak position is the HH34 region, providing evidence that the NH3 is underabundant towards the central exciting stars. This underabundance may explain the toroidal structures often seen in NH3 observations of other outflow sources.


    Energy Technology Data Exchange (ETDEWEB)

    Masqué, Josep M.; Rodriguez, Luis F.; Carrasco-González, Carlos [Instituto de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México, Morelia 58089, México (Mexico); Araudo, Anabella [University of Oxford, Astrophysics, Keble Road, Oxford OX1 3RH (United Kingdom); Estalella, Robert [Departament d’Astronomia i Meteorologia and Institut de Ciències del Cosmos (IEEC-UB), Universitat de Barcelona, Martí i Franquès 1, E-08028 Barcelona, Catalunya (Spain); Anglada, Guillem; Osorio, Mayra [Instituto de Astrofísica de Andalucía (CSIC), Apartado 3004, E-18080 Granada (Spain); Girart, Josep M. [Institut de Ciències de l’Espai (CSIC-IEEC), Campus UAB, Carrer de Can Magrans, S/N, E-08193 Cerdanyola del Vallès, Catalunya (Spain)


    The radio-knots of the Herbig–Haro (HH) 80/81/80N jet extend from the HH 80 object to the recently discovered Source 34 and has a total projected jet size of 10.3 pc, constituting the largest collimated radio-jet system known so far. It is powered by the bright infrared source IRAS 18162−2048 associated with a massive young stellar object. We report 6 cm JVLA observations that, compared with previous 6 cm VLA observations carried out in 1989, allow us to derive proper motions of the HH 80, HH 81, and HH 80N radio knots located about 2.5 pc away in projection from the powering source. For the first time, we measure proper motions of the optically obscured HH 80N object providing evidence that this knot, along with HH 81 and HH 80 are associated with the same radio-jet. We also confirm the presence of Source 34, located further north of HH 80N, previously proposed to belong to the jet.We derived that the tangential velocity of HH 80N is 260 km s{sup −1} and has a direction in agreement with the expected direction of a ballistic precessing jet. The HH 80 and HH 81 objects have tangential velocities of 350 and 220 km s{sup −1}, respectively, but their directions are somewhat deviated from the expected jet path. The velocities of the HH objects studied in this work are significantly lower than those derived for the radio knots of the jet close to the powering source (600–1400 km s{sup −1}) suggesting that the jet is slowing down due to a strong interaction with the ambient medium. As a result, since HH 80 and HH 81 are located near the edge of the cloud, the inhomogeneous and low density medium may contribute to skew the direction of their determined proper motions. The HH 80 and HH 80N emission at 6 cm is, at least in part, probably synchrotron radiation produced by relativistic electrons in a magnetic field of 1 mG. If these electrons are accelerated in a reverse adiabatic shock, we estimate a jet total density of ≲1000 cm{sup −3}. All of these

  1. Molecular hydrogen and excitation in the HH 1-2 system (United States)

    Noriega-Crespo, A.; Garnavich, P. M.


    We present a series of molecular hydrogen images of the Herbig-Haro 1-2 system in the 1-0 S(1) transition at 2.121 microns, with a spatial resolution of approximately 2 sec. The distribution of H2 is then compared with that of the excitation, given by the (S II) 6717+6731 to H-alpha line ratio. We find that most optical condensations in the HH 1-2 system, including the VLA 1 jet, have H2 counterparts. H2 emission is detected in most low excitation knots, as expected for low velocity shocks (50 km/s less than), but also in high excitation regions, like in HH 1F and HH 2A min. For these latter objects, the H2 emission could be due to the interaction of the preionizing flux, produced by 150-200 km/s shocks, with the surrounding interstellar matter, i.e., fluorescence. The lack fluorescent lines in the ultraviolet (UV), however, suggest a different mechanism. H2 is detected at the tip of the VLA 1 jet, where the knot morphology suggests the presence of a second bow shock. H2 is detected also SE of HH 2E and SW of HH 1F, in regions with known NH3 emission.

  2. The Sinorhizobium fredii HH103 Genome: A Comparative Analysis With S. fredii Strains Differing in Their Symbiotic Behavior With Soybean. (United States)

    Vinardell, José-María; Acosta-Jurado, Sebastián; Zehner, Susanne; Göttfert, Michael; Becker, Anke; Baena, Irene; Blom, Jochem; Crespo-Rivas, Juan Carlos; Goesmann, Alexander; Jaenicke, Sebastian; Krol, Elizaveta; McIntosh, Matthew; Margaret, Isabel; Pérez-Montaño, Francisco; Schneiker-Bekel, Susanne; Serranía, Javier; Szczepanowski, Rafael; Buendía, Ana-María; Lloret, Javier; Bonilla, Ildefonso; Pühler, Alfred; Ruiz-Sainz, José-Enrique; Weidner, Stefan


    Sinorhizobium fredii HH103 is a fast-growing rhizobial strain infecting a broad range of legumes including both American and Asiatic soybeans. In this work, we present the sequencing and annotation of the HH103 genome (7.25 Mb), consisting of one chromosome and six plasmids and representing the structurally most complex sinorhizobial genome sequenced so far. Comparative genomic analyses of S. fredii HH103 with strains USDA257 and NGR234 showed that the core genome of these three strains contains 4,212 genes (61.7% of the HH103 genes). Synteny plot analysis revealed that the much larger chromosome of USDA257 (6.48 Mb) is colinear to the HH103 (4.3 Mb) and NGR324 chromosomes (3.9 Mb). An additional region of the USDA257 chromosome of about 2 Mb displays similarity to plasmid pSfHH103e. Remarkable differences exist between HH103 and NGR234 concerning nod genes, flavonoid effect on surface polysaccharide production, and quorum-sensing systems. Furthermore a number of protein secretion systems have been found. Two genes coding for putative type III-secreted effectors not previously described in S. fredii, nopI and gunA, have been located on the HH103 genome. These differences could be important to understand the different symbiotic behavior of S. fredii strains HH103, USDA257, and NGR234 with soybean.

  3. First Design of a Proton Collimation System for 50 TeV FCC-hh

    CERN Document Server

    Fiascaris, Maria; Mirarchi, Daniele; Redaelli, Stefano


    We present studies aimed at defining a first conceptual solution for a collimation system for the hadron-hadron option for the Future Circular Collider (FCC-hh). The baseline collimation layout is based on the scaling of the present LHC collimation system to the FCC-hh energy. It currently includes a dedicated betatron cleaning insertion as well as collimators in the experimental insertions to protect the inner triplets. An aperture model for the FCC-hh is defined and the geometrical acceptance is calculated at top energy taking into account mechanical and optics imperfections. Based on these studies the collimator settings needed to protect the machine are defined. The performance of the collimation system is then assessed with particle tracking simulation tools assuming a perfect machine.

  4. Cross-talk studies between FCC-hh Experimental Interaction Regions

    CERN Document Server

    Abelleira, Jose; Appleby, Robert Barrie; Rafique, Haroon; Besana, Maria Ilaria


    Debris from 50 TeV proton-proton collisions at the main interaction point in the FCC-hh may contribute to the background in the subsequent detector. This cross-talk is of possible concern for the FCC-hh due to the high luminosity and energy of the collider. DPMJET-III is used as a collision debris generator in order to assess the muon cross-talk contribution. An analytical calculation of muon range in rock is performed. This is followed by a full Monte Carlo simulation using FLUKA, where the accelerator tunnel has been modelled. The muon cross talk between the adjacent interaction points is assessed and its implications for FCC-hh design are discussed.

  5. Analytical parametrization and shape classification of anomalous HH production in EFT approach

    CERN Document Server

    Carvalho Antunes De Oliveira, Alexandra; De Castro Manzano, Pablo; Dorigo, Tommaso; Goertz, Florian; Gouzevitch, Maxime; Tosi, Mia


    In this document we study the effect of anomalous Higgs boson couplings on non-resonant pair production of Higgs bosons (HH) at the LHC. We explore the space of the five parameters $\\kappa_\\lambda$, $\\kappa_t$, $c_2$, $c_{g}$, and $c_{2g}$ in terms of the corresponding kinematics of the final state, and describe a suggested partition of the space into a limited number of regions featuring similar phenomenology in the kinematics of HH final state, along with a corresponding set of representative benchmark points. We also provide an analytical parametrization of the cross-section modifications that the variation of anomalous couplings produces with respect to standard model HH production along with a recipe to translate our results into other parameter-space bases. Finally, we provide a preliminary analysis of variations in the topology of the final state within each region based on recent LHC results.


    Energy Technology Data Exchange (ETDEWEB)

    Raga, A. C.; Castellanos-Ramírez, A. [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, Ap. 70-543, 04510 México, D.F. (Mexico); Reipurth, B.; Chiang, Hsin-Fang [Institute for Astronomy, University of Hawaii at Manoa, Hilo, HI 96720 (United States); Bally, J., E-mail: [Center for Astrophysics and Space Astronomy, University of Colorado, UCB 389, Boulder, CO 80309 (United States)


    We present new Hα and Hβ images of the HH 1/2 system, and we find that the Hα/Hβ ratio has high values in ridges along the leading edges of the HH 1 bow shock and of the brighter condensations of HH 2. These ridges have Hα/Hβ = 4 → 6, which is consistent with collisional excitation from the n = 1 to the n = 3 and 4 levels of hydrogen in a gas of temperatures T = 1.5 → 10 × 10{sup 4} K. This is therefore the first direct evidence that the collisional excitation/ionization region of hydrogen just behind Herbig-Haro shock fronts is detected.

  7. An alternating periodic-chaotic ISI sequence of HH neuron under external sinusoidal stimulus

    Institute of Scientific and Technical Information of China (English)

    Jin Wu-Yin; Xu Jian-Xue; Wu Ying; Hong Ling


    A study of Hodgkin-Huxley (HH) neuron under external sinusoidal excited stimulus is presented in this paper. As is well known, the stimulus frequency is to be considered as a bifurcate parameter, and numerous phenomena, such as synchronization, period, and chaos appear alternatively with the changing of the stimulus frequency. For the stimulus frequency less than 2fB (fB being the base frequency in this paper), the simulation results demonstrate that the single HH neuron could completely convey the sinusoidal signal in anti-phase into interspike interval (ISI) sequences. We also report, perhaps for the first time, another kind of phenomenon, the beat phenomenon, which exists in the phase dynamics of the ISI sequences of the HH neuron stimulated by a sinusoidal current. It is shown furthermore that intermittent transition results in the general route to chaos.

  8. Updates on the optics of the future hadron-hadron collider FCC-hh

    CERN Document Server

    Chance, Antoine; Dalena, Barbara; Holzer, Bernhard; Langner, Andy Sven; Schulte, Daniel


    The FCC-hh (Future Hadron-Hadron Circular Collider) is one of the three options considered for the next generation accelerator in high-energy physics as recommended by the European Strategy Group. The layout of FCC-hh has been optimized to a more compact design following recommendations from civil engineering aspects. The updates on the first order and second order optics of the ring will be shown for collisions at the required centre-of-mass energy of 100 TeV. Special emphasis is put on the dispersion suppressors and general beam cleaning sections as well as first considerations of injection and extraction sections.

  9. Cell penetrable humanized-VH/V(HH that inhibit RNA dependent RNA polymerase (NS5B of HCV.

    Directory of Open Access Journals (Sweden)

    Kanyarat Thueng-in

    Full Text Available NS5B is pivotal RNA dependent RNA polymerase (RdRp of HCV and NS5B function interfering halts the virus infective cycle. This work aimed to produce cell penetrable humanized single domain antibodies (SdAb; VH/V(HH that interfere with the RdRp activity. Recombinant NS5BΔ55 of genotype 3a HCV with de novo RNA synthetic activity was produced and used in phage biopanning for selecting phage clones that displayed NS5BΔ55 bound VH/V(HH from a humanized-camel VH/V(HH display library. VH/V(HH from E. coli transfected with four selected phage clones inhibited RdRp activity when tested by ELISA inhibition using 3'di-cytidylate 25 nucleotide directed in vitro RNA synthesis. Deduced amino acid sequences of two clones showed V(HH hallmark and were designated V(HH6 and V(HH24; other clones were conventional VH, designated VH9 and VH13. All VH/V(HH were linked molecularly to a cell penetrating peptide, penetratin. The cell penetrable VH9, VH13, V(HH6 and V(HH24 added to culture of Huh7 cells transfected with JHF-1 RNA of genotype 2a HCV reduced the amounts of RNA intracellularly and in culture medium implying that they inhibited the virus replication. VH/V(HH mimotopes matched with residues scattered on the polymerase fingers, palm and thumb which were likely juxtaposed to form conformational epitopes. Molecular docking revealed that the antibodies covered the RdRp catalytic groove. The transbodies await further studies for in vivo role in inhibiting HCV replication.

  10. 76 FR 66855 - United States Savings Bonds, Series EE, HH and I (United States)


    ... Fiscal Service 31 CFR Parts 351, 353, 359, and 360 United States Savings Bonds, Series EE, HH and I... be able to obtain paper Series I savings bonds with their tax refunds through Internal Revenue.... 0 7. Revise Sec. 351.46 to read as follows: Sec. 351.46 May I purchase definitive Series EE...

  11. Data of evolutionary structure change: 1JHKH-2V7HH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available equence>AFSLE---TTAYL e>EEE --- EEE> H 2V7HH TFTADTSSNTAYM ...>EEEEE EEEEE> ATOM 5465 CA THR H 69 25.885 18.472 40.39...dbChain> 1JHKH GNSAY---WGQGT > EEE--- E...entryIDChain> YWAYDFDYWGQGT > EE E

  12. HH-MIP: An Enhancement of Mobile IP by Home Agent Handover

    Directory of Open Access Journals (Sweden)

    Jeng-Yueng Chen


    Full Text Available We propose an enhancement of Mobile IP (MIP called MIP with Home Agent Handover (HH-MIP to enjoy most of the advantages of Route Optimization MIP (ROMIP but with only a small increase of signaling overhead. In HH-MIP, the concept of Temporary HA (THA is proposed and the mobile host (MH registers the new CoA with its THA rather than its original HA. Since the THA of an MH is selected to be close to the current location of MH, HH-MIP reduces the handoff latency and shortens the signaling path of registration as well. Moreover, HH-MIP adopts an aggressive approach in selecting THA for an MH, that is, whenever an MH is moving away from its HA or previous THA, the MH triggers the handover of THA. Theoretical analysis demonstrates that the proposed scheme enjoys small handoff latency as well as routing efficiency, and the signaling cost of the proposed scheme is significantly less than that in ROMIP.

  13. Overview of design development of FCC-hh Experimental Interaction Regions

    CERN Document Server

    Seryi, Andrei; Cruz Alaniz, Emilia; Van Riesen-Haupt, Leon; Benedikt, Michael; Besana, Maria Ilaria; Buffat, Xavier; Burkhardt, Helmut; Cerutti, Francesco; Langner, Andy Sven; Martin, Roman; Riegler, Werner; Schulte, Daniel; Tomas Garcia, Rogelio; Appleby, Robert Barrie; Rafique, Haroon; Barranco Garcia, Javier; Pieloni, Tatiana; Boscolo, Manuela; Collamati, Francesco; Nevay, Laurence James; Hofer, Michael


    The experimental interaction region (EIR) is one of the key areas that define the performance of the Future Circular Collider. In this overview we will describe the status and the evolution of the design of EIR of FCC-hh, focusing on design of the optics, energy deposition in EIR elements, beam-beam effects and machine detector interface issues.

  14. Fgf19 regulated by Hh signaling is required for zebrafish forebrain development. (United States)

    Miyake, Ayumi; Nakayama, Yoshiaki; Konishi, Morichika; Itoh, Nobuyuki


    Fibroblast growth factor (Fgf) signaling plays important roles in brain development. Fgf3 and Fgf8 are crucial for the formation of the forebrain and hindbrain. Fgf8 is also required for the midbrain to form. Here, we identified zebrafish Fgf19 and examined its roles in brain development by knocking down Fgf19 function. We found that Fgf19 expressed in the forebrain, midbrain and hindbrain was involved in cell proliferation and cell survival during embryonic brain development. Fgf19 was also essential for development of the ventral telencephalon and diencephalon. Regional specification is linked to cell type specification. Fgf19 was also essential for the specification of gamma-aminobutyric acid (GABA)ergic interneurons and oligodendrocytes generated in the ventral telencephalon and diencephalon. The cross talk between Fgf and Hh signaling is critical for brain development. In the forebrain, Fgf19 expression was down-regulated on inhibition of Hh but not of Fgf3/Fgf8, and overexpression of Fgf19 rescued partially the phenotype on inhibition of Hh. The present findings indicate that Fgf19 signaling is crucial for forebrain development by interacting with Hh and provide new insights into the roles of Fgf signaling in brain development.

  15. The time evolution of HH~2 from four epochs of HST images

    CERN Document Server

    Raga, A C; Velázquez, P F; Esquivel, A; Bally, J


    We have analyzed four epochs of H$\\alpha$ and [S~II] HST images of the HH~1/2 outflow (covering a time interval from 1994 to 2014) to determine proper motions and emission line fluxes of the knots of HH~2. We find that our new proper motions agree surprisingly well with the motions measured by Herbig \\& Jones (1981), although there is partial evidence for a slight deceleration of the motion of the HH~2 knots from 1945 to 2014. We also measure the time-variability of the H$\\alpha$ intensities and the [S~II]/H$\\alpha$ line ratios, and find that knots H and A have the largest intensity variabilities (in $1994\\to 2014$). Knot H (which now dominates the HH~2 emission) has strengthened substantially, while keeping an approximately constant [S~II]/H$\\alpha$ ratio. Knot A has dramatically faded, and at the same time has had a substantial increase in its [S~II]/H$\\alpha$ ratio. Possible interpretations of these results are discussed.

  16. CRISPR/Cas9-mediated Dax1 knockout in the monkey recapitulates human AHC-HH. (United States)

    Kang, Yu; Zheng, Bo; Shen, Bin; Chen, Yongchang; Wang, Lei; Wang, Jianying; Niu, Yuyu; Cui, Yiqiang; Zhou, Jiankui; Wang, Hong; Guo, Xuejiang; Hu, Bian; Zhou, Qi; Sha, Jiahao; Ji, Weizhi; Huang, Xingxu


    Mutations in the DAX1 locus cause X-linked adrenal hypoplasia congenita (AHC) and hypogonadotropic hypogonadism (HH), which manifest with primary adrenal insufficiency and incomplete or absent sexual maturation, respectively. The associated defects in spermatogenesis can range from spermatogenic arrest to Sertoli cell only syndrome. Conclusions from Dax1 knockout mouse models provide only limited insight into AHC/HH disease mechanisms, because mouse models exhibit more extensive abnormalities in testicular development, including disorganized and incompletely formed testis cords with decreased number of peritubular myoid cells and male-to-female sex reversal. We previously reported successful clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated protein 9 (Cas9)-mediated genome targeting in cynomolgus monkeys. Here, we describe a male fetal monkey in which targeted genome editing using CRISPR/Cas9 produced Dax1-null mutations in most somatic tissues and in the gonads. This DAX1-deficient monkey displayed defects in adrenal gland development and abnormal testis architecture with small cords, expanded blood vessels and extensive fibrosis. Sertoli cell formation was not affected. This phenotype strongly resembles findings in human patients with AHC-HH caused by mutations in DAX1. We further detected upregulation of Wnt/β-catenin-VEGF signaling in the fetal Dax1-deficient testis, suggesting abnormal activation of signaling pathways in the absence of DAX1 as one mechanism of AHC-HH. Our study reveals novel insight into the role of DAX1 in HH and provides proof-of-principle for the generation of monkey models of human disease via CRISPR/Cas9-mediated gene targeting.

  17. Crustacean hyperglycemic hormone (cHH as a modulator of aggression in crustacean decapods.

    Directory of Open Access Journals (Sweden)

    Laura Aquiloni

    Full Text Available Biogenic amines, particularly serotonin, are recognised to play an important role in controlling the aggression of invertebrates, whereas the effect of neurohormones is still underexplored. The crustacean Hyperglycemic Hormone (cHH is a multifunctional member of the eyestalk neuropeptide family. We expect that this neuropeptide influences aggression either directly, by controlling its expression, or indirectly, by mobilizing the energetic stores needed for the increased activity of an animal. Our study aims at testing such an influence and the possible reversion of hierarchies in the red swamp crayfish, Procambarus clarkii, as a model organism. Three types of pairs of similarly sized males were formed: (1 'control pairs' (CP, n = 8: both individuals were injected with a phosphate saline solution (PBS; (2 'reinforced pairs' (RP, n = 9: the alpha alone was injected with native cHH, and the beta with PBS; (3 'inverted pairs' (IP, n = 9: the opposite of (2. We found that, independently of the crayfish's prior social experience, cHH injections induced (i the expression of dominance behaviour, (ii higher glycemic levels, and (iii lower time spent motionless. In CP and RP, fight intensity decreased with the establishment of dominance. On the contrary, in IP, betas became increasingly likely to initiate and escalate fights and, consequently, increased their dominance till a temporary reversal of the hierarchy. Our results demonstrate, for the first time, that, similarly to serotonin, cHH enhances individual aggression, up to reverse, although transitorily, the hierarchical rank. New research perspectives are thus opened in our intriguing effort of understanding the role of cHH in the modulation of agonistic behaviour in crustaceans.

  18. Di-Higgs phenomenology in tt¯hh: The forgotten channel

    Directory of Open Access Journals (Sweden)

    Christoph Englert


    Full Text Available Searches for multi-Higgs final states allow to constrain parameters of the SM (or extensions thereof that directly relate to the mechanism of electroweak symmetry breaking. Multi-Higgs production cross sections, however, are small and the phenomenologically accessible final states are challenging to isolate in the busy multi-jet hadron collider environment of the LHC run 2 and HL-LHC. This makes the necessity to extend the list of potentially observable production mechanisms obvious. Most of the phenomenological analyses in the past have focused on gg→hh+jets; in this paper we study pp→tt¯hh at the HL-LHC and find that this channel for h→bb¯ and semi-leptonic and hadronic top decays has the potential to provide an additional handle to constrain the Higgs trilinear coupling in a global fit at the end of the high luminosity phase.

  19. VLA Detection of the Exciting Sources of the HH 288 and HHL59 Outflows

    Directory of Open Access Journals (Sweden)

    Mónica Rodríguez


    Full Text Available Presentamos observaciones hechas con el VLA a 3.6 cm hacia tres campos conteniendo flujos moleculares, incluyendo a la región de HHL59, cuyo flujo molecular en CO se reporta en este artículo. Detectamos candidatos para las fuentes excitadoras de los flujos moleculares en los tres campos observados: L1287, HH 288 y HHL59. La fuente excitadora de L1287 se ha reportado anteriormente, pero aquellas hacia HH 288 y HHL59 se presentan aquí por vez primera. Discutimos los parámetros de estas fuentes, así como su relación con fuentes detectadas a otras longitudes de onda.

  20. Progress towards next generation hadron colliders: FCC-hh, HE-LHC, and SPPC (United States)

    Zimmermann, Frank; EuCARD-2 Extreme Beams Collaboration; Future Circular Collider (FCC) Study Collaboration


    A higher-energy circular proton collider is generally considered to be the only path available in this century for exploring energy scales well beyond the reach of the Large Hadron Collider (LHC) presently in operation at CERN. In response to the 2013 Update of the European Strategy for Particle Physics and aligned with the 2014 US ``P5'' recommendations, the international Future Circular Collider (FCC) study, hosted by CERN, is designing such future frontier hadron collider. This so-called FCC-hh will provide proton-proton collisions at a centre-of-mass energy of 100 TeV, with unprecedented luminosity. The FCC-hh energy goal is reached by combining higher-field, 16 T magnets, based on Nb3Sn superconductor, and a new 100 km tunnel connected to the LHC complex. In addition to the FCC-hh proper, the FCC study is also exploring the possibility of a High-Energy LHC (HE-LHC), with a centre-of-mass energy of 25-27 TeV, as could be achieved in the existing 27 km LHC tunnel using the FCC-hh magnet technology. A separate design effort centred at IHEP Beijing aims at developing and constructing a similar collider in China, with a smaller circumference of about 54 km, called SPPC. Assuming even higher-field 20 T magnets, by relying on high-temperature superconductor, the SPPC could reach a c.m. energy of about 70 TeV. This presentation will report the motivation and the present status of the R&D for future hadron colliders, a comparison of the three designs under consideration, the major challenges, R&D topics, the international technology programs, and the emerging global collaboration. Work supported by the European Commission under Capacities 7th Framework Programme project EuCARD-2, Grant Agreement 312453, and the HORIZON 2020 project EuroCirCol, Grant Agreement 654305.

  1. Exploring the $Z' \\rightarrow t\\overline{t}$ heavy resonance at FCC-hh

    CERN Document Server

    Smith, Rachel Emma Clarke


    My summer student project explored the feasibility of detecting final states with boosted top quarks at 100 TeV with the baseline FCC-hh detector. I focused specifically on the $Z' \\rightarrow t\\overline{t}$ hadronic process. I determined the exclusion cross-section of $Z' \\rightarrow t\\overline{t}$ and the integrated luminosity required to make a discovery at the baseline FCC detector at 95% confidence level.

  2. Main changes to LHC layout for reuse as FCC-hh High Energy Booster

    CERN Document Server

    AUTHOR|(SzGeCERN)396044; Wolfgang Bartmann; Werner Herr; Philippe Lebrun; Attilio Milanese


    Reuse of the LHC is one option being investigated for a High Energy Booster for injection of 3.3 TeV protons (and heavy ions at equivalent rigidity) into the proposed 100 TeV centre of mass FCC-hh collider. In this note the major changes required to the LHC layout are listed, assuming beam transfer to the FCC collider is required from both LHC Points 1 and 8.

  3. Hot methanol from the inner region of the HH 212 protostellar system

    CERN Document Server

    Leurini, S; Cabrit, S; Gueth, F; Giannetti, A; Bacciotti, F; Bachiller, R; Ceccarelli, C; Gusdorf, A; Lefloch, B; Podio, L; Tafalla, M


    The mechanisms leading to the formation of disks around young stellar objects (YSOs) and to the launching of the associated jets are crucial to the understanding of the earliest stages of star and planet formation. HH 212 is a privileged laboratory to study a pristine jet-disk system. Therefore we investigate the innermost region ($<100$ AU) around the HH 212-MM1 protostar through ALMA band\\,7 observations of methanol. The 8 GHz bandwidth spectrum towards the peak of the continuum emission of the HH 212 system reveals at least 19 transitions of methanol. Several of these lines (among which several vibrationally excited lines in the v$_{\\rm t}=1,2$ states) have upper energies above 500 K. They originate from a compact ($<135$ AU in diameter), hot ($\\sim 295$ K) region elongated along the direction of the SiO jet. We performed a fit in the $uv$ plane of various velocity channels of the strongest high-excitation lines. The blue- and red-shifted velocity centroids are shifted roughly symmetrically on either...

  4. A study of the wiggle morphology of HH 211 through numerical simulations

    CERN Document Server

    Moraghan, Anthony; Huang, Po-Sheng; Vaidya, Bhargav


    Recent high-resolution high-sensitivity observations of protostellar jets have shown many to possess deviations to their trajectories. HH 211 is one such example where sub-mm observations with the SMA have revealed a clear reflection-symmetric wiggle. The most likely explanation is that the HH 211 jet source could be moving as part of a protobinary system. Here we test this assumption by simulating HH 211 through 3D hydrodynamic jet propagation simulations using the PLUTO code with a molecular chemistry and cooling module, and initial conditions based on an analytical model derived from SMA observations. Our results show the reflection-symmetric wiggle can be recreated through the assumption of a jet source perturbed by binary motion at its base, and that a regular sinusoidal velocity variation in the jet beam can be close to matching the observed knot pattern. However, a more complex model with either additional heating from the protostar, or a shorter period velocity pulsation may be required to account for...


    Energy Technology Data Exchange (ETDEWEB)

    Wang, Kun; Zhang, Xiaobin; Deng, Licai; Luo, Changqing; Luo, Yangping [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Zhang, Jun, E-mail: [Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)


    We report the discovery of flip-flop activity in a W UMa-type binary. A long-term multi-color photometric surveillance of HH UMa was carried out with three sets of light curves obtained over six weeks. The light curves of the eclipsing binary presented marked asymmetry and rapid interchange between the two light maxima. During the observations from 2014 February to 2014 April, the spot distortion phase jumped between phases 0.25 and 0.75 twice, a typical indication of flip-flop activity. We applied the Wilson–Devinney method to analyze the three light curves. The results indicate that HH UMa is a partially eclipsing contact system of A subtype with an obviously asymmetric light curve. The observed light curves can be modeled by assuming that there are two dark spots on the massive primary component that are almost persistently located around phases 0.25 and 0.75, but can interchange their intensities. We further suggest that a plausible scenario for explaining the properties of those dark spots is strong surface magnetic activity with a sudden reversal of the more active longitude. We therefore conclude that HH UMa is very likely a W UMa-type system displaying flip-flop activity.

  6. The counterjet of HH 30: new light on its binary driving source

    CERN Document Server

    Estalella, Robert; Anglada, Guillem; Gómez, Gabriel; Riera, Angels; Carrasco-González, Carlos


    We present new [SII] images of the HH 30 jet and counterjet observed in 2006, 2007, and 2010 that allowed us to measure with improved accuracy the positions and proper motions of the jet and counterjet knots. Our results show that the motion of the knots is essentially ballistic, with the exception of the farthest knots, which trace the large scale C-shape bending of the jet. The observed bending of the jet can be produced by a relative motion of the HH 30 star with respect to its surrounding environment, caused either by a possible proper motion of the HH 30 star, or by the entrainment of environment gas by the red lobe of the nearby L1551-IRS 5 outflow. Alternatively, the bending can be produced by the stellar wind from a nearby CTTS, identified in the 2MASS catalog. The proper motion velocities of the knots of the counterjet show more variations than those of the jet. In particular, we identify two knots of the counterjet that have the same kinematic age but whose velocities differ by almost a factor of tw...

  7. Analytical parametrization and shape classification of anomalous HH production in the EFT approach

    CERN Document Server

    Carvalho, Alexandra; Manzano, Pablo de Castro; Dorigo, Tommaso; Goertz, Florian; Gouzevich, Maxime; Tosi, Mia


    In this document we study the effect of anomalous Higgs boson couplings on non-resonant pair production of Higgs bosons ($HH$) at the LHC. We explore the space of the five parameters $\\kappa_{\\lambda}$, $\\kappa_{t}$, $c_2$, $c_g$, and $c_{2g}$ in terms of the corresponding kinematics of the final state, and describe a partition of the space into a limited number of regions featuring similar phenomenology in the kinematics of $HH$ final state. We call clusters the sets of points belonging to the same region; to each cluster corresponds a representative point which we call a benchmark. We discuss a possible technique to estimate the sensitivity of an experimental search to the kinematical differences between the phenomenology of the benchmark points and the rest of the parameter space contained in the corresponding cluster. We also provide an analytical parametrization of the cross-section modifications that the variation of anomalous couplings produces with respect to standard model $HH$ production along with ...

  8. Reconstruction of $\\pi^{0}$s in the Electromagnetic Calorimeter (ECAL) of the Future Circular Collider (FCC-hh)

    CERN Document Server



    This project has been dedicated to learn about the design and optimization of detectors for the Future Circular Collider (FCC)-hh in hadron mode, with special focus on the validation of the clustering algorithm used for photon reconstruction.

  9. The electronic structure and bonding of a H-H pair in the vicinity of a BCC Fe bulk vacancy

    Energy Technology Data Exchange (ETDEWEB)

    Juan, A.; Pistonesi, C.; Brizuela, G. [Universidad Nacional del Sur, Bahia Blanca (Argentina). Departamento de Fisica; Garcia, A.J. [Universidad Nacional del Sur, Bahia Blanca (Argentina). Departamento de Ciencias de la Computacion


    The H-Fe interaction near a bcc Fe vacancy is analysed using a semi-empirical theoretical method. Calculations were performed using a Fe{sub 86} cluster with a vacancy. Hydrogen atoms are positioned in their local energy minima configurations. Changes in the electronic structure of Fe atoms near a vacancy were analysed for the system without H, with one H and with two H atoms. Fe atoms surrounding the vacancy weaken their bond when hydrogen is present. This is due to the formation of H-Fe bonds. Hydrogen influences only its nearest-neighbour Fe atoms. The H-H interaction was also analysed. For H-H distance of 0.82 Angstrom an H-H association is formed, while H-Fe interaction and Fe-Fe weakening is markedly reduced, when compared with other H-H interactions. (author)

  10. Detailed optical study of HH 32 and the highly collimated outflow from the T Tauri star AS 353A

    Energy Technology Data Exchange (ETDEWEB)

    Hartigan, P.; Mundt, R.; Stocke, J.


    The T Tauri star AS 353A and its highly collimated bipolar outflow have been studied using medium- and high-resolution spectroscopy and deep emission-line CCD imagery. We report the discovery of a linear emission jet in the redshifted part of the flow, and present spectra of the HH objects (HH 32A--D) that confirm the bipolarity of the flow. Despite widely varying line profiles, all four HH objects have similar extremely broad emission linewidths and maximum radial velocities (approx.400 km/s) as well as nearly constant number density as a function of radial velocity. Three of the four objects (HH 32D is the possible exception) possess prominent double-peaked emission-line profiles, and in HH 32A and HH 32C the high-velocity component is situated closer to the star than the low-velocity component. The line profile of (O III) lambda5007 differs markedly from the profiles of lower-excitation lines for HH 32A. These characteristics are examined in the light of two physical models: HH objects as strongly radiating shocks in outflowing jets or as single bow shocks around dense clumps in the outflow. Both are successful in explaining the majority of characteristics observed, but both models encounter some difficulties. The stellar wind has been studied through examination of the star's emission and absorption lines, and we find that the wind is already accelerated to 300 km/s close to the star, and reaches a terminal velocity in excess of 350 km/s. The blueshifted component of the H..cap alpha.. profile of AS 353A is highly variable, and the profiles of different lines have quite dissimilar characteristics. The P Cygni line profiles are discussed briefly in terms of two wind models. There is evidence that the flow collimation occurs at distances greater than two stellar radii.

  11. Centimeter continuum observations of the northern head of the HH 80/81/80N jet: revising the actual dimensions of a parsec scale jet

    CERN Document Server

    Masqué, Josep M; Estalella, Robert; Rodríguez, Luis F; Beltrán, Maria T


    We present 6 and 20 cm JVLA/VLA observations of the northern head of the HH 80/81/80N jet, one of the largest collimated jet systems known so far, aimed to look for knots further away than HH 80N, the northern head of the jet. Aligned with the jet and 10 arcmin northeast of HH 80N, we found a radio source not reported before, with a negative spectral index similar to that HH 80, HH 81 and HH 80N. The fit of a precessing jet model to the knots of the HH 80/81/80N jet, including the new source, shows that the position of this source is close to the jet path resulting from the modeling. If the new source belongs to the HH 80/81/80N jet, its derived size and dynamical age are 18.4 pc and >9000 yr, respectively. If the jet is symmetric, its southern lobe would expand beyond the cloud edge resulting in an asymmetric appearance of the jet. Based on the updated dynamical age, we speculate on the possibility that the HH 80/81/80N jet triggered the star formation observed in a dense core found ahead of HH 80N, which sh...

  12. Searches for diboson resonances with ATLAS (VV, VH and HH, excl. diphoton resonance)

    CERN Document Server

    Gregersen, Kristian; The ATLAS collaboration


    An overview of ATLAS diboson resonance searches with LHC Run 2 data at 13 TeV are summarized in this talk. Resonant production of two bosons is a clear hint for physics beyond the Standard Model, potentially related to the nature of the electroweak symmetry breaking mechanism in the SM. Searches for diboson resonances have been performed in VV, VH and HH diboson channels with final states with different numbers of leptons and primarily in boosted topologies where the hadronically decaying bosons can be reconstructed as one large-radius jet.

  13. Exploring the triplet parameters space to optimise the final focus of the FCC-hh

    CERN Document Server

    Van Riesen-Haupt, Leon; Seryi, Andrei; Cruz Alaniz, Emilia


    One of the main challenges when designing final focus systems of particle accelerators is maximising the beam stay clear in the strong quadrupole magnets of the inner triplet. Moreover it is desirable to keep the quadrupoles in the triplet as short as possible for space and costs reasons but also to reduce chromaticity and simplify corrections schemes. An algorithm that explores the triplet parameter space to optimise both these aspects was written. It uses thin lenses as a first approximation and MADX for more precise calculations. In cooperation with radiation studies, this algorithm was then applied to design an alternative triplet for the final focus of the Future Circular Collider (FCC-hh).

  14. Searches for diboson resonances with ATLAS (VV, VH, HH, excl. diphoton resonance)

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00236292; The ATLAS collaboration


    This document summarises ATLAS searches for resonances decaying to diboson final states, VV , VH and HH, where V is either a W or a Z boson and H is the Standard Model Higgs boson. The results obtained are based on the full 2015 dataset corresponding to an integrated luminosity of 3.2 fb −1 . No discrepancies with respect to the Standard Model expectations are observed and thus 95% confidence level exclusion limits are set on the production cross section times branching ratios in a number of benchmark scenarios, including Heavy Vector Triplet, Randall-Sundrum Graviton and Extended Higgs sector models.

  15. Radiation Load Optimization in the Final Focus System of FCC-hh

    CERN Document Server

    Martin, Roman; Cerutti, Francesco; Tomás, Rogelio


    With a center-of-mass energy of up to 100 TeV, FCC-hh will produce highly energetic collision debris at the Interaction Point (IP). Protecting the final focus quadrupoles from this radiation is challenging, since the required amount of shielding placed inside the magnets will reduce the free aperture, thereby limiting the β^{*} reach and luminosity. Hence, radiation mitigation strategies that make best use of the available aperture are required. In this paper, we study the possibility to split the first quadrupole Q1 into two quadrupoles with individual apertures, in order to distribute the radiation load more evenly and reduce the peak dose.


    Energy Technology Data Exchange (ETDEWEB)

    López-Santiago, J. [Instituto de Matemática Interdisciplinar, S. D. Astronomía y Geodesia, Facultad de Ciencias Matemáticas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Peri, C. S.; Benaglia, P. [Instituto Argentino de Radioastronomía (IAR), CCT La Plata (CONICET), C.C.5, 1894 Villa Elisa, Buenos Aires (Argentina); Bonito, R. [Dipartimento di Fisica e Chimica, Università di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy); Miceli, M. [INAF-Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy); Albacete-Colombo, J. F. [Universidad Nacional del COMAHUE, Monseñor Esandi y Ayacucho, 8500 Viedma, Río Negro (Argentina); De Castro, E. [Dpto. de Astrofísica y CC. de la Atmósfera, Universidad Complutense de Madrid, E-28040 Madrid (Spain)


    Protostellar jets appear at all stages of star formation when the accretion process is still at work. Jets travel at velocities of hundreds of km s{sup –1}, creating strong shocks when interacting with the interstellar medium. Several cases of jets have been detected in X-rays, typically showing soft emission. For the first time, we report evidence of hard X-ray emission possibly related to non-thermal processes not explained by previous models of the post-shock emission predicted in the jet/ambient interaction scenario. HH 80 is located at the south head of the jet associated with the massive protostar IRAS 18162-2048. It shows soft and hard X-ray emission in regions that are spatially separated, with the soft X-ray emission region situated behind the region of hard X-ray emission. We propose a scenario for HH 80 where soft X-ray emission is associated with thermal processes from the interaction of the jet with denser ambient matter and hard X-ray emission is produced by synchrotron radiation at the front shock.

  17. Water and acetaldehyde in HH212: The first hot corino in Orion

    CERN Document Server

    Codella, C; Cabrit, S; Podio, L; Bachiller, R; Fontani, F; Gusdorf, A; Lefloch, B; Leurini, S; Tafalla, M


    Aims: Using the unprecedented combination of high resolution and sensitivity offered by ALMA, we aim to investigate whether and how hot corinos, circumstellar disks, and ejected gas are related in young solar-mass protostars. Methods: We observed CH$_3$CHO and deuterated water (HDO) high-excitation ($E_{\\rm u}$ up to 335 K) lines towards the Sun-like protostar HH212--MM1. Results: For the first time, we have obtained images of CH$_3$CHO and HDO emission in the inner $\\simeq$ 100 AU of HH212. The multifrequency line analysis allows us to contrain the density ($\\geq$ 10$^{7}$ cm$^{-3}$), temperature ($\\simeq$ 100 K), and CH$_3$CHO abundance ($\\simeq$ 0.2--2 $\\times$ 10$^{-9}$) of the emitting region. The HDO profile is asymmetric at low velocities ($\\leq$ 2 km s$^{-1}$ from $V_{\\rm sys}$). If the HDO line is optically thick, this points to an extremely small ($\\sim$ 20--40 AU) and dense ($\\ge$ 10$^{9}$ cm$^{-3}$) emitting region. Conclusions: We report the first detection of a hot corino in Orion. The HDO asymm...

  18. X-ray emission from protostellar jet HH 154: the first evidence of a diamond shock?

    CERN Document Server

    Bonito, R; Miceli, M; Peres, G; Micela, G; Favata, F


    X-ray emission from about ten protostellar jets has been discovered and it appears as a feature common to the most energetic jets. Although X-ray emission seems to originate from shocks internal to jets, the mechanism forming these shocks remains controversial. One of the best studied X-ray jet is HH 154 that has been observed by Chandra over a time base of about 10 years. We analyze the Chandra observations of HH 154 by investigating the evolution of its X-ray source. We show that the X-ray emission consists of a bright stationary component and a faint elongated component. We interpret the observations by developing a hydrodynamic model describing a protostellar jet originating from a nozzle and compare the X-ray emission synthesized from the model with the X-ray observations. The model takes into account the thermal conduction and radiative losses and shows that the jet/nozzle leads to the formation of a diamond shock at the nozzle exit. The shock is stationary over the period covered by our simulations and...

  19. Theory and observations of a jet in the _ orionis region: HH 444

    Directory of Open Access Journals (Sweden)

    L. López Martin


    Full Text Available El descubrimiento de un sistema de objetos Herbig{Haro eyectados por es- trellas j ovenes de baja masa en la regi on de Orionis (Reipurth et al. 1998 ha motivado a modelar la fotoionizaci on de un chorro neutro por una fuente externa. Presentamos espectros de rendija larga de alta resoluci on espectral de HH 444 y simulaciones num ericas para este objeto Herbig{Haro usando \\yguaz u", un c odigo 3D que incluye la din amica del gas y transferencia radiativa (Raga et al. 1999. Encontramos que es necesario incluir un per l de velocidad en el haz del chorro para explicar el diagrama posici on{velocidad del chorro HH. Tambi en necesitamos suponer un angulo de apertura no nulo en la base del chorro para explicar el de- crecimiento de la intensidad H con el aumento de la distancia a la fuente y una velocidad de eyecci on variable para reproducir los nudos que se observan a lo largo del chorro.

  20. Optimizing laboratory animal stress paradigms: The H-H* experimental design. (United States)

    McCarty, Richard


    Major advances in behavioral neuroscience have been facilitated by the development of consistent and highly reproducible experimental paradigms that have been widely adopted. In contrast, many different experimental approaches have been employed to expose laboratory mice and rats to acute versus chronic intermittent stress. An argument is advanced in this review that more consistent approaches to the design of chronic intermittent stress experiments would provide greater reproducibility of results across laboratories and greater reliability relating to various neural, endocrine, immune, genetic, and behavioral adaptations. As an example, the H-H* experimental design incorporates control, homotypic (H), and heterotypic (H*) groups and allows for comparisons across groups, where each animal is exposed to the same stressor, but that stressor has vastly different biological and behavioral effects depending upon each animal's prior stress history. Implementation of the H-H* experimental paradigm makes possible a delineation of transcriptional changes and neural, endocrine, and immune pathways that are activated in precisely defined stressor contexts. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. GT1_abenz_1: Completing the OH ladder for HH 46 (United States)

    Benz, A.


    First results from PACS observations towards the low-mass protostar HH 46 show surprisingly bright OH lines. The hydroxyl radical OH plays important roles in the water and oxygen chemistry of star-forming regions and their cooling. Furthermore, the hydroxyl-to-water line ratios are interesting tracers for ionizing radiation. We propose a nearly complete observation of the OH ladder in low-mass star formation for the first time. Four OH transitions in the class I object HH 46 were detected by PACS. We propose complementary observations towards the source in PACS line spectroscopy mode at 53, 56, 65, 71, 96, 115 and 135 micron. We gain insight in the origin and formation of OH from the PACS spatial information. The completeness of the OH ladder allows a reliable determination of the OH abundance and thus constrains water chemistry and cooling contribution more precisely. In addition, we propose HIFI observations of the OH transition at 163.4 micron to resolve the three hyperfine components for the first time. This will allow to determine optical depths of OH and test the hypothesis of asymmetries between the two closely spaced triplets, as the second triplet will be observed within the HIFI priority science program. Note: This proposal is submitted under the Swiss part of the HIFI guaranteed time program; HIFI PI: Frank Helmich, HIFI Swiss Lead CoI: Arnold O. Benz

  2. 3-D Kinematics of the near-IR HH 223 outflow in L723

    CERN Document Server

    López, R; Estalella, R; Gómez, G; García-Lorenzo, B


    In this work we derive the full 3-D kinematics of the near-infrared outflow HH 223, located in the dark cloud Lynds 723 (L723), where a well-defined quadrupolar CO outflow is found. HH 223 appears projected onto the two lobes of the east-west CO outflow. The radio continuum source VLA 2, towards the centre of the CO outflow, harbours a multiple system of low-mass young stellar objects. One of the components has been proposed to be the exciting source of the east-west CO outflow. From the analisys of the kinematics, we get further evidence on the relationship between the near-infrared and CO outflows and on the location of their exciting source. The proper motions were derived using multi-epoch, narrow-band H$_2$ (2.122 $\\mu$m line) images. Radial velocities were derived from the 2.122 $\\mu$m line of the spectra. Because of the extended (~5 arcmin), S-shaped morphology of the target, the spectra were obtained with the Multi-Object-Spectroscopy (MOS) observing mode using the instrument LIRIS at the 4.2m William...

  3. 3D kinematics of the near-IR HH 223 outflow in L723 (United States)

    López, R.; Acosta-Pulido, J. A.; Estalella, R.; Gómez, G.; García-Lorenzo, B.


    In this work, we derive the full 3D kinematics of the near-infrared outflow HH 223, located in the dark cloud Lynds 723 (L723), where a well-defined quadrupolar CO outflow is found. HH 223 appears projected on to the two lobes of the east-west CO outflow. The radio continuum source VLA 2, towards the centre of the CO outflow, harbours a multiple system of low-mass young stellar objects. One of the components has been proposed to be the exciting source of the east-west CO outflow. From the analysis of the kinematics, we get further evidence on the relationship between the near-infrared and CO outflows and on the location of their exciting source. The proper motions were derived using multi-epoch, narrow-band H2 (2.122 μm line) images. Radial velocities were derived from the 2.122 μm line of the spectra. Because of the extended (˜5 arcmin), S-shaped morphology of the target, the spectra were obtained with the multi-object-spectroscopy (MOS) observing mode using the instrument Long-Slit Intermediate Resolution Infrared Spectrograph (LIRIS) at the 4.2 m William Herschel Telescope. To our knowledge, this work is the first time that MOS observing mode has been successfully used in the near-infrared range for an extended target.

  4. The time evolution of HH 1 from four epochs of HST images

    CERN Document Server

    Raga, A C; Esquivel, A; Bally, J


    We present an analysis of four epochs of H$\\alpha$ and [S II] $\\lambda\\lambda$ 6716/6731 HST images of HH 1. For determining proper motions we explore a new method based on analysis of spatially degraded images obtained convolving the images with wavelet functions of chosen widths. With this procedure we are able to generate maps of proper motion velocities along and across the outflow axis, as well as (angularly integrated) proper motion velocity distributions. From the four available epochs, we find the time evolution of the velocities, intensities and spatial distribution of the line emission. We find that over the last two decades HH 1 shows a clear acceleration. Also, the H$\\alpha$ and [S II] intensities have first dropped, and then recovered in the more recent (2014) images. Finally, we show a comparison between the two available HST epochs of [O III] $\\lambda$ 5007 (1994 and 2014), in which we see a clear drop in the value of the [O III]/H$\\alpha$ ratio.

  5. 20 years of cosmic muons research performed in IFIN-HH

    Energy Technology Data Exchange (ETDEWEB)

    Mitrica, Bogdan [Horia Hulubei National Institute of Physics and Nuclear Engineering - IFIN HH, Bucharest, P.O.B.MG-6 (Romania)


    During the last two decades a modern direction in particle physics research has been developed in IFIN-HH Bucharest, Romania. The history started with the WILLI detector built in IFIN-HH Bucharest in collaboration with KIT Karlsruhe (formerly Forschungszentrum Karlsruhe). The detector was designed for measurements of the low energy muon charge ratio (< 1GeV) based on a delayed coincidence method, measuring the decay time of the muons stopped in the detector: the positive muons decay freely, but the negative muons are captured in the atom thus creating muonic atoms and decay depending on the nature of the host atom. In a first configuration, the WILLI detector was placed in a fixed position for measuring vertical muons. Further WILLI has been transformed in a rotatable device which allows directional measurements of muon charge ratio and muon flux. The results exhibit a pronounced azimuthal asymmetry (East-West effect) due to the different in fluence of the geomagnetic field on the trajectories of positive and negative muons in air. In parallel, flux measurement, taking into account muon events with nergies > 0.4GeV, show a diurnal modulation of the muon flux. The analysis of the muon events for energies < 0.6GeV reveals an aperiodic variation of the muon flux. A new detection system performing coincidence measurements between the WILLI calorimeter and a small array of 12 scintillators plates has been installed in IFIN-HH starting from the autumn of 2010. The aim of the system is to investigate muon charge ratio from individual EAS by using the mini-array as trigger for the WILLI calorimeter. Such experimental studies could provide detailed information on hadronic interaction models and primary cosmic ray composition at energies around 10{sup 15}eV. Simulation studies and preliminary experimental tests, regarding the performances of the mini-array, have been performed using H and Fe primaries, with energies in a range 10{sup 13}eV - 10{sup 15}eV. The results show

  6. Ubr3, a Novel Modulator of Hh Signaling Affects the Degradation of Costal-2 and Kif7 through Poly-ubiquitination.

    Directory of Open Access Journals (Sweden)

    Tongchao Li


    Full Text Available Hedgehog (Hh signaling regulates multiple aspects of metazoan development and tissue homeostasis, and is constitutively active in numerous cancers. We identified Ubr3, an E3 ubiquitin ligase, as a novel, positive regulator of Hh signaling in Drosophila and vertebrates. Hh signaling regulates the Ubr3-mediated poly-ubiquitination and degradation of Cos2, a central component of Hh signaling. In developing Drosophila eye discs, loss of ubr3 leads to a delayed differentiation of photoreceptors and a reduction in Hh signaling. In zebrafish, loss of Ubr3 causes a decrease in Shh signaling in the developing eyes, somites, and sensory neurons. However, not all tissues that require Hh signaling are affected in zebrafish. Mouse UBR3 poly-ubiquitinates Kif7, the mammalian homologue of Cos2. Finally, loss of UBR3 up-regulates Kif7 protein levels and decreases Hh signaling in cultured cells. In summary, our work identifies Ubr3 as a novel, evolutionarily conserved modulator of Hh signaling that boosts Hh in some tissues.

  7. 177Lu-DOTA-HH1, a Novel Anti-CD37 Radio-Immunoconjugate: A Study of Toxicity in Nude Mice (United States)

    Repetto-Llamazares, Ada H. V.; Larsen, Roy H.; Giusti, Anna Maria; Riccardi, Elena; Bruland, Øyvind S.; Selbo, Pål Kristian; Dahle, Jostein


    Background CD37 is an internalizing B-cell antigen expressed on Non-Hodgkin lymphoma (NHL) and chronic lymphocytic leukemia cells (CLL). The anti-CD37 monoclonal antibody HH1 was conjugated to the bifunctional chelator p-SCN-Bn-DOTA and labelled with the beta-particle emitting radionuclide 177Lu creating the radio-immunoconjugate (RIC) 177Lu-DOTA-HH1 (177Lu-HH1, trade name Betalutin). The present toxicity study was performed prior to initiation of clinical studieswith 177Lu-HH1. Methodology/Principal Findings Nude mice with or without tumor xenografts were treated with 50 to 1000 MBq/kg 177Lu- HH1 and followed for clinical signs of toxicity up to ten months. Acute, life threatening bone marrow toxicity was observed in animals receiving 800 and 1000 MBq/kg 177Lu-HH1. Significant changes in serum concentrations of liver enzymes were evident for treatment with 1000 MBq/kg 177Lu-HH1. Lymphoid depletion, liver necrosis and atrophy, and interstitial cell hyperplasia of the ovaries were also observed for mice in this dose group. Conclusions/Significance 177Lu-DOTA-HH1 was well tolerated at dosages about 10 times above those considered relevant for radioimmunotherapy in patients with B-cell derived malignancies.The toxicity profile was as expected for RICs. Our experimental results have paved the way for clinical evaluation of 177Lu-HH1 in NHL patients. PMID:25068508

  8. 177Lu-DOTA-HH1, a novel anti-CD37 radio-immunoconjugate: a study of toxicity in nude mice.

    Directory of Open Access Journals (Sweden)

    Ada H V Repetto-Llamazares

    Full Text Available CD37 is an internalizing B-cell antigen expressed on Non-Hodgkin lymphoma (NHL and chronic lymphocytic leukemia cells (CLL. The anti-CD37 monoclonal antibody HH1 was conjugated to the bifunctional chelator p-SCN-Bn-DOTA and labelled with the beta-particle emitting radionuclide 177Lu creating the radio-immunoconjugate (RIC 177Lu-DOTA-HH1 (177Lu-HH1, trade name Betalutin. The present toxicity study was performed prior to initiation of clinical studies with 177Lu-HH1.Nude mice with or without tumor xenografts were treated with 50 to 1000 MBq/kg 177Lu- HH1 and followed for clinical signs of toxicity up to ten months. Acute, life threatening bone marrow toxicity was observed in animals receiving 800 and 1000 MBq/kg 177Lu-HH1. Significant changes in serum concentrations of liver enzymes were evident for treatment with 1000 MBq/kg 177Lu-HH1. Lymphoid depletion, liver necrosis and atrophy, and interstitial cell hyperplasia of the ovaries were also observed for mice in this dose group.177Lu-DOTA-HH1 was well tolerated at dosages about 10 times above those considered relevant for radioimmunotherapy in patients with B-cell derived malignancies.The toxicity profile was as expected for RICs. Our experimental results have paved the way for clinical evaluation of 177Lu-HH1 in NHL patients.


    Directory of Open Access Journals (Sweden)

    A. C. Raga


    Full Text Available Calculamos modelos axisimétricos, con una variación sinusoidal (de un modo y un perfil de sección recta inicial de velocidad. Encontramos que para cocientes de velocidad borde a centro decrecientes, uno obtiene superficies de trabajo con choques de proa con alas progresivamente más extendidas. Estas alas producen emisión de [S II] que parcialmente llena las regiones entre los nudos en los mapas de emisión predichos. Luego calculamos modelos de 3 modos (con parámetros apropiados para el chorro HH 34, y comparamos los mapas de emisión predichos con imágenes del archivo del HST de HH 34. Encontramos que un modelo con cociente de velocidades borde a centro moderado produce estructuras de nudos con morfologías y variabilidades temporales muy parecidas a las observadas en HH 34.

  10. The jet/counterjet IR symmetry of HH34 and the size of the jet formation region

    CERN Document Server

    Raga, A C; Lora, V; Stapelfeldt, K R; Carey, S J


    We present a new Spitzer IRAC images of the HH 34 outflow. These are the first images that detect both the knots along the southern jet and the northern counterjet (the counterjet knots were only detected previously in a long slit spectrum). This result removes the problem of the apparent coexistence of a large scale symmetry (at distances of up to approx.1 pc) and a complete lack of symmetry close to the source (at distances of approx. 1.e+17 cm) for this outflow. We present a quantitative evaluation of the newly found symmetry between the HH 34 jet and counterjet, and show that the observed degree of symmetry implies that the jet production region has a characteristic size <2.8 AU. This is the strongest constraint yet derived for the size of the region in which HH jets are produced.


    Energy Technology Data Exchange (ETDEWEB)

    Estalella, Robert; Lopez, Rosario; Riera, Angels [Departament d' Astronomia i Meteorologia, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain); Anglada, Guillem; Carrasco-Gonzalez, Carlos [Instituto de Astrofisica de Andalucia, CSIC, Glorieta de la Astronomia s/n, E-18008 Granada (Spain); Gomez, Gabriel, E-mail:, E-mail:, E-mail:, E-mail:, E-mail:, E-mail:, E-mail: [Instituto de Astrofisica de Canarias, E-38200 La Laguna, Tenerife (Spain)


    We present new [S II] images of the Herbig-Haro (HH) 30 jet and counterjet observed in 2006, 2007, and 2010 that, combined with previous data, allowed us to measure with improved accuracy the positions and proper motions of the jet and counterjet knots. Our results show that the motion of the knots is essentially ballistic, with the exception of the farthest knots, which trace the large-scale 'C'-shape bending of the jet. The observed bending of the jet can be produced by a relative motion of the HH 30 star with respect to its surrounding environment, caused either by a possible proper motion of the HH 30 star, or by the entrainment of environment gas by the red lobe of the nearby L1551-IRS5 outflow. Alternatively, the bending can be produced by the stellar wind from a nearby classical T Tauri star, identified in the Two Micron All Sky Survey catalog as J04314418+181047. The proper motion velocities of the knots of the counterjet show more variations than those of the jet. In particular, we identify two knots of the counterjet that have the same kinematic age but whose velocities differ by almost a factor of two. Thus, it appears from our observations that counterjet knots launched simultaneously can be ejected with very different velocities. We confirm that the observed wiggling of the jet and counterjet arises from the orbital motion of the jet source in a binary system. Precession, if present at all, is of secondary importance in shaping the jet. We derive an orbital period of {tau}{sub o} = 114 {+-} 2 yr and a mass function of m{mu}{sup 3}{sub c} = 0.014 {+-} 0.006 M{sub Sun }. For a mass of the system of m = 0.45 {+-} 0.04 M{sub Sun} (the value inferred from observations of the CO kinematics of the disk), we obtain a mass of m{sub j} = 0.31 {+-} 0.04 M{sub Sun} for the jet source, a mass of m{sub c} = 0.14 {+-} 0.03 M{sub Sun} for the companion, and a binary separation of a = 18.0 {+-} 0.6 AU. This binary separation coincides with the value required

  12. Non linear field correction effects on the dynamic aperture of the FCC-hh

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00361058; Seryi, Andrei; Maclean, Ewen Hamish; Martin, Roman; Tomas Garcia, Rogelio


    The Future Circular Collider (FCC) design study aims to develop the designs of possible circular colliders in the post LHC era. In particular the FCC-hh will aim to produce proton-proton collisions at a center of mass energy of 100 TeV. Given the large beta functions and integrated length of the quadrupoles of the final focus triplet the effect of systematic and random non linear errors in the magnets are expected to have a severe impact on the stability of the beam. Following the experience on the HL-LHC this work explores the implementation of non-linear correctors to minimize the resonance driving terms arising from the errors of the triplet. Dynamic aperture studies are then performed to study the impact of this correction.

  13. Physics at the FCC-hh, a 100 TeV pp collider

    CERN Document Server


    A 100 TeV pp collider is under consideration, by the high-energy physics community, as an important step for the future development of our field, following the completion of the LHC and High-luminosity LHC physics programmes. In particular, CERN is considering 100 TeV pp collisions as the key target of a Future Circular Collider facility, built around a 100 km tunnel and designed to deliver pp, e+e- and ep collisions, in addition to a programme with heavy ion beams and with the injector complex. CERN is coordinating an international study tasked with the completion, by the end of 2018, of a Conceptual Design Report (CDR) for this facility. This document presents the first results of the assessment of the physics potential of the hadronic part of this research programme (FCC-hh).

  14. Proton cross-talk and losses in the dispersion suppressor regions at the FCC-hh

    CERN Document Server

    Rafique, Haroon; Krainer, Alexander; Langner, Andy Sven; Abelleira, Jose


    Protons that collide at the interaction points of the FCC-hh may contribute to the background in the subsequent detector. Due to the high luminosity of the proton beams this may be of concern. Using DPMJET-III to model 50 TeV proton-proton collisions, tracking studies have been performed with PTC and MERLIN in order to gauge the elastic and inelastic proton cross-talk. High arc losses, particularly in the dispersion suppressor regions, have been revealed. These losses originate mainly from particles with a momentum deviation, either from interaction with a primary collimator in the betatron cleaning insertion, or from the proton-proton collisions. This issue can be mitigated by introducing additional collimators in the dispersion suppressor region. The specific design, lattice integration, and the effect of these collimators on cross-talk is assessed.

  15. ATLAS Searches for VH, HH, VV, V+$\\gamma$/$\\gamma\\gamma$ Resonances

    CERN Document Server

    Biesuz, Nicolo Vladi; The ATLAS collaboration


    The discovery of a Higgs boson at the Large Hadron Collider motivates searches for physics beyond the Standard Model in channels involving coupling to the Higgs boson. A search for massive resonances decaying into couples of bosons is described. The considered final states are: $HH$, $VH$, $VV$, $V\\gamma$ and $\\gamma\\gamma$ with $V$ indicating either the $W$ or the $Z$ boson. Final states with different number of leptons or photons and where, in many cases, at least one Higgs decays into a b-quark pair are studied using different jet reconstruction techniques which allow to optimize the signal acceptance for low or Higgs boson transverse momentum. The most recent diboson resonance searches using LHC Run 2 data are described.

  16. Evidence for CP violation in time-integrated $D^0 \\rightarrow h^-h^+$ decay rates

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Estève, L; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R; Koppenburg, P; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalorav Goicochea, J M; Owen, P; Pal, K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, A C; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Torr, N; Tournefier, E; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E; Zvyagin, A


    A search for time-integrated $CP$ violation in $D^0 \\rightarrow h^-h^+$ ($h=K$, $\\pi$) decays is presented using 0.62~fb$^{-1}$ of data collected by LHCb in 2011. The flavor of the charm meson is determined by the charge of the slow pion in the $D^{*+} \\rightarrow D^0 \\pi^+$ and $D^{*-} \\rightarrow \\overline{D}^0 \\pi^-$ decay chains. The difference in $CP$ asymmetry between $D^0 \\rightarrow K^- K^+$ and $D^0 \\rightarrow \\pi^- \\pi^+$, $\\Delta A_{CP} \\equiv A_{CP}(K^-K^+) \\, - \\, A_{CP}(\\pi^-\\pi^+)$, is measured to be $\\left[ -0.82 \\pm 0.21 (\\mathrm{stat.}) \\pm 0.11 (\\mathrm{syst.}) \\right]\\%$. This differs from the hypothesis of $CP$ conservation by $3.5$ standard deviations.


    Directory of Open Access Journals (Sweden)



    Full Text Available This thesis investigates the linear free vibrations of functionally graded Carbon Nano-tube reinforced Composite (FG-CNTRC beams using Slender (Euler-Bernoulli’s beam theory. The material properties of FG-CNTRCs are assumed to be graded in the thickness direction and estimated through the rule of mixture. The Ritz method is employed to derive the governing Eigen value equation which is then solved by a direct iterative method to obtain the linear frequencies of FG-CNTRC beams with H-H Supports. A detailed parametric study is conducted to study the influences of Nanotube volume fraction, vibration amplitude, and slenderness ratio on the linear free vibration characteristics of FG-CNTRC beams.

  18. Dissecting a Molecular Shock: Spatially Resolved H2 Line Ratios Across the HH7 Bow Shock (United States)

    Pike, Rosemary E.; Geballe, Thomas R.; Burton, Michael G.; Chrysostomou, Antonio; Brand, Peter


    We report on a detailed study of the physics of molecular shocks using Gemini NIFS (Near-Infrared Field Spectrometer) K-band spectra of a 3.'2 x 2.'9 region near the tip of the HH7 bow shock. The IFU data have an angular resolution of 0.3", much higher resolution then in any previous study of a molecular shock, and a velocity resolution of 60 km/s. We have detected 20 H2 emission lines with upper state energies as high as 28,000 K, and 6 additional unidentified lines which share the same bow shock morphology as the H2. We use excitation temperatures derived from line pairs measured in 0.15' x 0.15' bins to attempt to constrain the shock type and distinguish between low velocity jump shocks, continuous shocks, and dissociative shocks in which the H2 line emission arises from newly reformed H2.

  19. Outflow Entrainment and Feedback: A Case Study with HH46/47 Molecular Outflow (United States)

    Zhang, Yichen; Arce, H.; Mardones, D.; Cabrit, S.


    Our ALMA multi-cycle multi-band observations of HH46/47 outflow show co-existence of entrainment by both wide-angle wind and jet bow-shock and this outflow is at a moment that the former has just become dominant. The estimated outflow mass and strength suggest that it has already strongly affected the core-to-star efficiency to 1/3 at this early stage. The zoom-in observation also reveals multiple wide outflowing shells with positions and shapes smoothly changing over a wide range of velocity, which may be an evidence of episodic eruption not only in jet but also in the wide-angle wind.

  20. Probing Charged Higgs Boson Couplings at the FCC-hh Collider

    CERN Document Server

    Cakir, I T; Saygin, H; Senol, A; Cakir, O


    Many of the new physics models predicts a light Higgs boson similar to the Higgs boson of the Standard Model (SM) and also extra scalar bosons. Beyond the search channels for a SM Higgs boson, the future collider experiments will explore additional channels that are specific to extended Higgs sectors. We study the charged Higgs boson production within the framework of two Higgs doublet models (THDM) in the proton-proton collisions at the FCC-hh collider. With an integrated luminosity of 500 fb$^{-1}$ at very high energy frontier, we obtain a significant coverage of the parameter space and distinguish the charged Higgs-top-bottom interaction within the THDM or other new physics models with charged Higgs boson mass up to 1 TeV.

  1. Fabry-perot kinematics of hh 202-204 in the orion nebula: are they part of a big bipolar outflow?

    Directory of Open Access Journals (Sweden)

    M. Rosado


    Full Text Available Se presenta un estudio cinem atico de los objetos HH 202, 203 y 204 usando mapas de velocidad Fabry-Perot en H y [N II]. En el caso de HH 202 se encuentran nebulosidades que podr an estar asociadas a este objeto o bien, dada sus altas velocidades (superiores a 100 km s

  2. A Mid-Infrared Spitzer Study of the Herbig Be Star R Mon and the Associated HH 39 Herbig-Haro Object

    CERN Document Server

    Audard, M; Güdel, M; Lanz, T; Paerels, F; Arce, H


    We report on initial results of our Spitzer Cycle 2 program to observe the young massive star R Mon and its associated HH 39 Herbig-Haro object in the mid-infrared. Our program used all instruments on-board Spitzer to obtain deep images with IRAC of the HH 39 complex and of R Mon and its surroundings, a deep image of HH 39 at 24 and 70 $\\mu$m with MIPS, and mid-infrared spectra with the SH, LH, and LL modules of IRS. The aim of this program is to study the physical links in a young massive star between accretion disk, outflows and jets, and sh ocks in the associated HH object. Our preliminary analysis reveals that several knots of HH 39 are clearly detected in most IRAC bands. In IRAC4 (8 $\\mu$m), diffuse emission, probably from PAHs, appears as foreground emission covering the HH 39 emission. The HH 39 knots are detected at 24 microns, despite the fact that dust continuum emission covers the knots and shows the same structure as observed with IRAC4. The IRS spectra of HH 39 show weak evidence of [Ne II] 12.8...

  3. Resolving the shocked gas in HH54 with Herschel: CO line mapping at high spatial and spectral resolution

    CERN Document Server

    Bjerkeli, P; Brinch, C; Olofsson, G; Santangelo, G; Cabrit, S; Benedettini, M; Black, J H; Herczeg, G; Justtanont, K; Kristensen, L E; Larsson, B; Nisini, B; Tafalla, M


    The HH54 shock is a Herbig-Haro object, located in the nearby Chamaeleon II cloud. Observed CO line profiles are due to a complex distribution in density, temperature, velocity, and geometry. Resolving the HH54 shock wave in the far-infrared cooling lines of CO constrain the kinematics, morphology, and physical conditions of the shocked region. We used the PACS and SPIRE instruments on board the Herschel space observatory to map the full FIR spectrum in a region covering the HH54 shock wave. Complementary Herschel-HIFI, APEX, and Spitzer data are used in the analysis as well. The observed features in the line profiles are reproduced using a 3D radiative transfer model of a bow-shock, constructed with the Line Modeling Engine code (LIME). The FIR emission is confined to the HH54 region and a coherent displacement of the location of the emission maximum of CO with increasing J is observed. The peak positions of the high-J CO lines are shifted upstream from the lower J CO lines and coincide with the position of ...

  4. Modelling the Emission And/or Absorption Features in the High Resolution Spectra of the Southern Binary System: HH Car (United States)

    Koseoglu, Dogan; Bakış, Hicran


    High-resolution spectra (R=48000) of the southern close binary system, HH Car, has been analyzed with modern analysis techniques. Precise absolute parameters were derived from the simultaneous solution of the radial velocity, produced in this study and the light curves, published. According to the results of these analyses, the primary component is an O9 type main sequence star while the secondary component is a giant/subgiant star with a spectral type of B0. Hα emissions can be seen explicitly in the spectra of HH Car. These features were modelled using the absolute parameters of the components. Since components of HH Car are massive early-type stars, mass loss through stellar winds can be expected. This study revealed that the components of HH Car have stellar winds and the secondary component loses mass to the primary. Stellar winds and the gas stream between the components were modelled as a hot shell around the system. It is determined that the interaction between the winds and the gas stream leads to formation of a high temperature impact region.

  5. Vibration Characterization and Health Risk Assessment of the Vermont Army National Guard UH-72 Lakota and HH-60M MEDEVAC (United States)


    Williams, HH60-M pilot, and 2LT Nathan Dubie, UH-72 pilot, for their unconditional support and guidance on the mockup activity, flight test...configurations, reviews, and test flights. Thanks to SGT Steve Lamonda, Aviation Life Support Systems Officer, for his help in the mockup and equipment

  6. The HH34 outflow as seen in [FeII]1.64um by LBT-LUCI

    CERN Document Server

    Antoniucci, S; Nisini, B; Giannini, T; Lorenzetti, D; Paris, D; Sani, E


    Dense atomic jets from young stars copiously emit in [FeII] IR lines, which can, therefore, be used to trace the immediate environments of embedded protostars. We want to investigate the morphology of the bright [FeII] 1.64um line in the jet of the source HH34 IRS and compare it with the most commonly used optical tracer [SII]. We analyse a 1.64um narrow-band filter image obtained with the Large Binocular Telescope (LBT) LUCI instrument, which covers the HH34 jet and counterjet. A Point Spread Function (PSF) deconvolution algorithm was applied to enhance spatial resolution and make the IR image directly comparable to a [SII] HST image of the same source. The [FeII] emission is detected from both the jet, the (weak) counter-jet, and from the HH34-S and HH34-N bow shocks. The deconvolved image allows us to resolve jet knots close to about 1\\arcsec from the central source. The morphology of the [FeII] emission is remarkably similar to that of the [SII] emission, and the relative positions of [FeII] and [SII] pea...

  7. Search and Rescue Aircrewman/HH3F Avionics, 2-11. Military Curriculum Materials for Vocational and Technical Education. (United States)

    Ohio State Univ., Columbus. National Center for Research in Vocational Education.

    This self-paced, individualized course, adapted from military curriculum materials for use in vocational and technical education, teaches students the skills needed to become a qualified avionics worker and aircrew rescuer on the HH-3F helicopter. The course materials consist of four pamphlets: two student workbooks and two student syllabuses. The…

  8. Efficient heterologous expression and secretion in Aspergillus oryzae of a llama variable heavy-chain antibody fragment V(HH) against EGFR. (United States)

    Okazaki, Fumiyoshi; Aoki, Jun-ichi; Tabuchi, Soichiro; Tanaka, Tsutomu; Ogino, Chiaki; Kondo, Akihiko


    We have constructed a filamentous fungus Aspergillus oryzae that secretes a llama variable heavy-chain antibody fragment (V(HH)) that binds specifically to epidermal growth factor receptor (EGFR) in a culture medium. A major improvement in yield was achieved by fusing the V(HH) with a Taka-amylase A signal sequence (sTAA) and a segment of 28 amino acids from the N-terminal region of Rhizopus oryzae lipase (N28). The yields of secreted, immunologically active anti-EGFR V(HH) reached 73.8 mg/1 in a Sakaguchi flask. The V(HH) fragments were released from the sTAA or N28 proteins by an indigenous A. oryzae protease during cultivation. The purified recombinant V(HH) fragment was specifically recognized and could bind to the EGFR with a high affinity.

  9. Sequential application of ligand and structure based modeling approaches to index chemicals for their hH4R antagonism.

    Directory of Open Access Journals (Sweden)

    Matteo Pappalardo

    Full Text Available The human histamine H4 receptor (hH4R, a member of the G-protein coupled receptors (GPCR family, is an increasingly attractive drug target. It plays a key role in many cell pathways and many hH4R ligands are studied for the treatment of several inflammatory, allergic and autoimmune disorders, as well as for analgesic activity. Due to the challenging difficulties in the experimental elucidation of hH4R structure, virtual screening campaigns are normally run on homology based models. However, a wealth of information about the chemical properties of GPCR ligands has also accumulated over the last few years and an appropriate combination of these ligand-based knowledge with structure-based molecular modeling studies emerges as a promising strategy for computer-assisted drug design. Here, two chemoinformatics techniques, the Intelligent Learning Engine (ILE and Iterative Stochastic Elimination (ISE approach, were used to index chemicals for their hH4R bioactivity. An application of the prediction model on external test set composed of more than 160 hH4R antagonists picked from the chEMBL database gave enrichment factor of 16.4. A virtual high throughput screening on ZINC database was carried out, picking ∼ 4000 chemicals highly indexed as H4R antagonists' candidates. Next, a series of 3D models of hH4R were generated by molecular modeling and molecular dynamics simulations performed in fully atomistic lipid membranes. The efficacy of the hH4R 3D models in discrimination between actives and non-actives were checked and the 3D model with the best performance was chosen for further docking studies performed on the focused library. The output of these docking studies was a consensus library of 11 highly active scored drug candidates. Our findings suggest that a sequential combination of ligand-based chemoinformatics approaches with structure-based ones has the potential to improve the success rate in discovering new biologically active GPCR drugs and


    Energy Technology Data Exchange (ETDEWEB)

    Masque, Josep M.; Estalella, Robert [Departament d' Astronomia i Meteorologia, Universitat de Barcelona, Marti i Franques 1, E-08028 Barcelona, Catalunya (Spain); Girart, Josep M. [Institut de Ciencies de l' Espai, (CSIC-IEEC), Campus UAB, Facultat de Ciencies, Torre C5-parell 2, E-08193 Bellaterra, Catalunya (Spain); Rodriguez, Luis F. [Centro de Radioastronomia y Astrofisica, Universidad Nacional Autonoma de Mexico, Apartado Postal 3-72, 58090 Morelia, Michoacan (Mexico); Beltran, Maria T. [INAF-Osservatorio Astrofisico di Arcetri, Largo E. Fermi 5, I-50125 Firenze (Italy)


    We present 6 and 20 cm Jansky Very Large Array/Very Large Array observations of the northern head of the HH 80/81/80N jet, one of the largest collimated jet systems known so far, aimed to look for knots farther than HH 80N, the northern head of the jet. Aligned with the jet and 10' northeast of HH 80N, we found a radio source not reported before, with a negative spectral index similar to that of HH 80, HH 81, and HH 80N. The fit of a precessing jet model to the knots of the HH 80/81/80N jet, including the new source, shows that the position of this source is close to the jet path resulting from the modeling. If the new source belongs to the HH 80/81/80N jet, its derived size and dynamical age are 18.4 pc and >9 Multiplication-Sign 10{sup 3} yr, respectively. If the jet is symmetric, its southern lobe would expand beyond the cloud edge resulting in an asymmetric appearance of the jet. Based on the updated dynamical age, we speculate on the possibility that the HH 80/81/80N jet triggered the star formation observed in a dense core found ahead of HH 80N, which shows signposts of interaction with the jet. These results indicate that parsec-scale radio jets can play a role in the stability of dense clumps and the regulation of star formation in the molecular cloud.

  11. The Sinorhizobium fredii HH103 lipopolysaccharide is not only relevant at early soybean nodulation stages but also for symbiosome stability in mature nodules.

    Directory of Open Access Journals (Sweden)

    Isabel Margaret

    Full Text Available In this work we have characterised the Sinorhizobium fredii HH103 greA lpsB lpsCDE genetic region and analysed for the first time the symbiotic performance of Sinorhizobium fredii lps mutants on soybean. The organization of the S. fredii HH103 greA, lpsB, and lpsCDE genes was equal to that of Sinorhizobium meliloti 1021. S. fredii HH103 greA, lpsB, and lpsE mutant derivatives produced altered LPS profiles that were characteristic of the gene mutated. In addition, S. fredii HH103 greA mutants showed a reduction in bacterial mobility and an increase of auto-agglutination in liquid cultures. RT-PCR and qPCR experiments demonstrated that the HH103 greA gene has a positive effect on the transcription of lpsB. Soybean plants inoculated with HH103 greA, lpsB or lpsE mutants formed numerous ineffective pseudonodules and showed severe symptoms of nitrogen starvation. However, HH103 greA and lps mutants were also able to induce the formation of a reduced number of soybean nodules of normal external morphology, allowing the possibility of studying the importance of bacterial LPS in later stages of the S. fredii HH103-soybean symbiosis. The infected cells of these nodules showed signs of early termination of symbiosis and lytical clearance of bacteroids. These cells also had very thick walls and accumulation of phenolic-like compounds, pointing to induced defense reactions. Our results show the importance of bacterial LPS in later stages of the S. fredii HH103-soybean symbiosis and their role in preventing host cell defense reactions. S. fredii HH103 lpsB mutants also showed reduced nodulation with Vigna unguiculata, although the symbiotic impairment was less pronounced than in soybean.

  12. NopC Is a Rhizobium-Specific Type 3 Secretion System Effector Secreted by Sinorhizobium (Ensifer) fredii HH103 (United States)

    Medina, Carlos; Ollero, Francisco Javier; López-Baena, Francisco Javier


    Sinorhizobium (Ensifer) fredii HH103 is a broad host-range nitrogen-fixing bacterium able to nodulate many legumes, including soybean. In several rhizobia, root nodulation is influenced by proteins secreted through the type 3 secretion system (T3SS). This specialized secretion apparatus is a common virulence mechanism of many plant and animal pathogenic bacteria that delivers proteins, called effectors, directly into the eukaryotic host cells where they interfere with signal transduction pathways and promote infection by suppressing host defenses. In rhizobia, secreted proteins, called nodulation outer proteins (Nops), are involved in host-range determination and symbiotic efficiency. S. fredii HH103 secretes at least eight Nops through the T3SS. Interestingly, there are Rhizobium-specific Nops, such as NopC, which do not have homologues in pathogenic bacteria. In this work we studied the S. fredii HH103 nopC gene and confirmed that its expression was regulated in a flavonoid-, NodD1- and TtsI-dependent manner. Besides, in vivo bioluminescent studies indicated that the S. fredii HH103 T3SS was expressed in young soybean nodules and adenylate cyclase assays confirmed that NopC was delivered directly into soybean root cells by means of the T3SS machinery. Finally, nodulation assays showed that NopC exerted a positive effect on symbiosis with Glycine max cv. Williams 82 and Vigna unguiculata. All these results indicate that NopC can be considered a Rhizobium-specific effector secreted by S. fredii HH103. PMID:26569401

  13. The small-scale HH34 IRS jet as seen by X-shooter (United States)

    Nisini, B.; Giannini, T.; Antoniucci, S.; Alcalá, J. M.; Bacciotti, F.; Podio, L.


    Context. Atomic jets are a common phenomenon among young stars, being intimately related to disk accretion. Most studies have been performed on jets from pre-main sequence stars. However, to date very little detailed information has been gathered on jets from young embedded low mass sources (the so-called class I stars), especially in the inner jet region. Aims: We exploit a diagnostic analysis based on multiwave spectroscopic observations to infer kinematics and physical conditions of the inner region of the prototypical class I jet from HH34 IRS. Methods: We use a deep X-shooter spectrum covering the wavelength range 350-2300 nm at resolution between 8000 and 18 000 (i.e., ΔV 17-27 km s-1), which allows us to detect lines in a wide range of excitation conditions (from Eup 8000 to 31 000 cm-1 ) and to study their kinematics. Statistical equilibrium and ionization models are adopted to derive the jet main physical parameters. Results: We separately derive the physical conditions for the extended high velocity jet (HVC, Vr -100 km s-1 ) and for the low velocity and compact gas (LVC, Vr -20-50 km s-1) located on-source. Close to the jet base ( 5 × 105 cm-3). The LVC gas has the same density and AV as the HVC, but it is at least a factor of two colder. Iron abundance in the HVC is consistent with the solar value, while it is a factor of 3 subsolar in the LVC, suggesting an origin of the LVC gas from a dusty disk. From the derived total density we infer that the jet mass flux rate is >5 × 10-7M⊙ yr-1. We find that the relationships between accretion luminosity and permitted line luminosity derived for T Tauri stars cannot be directly extended to class I sources embedded in reflection nebulae since the permitted lines are seen through scattered light. An accretion rate of 7 × 10-6M⊙ yr-1 is instead derived from an empirical relationship connecting Ṁacc with L([O i])(HVC). Conclusions: The class I HH34 IRS jet at small scale shares many kinematical and physical

  14. New cosmic rays experiments in the underground laboratory of IFIN-HH from Slanic Prahova, Romania

    Energy Technology Data Exchange (ETDEWEB)

    Mitrica, Bogdan; Stanca, Denis; Brancus, Iliana; Margineanu, Romul; Blebea-Apostu, Ana-Maria; Gomoiu, Claudia; Saftoiu, Alexandra; Toma, Gabriel; Gherghel-Lascu, Alexandru; Niculescu-Oglinzanu, Mihai [Horia Hulubei National Institute of Physics and Nuclear Engineering - IFIN HH, P.O.B. MG-6, Bucharest (Romania); Rebel, Heinigerd; Haungs, Andreas [Institute of Experimental Nuclear Physics, Karlsruhe Institute of Technology-Campus North, 76021 Karlsruhe (Germany); Sima, Octavian [Department of Physics, University of Bucharest, 077125 Magurele (Romania)


    Since 2006 a modern laboratory has been developed by IFIN-HH in the underground of Slanic Prahova salt ore. This work presents a short review of previous scientific activities performed in the underground laboratory, in parallel with some plans for the future. A mobile detector for cosmic muon flux measurements has been set up at IFIN-HH, Romania. The device is used to measure the muon flux on different locations at the surface and underground and it consists of two detection layers, each one including four large scintillator plates. A new rotatable detector for measurements of the directional variation of the muon flux has been designed and it is presently under preliminary tests. Built from four layers of sensitive material and using for collecting the signals and directing them to the micro PMTs a new technique, through optical fibers instead wave length shifters, it allows an easy discrimination of the moun flux on the arrival directions of muons. Combining the possibility to rotate and the directionality properties, the underground muon detector is acting like a muon tomography device, being able to scan, using cosmic muons, the rock material above the detector. In parallel new detection system based on SiPM will be also installed in the following weeks. It should be composed by four layers, each layer consisting in 4 scintillator plates what we consider in the following as a module of detection. For this purpose, first two scintillator layers, with the optical fibers positioned on perpendicular directions are put in coincidence with other two layers, 1 m distance from the first two, with similar optical fiber arrangement, thus allowing reconstructing muon trajectory. It is intended also to design and construct an experimental device for the investigation of such radio antennas and the behavior of the signal in rock salt at the Slanic salt mine in Romania. Another method to detect high energy neutrinos is based on the detection of secondary particles resulting

  15. A highly-collimated SiO jet in the HH212 protostellar outflow

    CERN Document Server

    Codella, C; Gueth, F; Cesaroni, R; Bacciotti, F; Le Floc'h, B; McCaughrean, M J


    We mapped the HH212 Class 0 outflow in SiO(2--1, 5--4) and continuum using the PdBI in its extended configurations. The unprecedented angular resolution (down to 0.34") allows accurate comparison with a new, deep H2 image obtained at the VLT. The SiO emission is confined to a highly-collimated bipolar jet (width 0.35") along the outflow axis. The jet can be traced down to within 500 AU of the protostar, in a region that is heavily obscured in H2 images. Where both species are detected, SiO shows the same overall kinematics and structure as H2, indicating that both molecules are tracing the same material. We find that the high-velocity SiO gas near the protostar is not tracing a wide-angle wind but is already confined to a flow inside a narrow cone of half-opening angle < 6 deg.

  16. Solving the excitation and chemical abundances in shocks: the case of HH1

    CERN Document Server

    Giannini, T; Nisini, B; Bacciotti, F; Podio, L


    We present deep spectroscopic (3600 - 24700 A) X-shooter observations of the bright Herbig-Haro object HH1, one of the best laboratories to study the chemical and physical modifications caused by protostellar shocks on the natal cloud. We observe atomic fine structure lines, HI, and He, recombination lines and H_2, ro-vibrational lines (more than 500 detections in total). Line emission was analyzed by means of Non Local Thermal Equilibiurm codes to derive the electron temperature and density, and, for the first time, we are able to accurately probe different physical regimes behind a dissociative shock. We find a temperature stratification in the range 4000 - 80000 K, and a significant correlation between temperature and ionization energy. Two density regimes are identified for the ionized gas, a more tenuous, spatially broad component (density about 10^3 cm^-3), and a more compact component (density > 10^5 cm^-3) likely associated with the hottest gas. A further neutral component is also evidenced, having te...

  17. A combined optical/infrared spectral diagnostic analysis of the HH1 jet

    CERN Document Server

    Nisini, B; Giannini, T; Massi, F; Eislöffel, J; Podio, L; Ray, T P; Nisini, Brunella; Bacciotti, Francesca; Giannini, Teresa; Massi, Fabrizio; Eisl\\"offel, Jochen; Podio, Linda; Ray, Thomas P.


    Complete flux-calibrated spectra covering the spectral range from 6000 A to 2.5 um have been obtained along the HH1 jet and analysed in order to explore the potential of a combined optical/near-IR diagnostic applied to jets from young stellar objects. Important physical parameters have been derived along the jet using various diagnostic line ratios. This multi-line analysis shows, in each spatially unresolved knot, the presence of zones at different excitation conditions, as expected from the cooling layers behind a shock front. In particular, a density stratification in the jet is evident from ratios of various lines of different critical density. In particular, [FeII] lines originate in a cooling layer located at larger distances from the shock front than that generating the optical lines, where the compression is higher and the temperature is declining. The derived parameters were used to measure the mass flux along the jet, adopting different procedures, the advantages and limitations of which are discuss...

  18. IR diagnostics of embedded jets: kinematics and physical characteristics of the HH46-47 jet

    CERN Document Server

    Lopez, Rebeca Garcia; Eisloeffel, Jochen; Giannini, Teresa; Bacciotti, Francesca; Podio, Linda


    We present an analysis of the kinematics and physical properties of the Class I driven jet HH46-47 based on IR medium and low resolution spectroscopy obtained with ISAAC on VLT. Our aim is to study the gas physics as a function of the velocity and distance from the source and compare the results with similar studies performed on other Class I and CTTS jets, as well as with existing models for the jet formation and excitation. The ratios and luminosities of several important diagnostic lines have been used to derive physical parameters. [FeII] and H2 Position Velocity Diagrams (PVDs) have been in addition constructed to study the kinematics. Within 1000-2000 AU from the source the atomic gas presents a wide range of radial velocities. Only the gas component at the highest velocity (HVC) survives at large distances. The H2, shows, close to the source, only a single velocity component at almost zero velocity, while it reaches higer velocities further downstream. Electron densities (ne) and mass ejection fluxes (...

  19. Spitzer observations of the HH 1/2 system. The discovery of the counterjet

    CERN Document Server

    Noriega-Crespo,; Raga,; C, A


    We present unpublished Spitzer IRAC observations of the HH 1/2 young stellar outflow processed with a high angular resolution deconvolution algorithm that produces sub-arcsecond (approx. 0.6" - 0.8") images. In the resulting mid-infrared images the optically invisible counterjet is detected for the first time. The counterjet is approximately half as bright as the jet at 4.5 micron (the IRAC band that best traces young stellar outflows) and has a length of approx. 10". The NW optical jet itself can be followed back in the mid-IR to the position of the exciting VLA 1 source. An analysis of the IRAC colors indicates that the jet/counterjet emission is dominated by collisionally excited H2 pure rotational lines arising from a medium with a neutral Hydrogen gas density of 1000-2000 per cubic cm and a temperature of 1500 K. The observed jet/counterjet brightness asymmetry is consistent with an intrinsically symmetric outflow with extinction from a dense, circumstellar structure of 6" size (along the outflow axis), ...


    Energy Technology Data Exchange (ETDEWEB)

    Noriega-Crespo, A. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Ap. 70-543, 04510 D.F. (Mexico)


    We present unpublished Spitzer IRAC observations of the HH 1/2 young stellar outflow processed with a high angular resolution deconvolution algorithm that produces subarcsecond ({approx}0.''6-0.''8) images. In the resulting mid-infrared images, the optically invisible counterjet is detected for the first time. The counterjet is approximately half as bright as the jet at 4.5 {mu}m (the IRAC band that best traces young stellar outflows) and has a length of {approx}10''. The NW optical jet itself can be followed back in the mid-IR to the position of the exciting VLA 1 source. An analysis of the IRAC colors indicates that the jet/counterjet emission is dominated by collisionally excited H{sub 2} pure rotational lines arising from a medium with a neutral hydrogen gas density of {approx}1000-2000 cm{sup -3} and a temperature of {approx} 1500 K. The observed jet/counterjet brightness asymmetry is consistent with an intrinsically symmetric outflow with extinction from a dense, circumstellar structure of {approx}6'' size (along the outflow axis), and with a mean visual extinction, A{sub V} {approx} 11 mag.

  1. Hot methanol from the inner region of the HH 212 protostellar system (United States)

    Leurini, S.; Codella, C.; Cabrit, S.; Gueth, F.; Giannetti, A.; Bacciotti, F.; Bachiller, R.; Ceccarelli, C.; Gusdorf, A.; Lefloch, B.; Podio, L.; Tafalla, M.


    The mechanisms leading to the formation of disks around young stellar objects (YSOs) and to the launching of the associated jets are crucial to the understanding of the earliest stages of star and planet formation. HH 212 is a privileged laboratory to study a pristine jet-disk system. Therefore we investigate the innermost region (uv plane of various velocity channels of the strongest high-excitation lines. The blue- and red-shifted velocity centroids are shifted roughly symmetrically on either side of the jet axis, indicating that the line-of-sight velocity beyond 0.7 km s-1 from systemic is dominated by rotational motions. The velocity increases moving away from the protostar further indicating that the emission of methanol is not associated with a Keplerian disk or rotating-infalling cavity, and it is more likely associated with outflowing gas. We speculate that CH3OH traces a disk wind gas accelerated at the base. The launching region would be at a radius of a few astronomical units from the YSO.

  2. Circular polarimetry reveals helical magnetic fields in the young stellar object HH 135-136

    CERN Document Server

    Chrysostomou, Antonio; Hough, James H


    Magnetic fields are believed to have a vital role in regulating and shaping the flow of material onto and away from protostars during their initial mass accretion phase. It is becoming increasingly accepted that bipolar outflows are generated and collimated as material is driven along magnetic field lines and centrifugally accelerated off a rotating accretion disk. However, the precise role of the magnetic field is poorly understood and evidence for its shape and structure has not been forthcoming. Here we report imaging circular polarimetry in the near-infrared and Monte Carlo modelling showing that the magnetic field along the bipolar outflow of the HH 135-136 young stellar object is helical. The field retains this shape for large distances along the outflow, so the field structure can also provide the necessary magnetic pressure for collimation of the outflow. This result lends further weight to the hypothesis - central to any theory of star formation - that the outflow is an important instrument for the r...

  3. Late-Type Near-Contact Eclipsing Binary [HH97] FS Aur-79

    CERN Document Server

    Austin, S J; Tycner, C; Campbell, T; Honeycutt, R K


    The secondary photometric standard star #79 for the FS Aur field (Henden & Honeycutt 1997) designated as [HH97] FS Aur-79 (GSC 1874 399) is a short period (0.2508 days) eclipsing binary whose light curve is a combination of the $\\beta$ Lyr and BY Dra type variables. High signal-to-noise multi-color photometry were obtained using the USNO 1-m telescope. These light curves show asymmetry at quadrature phases (O'Connell effect), which can be modeled with the presence of star spots. A low resolution spectrum obtained with the 3.5-m WIYN telescope at orbital phase 0.76 is consistent with a spectral type of dK7e and dM3e. A radial velocity curve for the primary star was constructed using twenty-four high resolution spectra from the 9.2 m HET. Spectra show H-alpha and H-beta in emission confirming chromospheric activity and possibly the presence of circumstellar material. Binary star models that simultaneously fit the U, B, V, R and RV curves are those with a primary star of mass 0.59+-0.02 Msun, temperature 410...

  4. The small-scale HH34 IRS jet as seen by X-shooter

    CERN Document Server

    Nisini, B; Antoniucci, S; Alcala', J M; Bacciotti, F; Podio, L


    Very little information has been so far gathered on atomic jets from young embedded low mass sources (class I stars), especially in the inner jet region. We exploit multiwave spectroscopic observations to infer physical conditions of the inner region of HH34 IRS, a prototypical class I jet. We use a deep X-shooter spectrum ( lambda = 350-2300 nm, R between 8000 and 18000) detecting lines with upper energies from 8000 to 31000 cm-1 . Statistical equilibrium and ionization models are adopted to derive the jet main physical parameters. We derive the physical conditions for the extended high velocity jet (HVC, V about -100 km/s) and for the low velocity and compact gas (LVC, V about -20-50 \\kms). At the jet base ( 5x10^5 cm-3). The LVC gas has the same density and A_V as the HVC, but it is a factor of two colder. Iron abundance in the HVC is close to solar, while it is 3 times subsolar in the LVC, suggesting an origin of the LVC gas from a dusty disk. We infer a jet mass flux rate > 5x10^{-7} Mo/yr. We find that ...

  5. Physical Structure and Dust Reprocessing in a sample of HH Jets

    CERN Document Server

    Podio, L; Bacciotti, F; Eislöffel, J; Ray, T P


    We investigate the physical structure and dust reprocessing in the shocks along the beam of a number of classical Herbig-Haro jets in the Orion and Lupus molecular cloud. Spectral diagnostic techniques are applied to obtain the jet physical conditions from the ratios between selected forbidden lines. The presence of dust grains is investigated by estimating the gas-phase abundance of calcium with respect to its Solar value. We find the electron density, ne, varies between 0.05-4 10^3 cm^-3, the ionisation fraction, xe, is 0.01-0.7, the temperature, te, ranges between 0.6-3 10^4 K, and the hydrogen density between 0.01-6 10^4 cm^-3. Interestingly, in the HH 111 jet, ne, xe, and te, peak in the High Velocity Interval (HVI) of the strongest working surfaces, confirming the prediction from shocks models. Calcium turns out to be depleted with respect to its Solar value, but its gas-phase abundance is higher than that estimated in the interstellar medium in Orion. The depletion is high (up to 80%) along the low-exc...

  6. The Structure of the Inner HH 34 Jet from Optical Integral Field Spectroscopy

    CERN Document Server

    Beck, T L; Raga, A C; Reipurth, B; Beck, Tracy L.; Reipurth, Bo


    We present high spatial resolution optical integral field spectroscopy of a collimated Herbig-Haro jet viewed nearly edge-on. Maps of the line emission, velocity centroid, and velocity dispersion were generated for the H$\\alpha$ and [S II] emission features from the inner collimated jet and exciting source region of the HH 34 outflow. The kinematic structure of the jet shows several maxima and minima in both velocity centroid value and velocity dispersion along the jet axis. Perpendicular to the flow direction the velocity decreases outward from the axis to the limb of the jet, but the velocity dispersion increases. Maps of the electron density structure were derived from the line ratio of [S II] 6731/6716 emission. We have found that the jet exhibits a pronounced ``striped'' pattern in electron density; the high $n_e$ regions are at the leading side of each of the emission knots in the collimated jet, and low $n_e$ regions in the down-flow direction. On average, the measured electron density decreases outwar...

  7. Herschel observations of the Herbig-Haro objects HH52-54

    CERN Document Server

    Bjerkeli, P; Nisini, B; Tafalla, M; Benedettini, M; Bergman, P; Dionatos, O; Giannini, T; Herczeg, G; Justtanont, K; Larsson, B; McCoey, C; Olberg, M; Olofsson, A O H


    We are aiming at the observational estimation of the relative contribution to the cooling by CO and H2O, as this provides decisive information for the understanding of the oxygen chemistry behind interstellar shock waves. Methods. The high sensitivity of HIFI, in combination with its high spectral resolution capability, allows us to trace the H2O outflow wings at unprecedented signal-to-noise. From the observation of spectrally resolved H2O and CO lines in the HH52-54 system, both from space and from ground, we arrive at the spatial and velocity distribution of the molecular outflow gas. Solving the statistical equilibrium and non-LTE radiative transfer equations provides us with estimates of the physical parameters of this gas, including the cooling rate ratios of the species. The radiative transfer is based on an ALI code, where we use the fact that variable shock strengths, distributed along the front, are naturally implied by a curved surface. Based on observations of CO and H2O spectral lines, we conclud...

  8. Spitzer spectral line mapping of the HH211 outflow

    DEFF Research Database (Denmark)

    Dionatos, Odyssefs; Nisini, Brunella; Cabrit, Sylvie


    of emission line diagnostics and an existing grid of molecular shock models. The physical properties of the warm gas are compared against other molecular jet tracers and to the results of a similar study towards the L1448-C outflow. Results: We have detected and mapped the v=0-0 S(0) - S(7) H2 lines and fine...... fitted by C-type shocks with a low beam filling factor ~ 0.01-0.04 and a mass-flux similar to the cool H2. The fine-structure line emission arises from dense gas with ionization fraction ~0.5 - 5 x 10e-3, suggestive of dissociative shocks. Line ratios to sulfur indicate that iron and silicon are depleted...... compared to solar abundances by a factor ~10-50. Conclusions: Spitzer spectral mapping observations reveal for the first time a cool H$_2$ component towards the CO jet of HH211 consistent with the CO material being fully molecular and warm at ~ 300 K. The maps also reveal for the first time the existence...

  9. Kinematics of SiO J=8-7 Emission towards the HH 212 Jet

    CERN Document Server

    Takami, M; Momose, M; Hayashi, M; Davis, C; Pyo, T S; Nishikawa, T; Kohno, K; Takami, Michihiro; Takamuwa, Shigehisa; Momose, Munetake; Hayashi, Masa; Davis, Christopher; Pyo, Tae-Soo; Nishikawa, Takayuki; Kohno, Kotaro


    We present SiO J=8-7 (347.3 GHz) observations towards HH 212 using the ASTE telescope. Our observations with a 22''-diameter beam show that the SiO emission is highly concentrated within 1' of the driving source. We carefully compare the SiO observations with archival H_2 1-0 S(1) images and published H_2 echelle spectra. We find that, although the SiO velocities closely match the radial velocities seen in H_2, the distribution of H_2 and SiO emission differ markedly. We attribute the latter to the different excitation conditions required for H_2 and SiO emission, particularly the higher critical density (n_H2 ~10^8 cm^-3) of the SiO J=8-7 emission. The kinematic similarities imply that the H_2 and SiO are associated with the same internal working surfaces. We conclude that the SiO J=8-7 emission has a potential to probe the jet/wind launching region through interferometric observations in the future, particularly for the youngest, most deeply embedded protostars where IR observations are not possible.

  10. A new ion beam facility based on a 3 MV Tandetron™ at IFIN-HH, Romania

    Energy Technology Data Exchange (ETDEWEB)

    Burducea, I.; Straticiuc, M. [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania); Ghiță, D.G., E-mail: [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania); Moșu, D.V.; Călinescu, C.I. [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania); Podaru, N.C.; Mous, D.J.W. [High Voltage Engineering Europa B.V., P.O. Box 99, 3800AB Amersfoort (Netherlands); Ursu, I.; Zamfir, N.V. [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania)


    A 3 MV Tandetron™ accelerator system has been installed and commissioned at the “Horia Hulubei” National Institute for Physics and Nuclear Engineering – IFIN-HH, Măgurele, Romania. The main purpose of this machine is to strengthen applied nuclear physics research ongoing in our institute for more than four decades. The accelerator system was developed by High Voltage Engineering Europa B.V. (HVE) and comprises three high energy beam lines. The first beam line is dedicated to ion beam analysis (IBA) techniques: Rutherford Backscattering Spectrometry – RBS, Nuclear Reaction Analysis – NRA, Particle Induced X-ray and γ-ray Emission – PIXE and PIGE and micro-beam experiments – μ-PIXE. The second beam line is dedicated to high energy ion implantation experiments and the third beam line was designed mainly for nuclear cross-sections measurements used in nuclear astrophysics. A unique feature, the first time in operation at an accelerator facility is the Na charge exchange canal (CEC), which is used to obtain high intensity beams of He{sup −} of at least 3 μA. The results of the acceptance tests demonstrate the huge potential of this new facility in various fields, from IBA to radiation hardness studies and from medical or environmental applications to astrophysics. The main features of the accelerator are presented in this paper.

  11. A new ion beam facility based on a 3 MV Tandetron™ at IFIN-HH, Romania (United States)

    Burducea, I.; Straticiuc, M.; Ghiță, D. G.; Moșu, D. V.; Călinescu, C. I.; Podaru, N. C.; Mous, D. J. W.; Ursu, I.; Zamfir, N. V.


    A 3 MV Tandetron™ accelerator system has been installed and commissioned at the "Horia Hulubei" National Institute for Physics and Nuclear Engineering - IFIN-HH, Măgurele, Romania. The main purpose of this machine is to strengthen applied nuclear physics research ongoing in our institute for more than four decades. The accelerator system was developed by High Voltage Engineering Europa B.V. (HVE) and comprises three high energy beam lines. The first beam line is dedicated to ion beam analysis (IBA) techniques: Rutherford Backscattering Spectrometry - RBS, Nuclear Reaction Analysis - NRA, Particle Induced X-ray and γ-ray Emission - PIXE and PIGE and micro-beam experiments - μ-PIXE. The second beam line is dedicated to high energy ion implantation experiments and the third beam line was designed mainly for nuclear cross-sections measurements used in nuclear astrophysics. A unique feature, the first time in operation at an accelerator facility is the Na charge exchange canal (CEC), which is used to obtain high intensity beams of He- of at least 3 μA. The results of the acceptance tests demonstrate the huge potential of this new facility in various fields, from IBA to radiation hardness studies and from medical or environmental applications to astrophysics. The main features of the accelerator are presented in this paper.


    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez-Gonzalez, A.; Esquivel, A.; Raga, A. C. [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Ap. 70-543, 04510 DF (Mexico); Canto, J.; Curiel, S. [Instituto de Astronomia, Universidad Nacional Autonoma de Mexico, Ap. 70-264, 04510 DF (Mexico); Riera, A. [Departamento de Fisica e Ingenieria Nuclear, Escuela Universitaria de Ingenieria Tecnica Industrial de Barcelona, Universidad Politecnica de Cataluna, C. Comte Urgell 187, 08036, Barcelona (Spain); Beck, T. L., E-mail: [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)


    We present an analysis of H{alpha} spectra of the HH 34 jet with two-dimensional spectral resolution. We carry out multi-Gaussian fits to the spatially resolved line profiles and derive maps of the intensity, radial velocity, and velocity width of each of the components. We find that close to the outflow source we have three components: a high (negative) radial velocity component with a well-collimated, jet-like morphology; an intermediate velocity component with a broader morphology; and a positive radial velocity component with a non-collimated morphology and large linewidth. We suggest that this positive velocity component is associated with jet emission scattered in stationary dust present in the circumstellar environment. Farther away from the outflow source, we find only two components (a high, negative radial velocity component, which has a narrower spatial distribution than an intermediate velocity component). The fitting procedure was carried out with the new AGA-V1 code, which is available online and is described in detail in this paper.

  13. A new AMS facility based on a Cockcroft–Walton type 1 MV tandetron at IFIN-HH Magurele, Romania

    Energy Technology Data Exchange (ETDEWEB)

    Stan-Sion, C., E-mail: [Horia Hulubei National Institute of Physics and Nuclear Engineering (IFIN-HH), Bucharest (Romania); Enachescu, M.; Ghita, D.G.; Calinescu, C.I.; Petre, A.; Mosu, D.V. [Horia Hulubei National Institute of Physics and Nuclear Engineering (IFIN-HH), Bucharest (Romania); Klein, M. [High Voltage Engineering Europa B.V., Amsterdamsweg 63, 3812 RR Amersfoort P.O. Box 99, 3800 AB Amersfoort (Netherlands)


    A 1 MV AMS machine was recently installed in the National Institute for Physics and Nuclear Engineering IFIN-HH, Bucharest Romania. It is the second AMS facility at IFIN-HH having the goal not only to continue but mainly to enlarge the research area of this highly sensitive analyzing method. The multi-element AMS was developed by HVEE to measure {sup 14}C, {sup 10}Be, and {sup 26}Al, and {sup 129}I. The results of an acceptance test are presented and demonstrate that this machine is capable of routine {sup 14}C age dating and of measurements of other radioisotopes in terms of accuracy and precision as well as a low background level.

  14. Simulating Proton Synchrotron Radiation in the Arcs of the LHC, HL-LHC, and FCC-hh

    CERN Document Server

    Guillermo Cantón, Gerardo; Zimmermann, Frank


    At high proton-beam energies, beam-induced synchrotron radiation is an important source of heating, of beam-related vacuum pressure increase, and of primary photoelectrons, which can give rise to an electron cloud. We use the Synrad3D code developed at Cornell to simulate the photon distributions in the arcs of the LHC, HL-LHC, and FCC-hh. Specifically, for the LHC we study the effect of the “sawtooth” chamber, for the HL-LHC the consequences of the ATS optics with large beta beating in the arcs, and for the FCC-hh the effect of a novel beam-screen design, with a long slit surrounded by a “folded” antechamber.

  15. CAL3JHH: a Java program to calculate the vicinal coupling constants (3 J H,H) of organic molecules (United States)

    Aguirre-Valderrama, Alonso; Dobado, José A.


    Here, we present a free web-accessible application, developed in the JAVA programming language for the calculation of vicinal coupling constant (3 J H,H) of organic molecules with the H-Csp3-Csp3-H fragment. This JAVA applet is oriented to assist chemists in structural and conformational analyses, allowing the user to calculate the averaged 3 J H,H values among conformers, according to its Boltzmann populations. Thus, the CAL3JHH program uses the Haasnoot-Leeuw-Altona equation, and, by reading the molecule geometry from a protein data bank (PDB) file format or from multiple pdb files, automatically detects all the coupled hydrogens, evaluating the data needed for this equation. Moreover, a "Graphical viewer" menu allows the display of the results on the 3D molecule structure, as well as the plotting of the Newman projection for the couplings.


    Energy Technology Data Exchange (ETDEWEB)

    Masqué, Josep M.; Estalella, Robert [Departament d' Astronomia i Meteorologia, Universitat de Barcelona, Martí i Franquès 1, E-08028 Barcelona, Catalunya (Spain); Girart, Josep M. [Institut de Ciències de l' Espai (CSIC-IEEC), Campus UAB, Facultat de Ciències, Torre C5 - parell 2, E-08193 Bellaterra, Catalunya (Spain); Anglada, Guillem; Osorio, Mayra [Instituto de Astrofísica de Andalucía, CSIC, Camino Bajo de Huétor 50, E-18008 Granada (Spain); Beltrán, Maria T. [INAF-Osservatorio Astrofisico di Arcetri, Largo E. Fermi 5, I-50125 Firenze (Italy)


    We present Very Large Array NH{sub 3} and Plateau de Bure Interferometer NH{sub 2}D and HN{sup 13}C observations of the star-forming core ahead of HH 80N, the optically obscured northern counterpart of the Herbig-Haro objects HH 80/81. The main goal is to determine the kinematical information of the high density regions of the core (n ∼> 10{sup 5} cm{sup –3}) missed in previous works due to the depletion of the species observed (e.g., CS). The obtained maps show different kinematical signatures between the eastern and western parts of the core, suggesting a possible dynamical interaction of the core with the HH 80/81/80N outflow. The analysis of the position-velocity (P-V) plots of these species rules out a previous interpretation of having a molecular ring-like structure with a radius of 6 × 10{sup 4} AU traced by CS infalling onto a central protostar found in the core (IRS1). A high degree of NH{sub 3} deuteration, with respect to the central part of the core harboring IRS1, is derived in the eastern part, where a dust condensation (SE) is located. This deuteration trend of NH{sub 3} suggests that SE is in a pre-stellar evolutionary stage, earlier than that of IRS1. Since SE is the closest condensation to the HH 80N/81/80N outflow, in a case of outflow-core dynamical interaction, it should be perturbed first and be the most evolved condensation in the core. Therefore, the derived evolutionary sequence for SE and IRS1 makes outflow triggered star formation on IRS1 unlikely.

  17. Current challenges and future prospects for $\\gamma$ from $B\\to D hh^\\prime$ decays arXiv

    CERN Document Server

    Gershon, Tim

    Decays of the type $B\\to D hh^\\prime$, where a $b$~hadron decays to a neutral charm meson that can be an admixture of $D^0$ and $\\overline{D}{}^0$ states together with two light particles that are typically a kaon and a pion, have demonstrated potential to enable precise determinations of the angle $\\gamma$ of the CKM Unitarity Triangle. The current status and future prospects of these measurements are reviewed.


    Energy Technology Data Exchange (ETDEWEB)

    López-Santiago, J.; Ustamujic, S.; Castro, A. I. Gómez de [S. D. Astronomía y Geodesia, Facultad de Ciencias Matemáticas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Bonito, R.; Orlando, S. [Dipartimento di Fisica e Chimica, Università di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy); Orellana, M. [Sede Andina de la Universidad Nacional de Río Negro (Argentina); Miceli, M. [INAF-Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy); Albacete-Colombo, J. F. [Sede Atlántica de la Universidad Nacional de Río Negro, Don Bosco y Leloir s/n, 8500 Viedma RN (Argentina); Castro, E. de [Dpto. de Astrofísica y CC. de la Atmósfera, Facultad de Física, Universidad Complutense de Madrid, E-28040 Madrid (Spain)


    We investigate the plausibility of detecting X-ray emission from a stellar jet that impacts a dense molecular cloud, a scenario that may be typical for classical T Tauri stars with jets in dense star-forming complexes. We first model the impact of a jet against a dense cloud using two-dimensional axisymmetric hydrodynamic simulations, exploring different configurations of the ambient environment. Then, we compare our results with XMM-Newton observations of the Herbig–Haro object HH 248, where extended X-ray emission aligned with the optical knots is detected at the edge of the nearby IC 434 cloud. Our simulations show that a jet can produce plasma with temperatures up to 10{sup 7} K, consistent with production of X-ray emission, after impacting a dense cloud. We find that jets denser than the ambient medium but less dense than the cloud produce detectable X-ray emission only at impact with the cloud. From an exploration of the model parameter space, we constrain the physical conditions (jet density and velocity and cloud density) that reproduce the intrinsic luminosity and emission measure of the X-ray source possibly associated with HH 248 well. Thus, we suggest that the extended X-ray source close to HH 248 corresponds to a jet impacting a dense cloud.

  19. A rotating molecular disk toward IRAS 18162-2048, the exciting source of HH 80-81

    CERN Document Server

    Fernández-López, M; Curiel, Salvador; Gómez, Yolanda; Ho, Paul T P; Patel, Nimesh


    We present several molecular line emission arcsec and subarcsec observations obtained with the Submillimeter Array (SMA) in the direction of the massive protostar IRAS 18162-2048, the exciting source of HH 80-81. The data clearly indicates the presence of a compact (radius~425-850 AU) SO2 structure, enveloping the more compact (radius~150 AU) 1.4 millimeter dust emission (reported in a previous paper). The emission spatially coincides with the position of the prominent thermal radio jet which terminates at the HH 80-81 and HH 80N Herbig-Haro objects. Furthermore, the molecular emission is elongated in the direction perpendicular to the axis of the thermal radio jet, suggesting a disk-like structure. We derive a total dynamic mass (disk-like structure and protostar) of 11-15 msun. The SO2 spectral line data also allow us to constrain the structure temperature between 120-160 K and the volume density \\geq 2 \\times 10^9 cm3. We also find that such a rotating flattened system could be unstable due to gravitationa...

  20. Accurate quantum thermal rate constants for the three-dimensional H+H2 reaction (United States)

    Park, Tae Jun; Light, J. C.


    The rate constants for the three-dimensional H+H2 reaction on the Liu-Siegbahn-Truhlar-Horowitz (LSTH) surface are calculated using Pack-Parker hyperspherical (APH) coordinates and a C2v symmetry adapted direct product discrete variable representation (DVR). The C2v symmetry decomposition and the parity decoupling on the basis are performed for the internal coordinate χ. The symmetry decomposition results in a block diagonal representation of the flux and Hamiltonian operators. The multisurface flux is introduced to represent the multichannel reactive flux. The eigenvalues and eigenvectors of the J=0 internal Hamiltonian are obtained by sequential diagonalization and truncation. The individual symmetry blocks of the flux operator are propagated by the corresponding blocks of the Hamiltonian, and the J=0 rate constant k0(T) is obtained as a sum of the rate constants calculated for each block. k0(T) is compared with the exact k0(T) obtained from thermal averaging of the J=0 reaction probabilities; the errors are within 5%-20% up to T=1500 K. The sequential diagonalization-truncation method reduces the size of the Hamiltonian greatly, but the resulting Hamiltonian matrix still describes the time evolution very accurately. For the J≠0 rate constant calculations, the truncated internal Hamiltonian eigenvector basis is used to construct reduced (JKJ) blocks of the Hamiltonian. The individual (JKJ) blocks are diagonalized neglecting Coriolis coupling and treating the off-diagonal KJ±2 couplings by second order perturbation theory. The full wave function is parity decoupled. The rate constant is obtained as a sum over J of (2J+1)kJ(T). The time evolution of the flux for J≠0 is again very accurately described to give a well converged rate constant.

  1. Late-Type Near-Contact Eclipsing Binary [HH97] FS Aur-79 (United States)

    Austin, S. J.; Robertson, J. W.; Tycner, C.; Campbell, T.; Honeycutt, R. K.


    The secondary photometric standard star number 79 for the FS Aur field (Henden & Honeycutt 1997), designated as [HH97] FS Aur-79 (GSC 1874-399), is a short-period (0.2508 days) eclipsing binary whose light curve is a combination of the β Lyr and BY Dra type variables. High signal-to-noise ratio multicolor photometry was obtained using the US Naval Observatory 1 m telescope. These light curves show asymmetry at quadrature phases (the O'Connell effect), which can be modeled with the presence of starspots. A low-resolution spectrum obtained with the 3.5 m Wisconsin-Indiana-Yale-NOAO telescope at orbital phase 0.76 is consistent with a spectral type of dK7e and dM3e. A radial velocity curve for the primary star was constructed using 24 high-resolution spectra from the 9.2 m Hobby-Eberly Telescope. Spectra show Hα and Hβ in emission confirming chromospheric activity and possibly the presence of circumstellar material. Binary star models that simultaneously fit the U, B, V, R, and radial velocity curves are those with a primary star of mass 0.59+/-0.02 Msolar, temperature 4100+/-25 K, and mean radius 0.67 Rsolar, just filling its Roche lobe, and a secondary star of mass 0.31+/-0.09 Msolar, temperature 3425+/-25 K, and mean radius 0.48 Rsolar, just within its Roche lobe. An inclination angle of 83deg+/-2deg with a center-of-mass separation of 1.62 Rsolar is also derived. Starspots, expected for a rotation period of less than 1 day, had to be included in the modeling to fit the O'Connell effect.

  2. Atomic Hydrogen Surrounded by Water Molecules, H(H2O)m, Modulates Basal and UV-Induced Gene Expressions in Human Skin In Vivo (United States)

    Shin, Mi Hee; Park, Raeeun; Nojima, Hideo; Kim, Hyung-Chel; Kim, Yeon Kyung; Chung, Jin Ho


    Recently, there has been much effort to find effective ingredients which can prevent or retard cutaneous skin aging after topical or systemic use. Here, we investigated the effects of the atomic hydrogen surrounded by water molecules, H(H2O)m, on acute UV-induced responses and as well as skin aging. Interestingly, we observed that H(H2O)m application to human skin prevented UV-induced erythema and DNA damage. And H(H2O)m significantly prevented UV-induced MMP-1, COX-2, IL-6 and IL-1β mRNA expressions in human skin in vivo. We found that H(H2O)m prevented UV-induced ROS generation and inhibited UV-induced MMP-1, COX-2 and IL-6 expressions, and UV-induced JNK and c-Jun phosphorylation in HaCaT cells. Next, we investigated the effects of H(H2O)m on intrinsically aged or photoaged skin of elderly subjects. In intrinsically aged skin, H(H2O)m application significantly reduced constitutive expressions of MMP-1, IL-6, and IL-1β mRNA. Additionally, H(H2O)m significantly increased procollagen mRNA and also decreased MMP-1 and IL-6 mRNA expressions in photoaged facial skin. These results demonstrated that local application of H(H2O)m may prevent UV-induced skin inflammation and can modulate intrinsic skin aging and photoaging processes. Therefore, we suggest that modifying the atmospheric gas environment within a room may be a new way to regulate skin functions or skin aging. PMID:23637886

  3. Simultaneous Overexpression of the HhERF2 and PeDREB2a Genes Enhanced Tolerances to Salt and Drought in Transgenic Cotton. (United States)

    Li, Jin Bo; Ni Dong, Xue; Lei, Zhi; Liang Li, Yong; Yang Yang, Pei; Tao, Fei; Zhao, Liang; Li, Shi-Gang; Du, Lin Feng; Shao, Ji Rong; Wu, Yan Min


    A desert-grown Halimodendron halodendron ethylene-responsive element binding factor gene (HhERF2), which encodes a 245 amino acids protein containing a conserved AP2/EREBP domain, was isolated through the rapid amplification cDNA end (RACE) method. Sequence and phylogenetic analysis indicated that HhERF2 was classified into the B-2 group of ERF subfamily. Semiquantitative RT-PCR showed that HhERF2 was greatly induced by treatments with high-salt, drought and low temperature in H. halodendron seedlings. The expression vector containing HhERF2 and Populus euphratica dehydration- responsive element binding protein (PeDREB2a) genes driven by rd29A promoter was constructed and transferred into cotton (Gossypium hirsutum L.) by non-tissue culture Agrobacterium-mediated genetic transformation system. The transformation and expression of HhERF2 and PeDREB2a were identified by PCR and RT-PCR. Analyses of physiological function indicated that transgenic cottons had improved seeds germination, tolerance to drought and highsalt stresses. Agronomic evaluation in the field exhibited that transgenic lines presented a dwarf phenotype and improved further in the yield and characters. These results demonstrated that overexpressed both HhERF2 and PeDREB2a transcription factor genes in cotton induced elevated tolerance to drought and high-salt stresses.

  4. HH 666: different kinematics from H α and [Fe II] emission provide a missing link between jets and outflows (United States)

    Reiter, Megan; Smith, Nathan; Kiminki, Megan M.; Bally, John


    HH 666 is an externally irradiated protostellar outflow in the Carina nebula for which we present new near-IR [Fe II] spectra obtained with the Folded-Port Infrared Echellette spectrograph at Magellan Observatory. Earlier H α and near-IR [Fe II] imaging revealed that the two emission lines trace substantially different morphologies in the inner ˜40 arcsec of the outflow. H α traces a broad cocoon that surrounds the collimated [Fe II] jet that extends throughout the parent dust pillar. New spectra show that this discrepancy extends to their kinematics. Near-IR [Fe II] emission traces steady, fast velocities of ±200 km s-1 from the eastern and western limbs of the jet. We compare this to a previously published H α spectrum that reveals a Hubble-flow velocity structure near the jet-driving source. New, second-epoch Hubble Space Telescope (HST)/Advanced Camera for Surveys (ACS) H α images reveal the lateral spreading of the H α outflow lobe away from the jet axis. H α proper motions also indicate a sudden increase in the mass-loss rate ˜1000 yr ago, while steady [Fe II] emission throughout the inner jet suggest that the burst is ongoing. An accretion burst sustained for ˜1000 yr is an order of magnitude longer than expected for FU Orionis outbursts, but represents only a small fraction of the total age of the HH 666 outflow. Altogether, available data suggests that [Fe II] traces the highly collimated protostellar jet while H α traces the entrained and irradiated outflow. HH 666 appears to be a missing link between bare jets seen in H II regions and entrained molecular outflows seen from embedded protostars in more quiescent regions.

  5. 铁过载引发人肝细胞HH4 N-糖链表达差异研究%Study on differential expression of N-linked glycans in iron overload-induced human hepatocytes HH4

    Institute of Scientific and Technical Information of China (English)

    李士伟; 关锋; 李想


    Hepatic iron overload is common in patients undergoing hematopoietic cell transplantation and may be associated with hepatic injury. Here iron overload model of HH4 cells induced by FAC (ferric ammonium citrate) was established. The total proteins of HH4 cells treated with or without FAC were extracted, and total glycopeptides were isolated by an ultrafiltration unit. The glycopeptides were enzymatically hydrolyzed by Peptide-N-glycosidase F (PNGase F) and the released N-linked glycans were desalinated using Sepharose 4B. The structures of the purified N-glycans were identified by matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF/TOF-MS). Furthermore, the comparative expression of N-glycans was analyzed by lectin immunohistochemistry. The result indicated that 16 N-glycans were differentially expressed in HH4 cells treated with or without FAC. The levels of high-mannose-type N-glycans were decreased significantly, while the expression of hybrid type, complex type, bisecting type, fucosylation and sialylation of glycans were enhanced markedly in FAC-treated HH4 cells. Consistent with MS analysis, lectin immunohistochemistry study showed that the binding affinity to lectin ConA was reduced in FAC-treated HH4 cells, but the binding affinities to 4 lectins PHA-E, AAL, LCA and MAL-II were significantly increased. The present research provides the fundamental observations for further understanding functional roles of differential expression of N-linked glycans in iron-overload HH4 cells.%肝脏铁过载是血液系统疾病患者进行骨髓移植后的典型并发症之一,长期铁过载可引发肝脏细胞凋亡和器官损坏,然而铁过载的分子调控机理迄今仍不清楚。以培养的枸橼酸铁铵过载人肝细胞HH4和正常人肝细胞HH4为研究对象,细胞裂解提取总蛋白,分子筛超滤管分离获得总糖肽,PNGase F酶解释放出N-糖链,Sepharose 4B除盐纯化N-糖链,再利用基质

  6. The physical properties of the HH 30 jet from HST and ground-based data (United States)

    Bacciotti, Francesca; Eislöffel, Jochen; Ray, Thomas P.


    We investigate the physical properties of the HH 30 jet by applying the spectroscopic diagnostic technique described in Bacciotti & Eislöffel (\\cite{be99}) to ground-based spectra and Hubble Space Telescope (HST) calibrated emission-line images. We derive the variation along the beam of the ionization fraction xe, of the total hydrogen density n_H and of the average excitation temperature Te, with a spatial sampling of 0.1" to 0.6" (depending on the dataset used) near the source of the flow and of 1.8" further out. In the jet xe rapidly rises from 0.065 at 0.2" to 0.1 at 0.4", and then slowly increases up to 0.140 within 2'' from the source. From 2.4" to 12.5", xe decreases very slowly down to a value of 0.04. The slow recombination in the outermost collimated part is consistent with a flow opening angle of about 2(deg) . At the beginning of the jet n_H is at least ~ 10(5) cm(-3) , but it decreases to 5 10(4) cm(-3) within the first arcsecond and then slowly falls to 10(4) cm(-3) at large distance from the source. On average Te decreases from ~ 2 10(4) K to 10(4) K within the first arcsecond of the jet, then it slowly decays to 6000-7000 K. In the faint counter-jet, which appears to be substantially more excited than the jet, xe rises from 0.07 up to 0.35 at 2-3 arcsec from the source, n_H decreases from about 8 10(4) cm(-3) to a few 10(3) cm(-3) , while Te is scattered around 1.2-1.3 10(4) K. A comparison between the observed and calculated line fluxes shows that the filling factor is of order unity in this flow. The emission-weighted jet width calculated with the parameters that we derive is in good agreement with the observed FWHM; we find, however, that the jet radius apparently goes to zero at the source location, defining an initial full opening angle of about 10(deg) . The intensity peaks, i.e. the knots, are clearly correlated with local temperature maxima. The ionization fraction and the electron and total densities do not show any evident increase at

  7. A Possible Origin of the H-H Objects in Young Stellar Outflows (United States)

    de Gouveia dal Pino, E.; Opher, R.


    RESUMEN. La presencIa de flujos coljmados asocjados con objetos estelares j6venes es un fen6meno comun en reglones de formacI6n estelar. Estos chorros frecuentemente muestran una cadena de reglones de lineas de emjsI6n, a varIas de las cuales se les conoce desde bace mucho tlempo objetos HerbIg-Haro (HAl). En el presente trabajo examjnamos la poslbIlI dad de que estos nudos sean condensaciones producIdas por inestabilidad termica en un plasma que se se expande sujeto a `bremsstrahlung' reco - binaci6n y perdida por radjacj5n en lineas de emjsj6n. Nostramos que el valor minimo de = P0/PN0 bajo condjcjones Isobaricas para el crecimien to de la inestabilidad termica es = (6/5) [9/(STc\\)e) - 3/2]; en donde P0 es la presi6n de particulas, PM0 la presi6n magnetica, `)e la tasa de expansI5n y Tc el tiempo de enfriatniento radiativo en el flujo (3eI plasma ambiente. Haciendo calculos no lineales, encontratnos que l9s flujos colitnados de temperatura K, tasas de perdida de masa `4 = 10-6 - lO 8 Ne y velocidades de flujo VJ = 100-400 km/s, resultan favorables para la formacl6n de condensaciones por inestabilidad termica con contrastes de densidad Pp/ .3 -2.0 creados en intervalos de tiempo mas cortos que el tiempo estirnado de expansl6n en los chorros, en donde Pp(Po) es la densidad en la regi5n (ambiente) perturbada. ABSTRACT. The presence of collimated outflows associated with young stellar objects is a common phenomenon in star-fortning regions. These jets frequently show a chain of emission-line regions several of which have long been known as Herbig-Haro (H-H) objects. In this paper we examine the possibility that these knots are condensations produced by thermal instability in an expanding plasma , recombination and emission-line radiation losses. We show that the minimum value of = P /PNo under isobaric conditions for the growth of a thermal instability 0is = (6/5)1 [9/(STcN)e) - 3/2]; where P0 is the particle pressure, NQ tWe magnetic pressure, N) the expansion rate

  8. Medium Screening and Optimization for Soy Bean Rhizobium (Rhizobium fredii) HH103%大豆根瘤菌HH103菌株培养基的筛选与优化

    Institute of Scientific and Technical Information of China (English)

    肖亦农; 徐琼


    Quick-growing soy bean rhizobium (Rhizobium fredii) HH103 was used as a tested strain, and adopted single factor nitrogen source utilization experiment and orthogonal design experiment to confirm the optimum medium and its formula. The results showed that the strain grew well on YMA, the optimum carbon source was sucrose, and the optimum nitrogen was yeast extract with the optimum medium formula as follows (in g/L) : sucrose 11, yeast extract 0.9, K2HPO40.5, MnSO4 0.005, CaCl2 0.1, KH2PO40.5, MgSO40.2, KNO30.77, (NH4)2HPO4 0. 33, FeCl3 0.005, andpH7.2.%以快生型大豆根瘤菌HH103菌株为供试菌株,采用单因素碳氮源利用试验和正交设计试验,确定最佳培养基及其配方.结果表明:该菌株在YMA中生长良好,最佳碳源为蔗糖,最佳氮源为酵母膏,最佳培养基成分配方(g/L):蔗糖11,酵母膏0.9,K2HPO4 0.5,MnSO40.005,CaCl2 0.1,KH2PO4 0.5,MgSO4 0.2,KNO30.77,(NH4)2HPO4 0.33,FeCl3 0.005,pH 7.2.

  9. An investigation into crystalline phases and nano structural and mechanical properties of HH heat resistant stainless steels

    Directory of Open Access Journals (Sweden)

    M Hosseini


    Full Text Available In the present work, the effects of different casting parameters including pouring temperature and cooling rate on stainless steel structures and mechanical properties of heat resistant alloy (HH were studied. Mo nanoparticles were synthesized through sol-gel method and were coated on the stainless steel device using spin-coating method. The effect of coating layer on the device was studied by using XRD (X-Ray Diffraction and FT-IR (Fourier Transform Infra red and SEM (Scanning Electron Microscopy techniques. The obtained results indicated an enhancement of corrosion, surface abrasion protection without changing metal surface structure, and a reduction of leakage current through the stainless steel device. Furthermore, pouring temperature and cooling rate increase caused a fine grain structure to be acquired with less carbides and better distribution in the austenitic matrix.

  10. Resonant Higgs boson pair production in the $hh\\rightarrow b\\bar{b} \\; WW \\rightarrow b\\bar{b} \\ell^+ \

    CERN Document Server

    Martín Lozano, Víctor; Park, Chan Beom


    Adding a scalar singlet provides one of the simplest extensions of the Standard Model. In this work we briefly review the latest constraints on the mass and mixing of the new Higgs boson and study its production and decay at the LHC. We mainly focus on double Higgs production in the $hh \\rightarrow b \\bar{b} WW \\rightarrow b \\bar{b} \\ell^+ \

  11. Search and Rescue Aircrewman/HH3F Flight Mechanic, 2-10. Military Curriculum Materials for Vocational and Technical Education. (United States)

    Ohio State Univ., Columbus. National Center for Research in Vocational Education.

    This self-paced, individualized course, adapted from military curriculum materials for use in vocational and technical education, teaches students the skills needed to become a qualified avionics worker on the HH-3F helicopter. The course materials consist of three pamphlets: two student workbooks and a composite ground/flight syllabus. Each…

  12. Production of bifunctional proteins by Aspergillus awamori: Llama variable heavy chain antibody fragment (V-HH) R9 coupled to Arthromyces ramosus peroxidase (ARP)

    NARCIS (Netherlands)

    Joosten, V.; Roelofs, M.S.; Dries, van den N.; Goosen, T.; Verrips, C.T.; Hondel, van den C.A.M.J.J.; Lokman, B.C.


    The Arthromyces ramosus peroxidase gene (arp) was genetically fused to either the 5'- or 3'-terminal ends of the gene encoding llama variable heavy chain antibody fragment V-HH R9, resulting in the fusion expression cassettes ARP-R9 or R9-ARP. Aspergillus awamori transformants were obtained which

  13. Production of bifunctional proteins by Aspergillus awamori: Llama variable heavy chain antibody fragment (V-HH) R9 coupled to Arthromyces ramosus peroxidase (ARP)

    NARCIS (Netherlands)

    Joosten, V.; Roelofs, M.S.; Dries, van den N.; Goosen, T.; Verrips, C.T.; Hondel, van den C.A.M.J.J.; Lokman, B.C.


    The Arthromyces ramosus peroxidase gene (arp) was genetically fused to either the 5'- or 3'-terminal ends of the gene encoding llama variable heavy chain antibody fragment V-HH R9, resulting in the fusion expression cassettes ARP-R9 or R9-ARP. Aspergillus awamori transformants were obtained which pr

  14. Production of bifunctional proteins by Aspergillus awamori: Llama variable heavy chain antibody fragment (V-HH) R9 coupled to Arthromyces ramosus peroxidase (ARP)

    NARCIS (Netherlands)

    Joosten, V.; Roelofs, M.S.; Dries, van den N.; Goosen, T.; Verrips, C.T.; Hondel, van den C.A.M.J.J.; Lokman, B.C.


    The Arthromyces ramosus peroxidase gene (arp) was genetically fused to either the 5'- or 3'-terminal ends of the gene encoding llama variable heavy chain antibody fragment V-HH R9, resulting in the fusion expression cassettes ARP-R9 or R9-ARP. Aspergillus awamori transformants were obtained which pr

  15. Snapshots of the ``breaking” of the H-H bond in the oxidative addition of H2 to a metal centre

    Indian Academy of Sciences (India)

    Saikat Dutta; Balaji R Jagirdar


    Three new monocationic molecular hydrogen complexes of ruthenium of the type trans-[RuCl(2-H2)(PP)2][BF4] (PP = bis-1,2(diarylphosphino)ethane, aryl = -fluorobenzyl, benzyl, -methylbenzyl) have been prepared by protonating the precursor hydride complexes trans-[RuCl(H)(PP)2] using HBF4.Et2O. These three dihydrogen complexes are quite stable and have been isolated in the solid state. The intact nature of the H-H bond in these derivatives has been established from the short spin-lattice relaxation times (1, ) and the observation of substantial H, D couplings in the HD isotopomers. The H-H bond distances (HH, Å) increase from 0.97 to 1.01 Å as the electron donor ability of the diphosphine ligand increases from the -fluorobenzyl to the benzyl to the -methylbenzyl moiety. These dihydrogen complexes constitute the initial stages of elongation of the H-H bond enroute to its cleavage along the reaction coordinate for the oxidative addition of H2 to a metal centre.

  16. HH 223: a parsec-scale H2 outflow in the star-forming region L723 (United States)

    López, R.; Acosta-Pulido, J. A.; Gómez, G.; Estalella, R.; Carrasco-González, C.


    Context. The dark cloud Lynds 723 (L723) is a low-mass star-forming region where one of the few known cases of a quadrupolar CO outflow has been reported. Two recent works have found that the radio continuum source VLA 2, towards the centre of the CO outflow, is actually a multiple system of young stellar objects (YSOs). Several line-emission nebulae that lie projected on the east-west CO outflow were detected in narrow-band Hα and [S ii] images. The spectra of the knots are characteristic of shock-excited gas (Herbig-Haro spectra), with supersonic blueshifted velocities, which suggests an optical outflow also powered by the VLA 2 YSO system of L723. Aims: Our aim is to study L723 in the near-infrared and look for line-emission nebulae associated with the optical and CO outflows. Methods: We imaged a field of ~5' × 5' centred on HH 223, which includes the whole region of the quadrupolar CO outflow with narrow-band filters centred on the [Fe ii] 1.644 μm and H2 2.122 μm lines, together with off-line Hc and Kc filters. The [Fe ii] and H2 line-emission structures were identified after extracting the continuum contribution, if any. Their positions were determined from an accurate astrometry of the images. Results: The H2 line-emission structures appear distributed over a region of 5.5 arcmin (~0.5 pc for a distance of 300 pc) at both sides of the VLA 2 YSO system, with an S-shape morphology, and are projected onto the east-west CO outflow. Most of them were resolved in smaller knotty substructures. The [Fe ii] emission only appears associated with HH 223. An additional nebular emission from the continuum in Hc and Kc appears associated with HH 223-K1, the structure closest to the VLA 2 YSO system, and could be tracing the cavity walls. Conclusions: We propose that the H2 structures form part of a large-scale near-infrared outflow, which is also associated with the VLA 2 YSO system. The current data do not allow us to discern which of the YSOs of VLA 2 is powering

  17. Two Component Decomposition of Dual Polarimetric HH/VV SAR Data: Case Study for the Tundra Environment of the Mackenzie Delta Region, Canada

    Directory of Open Access Journals (Sweden)

    Tobias Ullmann


    Full Text Available This study investigates a two component decomposition technique for HH/VV-polarized PolSAR (Polarimetric Synthetic Aperture Radar data. The approach is a straight forward adaption of the Yamaguchi decomposition and decomposes the data into two scattering contributions: surface and double bounce under the assumption of a negligible vegetation scattering component in Tundra environments. The dependencies between the features of this two and the classical three component Yamaguchi decomposition were investigated for Radarsat-2 (quad and TerraSAR-X (HH/VV data for the Mackenzie Delta Region, Canada. In situ data on land cover were used to derive the scattering characteristics and to analyze the correlation among the PolSAR features. The double bounce and surface scattering features of the two and three component scattering model (derived from pseudo-HH/VV- and quad-polarized data showed similar scattering characteristics and positively correlated-R2 values of 0.60 (double bounce and 0.88 (surface scattering were observed. The presence of volume scattering led to differences between the features and these were minimized for land cover classes of low vegetation height that showed little volume scattering contribution. In terms of separability, the quad-polarized Radarsat-2 data offered the best separation of the examined tundra land cover types and will be best suited for the classification. This is anticipated as it represents the largest feature space of all tested ones. However; the classes “wetland” and “bare ground” showed clear positions in the feature spaces of the C- and X-Band HH/VV-polarized data and an accurate classification of these land cover types is promising. Among the possible dual-polarization modes of Radarsat-2 the HH/VV was found to be the favorable mode for the characterization of the aforementioned tundra land cover classes due to the coherent acquisition and the preserved co-pol. phase. Contrary, HH/HV-polarized and VV

  18. Studying the Outflow-Core Interaction with ALMA Cycle 1 Observations of the HH 46/47 Molecular Outflow

    CERN Document Server

    Zhang, Yichen; Mardones, Diego; Cabrit, Sylvie; Dunham, Michael M; Garay, Guido; Noriega-Crespo, Alberto; Offner, Stella S R; Raga, Alejandro C; Corder, Stuartt A


    We present ALMA Cycle 1 observations of the HH 46/47 molecular outflow using combined 12m array and 7m array observations. We use 13CO and C18O emission to correct for the 12CO optical depth, to accurately estimate the outflow mass, momentum and kinetic energy. Applying the optical depth correction increases the mass estimate by a factor of 14, the momentum by a factor of 6, and the kinetic energy by a factor of about 2. The new 13CO(1-0) and C18O(1-0) data also allow us to trace denser and slower outflow material than that traced by 12CO. These species are only detected within about 1~2 km/s from the cloud velocity. The cavity wall of the red lobe appears at very low velocities (~0.2 km/s). Combing the material traced only by 13CO and C18O, the measured total mass of the CO outflow is 1.4 Msun, the total momentum is 1.7 Msun km/s and the total energy is 4.7e43 erg, assuming Tex=15 K. The improved angular resolution and sensitivity in 12CO reveal more details of the outflow structure. Specifically, we find th...

  19. HH 666: Different kinematics from H{\\alpha} and [Fe II] emission provide a missing link between jets and outflows

    CERN Document Server

    Reiter, Megan; Kiminki, Megan M; Bally, John


    HH 666 is an externally irradiated protostellar outflow in the Carina Nebula for which we present new near-IR [Fe II] spectra obtained with the FIRE spectrograph at Magellan Observatory. Earlier H{\\alpha} and near-IR [Fe II] imaging revealed that the two emission lines trace substantially different morphologies in the inner ~40" of the outflow. H{\\alpha} traces a broad cocoon that surrounds the collimated [Fe II] jet that extends throughout the parent dust pillar. New spectra show that this discrepancy extends to their kinematics. Near-IR [Fe II] emission traces steady, fast velocities of +/- 200 km/s from the eastern and western limbs of the jet. We compare this to a previously published H{\\alpha} spectrum that reveals a Hubble-flow velocity structure near the jet-driving source. New, second-epoch HST/ACS H{\\alpha} images reveal the lateral spreading of the H{\\alpha} outflow lobe away from the jet axis. H{\\alpha} proper motions also indicate a sudden increase in the mass-loss rate ~1000 yr ago, while steady ...

  20. KK MC-hh: Resumed exact O (α2L ) EW corrections in a hadronic MC event generator (United States)

    Jadach, S.; Ward, B. F. L.; Was, Z. A.; Yost, S. A.


    We present an improvement of the Monte Carlo (MC) event generator Herwiri2, where we recall the latter MC was a prototype for the inclusion of CEEX resummed electroweak (EW) corrections in hadron-hadron scattering at high center of momentum system (cms) energies. In this improvement the new exact O (α2L ) resummed EW generator K K MC 4.22, featuring as it does the CEEX realization of resummation in the EW sector, is put in union with the Herwig parton shower environment. The Les Houches (LHE) format of the attendant output event file means that all other conventional parton shower environments are available to the would-be user of the resulting new MC. For this reason (and others—see the text) we henceforth refer to the new improvement of the Herwiri2 MC as K K MC -hh. Since this new MC features exact O (α ) pure weak corrections from the DIZET EW library and features the CEEX and the EEX YFS-style resummation of large multiple photon effects, it provides already the concrete path to 0.05% precision on such effects if we focus on the EW effects themselves. We therefore show predictions for observable distributions and comparisons with other approaches in the literature. This MC represents an important step in the realization of the exact amplitude-based QED ⊗QCD resummation paradigm. Independently of this latter observation, the MC rigorously quantifies important EW effects in the current LHC experiments.

  1. One-parameter cascade model of multiple hadrons production in inelastic hh-processes at high energies

    Energy Technology Data Exchange (ETDEWEB)

    Rusov, V.D. [Department of Theoretical and Experimental Nuclear Physics, Odessa National Polytechnic University, Shevchenko av. 1, Odessa 65044 (Ukraine)]. E-mail:; Sharf, I.V. [Department of Theoretical and Experimental Nuclear Physics, Odessa National Polytechnic University, Shevchenko av. 1, Odessa 65044 (Ukraine)


    The inhomogeneous cascade-stochastic model of multiple hadrons production in inelastic p-bar p- and pp-interactions at high energies is proposed. In this model inclusive rapidity distributions of secondary hadrons are used as input data. One-parameter cascade-stochastic multiplicity distribution, where adjustable parameter has sense of the height of Feynman plateau of inclusive rapidity distribution of secondary hadrons in one hadron shower, is obtained. It is shown that all known now experimental data concerning both multiplicity and rapidity distributions of secondary particles in inelastic hh-processes in energy range s=30-1800 GeV, and also the ratio of cumulant moments to factorial moments of the multiplicity distributions in energy range s=200-900 GeV are described with high accuracy by one-parameter cascade-stochastic model of multiple hadrons production. The explicit form of asymptotic of distributions as well-known Polyakov-Dokshitzer's scaling function for quark and gluon jets is obtained by fitting of prognosis multiplicity distributions at energies s=14-30 TeV. A simplified quantitative analysis is presented and the qualitative explanation of behavior features of forward-backward multiplicity correlations is given within the framework of proposed model.

  2. Origin of the hot gas in low-mass protostars: Herschel-PACS spectroscopy of HH 46

    CERN Document Server

    van Kempen, T A; Herczeg, G J; Visser, R; van Dishoeck, E F; Wampfler, S F; Bruderer, S; Benz, A O; Doty, S D; Brinch, C; Hogerheijde, M R; Jørgensen, J K; Tafalla, M; Neufeld, D; Bachiller, R; Baudry, A; Benedettini, M; Bergin, E A; Bjerkeli, P; Blake, G A; Bontemps, S; Braine, J; Caselli, P; Cernicharo, J; Codella, C; Daniel, F; di Giorgio, A M; Dominik, C; Encrenaz, P; Fich, M; Fuente, A; Giannini, T; Goicoechea, J R; de Graauw, Th; Helmich, F; Herpin, F; Jacq, T; Johnstone, D; Kaufman, M J; Larsson, B; Lis, D; Liseau, R; Marseille, M; McCoey, C; Melnick, G; Nisini, B; Olberg, M; Parise, B; Pearson, J C; Plume, R; Risacher, C; Santiago-Garcia, J; Saraceno, P; Shipman, R; van der Tak, F; Wyrowski, F; Yildiz, U A; Ciechanowicz, M; Dubbeldam, L; Glenz, S; Huisman, R; Lin, R H; Morris, P; Murphy, J A; Trappe, N


    'Water in Star-forming regions with Herschel' (WISH) is a Herschel Key Programme aimed at understanding the physical and chemical structure of young stellar objects (YSOs) with a focus on water and related species. The low-mass protostar HH 46 was observed with the Photodetector Array Camera and Spectrometer (PACS) on the Herschel Space Observatory to measure emission in H2O, CO, OH, [OI], and [CII] lines located between 63 and 186 um. The excitation and spatial distribution of emission can disentangle the different heating mechanisms of YSOs, with better spatial resolution and sensitivity than previously possible. Far-IR line emission is detected at the position of the protostar and along the outflow axis. The OH emission is concentrated at the central position, CO emission is bright at the central position and along the outflow, and H2O emission is concentrated in the outflow. In addition, [OI] emission is seen in low-velocity gas, assumed to be related to the envelope, and is also seen shifted up to 170 km...

  3. X-ray emission from stellar jets by collision against high-density molecular clouds: an application to HH 248

    CERN Document Server

    Lopez-Santiago, Javier; Orellana, Mariana; Miceli, Marco; Orlando, Salvatore; Ustamujic, Sabina; Albacete-Colombo, Juan Facundo; de Castro, Elisa; de Castro, Ana Ines Gomez


    We investigate the plausibility of detecting X-ray emission from a stellar jet that impacts against a dense molecular cloud. This scenario may be usual for classical T Tauri stars with jets in dense star-forming complexes. We first model the impact of a jet against a dense cloud by 2D axisymmetric hydrodynamic simulations, exploring different configurations of the ambient environment. Then, we compare our results with XMM-Newton observations of the Herbig-Haro object HH 248, where extended X-ray emission aligned with the optical knots is detected at the edge of the nearby IC 434 cloud. Our simulations show that a jet can produce plasma with temperatures up to 10 MK, consistent with production of X-ray emission, after impacting a dense cloud. We find that jets denser than the ambient medium but less dense than the cloud produce detectable X-ray emission only at the impact onto the cloud. From the exploration of the model parameter space, we constrain the physical conditions (jet density and velocity, cloud den...

  4. Late-time spectroscopy of SN 2002hh: A continued visible light echo with no shock interaction yet

    CERN Document Server

    Andrews, Jennifer E; Mauerhan, Jon C


    Supernova (SN) 2002hh was unusual among core-collapse SNe because it was highly reddened, and displayed a bright infrared (IR) excess due to radiatively heated dust in its circumstellar medium (CSM). Estimates for the mass of dust responsible for the IR echo suggested the presence of a massive shell within 0.26 pc of the star. For a velocity of 5000 - 10000 km/s, this material should be hit by the SN blast wave at late times, starting at roughly 12 years post-explosion. We have obtained deep late-time spectra with the MMT Blue Channel spectrograph to search for any spectral signatures of ongoing shock interaction. Interaction with a strength comparable to SN 1987A's collision with the equatorial ring would be detected in our data. However, in the spectra reported here, we do not detect clear signs of strong CSM interaction, contrary to expectations based on the reported radii of the dust shell. We do, however, detect emission associated with the old SN, and we find that the broad lines in the spectrum indicat...

  5. Late-time spectroscopy of SN 2002hh: a continued visible light echo with no shock interaction yet (United States)

    Andrews, J. E.; Smith, Nathan; Mauerhan, Jon C.


    Supernova (SN) 2002hh was unusual among core-collapse SNe because it was highly reddened, and displayed a bright infrared (IR) excess due to radiatively heated dust in its circumstellar medium (CSM). Estimates for the mass of dust responsible for the IR echo suggested the presence of a massive shell within 0.26 pc of the star. For a velocity of 5000-10 000 km s-1, this material should be hit by the SN blast wave at late times, starting at roughly 12 years post-explosion. We have obtained deep late-time spectra with the Multiple Mirror Telescope (MMT) Blue Channel spectrograph to search for any spectral signatures of ongoing shock interaction. Interaction with a strength comparable to SN 1987A's collision with the equatorial ring would be detected in our data. However, in the spectra reported here, we do not detect clear signs of strong CSM interaction, contrary to expectations based on the reported radii of the dust shell. We do, however, detect emission associated with the old SN, and we find that the broad lines in the spectrum indicate a continuation of an ongoing reflected light echo, which appears similar to the spectrum at peak luminosity for this Type II-P event.

  6. HH 223: a parsec-scale H2 outflow in the star-forming region L723

    CERN Document Server

    Lopez, R; Gomez, G; Estalella, R; Carrasco-Gonzalez, C


    The dark cloud Lynds 723 (L723) is a low-mass star-forming region where one of the few known cases of a quadrupolar CO outflow has been reported. Two recent works have found that the radio continuum source VLA 2, towards the centre of the CO outflow, is actually a multiple system of young stellar objects (YSOs). Several line-emission nebulae that lie projected on the east-west CO outflow were detected in narrow-band Halpha and [SII] images. The spectra of the knots are characteristic of shock-excited gas (Herbig-Haro spectra), with supersonic blueshifted velocities, which suggests an optical outflow also powered by the VLA 2 YSO system of L723. We imaged a field of ~5' X 5' centred on HH 223, which includes the whole region of the quadrupolar CO outflow with nir narrow-band filters . The H2 line-emission structures appear distributed over a region of 5.5' (0.5 pc for a distance of 300 pc) at both sides of the VLA 2 YSO system, with an S-shape morphology, and are projected onto the east-west CO outflow. Most o...

  7. Di-Higgs final states augMT2ed – Selecting hh events at the high luminosity LHC

    Energy Technology Data Exchange (ETDEWEB)

    Barr, Alan J., E-mail: [Denys Wilkinson Building, Department of Physics, Keble Road, Oxford, OX1 3RH (United Kingdom); Dolan, Matthew J., E-mail: [Institute for Particle Physics Phenomenology, Department of Physics, Durham University, DH1 3LE (United Kingdom); Englert, Christoph, E-mail: [SUPA, School of Physics and Astronomy, University of Glasgow, Glasgow, G12 8QQ (United Kingdom); Spannowsky, Michael, E-mail: [Institute for Particle Physics Phenomenology, Department of Physics, Durham University, DH1 3LE (United Kingdom)


    Higgs boson self-interactions can be investigated via di-Higgs (pp→hh+X) production at the LHC. With a small O(30) fb Standard Model production cross section, and a large tt{sup ¯} background, this measurement has been considered challenging, even at a luminosity-upgraded LHC. We demonstrate that by using simple kinematic bounding variables, of the sort already employed in existing LHC searches, the dominant tt{sup ¯} background can be largely eliminated. Simulations of the signal and the dominant background demonstrate the prospect for measurement of the di-Higgs production cross section at the 30% level using 3 ab{sup −1} of integrated luminosity at a high luminosity LHC. This corresponds to a Higgs self-coupling determination with 60% accuracy in the bb{sup ¯}τ{sup +}τ{sup −} mode, with potential for further improvements from e.g. subjet technologies and from additional di-Higgs decay channels.

  8. The Sinorhizobium (Ensifer) fredii HH103 Type 3 Secretion System Suppresses Early Defense Responses to Effectively Nodulate Soybean. (United States)

    Jiménez-Guerrero, Irene; Pérez-Montaño, Francisco; Monreal, José Antonio; Preston, Gail M; Fones, Helen; Vioque, Blanca; Ollero, Francisco Javier; López-Baena, Francisco Javier


    Plants that interact with pathogenic bacteria in their natural environments have developed barriers to block or contain the infection. Phytopathogenic bacteria have evolved mechanisms to subvert these defenses and promote infection. Thus, the type 3 secretion system (T3SS) delivers bacterial effectors directly into the plant cells to alter host signaling and suppress defenses, providing an appropriate environment for bacterial multiplication. Some rhizobial strains possess a symbiotic T3SS that seems to be involved in the suppression of host defenses to promote nodulation and determine the host range. In this work, we show that the inactivation of the Sinorhizobium (Ensifer) fredii HH103 T3SS negatively affects soybean nodulation in the early stages of the symbiotic process, which is associated with a reduction of the expression of early nodulation genes. This symbiotic phenotype could be the consequence of the bacterial triggering of soybean defense responses associated with the production of salicylic acid (SA) and the impairment of the T3SS mutant to suppress these responses. Interestingly, the early induction of the transcription of GmMPK4, which negatively regulates SA accumulation and defense responses in soybean via WRKY33, could be associated with the differential defense responses induced by the parental and the T3SS mutant strain.

  9. Assessment of Snow Status Changes Using L-HH Temporal-Coherence Components at Mt. Dagu, China

    Directory of Open Access Journals (Sweden)

    Yong Wang


    Full Text Available Multitemporal Phased Array type L-band Synthetic Aperture Radar (PALSAR horizontally transmitted and horizontally received (HH coherence data was decomposed into temporal-coherence, spatial-coherence, and thermal noise components. The multitemporal data spanned between February and May of 2008, and consisted of two pairs of interferometric SAR (InSAR images formed by consecutive repeat passes. With the analysis of ancillary data, a snow increase process and a snow decrease process were determined. Then, the multiple temporal-coherence components were used to study the variation of thawing and freezing statuses of snow because the components can mostly reflect the temporal change of the snow that occurred between two data acquisitions. Compared with snow mapping results derived from optical images, the outcomes from the snow increase process and the snow decrease process reached an overall accuracy of 71.3% and 79.5%, respectively. Being capable of delineating not only the areas with or without snow cover but also status changes among no-snow, wet snow, and dry snow, we have developed a critical means to assess the water resource in alpine areas.

  10. High pressure investigations on hydrous magnesium silicate-phase A using first principles calculations: H---H repulsion and changes in hydrogen bond geometry with compression (United States)

    Poswal, H. K.; Sharma, Surinder; Sikka, S. K.


    We have carried out first principles structural relaxation calculations on the hydrous magnesium silicate Phase A (Mg7Si2O8(OH)6) under high pressures. Our results show that phase A does not undergo any phase transition upto ~ 45 GPa. We find that non-bonded H--H distance reaches a limiting value of 1.85 angstrom at about 45 GPa. The H--H repulsive strain releasing mechanism in Phase A is found to be dramatically different from the hydrogen bond bending one that was proposed by Hofmeister et al1 for Phase B. It is based on the reduction of one of the O-H bond distances with compression.

  11. Hedgehog(Hh)信号通路及P53在尖锐湿疣皮损中的表达及意义

    Institute of Scientific and Technical Information of China (English)

    朱文胜; 冯世军; 李萍



  12. The innate defense regulator peptides IDR-HH2, IDR-1002, and IDR-1018 modulate human neutrophil functions. (United States)

    Niyonsaba, François; Madera, Laurence; Afacan, Nicole; Okumura, Ko; Ogawa, Hideoki; Hancock, Robert E W


    Although HDPs were originally hypothesized to act as antimicrobial agents, they also have been shown to broadly modulate the immune response through the activation of different cell types. We recently developed a series of novel, synthetic peptides, termed IDRs, which are conceptually based on a natural HDP, bovine bactenecin. We showed that IDR-1 and IDR-1002 protect the host against bacterial infections through the induction of chemokines. The objective of this study was to investigate the effects of the IDRs on various functions of human neutrophils. Here, we demonstrated that IDR-HH2, IDR-1002, and IDR-1018 modulated the expression of neutrophil adhesion and activation markers. Moreover, these IDRs enhanced neutrophil adhesion to endothelial cells in a β₂ integrin-dependent manner and induced neutrophil migration and chemokine production. The IDR peptides also increased the release of the neutrophil-generated HDPs (antimicrobial), human α-defensins, and LL-37 and augmented neutrophil-mediated killing of Escherichia coli. Notably, the IDRs significantly suppressed LPS-mediated neutrophil degranulation, the release of ROS, and the production of the inflammatory cytokines TNF-α and IL-10, consistent with their ability to dampen inflammation. As evidenced by the inhibitory effects of MAPK-specific inhibitors, IDRs activated the MAPK pathway that was required for chemokine production. In conclusion, our study provides novel evidence regarding the contribution of the IDR peptides to the innate immune response through the modulation of neutrophil functions. The results described here may aid in the development of IDRs as novel, anti-infective and immunomodulatory agents.

  13. ALMA Cycle 1 Observations of the HH46/47 Molecular Outflow: Structure, Entrainment, and Core Impact (United States)

    Zhang, Yichen; Arce, Héctor G.; Mardones, Diego; Cabrit, Sylvie; Dunham, Michael M.; Garay, Guido; Noriega-Crespo, Alberto; Offner, Stella S. R.; Raga, Alejandro C.; Corder, Stuartt A.


    We present Atacama Large Millimeter/sub-millimeter Array Cycle 1 observations of the HH 46/47 molecular outflow using combined 12 m array and Atacama Compact Array observations. The improved angular resolution and sensitivity of our multi-line maps reveal structures that help us study the entrainment process in much more detail and allow us to obtain more precise estimates of outflow properties than in previous observations. We use {}13{{CO}} (1-0) and {{{C}}}18{{O}} (1-0) emission to correct for the {}12{{CO}} (1-0) optical depth to accurately estimate the outflow mass, momentum, and kinetic energy. This correction increases the estimates of the mass, momentum, and kinetic energy by factors of about 9, 5, and 2, respectively, with respect to estimates assuming optically thin emission. The new {}13{{CO}} and {{{C}}}18{{O}} data also allow us to trace denser and slower outflow material than that traced by the {}12{{CO}} maps, and they reveal an outflow cavity wall at very low velocities (as low as 0.2 {\\text{km s}}-1 with respect to the core’s central velocity). Adding the slower material traced only by {}13{{CO}} and {{{C}}}18{{O}}, there is another factor of three increase in the mass estimate and 50% increase in the momentum estimate. The estimated outflow properties indicate that the outflow is capable of dispersing the parent core within the typical lifetime of the embedded phase of a low-mass protostar and that it is responsible for a core-to-star efficiency of 1/4 to 1/3. We find that the outflow cavity wall is composed of multiple shells associated with a series of jet bow-shock events. Within about 3000 au of the protostar the {}13{{CO}} and {{{C}}}18{{O}} emission trace a circumstellar envelope with both rotation and infall motions, which we compare with a simple analytic model. The CS (2-1) emission reveals tentative evidence of a slowly moving rotating outflow, which we suggest is entrained not only poloidally but also toroidally by a disk wind that

  14. Efecto hipolipemiante del aceite de Sacha Inchi en adultos con hipercolesterolemia e hipertrigliceridemia de 35 - 64 años, Nuevo AA.HH. Nueva Alianza, Chaclacayo, Lima


    Gamarra Camacho, María; Flores Albino, Betzabé; Palacios Morales, Félix


    Objetivo: Determinar el efecto hipolipemiante del aceite de Sacha Inchi (Plukenetia volúbilis linneo) administrado en personas con hipercolesterolemia e hipertrigliceridemía de 35 a 64 años en el AA. HH. Nueva Alianza - Chaclacayo. Material y métodos: Estudio de diseño preexperimental, de corte longitudinal prospectivo y de alcance explicativo. El grupo de participantes se conformó de 30 personas, en quienes se determinaron los valores sanguíneos de colesterol total (CT), colesterol (LDL), co...

  15. The Sinorhizobium (Ensifer) fredii HH103 Nodulation Outer Protein NopI Is a Determinant for Efficient Nodulation of Soybean and Cowpea Plants. (United States)

    Jiménez-Guerrero, Irene; Pérez-Montaño, Francisco; Medina, Carlos; Ollero, Francisco Javier; López-Baena, Francisco Javier


    The type III secretion system (T3SS) is a specialized secretion apparatus that is commonly used by many plant and animal pathogenic bacteria to deliver proteins, termed effectors, to the interior of the host cells. These effectors suppress host defenses and interfere with signal transduction pathways to promote infection. Some rhizobial strains possess a functional T3SS, which is involved in the suppression of host defense responses, host range determination, and symbiotic efficiency. The analysis of the genome of the broad-host-range rhizobial strain Sinorhizobium fredii HH103 identified eight genes that code for putative T3SS effectors. Three of these effectors, NopL, NopP, and NopI, are Rhizobium specific. In this work, we demonstrate that NopI, whose amino acid sequence shows a certain similarity with NopP, is secreted through the S. fredii HH103 T3SS in response to flavonoids. We also determined that NopL can be considered an effector since it is directly secreted to the interior of the host cell as demonstrated by adenylate cyclase assays. Finally, the symbiotic phenotype of single, double, and triple nopI, nopL, and nopP mutants in soybean and cowpea was assayed, showing that NopI plays an important role in determining the number of nodules formed in both legumes and that the absence of both NopL and NopP is highly detrimental for symbiosis.IMPORTANCE The paper is focused on three Rhizobium-specific T3SS effectors of Sinorhizobium fredii HH103, NopL, NopP, and NopI. We demonstrate that S. fredii HH103 is able to secrete through the T3SS in response to flavonoids the nodulation outer protein NopI. Additionally, we determined that NopL can be considered an effector since it is secreted to the interior of the host cell as demonstrated by adenylate cyclase assays. Finally, nodulation assays of soybean and cowpea indicated that NopI is important for the determination of the number of nodules formed and that the absence of both NopL and NopP negatively affected

  16. Study of the physics potential of the FCC-hh machine to measure the coupling of the Higgs boson to b quarks

    CERN Document Server

    Rodríguez, Arturo


    The FCC project as well as the Pythia + Delphes analysis within the FCC software are introduced. The ROOT analysis carried out to reconstruct main observables, such the invariant mass of the bb system, transverse mass and momentum of the W boson together with the lepton pT and distribution is explained. The resulting reconstructed invariant mass of the bb system showed a peak near the 125 GeV in correspondence with the Higgs boson. Future steps towards estimating the physics potential of the FCC-hh machine in this channel are discussed.

  17. C-H and H-H bond activation via ligand dearomatization/rearomatization of a PN³P-rhodium(I) complex. (United States)

    Wang, Yuan; Zheng, Bin; Pan, Yupeng; Pan, Chengling; He, Lipeng; Huang, Kuo-Wei


    A neutral complex PN(3)P-Rh(I)Cl (2) was prepared from a reaction of the PN(3)P pincer ligand (1) with [Rh(COD)Cl]2 (COD = 1,5-cyclooctadiene). Upon treatment with a suitable base, H-H and C(sp(2))-H activation reactions can be achieved through the deprotonation/reprotonation of one of the N-H arms and dearomatization/rearomatization of the central pyridine ring with the oxidation state of Rh remaining I.

  18. Searches for Higgs boson pair production in the $hh\\to bb\\tau\\tau, \\gamma\\gamma WW*, \\gamma\\gamma bb, bbbb$ channels with the ATLAS detector

    CERN Document Server

    Aad, Georges; Abdallah, Jalal; Abdinov, Ovsat; Aben, Rosemarie; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Agricola, Johannes; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Alimonti, Gianluca; Alio, Lion; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Baca, Matthew John; Bacci, Cesare; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bain, Travis; Baines, John; Baker, Oliver Keith; Baldin, Evgenii; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Balunas, William Keaton; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James Baker; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Kathrin; Becker, Maurice; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Bernard, Clare; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertsche, Carolyn; Bertsche, David; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bevan, Adrian John; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Biedermann, Dustin; Bieniek, Stephen Paul; Biesuz, Nicolo Vladi; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet


    Searches for both resonant and non-resonant Higgs boson pair production are performed in the $hh\\to bb\\tau\\tau, \\gamma\\gamma WW^*$ final states using 20.3 fb$^{-1}$ of $pp$ collision data at a center-of-mass energy of 8 TeV recorded with the ATLAS detector at the Large Hadron Collider. No evidence of their production is observed and 95% confidence level upper limits on the production cross sections are set. These results are then combined with the published results of the $hh\\to \\gamma\\gamma bb, bbbb$ analyses. An upper limit of 0.69 (0.47) pb on the non-resonant Standard Model like $hh$ production is observed (expected), corresponding to 70 (48) times of the SM $gg\\to hh$ cross section. For production via narrow resonances, cross section limits of $hh$ production from a heavy Higgs boson decay are set as a function of the heavy Higgs boson mass. The observed (expected) limits range from 2.1 (1.1) pb at 260 GeV to 0.011 (0.018) pb at 1000 GeV. These results are interpreted in the context of two simplified sce...

  19. PdBI sub-arcsecond study of the SiO microjet in HH212 - Origin and collimation of Class 0 jets

    CERN Document Server

    Cabrit, S; Gueth, F; Nisini, B; Gusdorf, A; Dougados, C; Bacciotti, F


    The bipolar HH 212 outflow has been mapped in SiO using the extended configuration of the Plateau de Bure Interferometer (PdBI), revealing a highly collimated SiO jet closely associated with the H2 jet component. We study at unprecedented resolution (0.34" across the jet axis) the properties of the innermost SiO ``microjet'' within 1000 AU of this young Class 0 source, to compare it with atomic microjets from more evolved sources and to constrain its origin. The SiO channel maps are used to investigate the microjet collimation and velocity structure. A large velocity gradient analysis is applied to SiO (2-1), (5-4) and (8-7) data from the PdBI and the Submillimeter Array to constrain the SiO opacity and abundance. The HH212 Class 0 microjet shows striking similarities in collimation and energetic budget with atomic microjets from T Tauri sources. Furthermore, the SiO lines appear optically thick, unlike what is generally assumed. We infer T(kin) ~ 50-500 K and an SiO/H2 abundance greater than 4 10(-8)-6 10(-5...

  20. Biomechanics of the chick embryonic heart outflow tract at HH18 using 4D optical coherence tomography imaging and computational modeling.

    Directory of Open Access Journals (Sweden)

    Aiping Liu

    Full Text Available During developmental stages, biomechanical stimuli on cardiac cells modulate genetic programs, and deviations from normal stimuli can lead to cardiac defects. Therefore, it is important to characterize normal cardiac biomechanical stimuli during early developmental stages. Using the chicken embryo model of cardiac development, we focused on characterizing biomechanical stimuli on the Hamburger-Hamilton (HH 18 chick cardiac outflow tract (OFT, the distal portion of the heart from which a large portion of defects observed in humans originate. To characterize biomechanical stimuli in the OFT, we used a combination of in vivo optical coherence tomography (OCT imaging, physiological measurements and computational fluid dynamics (CFD modeling. We found that, at HH18, the proximal portion of the OFT wall undergoes larger circumferential strains than its distal portion, while the distal portion of the OFT wall undergoes larger wall stresses. Maximal wall shear stresses were generally found on the surface of endocardial cushions, which are protrusions of extracellular matrix onto the OFT lumen that later during development give rise to cardiac septa and valves. The non-uniform spatial and temporal distributions of stresses and strains in the OFT walls provide biomechanical cues to cardiac cells that likely aid in the extensive differential growth and remodeling patterns observed during normal development.

  1. Observations and measurements of dynamic effects due to beam-beam interactions in the LHC and extrapolation to the FCC-hh

    CERN Document Server

    Goncalves Jorge, Patrik

    The Future Circular hadron-hadron Collider (FCC-hh) is a design study for a 100 TeV centre-of-mass energy. The dynamics of the beams in such a collider poses many challenges, in particular the amount of energy stored in each beam (8.4 GJ) makes them very destructive and therefore requires a tight control of the machine and beam parameters during the full cycle in order to avoid damages and reach the collider designed performances. The FCC-hh features an increase of the beam brightness during the cycle due to the presence of synchrotron radiation damping at high energy. As a result, the electromagnetic forces that the two beams exert on each other, the so-called beam-beam forces, are enhanced and might become an issue for the safe operation of the machine. In this new regime, the impact of the beam-beam interaction on the optics becomes non-negligible. In this master thesis, for the first time, the impact of the beam-beam interaction on the optics ($\\beta$-beating) is measured in a hadron collider (LHC). The e...

  2. Immunoproteasome LMP2 60HH variant alters MBP epitope generation and reduces the risk to develop multiple sclerosis in Italian female population.

    Directory of Open Access Journals (Sweden)

    Michele Mishto

    Full Text Available BACKGROUND: Albeit several studies pointed out the pivotal role that CD4+T cells have in Multiple Sclerosis, the CD8+ T cells involvement in the pathology is still in its early phases of investigation. Proteasome degradation is the key step in the production of MHC class I-restricted epitopes and therefore its activity could be an important element in the activation and regulation of autoreactive CD8+ T cells in Multiple Sclerosis. METHODOLOGY/PRINCIPAL FINDINGS: Immunoproteasomes and PA28-alphabeta regulator are present in MS affected brain area and accumulated in plaques. They are expressed in cell types supposed to be involved in MS development such as neurons, endothelial cells, oligodendrocytes, macrophages/macroglia and lymphocytes. Furthermore, in a genetic study on 1262 Italian MS cases and 845 controls we observed that HLA-A*02+ female subjects carrying the immunoproteasome LMP2 codon 60HH variant have a reduced risk to develop MS. Accordingly, immunoproteasomes carrying the LMP2 60H allele produce in vitro a lower amount of the HLA-A*0201 restricted immunodominant epitope MBP(111-119. CONCLUSION/SIGNIFICANCE: The immunoproteasome LMP2 60HH variant reduces the risk to develop MS amongst Italian HLA-A*02+ females. We propose that such an effect is mediated by the altered proteasome-dependent production of a specific MBP epitope presented on the MHC class I. Our observations thereby support the hypothesis of an involvement of immunoproteasome in the MS pathogenesis.

  3. Ability of innate defence regulator peptides IDR-1002, IDR-HH2 and IDR-1018 to protect against Mycobacterium tuberculosis infections in animal models.

    Directory of Open Access Journals (Sweden)

    Bruno Rivas-Santiago

    Full Text Available Tuberculosis is an ongoing threat to global health, especially with the emergence of multi drug-resistant (MDR and extremely drug-resistant strains that are motivating the search for new treatment strategies. One potential strategy is immunotherapy using Innate Defence Regulator (IDR peptides that selectively modulate innate immunity, enhancing chemokine induction and cell recruitment while suppressing potentially harmful inflammatory responses. IDR peptides possess only modest antimicrobial activity but have profound immunomodulatory functions that appear to be influential in resolving animal model infections. The IDR peptides HH2, 1018 and 1002 were tested for their activity against two M. tuberculosis strains, one drug-sensitive and the other MDR in both in vitro and in vivo models. All peptides showed no cytotoxic activity and only modest direct antimicrobial activity versus M. tuberculosis (MIC of 15-30 µg/ml. Nevertheless peptides HH2 and 1018 reduced bacillary loads in animal models with both the virulent drug susceptible H37Rv strain and an MDR isolate and, especially 1018 led to a considerable reduction in lung inflammation as revealed by decreased pneumonia. These results indicate that IDR peptides have potential as a novel immunotherapy against TB.

  4. Searching Heavier Higgs Boson via $H \\to hh \\to WW^*\\gamma\\gamma$ at LHC Run-2

    CERN Document Server

    Lü, Lan-Chun; Fang, Yaquan; He, Hong-Jian; Zhang, Huijun


    The LHC discovery of a light Higgs particle $h^0$ (125GeV) opens up new prospect for searching heavier Higgs boson(s) at the LHC Run-2, which will unambiguously point to new physics beyond the standard model (SM). We study the detection of a heavier neutral Higgs boson $H^0$ via di-Higgs production channel at the LHC (14TeV), $H^0 \\to h^0h^0 \\to WW^*\\gamma\\gamma$. This directly probes the $Hhh$ cubic Higgs interaction, which exists in most extensions of the SM Higgs sector. For the decay products of final states $WW^*$, we include both pure leptonic mode $WW^* \\to \\ell\\bar{\

  5. Microcalorimetric Studies on Gene Promoter Function of Cloned DNA Fragements from Halobacterium halobium J7 Plasmid pHH205 in Escherichia coli TG1

    Institute of Scientific and Technical Information of China (English)

    LEI,Ke-Lin; HOU,Han-Na; LIU,Yi; YE,Xue-Cheng; SHEN,Ping


    Halobacterium halobium is a typical kind of extremely halophilic bacterium. Combined with the antibiotic resistance assay, the microcalorimetric method was used to study the promoter function of the cloned DNA fragments from Halobacterium halobium J7 plasmid pHH205 in Escherichia coli TG1. The promoter probe vector, plasmid pKK232-8, was used to form the recombinants. The DNA fragment, which is the promoter for the chloramphenicol acetyl transferase (CAT) gene in plasmid pKK232-8, is about 800 bp, and the chloramphenicol resistance level presented by IC50 is about 200 μg·mL-1, which suggests a high promoter activity. The conclusions show that there probably exist double-function or trinary-function gene promoters in Halobacterium halobium, and Archaea may contain rich genetic resources.

  6. Product spin-orbit state resolved dynamics of the H+H2O and H+D2O abstraction reactions. (United States)

    Brouard, M; Burak, I; Marinakis, S; Rubio Lago, L; Tampkins, P; Vallance, C


    The product state-resolved dynamics of the reactions H+H(2)O/D(2)O-->OH/OD((2)Pi(Omega);v',N',f )+H(2)/HD have been explored at center-of-mass collision energies around 1.2, 1.4, and 2.5 eV. The experiments employ pulsed laser photolysis coupled with polarized Doppler-resolved laser induced fluorescence detection of the OH/OD radical products. The populations in the OH spin-orbit states at a collision energy of 1.2 eV have been determined for the H+H(2)O reaction, and for low rotational levels they are shown to deviate from the statistical limit. For the H+D(2)O reaction at the highest collision energy studied the OD((2)Pi(3/2),v'=0,N'=1,A') angular distributions show scattering over a wide range of angles with a preference towards the forward direction. The kinetic energy release distributions obtained at 2.5 eV also indicate that the HD coproducts are born with significantly more internal excitation than at 1.4 eV. The OD((2)Pi(3/2),v'=0,N'=1,A') angular and kinetic energy release distributions are almost identical to those of their spin-orbit excited OD((2)Pi(1/2),v'=0,N'=1,A') counterpart. The data are compared with previous experimental measurements at similar collision energies, and with the results of previously published quasiclassical trajectory and quantum mechanical calculations employing the most recently developed potential energy surface. Product OH/OD spin-orbit effects in the reaction are discussed with reference to simple models.

  7. Transcriptional Regulation and Adaptation to a High-Fiber Environment in Bacillus subtilis HH2 Isolated from Feces of the Giant Panda (United States)

    Zhou, Ziyao; Zhou, Xiaoxiao; Li, Jin; Zhong, Zhijun; Li, Wei; Liu, Xuehan; Liu, Furui; Su, Huaiyi; Luo, Yongjiu; Gu, Wuyang; Wang, Chengdong; Zhang, Hemin; Li, Desheng; He, Tingmei; Fu, Hualin; Cao, Suizhong; Shi, Jinjiang; Peng, Guangneng


    In the giant panda, adaptation to a high-fiber environment is a first step for the adequate functioning of intestinal bacteria, as the high cellulose content of the gut due to the panda's vegetarian appetite results in a harsh environment. As an excellent producer of several enzymes and vitamins, Bacillus subtilis imparts various advantages to animals. In our previous study, we determined that several strains of B. subtilis isolated from pandas exhibited good cellulose decomposition ability, and we hypothesized that this bacterial species can survive in and adapt well to a high-fiber environment. To evaluate this hypothesis, we employed RNA-Seq technology to analyze the differentially expressed genes of the selected strain B. subtilis HH2, which demonstrates significant cellulose hydrolysis of different carbon sources (cellulose and glucose). In addition, we used bioinformatics software and resources to analyze the functions and pathways of differentially expressed genes. Interestingly, comparison of the cellulose and glucose groups revealed that the up-regulated genes were involved in amino acid and lipid metabolism or transmembrane transport, both of which are involved in cellulose utilization. Conversely, the down-regulated genes were involved in non-essential functions for bacterial life, such as toxin and bacteriocin secretion, possibly to conserve energy for environmental adaptation. The results indicate that B. subtilis HH2 triggered a series of adaptive mechanisms at the transcriptional level, which suggests that this bacterium could act as a probiotic for pandas fed a high-fiber diet, despite the fact that cellulose is not a very suitable carbon source for this bacterial species. In this study, we present a model to understand the dynamic organization of and interactions between various functional and regulatory networks for unicellular organisms in a high-fiber environment. PMID:25658435

  8. Transcriptional regulation and adaptation to a high-fiber environment in Bacillus subtilis HH2 isolated from feces of the giant panda.

    Directory of Open Access Journals (Sweden)

    Ziyao Zhou

    Full Text Available In the giant panda, adaptation to a high-fiber environment is a first step for the adequate functioning of intestinal bacteria, as the high cellulose content of the gut due to the panda's vegetarian appetite results in a harsh environment. As an excellent producer of several enzymes and vitamins, Bacillus subtilis imparts various advantages to animals. In our previous study, we determined that several strains of B. subtilis isolated from pandas exhibited good cellulose decomposition ability, and we hypothesized that this bacterial species can survive in and adapt well to a high-fiber environment. To evaluate this hypothesis, we employed RNA-Seq technology to analyze the differentially expressed genes of the selected strain B. subtilis HH2, which demonstrates significant cellulose hydrolysis of different carbon sources (cellulose and glucose. In addition, we used bioinformatics software and resources to analyze the functions and pathways of differentially expressed genes. Interestingly, comparison of the cellulose and glucose groups revealed that the up-regulated genes were involved in amino acid and lipid metabolism or transmembrane transport, both of which are involved in cellulose utilization. Conversely, the down-regulated genes were involved in non-essential functions for bacterial life, such as toxin and bacteriocin secretion, possibly to conserve energy for environmental adaptation. The results indicate that B. subtilis HH2 triggered a series of adaptive mechanisms at the transcriptional level, which suggests that this bacterium could act as a probiotic for pandas fed a high-fiber diet, despite the fact that cellulose is not a very suitable carbon source for this bacterial species. In this study, we present a model to understand the dynamic organization of and interactions between various functional and regulatory networks for unicellular organisms in a high-fiber environment.

  9. Transcriptional regulation and adaptation to a high-fiber environment in Bacillus subtilis HH2 isolated from feces of the giant panda. (United States)

    Zhou, Ziyao; Zhou, Xiaoxiao; Li, Jin; Zhong, Zhijun; Li, Wei; Liu, Xuehan; Liu, Furui; Su, Huaiyi; Luo, Yongjiu; Gu, Wuyang; Wang, Chengdong; Zhang, Hemin; Li, Desheng; He, Tingmei; Fu, Hualin; Cao, Suizhong; Shi, Jinjiang; Peng, Guangneng


    In the giant panda, adaptation to a high-fiber environment is a first step for the adequate functioning of intestinal bacteria, as the high cellulose content of the gut due to the panda's vegetarian appetite results in a harsh environment. As an excellent producer of several enzymes and vitamins, Bacillus subtilis imparts various advantages to animals. In our previous study, we determined that several strains of B. subtilis isolated from pandas exhibited good cellulose decomposition ability, and we hypothesized that this bacterial species can survive in and adapt well to a high-fiber environment. To evaluate this hypothesis, we employed RNA-Seq technology to analyze the differentially expressed genes of the selected strain B. subtilis HH2, which demonstrates significant cellulose hydrolysis of different carbon sources (cellulose and glucose). In addition, we used bioinformatics software and resources to analyze the functions and pathways of differentially expressed genes. Interestingly, comparison of the cellulose and glucose groups revealed that the up-regulated genes were involved in amino acid and lipid metabolism or transmembrane transport, both of which are involved in cellulose utilization. Conversely, the down-regulated genes were involved in non-essential functions for bacterial life, such as toxin and bacteriocin secretion, possibly to conserve energy for environmental adaptation. The results indicate that B. subtilis HH2 triggered a series of adaptive mechanisms at the transcriptional level, which suggests that this bacterium could act as a probiotic for pandas fed a high-fiber diet, despite the fact that cellulose is not a very suitable carbon source for this bacterial species. In this study, we present a model to understand the dynamic organization of and interactions between various functional and regulatory networks for unicellular organisms in a high-fiber environment.

  10. Effective inhibition of melanoma tumorigenesis and growth via a new complex vaccine based on NY-ESO-1-alum-polysaccharide-HH2 (United States)


    Background A safe and effective adjuvant plays an important role in the development of a vaccine. However, adjuvants licensed for administration in humans remain limited. Here, for the first time, we developed a novel combination adjuvant alum-polysaccharide-HH2 (APH) with potent immunomodulating activities, consisting of alum, polysaccharide of Escherichia coli and the synthetic cationic innate defense regulator peptide HH2. Methods The adjuvant effects of APH were examined using NY-ESO-1 protein-based vaccines in prophylactic and therapeutic models. We further determined the immunogenicity and anti-tumor effect of NY-ESO-1-APH (NAPH) vaccine using adoptive cellular/serum therapy in C57/B6 and nude mice. Cell-mediated and antibody-mediated immune responses were evaluated. Results The APH complex significantly promoted antigen uptake, maturation and cross-presentation of dendritic cells and enhanced the secretion of TNF-α, MCP-1 and IFN-γ by human peripheral blood mononuclear cells compared with individual components. Vaccination of NAPH resulted in significant tumor regression or delayed tumor progression in prophylactic and therapeutic models. In addition, passive serum/cellular therapy potently inhibited tumor growth of NY-ESO-1-B16. Mice treated with NAPH vaccine produced higher antibody titers and greater antibody-dependent/independent cellular cytotoxicity. Therefore, NAPH vaccination effectively stimulated innate immunity, and boosted both arms of the adaptive humoral and cellular immune responses to suppress tumorigenesis and growth of melanoma. Conclusions Our study revealed the potential application of APH complex as a novel immunomodulatory agent for vaccines against tumor refractory and growth. PMID:25070035

  11. Quality assurance for measurements of the radioactivity in the area of the"Horia Hulubei" National Institute for Physics and Nuclear Engineering, IFIN-HH. (United States)

    Stochioiu, Ana; Luca, Aurelian; Sahagia, Maria; Margineanu, Romul Mircea; Tudor, Ion


    This paper presents one part of the activities deployed by the Laboratory for Environment and Personnel Dosimetry (LDPM) of IFIN-HH, namely the radiological monitoring of the environment within the Institute's area and its surrounding influence zone, according to the program approved by the National Regulatory Body for Nuclear Activities, CNCAN. The representative reports regard the radioactive content of soil, surface and underground water, cultivated and spontaneous vegetation, aerosols and atmospheric fallout, sediments. The common requirement is that the measured quantities be precise and the reported values be reliable and credible. This goal is achieved by maintaining a Quality System, verified within the obtaining and maintaining of the laboratory accreditation, according to the international standard ISO/IEC 17025:2005.The LDPM is accredited by the Romanian accreditation body, RENAR, member of the European Accreditation, EA and is designed by CNCAN as a notified testing laboratory. Many measurements were performed in collaboration with the Radionuclide Metrology Laboratory (RML) from IFIN-HH, RENAR accredited and CNCAN notified for calibration and for testing in the field of radioactivity measurement. This paper proposes a short presentation of the important aspects in our activity: i. description of equipment, samplingmethods, processing and measurement of environmental samples; ii. validation of equipment and methods by participation in international and national proficiency tests; iii. a five year follow chart, containing the results in measurement of samples; iv. a recent application, with a wide impact in Romanian mass media: the credible daily report on the possible influence of Fukushima accident over the Romanian environmental radioactivity.

  12. The Sinorhizobium fredii HH103 MucR1 Global Regulator Is Connected With the nod Regulon and Is Required for Efficient Symbiosis With Lotus burttii and Glycine max cv. Williams. (United States)

    Acosta-Jurado, Sebastián; Alias-Villegas, Cynthia; Navarro-Gómez, Pilar; Zehner, Susanne; Murdoch, Piedad Del Socorro; Rodríguez-Carvajal, Miguel A; Soto, María J; Ollero, Francisco-Javier; Ruiz-Sainz, José E; Göttfert, Michael; Vinardell, José-María


    Sinorhizobium fredii HH103 is a rhizobial strain showing a broad host range of nodulation. In addition to the induction of bacterial nodulation genes, transition from a free-living to a symbiotic state requires complex genetic expression changes with the participation of global regulators. We have analyzed the role of the zinc-finger transcriptional regulator MucR1 from S. fredii HH103 under both free-living conditions and symbiosis with two HH103 host plants, Glycine max and Lotus burttii. Inactivation of HH103 mucR1 led to a severe decrease in exopolysaccharide (EPS) biosynthesis but enhanced production of external cyclic glucans (CG). This mutant also showed increased cell aggregation capacity as well as a drastic reduction in nitrogen-fixation capacity with G. max and L. burttii. However, in these two legumes, the number of nodules induced by the mucR1 mutant was significantly increased and decreased, respectively, with respect to the wild-type strain, indicating that MucR1 can differently affect nodulation depending on the host plant. RNA-Seq analysis carried out in the absence and the presence of flavonoids showed that MucR1 controls the expression of hundreds of genes (including some related to EPS production and CG transport), some of them being related to the nod regulon.

  13. Observations of Lambda(0)(b) -> Lambda K+pi(-) and Lambda(0)(b) -> Lambda K+K- decays and searches for other Lambda(0)(b) and Xi(0)(b) decays to Lambda h(+)h '(-) final states

    NARCIS (Netherlands)

    Aaij, R.; Beteta, C. Abelian; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrechtl, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Arnato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; d'Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baker, S.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Betti, F.; Bettler, M. -O.; van Beuzekom, M.; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borgheresi, A.; Borghi, S.; Borisyak, M.; Borsato, M.; Boubdir, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Gomez, M. Calvo; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Akiba, K. Carvalho; Casse, G.; Cassinak, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chatzikonstantinidis, G.; Chefdeville, M.; Cheung, S. -F.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogonif, V.; Cojocariu, L.; Collazuor, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Ruscio, F.; Dordei, F.; Dorigo, M.; Suarez, A. Dosil; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Faerber, C.; Farley, N.; Farry, S.; Fay, R.; Fazzini, D.; Ferguson, D.; Albor, V. Fernandez; Ferrari, F.; Rodrigues, F. Ferreira; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuretb, F.; Fohl, K.; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Frei, C.; Frosini, M.; Furfaro, E.; Torreira, A. Gallas; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Pardinas, J. Garcia; Tico, J. Garra; Garrido, L.; Garsed, P. J.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Giani, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gornes, A.; Gotti, C.; Gandara, M. Grabalosa; Diaz, R. Graciani; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; Morata, J. A. Hernando; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hongming, L.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanjik, B.; Khurewathanaku, C.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Kolpin, M.; Komarov, I.; Koppenburg, P.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Cid, E. Lemos; Leroy, O.; Lesiak, T.; Leverington, B.; Likhomanenko, T.; Lindner, R.; Linn, C.; Lionetto, F.; Loh, D.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Martinez, M. Lucio; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Lusardi, N.; Lusiani, A.; Lyu, X.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, K.; Malde, S.; Malinin, A.; Manca, G.; Mancinelli, G.; Manning, P.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Benito, C. Marin; Marinot, P.; Marks, J.; Martellotti, G.; Martinelli, M.; Santos, D. Martinez; Vidal, F. Martinez; Tostes, D. Martins; Massacrier, L. M.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; Meadows, B.; Meierl, F.; Melnychuk, D.; Merk, M.; Merli, A.; Michielin, E.; Milanes, D. A.; Minard, M. -N.; Mitzel, D. S.; Rodriguez, J. Molina; Monroy, I. A.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. B.; Mountain, R.; Muheim, F.; Mueller, J.; Mueller, K.; Mueller, V.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen-Mau, C.; Niess, V.; Nieswand, S.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, C. J. G.; Rodrigues, B. Osorio; Goicochea, J. M. Otalora; Otto, A.; Owen, P.; Oyanguren, A.; Palano, A.; Palornbo, F.; Palutan, M.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Pappenheimer, C.; Parker, W.; Parkes, C.; Passaleva, G.; Pate, G. D.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Pensom, G.; Altarelli, M. Pepe; Perazzinie, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petruzzo, M.; Olloqui, E. Picatoste; Pietrzyk, B.; Pikies, M.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Casasus, M. Plo; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rama, M.; Pernas, M. Ramos; Rangel, M. S.; Raniuk, I.; Raven, G.; Redi, F.; Reichert, S.; dos Reis, A. C.; Renaudin, V.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Molina, V. Rives; Rodrigues, A. B.; Rodrigues, E.; Lopez, J. A. Rodriguez; Perez, P. Rodriguez; Rogozhnikov, A.; Roiser, S.; Romanovsky, V.; Vidal, A. Romero; Ronayne, J. W.; Rotondo, M.; Ruf, T.; Valls, P. Ruiz; Silva, J. J. Saborido; Sagidova, N.; Saitta, B.; Guimaraes, V. Salustino; Mayordomo, C. Sanchez; Sedes, B. Sanmartin; Santacesaria, R.; Rios, C. Santamarina; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schael, S.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubbam, A.; Semennikov, A.; Sergi, A.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapovalg, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Siddi, B. G.; Coutinho, R. Silva; de Oliveira, L. Silva; Simi, G.; Sirendi, M.; Skidrnore, N.; Skwarnicki, T.; Smith, I. T.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; De Paula, B. Souza; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Stefkova, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szumlak, T.; T'Jampens, S.; Tayduganov, A.; Tekampe, T.; Tellarini, G.; Teubert, F.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Traill, M.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valat, S.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Regueiro, P. Vazquez; Sierra, C. Vazquez; Vecchi, S.; van Veghel, M.; Velthuis, J. J.; Veltril, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Diaz, M. Vieites; Vilasis-Cardona, X.; Volkov, V.; Vollhardt, A.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Waldi, R.; Wallace, C.; Wallace, R.; Ward, D. R.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Williams, T.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wraight, K.; Wright, S.; Wyllie, K.; Xie, Y.; Yang, Z.; Yu, J.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhelezov, A.; Zheng, Y.; Zhokhov, A.; Zhong, L.; Zhukov, V.; Zucchelli, S.


    A search is performed for the charmless three-body decays of the Lambda(0)(b) and Xi(0)(b) baryons to the final states Lambda h(+)h'(-), where h(') = pi or K. The analysis is based on a data sample, corresponding to an integrated luminosity of 3 fb-1 of pp collisions, collected by the LHCb

  14. Observations of Lambda(0)(b) -> Lambda K+pi(-) and Lambda(0)(b) -> Lambda K+K- decays and searches for other Lambda(0)(b) and Xi(0)(b) decays to Lambda h(+)h '(-) final states

    NARCIS (Netherlands)

    Aaij, R.; Beteta, C. Abelian; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrechtl, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Arnato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; d'Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baker, S.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Betti, F.; Bettler, M. -O.; van Beuzekom, M.; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borgheresi, A.; Borghi, S.; Borisyak, M.; Borsato, M.; Boubdir, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Gomez, M. Calvo; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Akiba, K. Carvalho; Casse, G.; Cassinak, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chatzikonstantinidis, G.; Chefdeville, M.; Cheung, S. -F.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogonif, V.; Cojocariu, L.; Collazuor, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Ruscio, F.; Dordei, F.; Dorigo, M.; Suarez, A. Dosil; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Faerber, C.; Farley, N.; Farry, S.; Fay, R.; Fazzini, D.; Ferguson, D.; Albor, V. Fernandez; Ferrari, F.; Rodrigues, F. Ferreira; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuretb, F.; Fohl, K.; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Frei, C.; Frosini, M.; Furfaro, E.; Torreira, A. Gallas; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Pardinas, J. Garcia; Tico, J. Garra; Garrido, L.; Garsed, P. J.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Giani, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gornes, A.; Gotti, C.; Gandara, M. Grabalosa; Diaz, R. Graciani; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; Morata, J. A. Hernando; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hongming, L.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanjik, B.; Khurewathanaku, C.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Kolpin, M.; Komarov, I.; Koppenburg, P.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.


    A search is performed for the charmless three-body decays of the Lambda(0)(b) and Xi(0)(b) baryons to the final states Lambda h(+)h'(-), where h(') = pi or K. The analysis is based on a data sample, corresponding to an integrated luminosity of 3 fb-1 of pp collisions, collected by the LHCb experimen

  15. Reticulate evolutionary history of a complex group of grasses: phylogeny of Elymus StStHH allotetraploids based on three nuclear genes.

    Directory of Open Access Journals (Sweden)

    Roberta J Mason-Gamer

    Full Text Available BACKGROUND: Elymus (Poaceae is a large genus of polyploid species in the wheat tribe Triticeae. It is polyphyletic, exhibiting many distinct allopolyploid genome combinations, and its history might be further complicated by introgression and lineage sorting. We focus on a subset of Elymus species with a tetraploid genome complement derived from Pseudoroegneria (genome St and Hordeum (H. We confirm the species' allopolyploidy, identify possible genome donors, and pinpoint instances of apparent introgression or incomplete lineage sorting. METHODOLOGY/PRINCIPAL FINDINGS: We sequenced portions of three unlinked nuclear genes-phosphoenolpyruvate carboxylase, beta-amylase, and granule-bound starch synthase I-from 27 individuals, representing 14 Eurasian and North American StStHHElymus species. Elymus sequences were combined with existing data from monogenomic representatives of the tribe, and gene trees were estimated separately for each data set using maximum likelihood. Trees were examined for evidence of allopolyploidy and additional reticulate patterns. All trees confirm the StStHH genome configuration of the Elymus species. They suggest that the StStHH group originated in North America, and do not support separate North American and European origins. Our results point to North American Pseudoroegneria and Hordeum species as potential genome donors to Elymus. Diploid P. spicata is a prospective St-genome donor, though conflict among trees involving P. spicata and the Eurasian P. strigosa suggests either introgression of GBSSI sequences from P. strigosa into North American Elymus and Pseudoroegneria, or incomplete lineage sorting of ancestral GBSSI polymorphism. Diploid H. californicum and/or allotetraploid H. jubatum are possible H-genome donors; direct involvement of an allotetraploid Hordeum species would simultaneously introduce two distinct H genomes to Elymus, consistent with some of the relationships among H-genome sequences in Hordeum and

  16. A study of H+H2 and several H-bonded molecules by phaseless auxiliary-field quantum Monte Carlo with plane wave and Gaussian basis sets. (United States)

    Al-Saidi, W A; Krakauer, Henry; Zhang, Shiwei


    The authors present phaseless auxiliary-field (AF) quantum Monte Carlo (QMC) calculations of the ground states of some hydrogen-bonded systems. These systems were selected to test and benchmark different aspects of the new phaseless AF QMC method. They include the transition state of H+H(2) near the equilibrium geometry and in the van der Walls limit, as well as the H(2)O, OH, and H(2)O(2) molecules. Most of these systems present significant challenges for traditional independent-particle electronic structure approaches, and many also have exact results available. The phaseless AF QMC method is used either with a plane wave basis with pseudopotentials or with all-electron Gaussian basis sets. For some systems, calculations are done with both to compare and characterize the performance of AF QMC under different basis sets and different Hubbard-Stratonovich decompositions. Excellent results are obtained using as input single Slater determinant wave functions taken from independent-particle calculations. Comparisons of the Gaussian based AF QMC results with exact full configuration interaction show that the errors from controlling the phase problem with the phaseless approximation are small. At the large basis-size limit, the AF QMC results using both types of basis sets are in good agreement with each other and with experimental values.

  17. Comportamiento de las aleaciones termorresistentes AISI HH y HK-40 ante los procesos de carburización y nitruración

    Directory of Open Access Journals (Sweden)

    Eleno Alfonso-Brindis


    Full Text Available Se evalúa el comportamiento de los aceros austeníticos fundidos AISI HH y HK- 40 (de producción nacional ante los procesos de carburización y nitruración en los rangos de temperaturas desde 750 hasta 1 000 °C. Se estudia la cinética y la termodinámica de las posibles reacciones y los productos de las mismas se caracterizan mediante técnicas de Microscopía Óptica, Microscopía Electrónica de Barrido y Microanálisis (MEB-EDAX. En el análisis microscópico se observó la formación de carburos de cromo después de la carburización, mientras que la nitruración dio lugar a la formación de nitruros de cromo. Se concluye que la aleación AISI HK-40 posee una elevada resistencia intrínseca a la carburización y a la nitruración, que hace factible su empleo en componentes de hornos de soleras múltiples para la reducción de minerales lateríticos

  18. ${\\cal{KK}}\\text{MC-hh}$: Resummed Exact ${\\cal O}(\\alpha^2L)$ EW Corrections in a Hadronic MC Event Generator

    CERN Document Server

    Jadach, S; Was, Z A; Yost, S A


    We present an improvement of the MC event generator Herwiri2, where we recall the latter MC was a prototype for the inclusion of CEEX resummed EW corrections in hadron-hadron scattering at high cms energies. In this improvement the new exact ${\\cal O}(\\alpha^2L)$ resummed EW generator ${\\cal{KK}}$ MC 4.22, featuring as it does the CEEX realization of resummation in the EW sector, is put in union with the Herwig parton shower environment. The {\\rm LHE} format of the attendant output event file means that all other conventional parton shower environments are available to the would-be user of the resulting new MC. For this reason (and others -- see the text) we henceforth refer to the new improvement of the Herwiri2 MC as ${\\cal{KK}}\\text{MC-hh}$. Since this new MC features exact ${\\cal O}(\\alpha)$ pure weak corrections from the DIZET EW library and features the CEEX and the EEX YFS-style resummation of large multiple photon effects, it provides already the concrete path to 0.05\\% precision on such effects if we...

  19. Geometric phase effects in the H+H2 reaction: quantum wave-packet calculations of integral and differential cross sections. (United States)

    Juanes-Marcos, Juan Carlos; Althorpe, Stuart C


    We report quantum wave-packet calculations on the H+H(2) reaction, aimed at resolving the controversy over whether geometric phase (GP) effects can be observed in this reaction. Two sets of calculations are reported of the state-to-state reaction probabilities, and integral and differential cross sections (ICSs and DCSs). One set includes the GP using the vector potential approach of Mead and Truhlar; the other set neglects the phase. We obtain unequivocal agreement with recent results of Kendrick [J. Phys. Chem. A 107, 6739 (2003)], predicting GP effects in the state-to-state reaction probabilities, which cancel exactly on summing the partial waves to yield the ICS. Our results therefore contradict those of Kuppermann and Wu [Chem. Phys. Lett. 349 537 (2001)], which predicted pronounced GP effects in the cross sections. We also agree with Kendrick in predicting that there are no significant GP effects in the full DCS at energies below 1.8 eV, and in the partial (0

  20. Do nonbonded H--H interactions in phenanthrene stabilize it relative to anthracene? A possible resolution to this question and its implications for ligands such as 2,2'-bipyridyl. (United States)

    Hancock, Robert D; Nikolayenko, Igor V


    The problem of whether interactions between the hydrogen atoms at the 1,10-positions in the "cleft" of the "bent" phenanthrene stabilize the latter molecule thermodynamically relative to "linear" anthracene, or whether the higher stability of phenanthrene is due to a more energetically favorable π-system, is considered. DFT calculations at the X3LYP/cc-pVTZ(-f)++ level of the ground state energies (E) of anthracene, phenanthrene, and the set of five benzoquinolines are reported. In the gas phase, "bent" phenanthrene was computed to be thermodynamically more stable than "linear" anthracene by -28.5 kJ mol(-1). This fact was attributed predominantly to the phenomenon of higher aromatic stabilization of the π-system of phenanthrene relative to anthracene, and not to the stabilizing influence of the nonbonding H--H interactions in its cleft. In fact, these interactions in phenanthrene were shown to be destabilizing. Similar calculations for five benzoquinolines (bzq) indicate that ΔE values vary as: 6,7-bzq (linear) ≤ 2,3-bzq (linear) < 5,6-bzq (bent) ≤ 3,4-bzq (bent) < 7,8-bzq (bent, no H--H nonbonding interactions in cleft), supporting the idea that it is a more stable π-system that favors 7,8-bzq over 2,3-bzq and 6,7-bzq, and that the H--H interactions in the clefts of 3,4-bzq and 5,6-bzq are destabilizing. Intramolecular hydrogen bonding in the cleft of 7,8-bzq plays a secondary role in its stabilization relative 6,7-bzq. The question of whether H--H nonbonded interactions between H atoms at the 3 and 3' positions of 2,2'-bipyridyl (bpy) coordinated to metal ions are stabilizing or destabilizing is then considered. The energy of bpy is scanned as a function of N-C-C-N torsion angle (χ) in the gas-phase, and it is found that the trans form is 32.8 kJ mol(-1) more stable than the cis conformer. A relaxed coordinate scan of energy of bpy in aqueous solution as a function of χ is modeled using the PBF approach, and it is found that the trans conformer is

  1. Transition metal complexes with thiosemicarbazide-based ligands. Part 60. Reactions of copper(II bromide with pyridoxal S-methylisothiosemicarbazone (PLITSC. Crystal structure of [Cu(PLITSC−HH2O]Br•H2O

    Directory of Open Access Journals (Sweden)

    Leovac Vukadin M.


    Full Text Available The synthesis and structural characterization of a square-planar copper(II complex with pyridoxal S-methylisothiosemicarbazone (PLITSC of the formula [Cu(PLITSC−HH2O]Br•H2O (1 as the first Cu(II complex with monoanionic form of this ligand were described. Complex 1 together with two previously synthesized complexes [Cu(PLITSCBr2] (2 and [Cu(PLITSCBr(MeOH]Br (3 were characterized by elemental analysis, IR and electronic spectra and also by the methods of thermal analysis, conductometry and magnetochemistry. [Projekat Pokrajisnkog sekretarijata za nauku i tehnoloski razvoj Vojvodine i Ministarstva nauke Republike Srbije, br. 172014

  2. Synthesis, biological evaluation, and computational studies of Tri- and tetracyclic nitrogen-bridgehead compounds as potent dual-acting AChE inhibitors and hH3 receptor antagonists. (United States)

    Darras, Fouad H; Pockes, Steffen; Huang, Guozheng; Wehle, Sarah; Strasser, Andrea; Wittmann, Hans-Joachim; Nimczick, Martin; Sotriffer, Christoph A; Decker, Michael


    Combination of AChE inhibiting and histamine H3 receptor antagonizing properties in a single molecule might show synergistic effects to improve cognitive deficits in Alzheimer's disease, since both pharmacological actions are able to enhance cholinergic neurotransmission in the cortex. However, whereas AChE inhibitors prevent hydrolysis of acetylcholine also peripherally, histamine H3 antagonists will raise acetylcholine levels mostly in the brain due to predominant occurrence of the receptor in the central nervous system. In this work, we designed and synthesized two novel classes of tri- and tetracyclic nitrogen-bridgehead compounds acting as dual AChE inhibitors and histamine H3 antagonists by combining the nitrogen-bridgehead moiety of novel AChE inhibitors with a second N-basic fragment based on the piperidinylpropoxy pharmacophore with different spacer lengths. Intensive structure-activity relationships (SARs) with regard to both biological targets led to compound 41 which showed balanced affinities as hAChE inhibitor with IC50 = 33.9 nM, and hH3R antagonism with Ki = 76.2 nM with greater than 200-fold selectivity over the other histamine receptor subtypes. Molecular docking studies were performed to explain the potent AChE inhibition of the target compounds and molecular dynamics studies to explain high affinity at the hH3R.

  3. Predominance Diagrams for NH4+-Mg2+-PO3-4H+-H2O System%NH4+-Mg2+-pO3-4-H+-H2O体系的优势区相图

    Institute of Scientific and Technical Information of China (English)

    姜科; 周康根; 彭佳乐


    The thermodynamics of NH4+-Mg2+-PO43-H+-H2O system was investigated based on the construction of predominance diagrams.The lgCT,Mg-lgCT,p and lgCTP-pH diagrams were constructed at an arbitrary Mg/P molar ratio with consideration of the ion strength influence(CT.Mg: total concentration of magnesium; CT,P: total concentration of phosphorus; CT,N: total concentration of nitrogen).The thermodynamic stable zones of struvite (MgNH4PO4· 6H2O),bobierrite (Mg3(PO4)2·8H2O),newberyite (MgHPO4·3H2O),and magnesium hydroxide (Mg(OH)2) were determined.The results show that struvite and bobierrite are the dominating phases in a wide range of pH value.Struvite and newberyite coexist with solute phase at low pH value and high total concentration of phosphorus while struvite and magnesium hydroxide are more stable at the alkaline condition.The minimum total concentration of nitrogen appears at pH value of 9.08~9.52 while struvite and bobierrite coexist with the solute phase.The predominance diagrams could be used to predict the precipitation-dissolution equilibrium of struvite for ammonia nitrogen removal and recovery from wastewater.%通过优势区相图的构建对NH4+-Mg2+-PO43-H+-H2O体系的热力学平衡关系进行了研究.在不同镁、磷物质的量比和离子强度的条件下绘制了lgCT,Mg-lgC,T,P和lgCT,p-pH相图,确定了MgNH4PO4·6H2O、Mg3(PO4)2· 8H2O、MgHPO4· 3H2O和Mg(OH)2的热力学稳定区.结果表明,在相当广的pH范围内,MgNH4PO4·6H2O和Mg3(PO4)2·8H2O都是主要存在的固相;在较低pH和较高磷浓度的条件下,MgNH4PO4·6H2O和MgHPO4· 3H2O可以共存;而MgNH4PO4·6H2O和Mg(OH)2在碱性条件下更为稳定.当MgNH4PO4·6H2O、Mg3(PO4)2· 8H2O与液相共存、pH=9.08~9.52时,溶液总氮浓度达到最低值.lgCT,Mg-lgCT,P和lgCT,P-pH相图可以用于指导磷酸铵镁的沉淀-溶解平衡过程,有利于废水中氨氮的脱除和回收.

  4. Snapshots of Proton Accommodation at a Microscopic Water Surface: Understanding the Vibrational Spectral Signatures of the Charge Defect in Cryogenically Cooled H+(H2O)n=2 – 28 Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Fournier, Joseph A.; Wolke, Conrad T.; Johnson, Mark A.; Odbadrakh, Tuguldur T.; Jordan, Kenneth D.; Kathmann, Shawn M.; Xantheas, Sotiris S.


    In this Article, we review the role of gas-phase, size-selected protonated water clusters, H+(H2O)n, in the analysis of the microscopic mechanics responsible for the behavior of the excess proton in bulk water. We extend upon previous studies of the smaller, two-dimensional sheet-like structures to larger (n≥10) assemblies with three-dimensional cage morphologies which better mimic the bulk environment. Indeed, clusters in which a complete second solvation shell forms around a surface-embedded hydronium ion yield vibrational spectra where the signatures of the proton defect display strikingly similar positions and breadth to those observed in dilute acids. We investigate effects of the local structure and intermolecular interactions on the large red shifts observed in the proton vibrational signature upon cluster growth using various theoretical methods. We show that, in addition to sizeable anharmonic couplings, the position of the excess proton vibration can be traced to large increases in the electric field exerted on the embedded hydronium ion upon formation of the first and second solvation shells. MAJ acknowledges support from the U.S. Department of Energy under Grant No. DE-FG02- 06ER15800 as well as the facilities and staff of the Yale University Faculty of Arts and Sciences High Performance Computing Center, and by the National Science Foundation under Grant No. CNS 08-21132 that partially funded acquisition of the facilities. SMK and SSX acknowledge support from the US Department of Energy, Office of Science, Office of Basic Energy Sciences, Division of Chemical Sciences, Geosciences and Biosciences. Pacific Northwest National Laboratory (PNNL) is a multiprogram national laboratory operated for DOE by Battelle. This research used resources of the National Energy Research Scientific Computing Center, which is supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231.

  5. (1) H NMR Spectra. Part 28: Proton chemical shifts and couplings in three-membered rings. A ring current model for cyclopropane and a novel dihedral angle dependence for (3) J(HH) couplings involving the epoxy proton. (United States)

    Abraham, Raymond J; Leonard, Paul; Tormena, Cláudio F


    The (1) H chemical shifts of selected three-membered ring compounds in CDCl(3) solvent were obtained. This allowed the determination of the substituent chemical shifts of the substituents in the three-membered rings and the long-range effect of these rings on the distant protons. The substituent chemical shifts of common substituents in the cyclopropane ring differ considerably from the same substituents in acyclic fragments and in cyclohexane and were modelled in terms of a three-bond (γ)-effect. For long-range protons (more than three bonds removed), the substituent effects of the cyclopropane ring were analysed in terms of the cyclopropane magnetic anisotropy and steric effect. The cyclopropane magnetic anisotropy (ring current) shift was modelled by (a) a single equivalent dipole perpendicular to and at the centre of the cyclopropane ring and (b) by three identical equivalent dipoles perpendicular to the ring placed at each carbon atom. Model (b) gave a more accurate description of the (1) H chemical shifts and was the selected model. After parameterization, the overall root mean square error for the dataset of 289 entries was 0.068 ppm. The anisotropic effects are significant for the cyclopropane protons (ca 1 ppm) but decrease rapidly with distance. The heterocyclic rings of oxirane, thiirane and aziridine do not possess a ring current. (3) J(HH) couplings of the epoxy ring proton with side-chain protons were obtained and shown to be dependent on both the H-C-C-H and H-C-C-O orientations. Both density functional theory calculations and a simple Karplus-type equation gave general agreement with the observed couplings (root mean square error 0.5 Hz over a 10-Hz range).

  6. ATLAS Searches for VH and HH Resonances

    CERN Document Server

    Fisher, Wade Cameron; The ATLAS collaboration


    The discovery of a Higgs boson at the Large Hadron Collider (LHC) motivates searches for physics beyond the Standard Model (SM) in channels involving coupling to the Higgs boson. A search for a massive resonance decaying into a standard model Higgs boson (h) and a W or Z boson or two a standard model Higgs bosons is performed. Final states with different number of leptons and where the Higgs decays into a b-quark pair are studied using different jet reconstruction techniques which are complementary in their acceptance for low and high mass transverse momentum. This talk summarizes ATLAS searches for diboson resonances including at least one H bosons in the final state with LHC Run 2 data.

  7. FCC-hh turn-around cycle

    CERN Document Server

    Alemany Fernandez, Reyes; Bartmann, Wolfgang; Buffat, Xavier; Niemi, Arto; Schulte, Daniel; Solfaroli Camillocci, Matteo; Stoel, Linda


    The turn-around cycle time of a collider is defined as the time spent between the end of stable beams and the start of the next stable beams period, and its calculation is of fundamental importance. On one side it is a crucial ingredient for the computation of the optimal time spent in luminosity production, which defines the integrated luminosity per fill or store. On the other side, combined with the availability and reliability of the machine, it allows to perform a detailed breakdown of the operational performance of the collider over an operational season, i.e. percentage of time in stable beams and beam in the machine with respect to down time. This paper presents a preliminary operational cycle definition for the hadron-hadron Future Circular Collider, as a base line for estimating the corresponding turn-around time. The cycle definition is based on the Large Hadron Collider (LHC) operational cycle. Two turn-around times are presented, the theoretical one and a more realistic one based on the LHC exper...

  8. Search and prospects for HH production

    CERN Document Server

    Cadamuro, Luca


    The study of Higgs boson pair production at the LHC gives unique insight into the electroweak symmetry breaking mechanism. Both the resonant and non-resonant production modes need to be explored to search for extensions of the scalar sector and to probe the shape of scalar potential itself. The ATLAS and CMS Collaborations have searched for Higgs boson pair production in proton-proton collisions at $\\sqrt{s} = 8\\,\\text{TeV}$ and $13\\,\\text{TeV}$, and the results of these searches as well as the prospects for future measurements are discussed here.

  9. Study of HH production at CMS

    CERN Document Server

    Oliveira, Alexandra


    The production of the pairs of higgs bosons provides a direct handle on the structure of the Higgs field potential.While the di-higgs bosons production within the SM is very small and essentially out of the experimental reach within the Run I or II, several beyond SM theories foresee an enhancement that can be already probed with the available data. First searches for an inclusively produced heavy resonance that decays in pairs of higgs bosons within BSM theories, made using data collected during Run I by the CMS collaboration, are presented.

  10. What if $\\lambda_{hhh}\

    CERN Document Server

    Efrati, Aielet


    A measurement of the Higgs trilinear self coupling $\\lambda_{hhh}$ will test the Standard Model Higgs potential. But can it reveal information that cannot be learned otherwise? By analyzing several simple extensions of the Standard Model scalar sector we show that this measurement might give a first hint for New Physics modifying the electroweak symmetry breaking. Combining the measurements of $\\lambda_{hhh}$ and $\\lambda_{hVV}$ ($V=W,Z$) is particularly powerful in distinguishing between various models of New Physics and in providing unique information on these models.

  11. 宫颈鳞癌演进过程P16INK4a及Hh-Gli信号通路相关蛋白表达及其相关性研究%Involvement of P16INK4a and Sonic Hedgehog Signaling Pathways in Squamous Cell Carcinoma of Uterine Cervix and Its Precursor Lesions

    Institute of Scientific and Technical Information of China (English)

    苗劲蔚; 张永清; 徐春玉; 房纯; 邓小虹


    To investigate the expression and the relationship of P16INK4a and sonic hedgehog signal pathway in cervical squamous cell carcinoma and its precursor lesions. The expression of P16INK4a, Smo, Ptch and Gli in different HPV types positive cell lines were detected by Western-blot. A tissue microarray constructed with 20 normal cervical tissues and 100 uterine cervical cancers and related lesions (28 squamous cell carcinomas, 26 cervical intraepithelial neoplasia (CIN) Ⅲ, 16 CIN Ⅱ , 12 CIN Ⅰ , 18 tumor-adjacent tissue specimens) was immunohistochemically analyzed with anti- P16INK4a, Shh, Patched (Ptch), Smoothened (Smo), Gli antibodies. The correlation between their expressions was analyzed. There was no significant difference among different HPV type cell lines regarding the expression of P16INK4a and Shh, Ptch and Gli proteins(P > 0.05). The expression of P16INK4a and the Hh-signaling molecules was greatly enhanced in cervical carcinoma tissues, compared with that in normal epithelium and tumor-adjacent tissues (P 0.05), whereas, in case of P16INK4a, Shh, Smo, and Gli, the differences among CIN Ⅰ , CIN Ⅱ and CIN Ⅲ were significant (P < 0.05). The expression of P16INK4a protein was significantly correlated with that of Shh, Smo and Gli protein in CIN Ⅱ -CIN Ⅲ and cervical carcinoma and was correlated with that of Shh, Smo only in carcinoma tissue. P16INK4a and the Hh-Gli signaling pathways were extensively activated in the development and evolution of cervical cancer, and the overexpression of P16INK4a was correlated with Hh-signaling pathways. The abnormal Hh-signaling pathways maybe much associated with Smo protein overexpression induced by Shh, which can upregulate the expression of Gli protein.%探讨P16INK4a及Sonic hedgehog (Hh-Gli)信号通路蛋白在宫颈癌及癌前病变(CIN)中的表达相关性及其意义.采用Western-blot方法检测HPV16阳性及HPV18阳性宫颈癌细胞系P16INK4a及Hh-Gli信号通路蛋白Smo、Ptch及Gli表达.

  12. 具有优良传导性能杂多酸复合物{[Co(H2O)8][H(H2O)3](HINO)4(PW12O40)}n的合成,结构和性质研究%A Good Proton-conductive Polyoxometalate Complex {[Co(H2O)8][H(H2O)3(HINO)4(PW12O40)}n: Synthesis,Crystal Structure and Properties

    Institute of Scientific and Technical Information of China (English)

    段显英; 郭利兵; 王建莉


    One organic/inorganic hybrid complex{[Co(H2O)8][H(H2O)3(HINO)4(PW12O40)] was constructed by a self-assembly of H+(H2O)3 clusters, [Co(H2O)8]:+ clusters, [PW12O40]3- anions and isonicotinic acid N-oxide (HINO). It was characterized by X-ray diffraction analysis, elemental analysis, IR, TG, UV, XRD, proton conductivity analysis. In the synthetic procedure of title complex, a mixture of result heteropolyacid cobalt salts CoHPW12O40nH2O (90 mg, 0.03 mmol) and HINO (17 mg, 0.12 mmol) was dissolved in enough acetonitrile/water (1 :1, VIV) to form a homogeneous solution. Finally, the solution was filtered and the solvent left to evaporate at room temperature. A week later, light red crystals appeared and were collected and dried in air after quickly being washed with water. Single-crystal X-ray diffraction analysis at 293 K showed that complex 1 crystallizes in orthorhombic crystal system, Pnnm, and there was exactly a three-dimensional (3D) hydrogen-bonded network with large one-dimensional (ID) channels, in which [PW12O40]3- anions just filled in the ID channels and self-assembled into poly-Keggin-anion chains. The result of the UV spectra indicates that the saturated aqueous concentration of 1 is ca. 10 5 mol/L and it is insoluble in water. Thermogravimetric analysis shows no weight loss in the temperature range of 20~100℃, indicating that all water molecules in the structure are not easily lost below 100 ℃. The powder X-ray diffraction data exhibits that although crystallized water molecules are lost at 200 ℃, the evacuated complex has the same structure as the single-crystal of 1. Moreover, the powder sample after the proton-conductive measurement has the same supramoiecular framework as that of complex 1. Interestingly, the title complex was characterized by a satisfactory ionic conductivity (1 × 10-3~2× 10-3 S·cm-1) in the temperature range of 85 to 100 ℃ only. The mechanism of proton conduction of the title complex is, expected to be similar to that of

  13. Data of evolutionary structure change: 1CG8A-2DN1B [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available equence>FSGFE-----ACNEQ ure> ----- HH> B 2DN1B FGDLSTPDAVMGNPK re>G HHHH HH...ence>VNLQA-FTPVT >HH - HHH> 2DN1 B 2DN1B HHFGKEFTPPV ...>HHHGGG HHH> ATOM 1931 CA HIS B 116 17.758 39.

  14. FcγRIIA受体131位点多态性与肺炎易感性关系的荟萃分析%FcγRIIA H/H131 genotype is associated with pneumonia:a meta-analysis

    Institute of Scientific and Technical Information of China (English)

    王敏; 吴晓东; 吴婷; 苏欣; 施毅


    Objective To investigate the association between FcγRIIA H/H131 genotype and pneumonia through a comprehensive meta‐analysis .Methods Databases including PubMed ,Embase ,and China National Knowledge Infrastructure (CNKI) were searched with such terms as “FcgammaRIIa” ,“FCGR2A” ,“Fcgamma receptor IIA” ,“CD32” and“pneumonia” ,“polymorphism” ,“variant” ,“genotype” ,“allotype” ,as well as“pneumonia”and“polymorphism”in Chinese to identify relevant studies .Two reviewers independently extracted the data .Crude odds ratios (ORs) and corresponding 95%confidence intervals (CIs) were estimated .Heterogeneity across studies and publication bias were evaluated and sensitivity analyses were performed .Results Six case‐control studies were finally included in this analysis .The results indicated an association between FcγRIIA H/H131 genotype and pneumonia susceptibility (OR 1 .67 , 95% CI 1 .11‐2 .51 ) , but no significant association with R/R genotype(OR 1 .09 ,95% CI 0 .85‐1 .40) or H/R genotype(OR 0 .81 ,95% CI 0 .60‐1 .19) . Statistically significant heterogeneity was found during data pooling (I2 was 75 .4 % ,51 .8% and 71 .9% ) .Sensitivity analyses further indicated the reliability of the study .Egger′s and Begg′s tests identified publication bias in R/R genotype ,but not in H/H or H/R genotype .Conclusions We preliminarily find an association between FcγRIIA H/H131 genotype and pneumonia susceptibility .%目的:综合评价 FcγRIIA 受体131位点多态性与肺炎易感性的关系。方法以“FcgammaRIIa”、“FCGR2A”、“Fcgamma receptor IIA”、“CD32”、“pneumonia”、“polymorphism”、“variant”、“genotype”、“allotype”、“肺炎”、“多态性”为检索词检索PubMed数据库、Embase数据库和中国学术期刊全文数据库,根据标准纳入相关文献,检验各组Hardy‐Weinberg遗传平衡定律,评估各项研究结果的异质性及发表偏

  15. Organización del mercado de generación de electricidad colombiano. Una aplicación de los índices de diversificación tecnológica y de concentración H-H y C-4, 1995-2004

    Directory of Open Access Journals (Sweden)

    Gustavo Castillo


    Full Text Available El objetivo de este artículo es analizar la evolución de la concentración del mercado de generación de electricidad colombiano, con base en los índices de diversificación tecnológica y de concentración H-H y C-4, en el período 1995-2004. Se entiende la concentración como un comportamiento empresarial que, desde la perspectiva del regulador, puede atentar contra los resultados de eficiencia esperados con la reforma de las reglas de juego para la industria. Del análisis se concluye, por un lado, que los niveles de concentración han disminuido en el período de estudio, pasando de oligopolio fuerte a moderado; sin embargo, por el otro, al agrupar las empresas por vínculos empresariales los índices se elevan. Curiosamente, las empresas generadoras que apuntalan los índices son aquellas con diversificación tecnológica alta.

  16. Retraction RETRACTION of "Methylation of the RASSFIA promoter in breast cancer" by Y. Ji, H.H. Jin, M.D. Wang, W.X. Cao, J.L. Bao - Genet. Mol. Res. 15 (2): gmr.15028261 (2016) - DOI: 10.4238/gmr.15028261. (United States)

    Ji, Y; Jin, H H; Wang, M D; Cao, W X; Bao, J L


    The retracted article is: Ji Y, Jin HH, Wang MD, Cao WX, et al. (2016). Methylation of the RASSFIA promoter in breast cancer. Genet. Mol. Res. 15: gmr.15028261. There are significant parts of this article (particularly, in the discussion section) that are copied from "Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome", by Jia Xu, Priya B Shetty, Weiwei Feng, Carol Chenault, Robert C Bast Jr, Jean-Pierre J Issa, Susan G Hilsenbeck and Yinhua Yu, published in BMC Cancer 2012; 12: 243. DOI: 10.1186/1471-2407-12-243. The first paragraphs of both discussions are identical. This is concerning. The abstract and introduction sections have much of their text plagiarized. Overall, there is high plagiarism detected. The GMR editorial staff was alerted and after a thorough investigation, we have strong reason to believe that the peer review process was failure and, after review and contacting the authors, the editors of Genetics and Molecular Research decided to retract the article in accordance with the recommendations of the Committee on Publication Ethics (COPE). The authors and their institutions were advised of this serious breach of ethics.

  17. Organización del mercado de generación de electricidad colombiano.: Una aplicación de los índices de diversificación tecnológica y de concentración H-H y C-4, 1995-2004

    Directory of Open Access Journals (Sweden)

    David Tobón Orozco


    Full Text Available El objetivo de este artículo es analizar la evolución de la concentración del mercado de generación de electricidad colombiano, con base en los índices de diversificación tecnológica y de concentración H-H y C-4, en el período 1995-2004. Se entiende la concentración como un comportamiento empresarial que, desde la perspectiva del regulador, puede atentar contra los resultados de eficiencia esperados con la reforma de las reglas de juego para la industria. Del análisis se concluye, por un lado, que los niveles de concentración han disminuido en el periodo de estudio, pasando de oligopolio fuerte a moderado; sin embargo, por el otro, al agrupar las empresas por vínculos empresariales los índices se elevan. Curiosamente, las empresas generadoras que apuntalan los índices son aquellas con diversificación tecnológica alta.

  18. Data of evolutionary structure change: 1CTJA-351CA [Confc[Archive

    Lifescience Database Archive (English)


  19. 40 CFR Appendix: Table 1 to... - List of Hazardous Air Pollutants (HAP) for Subpart HHH (United States)


    ...) for Subpart HHH Table Appendix: Table 1 to Subpart HHH of Part 63 Protection of Environment... Natural Gas Transmission and Storage Facilities Pt. 63, Subpt. HHH, Table 1 Appendix: Table 1 to Subpart HHH of Part 63—List of Hazardous Air Pollutants (HAP) for Subpart HHH CAS Number a Chemical name...

  20. hhh Coupling in SUSY models after LHC run I

    CERN Document Server

    Wu, Lei; Yuan, Chien-Peng; Zhang, Mengchao


    We examine the Higgs triple coupling in MSSM and NMSSM under current constraints, which include the LHC measurements, Higgs data, B physics, electroweak precision observables, relic density and so on. The ratio $\\lambda^{\\rm MSSM}_{hhh}/\\lambda^{\\rm SM}_{hhh}$ is above 0.97, due to the highly constrained parameter space. While the ratio $\\lambda^{\\rm NMSSM}_{hhh}/\\lambda^{\\rm SM}_{hhh}$ can reach 0.1 under current constraints. The precise measurement in future collider will give a tighter constraint to the Higgs triple coupling in MSSM and NMSSM.

  1. Searches for HH production by the ATLAS collaboration

    CERN Document Server

    Sun, Xiaohu; The ATLAS collaboration


    An enhanced production of two Higgs bosons would be a clear sign of beyond Standard Model physics. Searches are performed for resonant and non-resonant excess production in several final states. In this presentation the latest ATLAS results on these searches will be discussed.

  2. Autocrine and Paracrine Hh Signaling Regulate Prostate Development (United States)


    and Placzek, M. (2006) Nat. Rev. Genet. 7, 841–850 13. Callahan, C. A., Ofstad, T., Horng, L.,Wang, J. K., Zhen, H. H., Coulombe , P. A., and Oro, A. E...Albig, A. R., and Schiemann, W. P. (2005)Mol. Biol. Cell 16, 609–625 45. Olsen, M. W., Ley , C. D., Junker, N., Hansen, A. J., Lund, E. L., and Krist

  3. Advance on dynamic aperture at injection for FCC-hh

    CERN Document Server

    Dalena, Barbara; Chance, Antoine


    In the Hadron machine option, proposed in the context of the Future Circular Colliders (FCC) study, the first evaluation of dipole field quality, based on the Nb$_{3}$Sn technology, has shown a Dynamic Aperture at injection above the LHC target value. In this paper the effect of field imperfections on the dynamic aperture, using the updated lattice design, is presented. Tolerances on the main multipole components are evaluated including feed-down effect.

  4. 40 CFR Appendix to Subpart Hh of... - Tables (United States)


    ... Ethylene glycol 50000 Formaldehyde 110543 n-Hexane 91203 Naphthalene 108883 Toluene 540841 2,2,4... Emission Standards for Hazardous Air Pollutants From Oil and Natural Gas Production Facilities Pt. 63...

  5. SAR Aircrew--HH-3F Avionics and HH-3F Flight Preparation. ACH3AV-0442. Second Edition, Revised. (United States)

    Coast Guard Inst., Oklahoma City, OK.

    This document contains two U.S. Coast Guard self-study pamphlets that provide training in helicopter flight preparation and avionics duties. Each pamphlet consists of a number of lessons that include objectives, information illustrated with line drawings and/or photographs, and self-quizzes with answers. The avionics course covers the following…

  6. The Expression of Key Molecules (Shh/Ptch/Gli-1) in Hh Signaling Pathway in Oral Squamous Cell Carcinoma and Its Clinical Significance%口腔鳞状细胞癌中Hh通路关键分子Shh/Ptch/Gli-1的表达及临床意义

    Institute of Scientific and Technical Information of China (English)

    王俊菊; 李多杰; 王晓敏; 刘艳平; 张凯


    [目的]探讨Hh通路关键分子Shh、Ptch、Gli-1在口腔鳞状细胞癌中的表达及意义.[方法]采用免疫组织化学方法分别检测40例口腔鳞状细胞癌组织和30例口腔黏膜正常组织中Shh、Ptch、Gli-1的表达.[结果]Shh、Ptch、Gli-1在30例正常口腔黏膜中均无表达,在口腔鳞状细胞癌中,Shh、Ptch、Gli-1阳性率分别为62.5%、60.0%和65.0%.Shh、Gli-1的阳性表达与肿瘤大小、淋巴结转移、临床分期相关(P<0.05),Ptch表达与淋巴结转移相关(P<0.05).Spearman等级相关分析显示Shh、Ptch和Gli-1的表达间均存在正相关(rs=0.527、0.406、0.578,P<0.01).[结论]Shh、Ptch、Gli-1蛋白在口腔鳞状细胞癌组织中均过表达,三者可能通过配体依赖途径被激活并参与口腔鳞癌的发生发展、转移.%[Purpose] To investigate the expression of key molecules (Shh/Ptch/Gli-1) in Hh signaling pathway in oral squamous cell carcinoma (OSCC) and its clinical significance.[Methods] The expression of Shh/Ptch/Gli-1 in 40 tissue samples with OSCC and 30 tissue samples with normal oral mucosa was detected by immunochemistry. [Results] There was no expression of Shh/Ptch/Glil in normal oral mucosa tissue samples. The positive rate of Shh,Ptch and Gli-1 in oral squamous cell carcinoma was 62.5%,60.0% and 65.0% respectively. The expression of Shh and Gli-1 was related to the tumor size,lymph node metastasis and clinical stage (P<0.05) ,and the expression of Ptch was related to lymph node metastasis (P<0.05). A positive correlation was found among the expression of Shh,Ptch and Gli-1 (rs=0.527,0.406,0.578,P<0.05). [Conclusion] Shh,Ptch and Gli-1 are over expression in OSCC. They may activated through ligand-de-pendent pathway and participated the carcinogenesis, progression and metastasis of OSCC.

  7. 40 CFR Table 2 to Subpart Hhh of... - Toxic Equivalency Factors (United States)


    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Toxic Equivalency Factors 2 Table 2 to Subpart HHH of Part 62 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS..., Subpt. HHH, Table 2 Table 2 to Subpart HHH of Part 62—Toxic Equivalency Factors Dioxin/furan...

  8. Tests of Higgs boson compositeness through the HHH form factor

    CERN Document Server

    Gounaris, G J


    We show how the $q^2$-dependence of the triple Higgs boson HHH form factor can reveal the presence of various types of new physics contributions, like new particles coupled to the Higgs boson or Higgs boson constituents, without directly observing them. We compare the effect of such new contributions to the one of higher order SM corrections to the point-like HHH coupling, due to triangle, 4-leg and s.e. diagrams. We establish simple analytic expressions describing accurately at high energy these SM corrections, as well as the examples of new physics contributions.

  9. 40 CFR Appendix: Table 2 to... - Applicability of 40 CFR Part 63 General Provisions to Subpart HHH (United States)


    ... HHH of Part 63—Applicability of 40 CFR Part 63 General Provisions to Subpart HHH General provisions... 40 Protection of Environment 11 2010-07-01 2010-07-01 true Applicability of 40 CFR Part 63 General Provisions to Subpart HHH Table Appendix: Table 2 to Subpart HHH of Part 63 Protection of...

  10. [Molecular genetic studies of mitochondrial ornithine transporter deficiency (HHH syndrome)]. (United States)

    Tsujino, S; Miyamoto, T; Kanazawa, N


    Mitochondrial ornithine transporter deficiency has been called HHH syndrome, because this disorder is characterized by three biochemical abnormalities; hyperornithinemia, hyperammonemia, and homocitrullinuria, and presents with various neurological symptoms; mental retardation, spastic paraparesis with pyramidal signs, cerebellar ataxia and episodic disturbance of consciousness or coma due to hyperammonemia. We identified four mutations in the mitochondrial ornithine transporter gene (ORNT1) of Japanese patients with HHH syndrome. These include a nonsense mutation (R179X), associated with exon skipping, missense mutations (G27E, P126R), and an insertion of AAC between codons 228 and 229, leading to an insertion of amino acid Asn. Especially, R179X was detected 4 of 7 Japanese patients (8 of 14 alleles), implying that this is a common mutation in Japanese population.

  11. Data of evolutionary structure change: 1BINA-2OIFE [Confc[Archive

    Lifescience Database Archive (English)


  12. 40 CFR Appendix A to Subpart Hhh... - Exempted Aquifers in New Mexico (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Exempted Aquifers in New Mexico A Appendix A to Subpart HHH of Part 147 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Appendix A to Subpart HHH of Part 147—Exempted Aquifers in New Mexico The areas described by a...

  13. 40 CFR Table 1 to Subpart Hhh of... - Emission Limits for Small Rural, Small, Medium, and Large HMIWI (United States)


    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission Limits for Small Rural, Small, Medium, and Large HMIWI 1 Table 1 to Subpart HHH of Part 62 Protection of Environment ENVIRONMENTAL... Incinerators Constructed on or Before June 20, 1996 Pt. 62, Subpt. HHH, Table 1 Table 1 to Subpart HHH of...

  14. Methanopyrus kandleri topoisomerase V contains three distinct AP lyase active sites in addition to the topoisomerase active site. (United States)

    Rajan, Rakhi; Osterman, Amy; Mondragón, Alfonso


    Topoisomerase V (Topo-V) is the only topoisomerase with both topoisomerase and DNA repair activities. The topoisomerase activity is conferred by a small alpha-helical domain, whereas the AP lyase activity is found in a region formed by 12 tandem helix-hairpin-helix ((HhH)2) domains. Although it was known that Topo-V has multiple repair sites, only one had been mapped. Here, we show that Topo-V has three AP lyase sites. The atomic structure and Small Angle X-ray Scattering studies of a 97 kDa fragment spanning the topoisomerase and 10 (HhH)2 domains reveal that the (HhH)2 domains extend away from the topoisomerase domain. A combination of biochemical and structural observations allow the mapping of the second repair site to the junction of the 9th and 10th (HhH)2 domains. The second site is structurally similar to the first one and to the sites found in other AP lyases. The 3rd AP lyase site is located in the 12th (HhH)2 domain. The results show that Topo-V is an unusual protein: it is the only known protein with more than one (HhH)2 domain, the only known topoisomerase with dual activities and is also unique by having three AP lyase repair sites in the same polypeptide.

  15. The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition. (United States)

    Wienk, Hans; Slootweg, Jack C; Speerstra, Sietske; Kaptein, Robert; Boelens, Rolf; Folkers, Gert E


    To maintain the integrity of the genome, multiple DNA repair systems exist to repair damaged DNA. Recognition of altered DNA, including bulky adducts, pyrimidine dimers and interstrand crosslinks (ICL), partially depends on proteins containing helix-hairpin-helix (HhH) domains. To understand how ICL is specifically recognized by the Fanconi anemia proteins FANCM and FAAP24, we determined the structure of the HhH domain of FAAP24. Although it resembles other HhH domains, the FAAP24 domain contains a canonical hairpin motif followed by distorted motif. The HhH domain can bind various DNA substrates; using nuclear magnetic resonance titration experiments, we demonstrate that the canonical HhH motif is required for double-stranded DNA (dsDNA) binding, whereas the unstructured N-terminus can interact with single-stranded DNA. Both DNA binding surfaces are used for binding to ICL-like single/double-strand junction-containing DNA substrates. A structural model for FAAP24 bound to dsDNA has been made based on homology with the translesion polymerase iota. Site-directed mutagenesis, sequence conservation and charge distribution support the dsDNA-binding model. Analogous to other HhH domain-containing proteins, we suggest that multiple FAAP24 regions together contribute to binding to single/double-strand junction, which could contribute to specificity in ICL DNA recognition.

  16. Data of evolutionary structure change: 1EDEA-2PSEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available in>A 1EDEA ERLDL-RNITL ...>HH - EEEe> ATOM 903 CA GLU A 111 31.387 ...ntryIDChain>2PSEA ELLNLPKKIIF EEcture...pdbChain>A 1EDEA PKMVA---QRDQA ucture...>HHH --- HH> ATOM 1790 CA PRO A 223 24.488 106.682 33.117 1

  17. Data of evolutionary structure change: 1JJIA-3H1BA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available hain> 3H1BA WLLDQ----GFKPQ ...>HHH ---- > ATOM 942 CA TRP A 127 -20.677 16.86...Chain>1JJIA WVAENAEELRIDPS ture>HHHH HHHH ...3H1BA LNGAD-AKHPY >H - HH...ure> GGGGG HH> ATOM 1801 CA PHE A 223

  18. Abnormal urinary excretion of polyamines in HHH syndrome (hyperornithinemia associated with hyperammonemia and homocitrullinuria). (United States)

    Shimizu, H; Maekawa, K; Eto, Y


    The HHH syndrome (hyperornithinemia associated with hyperammonemia and homocitrullinuria) is characterized by a very rare genetic defect of ornithine transport in mitochondrial membrane. We first demonstrated that a patient with HHH syndrome excreted about 6 times higher amount of polyamines in urine than the control when supplemented with high protein diets and ornithine loading. Each urinary polyamine fraction measured by HPLC method in HHH syndrome appears to be increased, as compared with those of the control. These data suggest that increased urinary excretion of polyamines in this syndrome is closely related to overflowing of plasma polyamine due to an ornithine transport defect in the mitochondrial membrane.

  19. Diagnosis and high incidence of hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome in northern Saskatchewan. (United States)

    Sokoro, AbdulRazaq A H; Lepage, Joyce; Antonishyn, Nick; McDonald, Ryan; Rockman-Greenberg, Cheryl; Irvine, James; Lehotay, Denis C


    Mutations in the SLC25A15 gene, encoding the human inner mitochondrial membrane ornithine transporter, are thought to be responsible for hyperornithinemia-hyperammonemia-homocitrullinemia (HHH) syndrome, a rare autosomal recessive condition. HHH syndrome has been detected in several small, isolated communities in northern Saskatchewan (SK). To determine the incidence of HHH syndrome in these communities, a PCR method was set up to detect F188Δ, the common French-Canadian mutation. Neonatal blood spots collected from all newborns from the high risk area were genotyped for the F188Δ mutation for seven consecutive years. Using DNA analysis, we estimated that the heterozygote frequency for the mutant allele for HHH syndrome to be about 1 in 19 individuals, predicting one affected child with HHH syndrome for approximately every 1,500 individuals (1 in 1,550 live births; 1 child every 12 years) in this isolated population. The frequency for the mutant allele for HHH syndrome in this isolated community is probably the highest in the world for this rare disorder. We determined that ornithine levels, by tandem mass spectrometry, were not abnormal in newborns with F188Δ mutation, carriers and normals. Ornithine rises to abnormally high levels at some time after birth well past the time that the newborn screening blood spot is collected. The timing or the reasons for the delayed rise of ornithine in affected children with HHH syndrome have not been determined. Newborn screening for HHH Syndrome in this high risk population is only possible by detection of the mutant allele using DNA analysis.

  20. Characterization of the Radiation Field in the FCC-hh Detector

    CERN Document Server

    Besana, Maria Ilaria; Ferrari, Alfredo; Riegler, Werner; Vlachoudis, Vasilis


    As part of the post-LHC high-energy program, a study is ongoing to design a new 100 km long hadron collider, which is expected to operate at a centre-of-mass energy of 100 TeV and to accumulate up to 30 ab−1, with a peak instantaneous luminosity that could reach 30 1034cm−2s−1. In this context, the evaluation of the radiation load on the detector is a key step for the choice of materials and technologies. In this contribution, a first detector concept will be presented. At the same time, fluence distributions, relevant for detector occupancy, and accumulated damage on materials and electronics will be shown. The effectiveness of a possible shielding configuration, intended to minimise the background in the muon chambers and tracking stations, will be presented.

  1. Measurement of time-integrated $D^0\\to hh$ asymmetries at LHCb

    CERN Document Server

    Marino, Pietro


    LHCb collected the world’s largest sample of charm decays during LHC Run I, corresponding to an integrated luminosity of 3fb$^{−1}$. This has permitted many precision measurements of charm mixing and CP violation parameters. One of the most precise and important observables is the so-called $\\Delta A_{CP}$ parameter, corresponding to the difference between the time-integrated CP asymmetry in singly Cabibbo-suppressed $D^{0} \\rightarrow K^{+}K^{-}$ and $D^{0} \\rightarrow \\pi^{+}\\pi{-}$ decay modes. The flavour of the $D^{0}$ meson is inferred from the charge of the pion in $D^{∗+} \\rightarrow D^{0}\\pi^{+}$ and $D^{∗−} \\rightarrow \\overline{D}^{0}\\pi^{-}$ decays. $\\Delta A_{CP} \\equiv A_{raw}(K^{+}K^{−})−A_{raw}(\\pi^{+}\\pi{−})$ is measured to be $\\Delta A_{CP}=(−0.10±0.08±0.03)$%, where the first uncertainty is statistical and the second systematic. The measurement is consistent with the no- CP -violation hypothesis and represents the most precise measurement of time-integrated CP asymmetry ...

  2. Hh and Wnt signaling regulate formation of olig2+ neurons in the zebrafish cerebellum. (United States)

    McFarland, Karen A; Topczewska, Jolanta M; Weidinger, Gilbert; Dorsky, Richard I; Appel, Bruce


    The cerebellum, which forms from anterior hindbrain, coordinates motor movements and balance. Sensory input from the periphery is relayed and modulated by cerebellar interneurons, which are organized in layers. The mechanisms that specify the different neurons of the cerebellum and direct its layered organization remain poorly understood. Drawing from investigations of spinal cord, we hypothesized that the embryonic cerebellum is patterned on the dorsoventral axis by opposing morphogens. We tested this using zebrafish. Here we show that expression of olig2, which encodes a bHLH transcription factor, marks a distinct subset of neurons with similarities to eurydendroid neurons, the principal efferent neurons of the teleost cerebellum. In combination with other markers, olig2 reveals a dorsoventral organization of cerebellar neurons in embryos. Disruption of Hedgehog signaling, which patterns the ventral neural tube, produced a two-fold increase in the number of olig2(+) neurons. By contrast, olig2(+) neurons did not develop in embryos deficient for Wnt signaling, which patterns dorsal neural tube, nor did they develop in embryos deficient for both Hedgehog and Wnt signaling. Our data indicate that Hedgehog and Wnt work in opposition across the dorsoventral axis of the cerebellum to regulate formation of olig2(+) neurons. Specifically, we propose that Hedgehog limits the range of Wnt signaling, which is necessary for olig2(+) neuron development.

  3. C-H and H-H Activation in Transition Metal Complexes and on Surfaces. (United States)


    Jane Jorgensen and Elisabeth Fields, and the typing by Eleanor Stolz. The permanent address of Jean-Yves Saillard is at the Laboratoire de...Soc. 1980, 102, 981-986. (s) Brookhart, M.; Lamanna, W.; Humphrey, M. B. J. Am. Chem. Soc. 1982, 104, 2117-2126. (t) Schultz, A. J.; Teller , R. G

  4. ATLAS Searches for VH, HH, VV, V+gamma/gammagamma Resonances

    CERN Document Server

    Biesuz, Nicolo Vladi; The ATLAS collaboration


    The discovery of a Higgs boson at the Large Hadron Collider (LHC) motivates searches for physics beyond the Standard Model (SM) in channels involving coupling to the Higgs boson. A search for a massive resonance decaying into a standard model Higgs boson (h) and a W or Z boson or two a standard model Higgs bosons is performed. Final states with different number of leptons or photons and where in many cases at least one Higgs decays into a b-quark pair are studied using different jet reconstruction techniques which are complementary in their acceptance for low and high mass transverse momentum. This talk summarizes ATLAS searches for diboson resonances including at least one h boson in the final state and searches for resonant and non-resonant di-Higgs production with LHC Run 2 data.

  5. Activation of Hh Signaling: A Critical Biological Consequence of ETS Gene Anomalies in Prostate Cancer (United States)


    Dev Biol 2009, 329:96-103. 46. Von Hoff DD, LoRusso PM, Rudin CM, Reddy JC, Yauch RL, Tibes R, Weiss GJ, Borad MJ, Hann CL, Brahmer JR, et al...and orally active hedgehog pathway antagonist (IPI-926). J Med Chem. 2009; 52(14):4400–4418. [PubMed: 19522463] 87. Von Hoff DD, LoRusso PM, Rudin CM... Rudin CM, Reddy JC, et al. Phase I trial of hedgehog pathway inhibitor GDC-0449 in patients with refractory, locally-advanced or metastatic solid

  6. HOME COST Pct Mortgaged Units by Costs as Pct 1999 HH Income NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  7. HOME COST All Owner Occ Units by Costs as Pct 1999 HH Income NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  8. First Evaluation of Dynamic Aperture at Injection for FCC-hh

    CERN Document Server

    Dalena, Barbara; Chancé, Antoine; Holzer, Bernhard; Martin, Roman; Payet, Jacques; Schulte, Daniel


    In the hadron machine option, proposed in the context of the Future Circular Colliders (FCC) study, the dipole field quality is expected to play an important role, as in the LHC. A preliminary evaluation of the field quality of dipoles, based on the Nb3Sn technology, has been provided by the magnet group. The effect of these field imperfections on the dynamic aperture, using the present lattice design, is presented and first tolerances on the main multipole components are evaluated.

  9. Relaxation of nonthermal hh and lh excitons in ZnSe quantum wells

    DEFF Research Database (Denmark)

    Kalt, H.; Hoffmann, J.; Umlauff, M.


    The strong exciton-LO phonon coupling in ZnSe QWs gives a direct access to the relaxation dynamics of nonthermal, free heavy-hole and light-hole excitons. Narrow hot-exciton distributions can be generated by LO-phonon assisted exciton formation. The thermalization of these excitons is monitored...


    Energy Technology Data Exchange (ETDEWEB)

    Raga, A. C.; Esquivel, A. [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, Ap. 70-543, 04510 D.F., México (Mexico); Reipurth, B. [Institute for Astronomy, University of Hawaii at Manoa, Hilo, HI 96720 (United States); Bally, J., E-mail: [Center for Astrophysics and Space Astronomy, University of Colorado, UCB 389, Boulder, CO 80309 (United States)


    We present an analysis of four epochs of Hα and [S ii] λλ 6716/6731 Hubble Space Telescope (HST) images of HH 1. For determining proper motions, we explore a new method based on the analysis of spatially degraded images obtained convolving the images with wavelet functions of chosen widths. With this procedure, we are able to generate maps of proper motion velocities along and across the outflow axis, as well as (angularly integrated) proper motion velocity distributions. From the four available epochs, we find the time evolution of the velocities, intensities, and spatial distribution of the line emission. We find that over the last two decades HH 1 shows a clear acceleration. Also, the Hα and [S ii] intensities first dropped and then recovered in the more recent (2014) images. Finally, we show a comparison between the two available HST epochs of [O iii] λ 5007 (1994 and 2014), in which we see a clear drop in the value of the [O iii]/Hα ratio.

  11. Avionics system design for requirements for the United States Coast Guard HH-65A Dolphin (United States)

    Young, D. A.


    Aerospatiale Helicopter Corporation (AHC) was awarded a contract by the United States Coast Guard for a new Short Range Recovery (SRR) Helicopter on 14 June 1979. The award was based upon an overall evaluation of performance, cost, and technical suitability. In this last respect, the SRR helicopter was required to meet a wide variety of mission needs for which the integrated avionics system has a high importance. This paper illustrates the rationale for the avionics system requirements, the system architecture, its capabilities and reliability and its adaptability to a wide variety of military and commercial purposes.

  12. IFIN-HH ionization chamber calibration and its validation; electrometric system improvement. (United States)

    Sahagia, M; Wätjen, A C; Luca, A; Ivan, C


    The paper presents the results obtained in the calibration of the CENTRONIC IG12/20A ionization chamber for 18 gamma ray emitters, and its improvement with a Keithley 6517A electrometer. The calibration figures were determined either directly in pA MBq(-1) units, or calculated from old units, by using the system capacity value. The calibration figures, determined with RML's standards, are compared with those deduced from the KCRV or the mean of the comparisons, and the values determined at PTB-Germany.

  13. Resolving the shocked gas in HH54 with Herschel

    DEFF Research Database (Denmark)

    Bjerkeli, P.; Liseau, R.; Brinch, C.


    Context. The HH 54 shock is a Herbig-Haro object, located in the nearby Chamaeleon II cloud. Observed CO line profiles are due to a complex distribution in density, temperature, velocity, and geometry. Aims. Resolving the HH 54 shock wave in the far-infrared (FIR) cooling lines of CO constrain...... the kinematics, morphology, and physical conditions of the shocked region. Methods. We used the PACS and SPIRE instruments on board the Herschel space observatory to map the full FIR spectrum in a region covering the HH 54 shock wave. Complementary Herschel-HIFI, APEX, and Spitzer data are used in the analysis...... dynamics. The coherent displacement with increasing J for CO is consistent with a scenario where IRAS12500 – 7658 is the exciting source of the flow, and the 180 K bow-shock is accompanied by a hot (800 K) molecular component located upstream from the apex of the shock and blueshifted by −7 km s-1...

  14. Hadron collective effects studies for the LHC and FCC-hh project

    CERN Document Server


    High intensity particle beams circulating in accelerators can be perturbed by the electromagnetic field created by the beam itself and the interaction with the surrounding environment. This perturbation can potentially drive the whole beam unstable and conduct to particle losses. The concepts of wakefield and impedance allow to study the electromagnetic interaction of the beam with its surroundings and are the starting point to perform numerical beam stability simulations. A way to study beam stability using an impedance model is to solve the Vlasov equation with a perturbative approach: the unstable modes developing in a beam are associated to the solution of an eigenvalue problem. In this work we will present the formalism used in the simulation code DELPHI (Discrete Expansion over Laguerre Polynomials and Headtail modes) that allows to extract the most unstable eigenmodes and the corresponding eigenvectors, directly comparable with the signal measurable with beam position monitors in the machine. We will p...

  15. IFIN-HH ionization chamber calibration and its validation; electrometric system improvement

    Energy Technology Data Exchange (ETDEWEB)

    Sahagia, M., E-mail: msahagia@nipne.r [' Horia Hulubei' National Institute of R and D for Physics and Nuclear Engineering, IFIN-HH, P.O. Box MG-6, Bucharest, RO-77125 (Romania); Waetjen, A.C.; Luca, A.; Ivan, C. [' Horia Hulubei' National Institute of R and D for Physics and Nuclear Engineering, IFIN-HH, P.O. Box MG-6, Bucharest, RO-77125 (Romania)


    The paper presents the results obtained in the calibration of the CENTRONIC IG12/20A ionization chamber for 18 gamma ray emitters, and its improvement with a Keithley 6517A electrometer. The calibration figures were determined either directly in pA MBq{sup -1} units, or calculated from old units, by using the system capacity value. The calibration figures, determined with RML's standards, are compared with those deduced from the KCRV or the mean of the comparisons, and the values determined at PTB-Germany.

  16. Physics Perspectives for a Future Circular Collider: FCC-hh - Accelerator & Detectors

    CERN Document Server

    CERN. Geneva


    The lectures will briefly discuss the parameters of a Future Circular Collider, before addressing in detail the physics perspectives and the challenges for the experiments and detector systems. The main focus will be on ee and pp collisions, but opportunities for e—p physics will also be covered. The FCC physics perspectives will be presented with reference to the ongoing LHC programme, including the physics potential from future upgrades to the LHC in luminosity and possibly energy.

  17. Analysis on Origin of Oscillation of H Moment in High-Energy hh Collision

    Institute of Scientific and Technical Information of China (English)

    WU Tao; ZHOU Dai-Cui


    Multiplicity distributions of negative binomial distribution (NBD) and modified NBD are obtained from a birth process model with an immigration. The ratio of factorial cumulant moment to factorial moment, i.e., H moment is calculated from different multiplicity distributions of NBD, modified NBD and the three fireball model, which shows an oscillatory behavior when there is a truncation of multiplicity. The oscillation of H moment is related to the common character of the truncated multiplicity distributions.

  18. Searches for narrow resonances decaying to pairs of boosted HH bosons

    CERN Document Server

    De Souza Santos, Angelo


    We present a search for narrow resonances production in gluon-gluon fusion followed by a decay into two Higgs bosons at 8 and 13 TeV. Decays of Higgs bosons into bottom quark pairs are considered for resonance massesabove 1 TeV, where each Higgs boson is produced with large momentum, and thehadronization products of the pair of bottom quarks can usually be reconstructed assingle large jets. The background from multijet and its events is significantly reducedby applying requirements related to the flavor of the jet, its mass, and its substructure.The signal is identified as a peak in the dijet invariant mass spectrum of the remain-ing background events.

  19. Alternative Approach to the Provision of the High-field Dipole for FCC-hh

    CERN Document Server



    This paper describes a possible approach to reducing the complexity and cost of the high field dipole magnets. In addition the cooling of the winding could be improved in the proposed design, with a consequent reduction in the shielding requirements. The correction of multipoles is also addressed: this feature may impact on the dynamic range of operation of the magnets. Noting that it would be possible to add a small gradient component to the dipole, it is suggested that a (partially) combined function lattice should be considered. The proposals lead to a brief re-appraisal of how best to apply superconductivity to magnets for large accelerators.

  20. FCC-hh final-focus for flat-beams: parameters and energy deposition studies

    CERN Document Server

    Abelleira, Jose; Seryi, Andrei; Van Riesen-Haupt, Leon; Besana, Maria Ilaria


    The international Future Circular Collider (FCC) study comprises the study of a new scientific structure in a tunnel of 100 km. This will allow the installation of two accelerators, a 45.6–175 GeV lepton collider and a 100-TeV hadron collider. An optimized design of a final-focus system for the hadron collider is presented here. The new design is more compact and enables unequal ${\\beta}$$^{∗}$ in both planes, whose choice is justified here. This is followed by energy deposition studies, where the total dose in the magnets as a consequence of the collision debris is evaluated.

  1. Stem cell and lung cancer development: blaming the Wnt, Hh and Notch signalling pathway. (United States)

    García Campelo, María Rosario; Alonso Curbera, Guillermo; Aparicio Gallego, Guadalupe; Grande Pulido, Enrique; Antón Aparicio, Luis Miguel


    Primary lung cancer may arise from the central (bronchial) or peripheral (bronchiolo-alveolar) compartments. However the origins of the different histological types of primary lung cancer are not well understood. Stem cells are believed to be crucial players in tumour development and there is much interest in identifying those compartments that harbour stem cells involved in lung cancer. Although the role of stem cells in carcinogenesis is not well characterised, emerging evidence is providing new insights into this process. Numerous studies have indicated that lung cancer is not a result of a sudden transforming event but a multistep process in which a sequence of molecular changes result in genetic and morphological aberrations. The exact sequence of molecular events involved in lung carcinogenesis is not yet well understood, therefore deeper knowledge of the aberrant stem cell fate signalling pathway could be crucial in the development of new drugs against the advanced setting.

  2. Searches for HH production at 13 TeV with the CMS detector

    CERN Document Server

    Dall'Osso, Martino


    The production of a pair of Higgs bosons provides a direct handle on the structure of the Higgs field potential. While the Higgs boson pair production within the Standard Model is very small and essentially out of experimental reach in the LHC Run II, several Standard Model extensions foresee an enhancement that can be already probed with the available data. The latest searches for resonant and non-resonant Higgs pair production made using CMS Run II data are presented considering different decay modes of the Higgs boson.

  3. CP sensitivity with B0(s)-> h+h- decays at LHCb

    CERN Document Server

    Balbi, G; Bertin, A; Bruschi, M; Carbone, A; Fabbri, Franco Luigi; Faccioli, P; Galli, D; Giacobbe, B; Gregori, D; Grimaldi, F; Marconi, U; Massa, I; Piccinini, M; Semprini-Cesari, N; Spighi, R; Vagnoni, V M; Vecchi, S; Villa, M; Vitale, A; Zoccoli, A


    LHCb can collect large samples of B0-->pi+pi-, B0-->K+pi-, Bs-->K+K- and Bs-->pi+K- decays. The sensitivity achievable on the corresponding Bs-->pi+direct and mixing-induced CP-violating observables has been studied in detail. The combined measurement of the B0-->pi+pi- and Bs-->K+K- CP asymmetries provides a promising strategy to determine the gamma angle of the unitarity triangle. The results of a study on the sensitivity on gamma achievable by employing this technique are presented and discussed.

  4. Search for CP violation in $D^0 \\to h^+h^-$ decays at CDF

    Energy Technology Data Exchange (ETDEWEB)

    Leo, Sabato [Illinois U., Urbana


    I report on a measurement of \\CP-violating asymmetries ($A_{\\Gamma}$) between effective lifetimes of $D^0$ or $\\bar{D}^0$ in fully reconstructed $D^0\\to K^+ K^-$ and $D^0\\to \\pi^+\\pi^-$ decays collected in $p\\bar{p}$ collisions by the Collider Detector at Fermilab experiment. The full CDF data set corresponding to $9.7$ fb$^{-1}$ of integrated luminosity is used. The flavor of the charm meson at production is determined by exploiting the strong-interaction decay $D^{*+} \\to D^0 \\pi^+$, while the contamination from mesons originated in $b$-hadron decays is evaluated and subtracted from the sample. Signal yields as functions of the observed decay-time distributions are extracted from maximum likelihood fits and used to measure the asymmetries. The results, $A_\\Gamma (K^+K^-) = \\bigl(-1.9 \\pm 1.5 \\mathrm{(stat)} \\pm 0.4 \\mathrm{(syst)} \\bigr)\\times10^{-3}$ and $A_\\Gamma (\\pi^+\\pi^-)= \\bigl(-0.1 \\pm 1.8 \\mathrm{(stat)} \\pm 0.3 \\mathrm{(syst)} \\bigr)\\times10^{-3}$, and their combination, $A_\\Gamma = \\bigl(-1.2 \\pm 1.2\\bigr)\\times10^{-3}$, are consistent with the SM predictions and other experimental determinations.

  5. A COMPARATIVE ANALYSIS HH Rajak* 1 Introduction It is a generally

    African Journals Online (AJOL)

    Dr Tanya du Plessis

    was no room for inferring such an intention and thus, they helped propel Britain into a new age. 3 ..... In the matter of debt avoidance, while the courts were ... substance of business decision-making, have generally avoided this troubling area.

  6. First Evaluation of Dynamic Aperture at Injection for FCC-hh

    CERN Document Server

    Dalena, B; Chancé, A; Holzer, B; Schulte, D


    In the Hadron machine option, proposed in the context of the Future Circular Colliders (FCC) study, the dipole field quality is expected to play an important role, as in the LHC. A preliminary evaluation of the field quality of dipoles, based on the Nb$_{3}$Sn technology, has been provided by the magnet group. The effect of these field imperfections on the dynamic aperture, using the present lattice design, is presented and first tolerances on the b$_3$ and b$_5$ multipole components are evaluated.

  7. HOME COST Nonmortgaged Units by Costs as Pct 1999 HH Income NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  8. HOME COST Pct All OwnerOcc Units Costs as Pct 1999 HH Income NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  9. HOME COST Nonmortgaged Units by Cost as Pct 1999 HH Income NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  10. HOME COST Pct Units by Rent as Pct of HH Income in 1999 NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  11. HOME COST Pct All OwnerOcc Units Costs as Pct 1999 HH Income NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  12. HOME COST Mortgaged Units by Costs as Pct 1999 HH Income NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  13. HOME COST Mortgaged Units by Costs as Pct 1999 HH Income NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  14. HOME COST Units by Rent as Pct of HH Income in 1999 NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  15. HOME COST All Owner Occ Units by Costs as Pct 1999 HH Income NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  16. HOME COST Pct Units by Rent as Pct of HH Income in 1999 NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  17. HOME COST Pct Nonmortgaged Units Costs as Pct 1999 HH Income NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  18. HOME COST Pct Nonmortgaged Units Costs as Pct 1999 HH Income NMHD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  19. HOME COST Units by Rent as Pct of HH Income om 1999 NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  20. HOME COST Pct Mortgaged Units by Costs as Pct 1999 HH Income NMSD 2000 (United States)

    Earth Data Analysis Center, University of New Mexico — The 2006 Second Edition TIGER/Line files are an extract of selected geographic and cartographic information from the Census TIGER database. The geographic coverage...

  1. Non-Canonical Hh Signaling in Cancer—Current Understanding and Future Directions

    Directory of Open Access Journals (Sweden)

    Dongsheng Gu


    Full Text Available As a major regulatory pathway for embryonic development and tissue patterning, hedgehog signaling is not active in most adult tissues, but is reactivated in a number of human cancer types. A major milestone in hedgehog signaling in cancer is the Food and Drug Administration (FDA approval of a smoothened inhibitor Vismodegib for treatment of basal cell carcinomas. Vismodegib can block ligand-mediated hedgehog signaling, but numerous additional clinical trials have failed to show significant improvements in cancer patients. Amounting evidence indicate that ligand-independent hedgehog signaling plays an essential role in cancer. Ligand-independent hedgehog signaling, also named non-canonical hedgehog signaling, generally is not sensitive to smoothened inhibitors. What we know about non-canonical hedgehog signaling in cancer, and how should we prevent its activation? In this review, we will summarize recent development of non-canonical hedgehog signaling in cancer, and will discuss potential ways to prevent this type of hedgehog signaling.

  2. Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome (HHH) presenting with acute fulminant hepatic failure. (United States)

    Mhanni, A A; Chan, A; Collison, M; Seifert, B; Lehotay, D C; Sokoro, Ah; Huynh, H Q; Greenberg, C R


    We report on two Aboriginal patients with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome. Both presented with acute hepatic failure with severe hypertransaminasemia and coagulopathy, prompting evaluation for emergent liver transplantation. The diagnosis of HHH syndrome was based on the presence of typical metabolic abnormalities. A protein-restricted diet and L-arginine or L-citrulline supplementation were immediately started, with rapid normalization of liver function test results and other biochemical abnormalities. Molecular analysis of the SLC25A15 gene showed that the two patients were homozygous for the common French Canadian mutation (F188Delta). The diagnosis of HHH syndrome should be considered in patients with unexplained fulminant hepatic failure. There does not appear to be a genotype-phenotype correlation for this presentation, inasmuch as the only other reported patient presenting with this picture had two different point mutations. Early identification and prompt treatment of these patients is crucial to avoid liver transplantation and can be life saving.

  3. HHH syndrome (hyperornithinaemia, hyperammonaemia, homocitrullinuria), with fulminant hepatitis-like presentation. (United States)

    Fecarotta, S; Parenti, G; Vajro, P; Zuppaldi, A; Della Casa, R; Carbone, M T; Correra, A; Torre, G; Riva, S; Dionisi-Vici, C; Santorelli, F M; Andria, G


    We report a 3-year-old Italian patient with the hyperornithinaemia, hyperammonaemia, homocitrullinuria (HHH) syndrome who presented with neurological deterioration after an intercurrent infection. Hyperammonaemia, coagulopathy and moderate hypertransaminasaemia were detected on hospital admission. Severe hepatocellular necrosis with hypertransaminasaemia (aspartate aminotransferase 20,000 UI/L, alanine aminotransferase 18,400 UI/L) and coagulopathy (PT HHH syndrome was based on the presence of the typical metabolic abnormalities. Molecular analysis of the SLC25A15 gene showed that the patient was heterozygous for two novel mutations (G113C and M273K). The diagnosis of HHH syndrome should be considered in patients with fulminant hepatitis-like presentations. Early identification and treatment of these patients can be life-saving and can avoid liver transplantation.

  4. Ultrastructural changes in fibroblast mitochondria of a patient with HHH-syndrome. (United States)

    Metoki, K; Hommes, F A; Dyken, P; Kelloes, C; Trefz, J


    Electron micrographs of fibroblasts of an HHH-syndrome patient showed abnormal structures, similar, but not identical, to those observed in the liver of such patients. It is suggested that incorporation of a mutated protein into the inner mitochondrial membrane gives rise to a rearrangement of that membrane, resulting in unusual structures.

  5. A novel mutation, P126R, in a Japanese patient with HHH syndrome. (United States)

    Miyamoto, Takeshi; Kanazawa, Naomi; Hayakawa, Chiemi; Tsujino, Seiichi


    Mitochondrial ornithine transporter deficiency, or HHH syndrome, is a metabolic disorder resulting in various neurologic symptoms, including mental retardation, spastic paraparesis with pyramidal signs, cerebellar ataxia, and episodic disturbance of consciousness or coma caused by hyperammonemia. Several mutations have been reported in the ORNT1 gene encoding mitochondrial ornithine transporter of patients with this disorder. In this article, we report a new patient, a male 15 years of age, who had typical clinical features of HHH syndrome. Because the patient did not have any of the three mutations previously described in other Japanese patients with HHH syndrome, and the only material available from the patient was peripheral leukocytes, we established a genomic polymerase chain reaction method using intronic primers to amplify every exon of the ORNT1 gene, and we directly sequenced the polymerase chain reaction products. Using this method, we documented a novel mutation in this patient, P126R, and demonstrated that HHH syndrome is genetically heterogeneous, even in the Japanese population.

  6. Clinical and functional characterization of a human ORNT1 mutation (T32R) in the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome. (United States)

    Camacho, José A; Mardach, Rebecca; Rioseco-Camacho, Natalia; Ruiz-Pesini, Eduardo; Derbeneva, Olga; Andrade, Dario; Zaldivar, Frank; Qu, Yong; Cederbaum, Stephen D


    We studied two related families (HHH013 and HHH015) with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome, a disorder of the urea cycle and ornithine degradation pathway, who have the same novel ornithine transporter (ORNT1) genotype (T32R) but a variable phenotype. Both HHH015 patients are doing well in school and are clinically stable; conversely, the three affected HHH013 siblings had academic difficulties and one suffered recurrent episodes of hyperammonemia and ultimately died. Overexpression studies revealed that the product of the ORNT1-T32R allele has residual function. Ornithine transport studies in HHH015 fibroblasts, however, showed basal activity similar to fibroblasts carrying nonfunctional ORNT1 alleles. We also examined two potential modifying factors, the ORNT2 gene and the mitochondrial DNA lineage (haplogroup). Haplogroups, associated with specific diseases, are hypothesized to influence mitochondrial function. Results demonstrated that both HHH015 patients are heterozygous for an ORNT2 gain of function polymorphism and belong to haplogroup A whereas the HHH013 siblings carry the wild-type ORNT2 and are haplogroup H. These observations suggest that the ORNT1 genotype cannot predict the phenotype of HHH patients. The reason for the phenotypic variability is unknown, but factors such as redundant transporters and mitochondrial lineage may contribute to the neuropathophysiology of HHH patients.

  7. Conscientious metabolic monitoring on a patient with hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome undergoing anaesthesia. (United States)

    Mühling, J; Dehne, M G; Fuchs, M; Sablotzki, A; Weiss, S; Spatz, J; Hempelmann, G


    Currently we know not more than 50 patients who show an interesting combination of increased plasma ornithine concentrations, postprandial hyperammonemia, and homocitrullinuria (HHH-syndrome). Since exact knowledge of this severe, although rare syndrome is important for any perioperative or intensive medical treatment concerning therapy and progression of the disease, we report a comprehensive study on a 32-year old woman with this rare multifaceted disorder who had to undergo general anaesthesia. For the first time amino acid status in plasma, urine, cerebrospinal fluid and especially polymorphonuclear leucocytes, which in the investigation showed to be valuable tool for evaluating amino acid metabolism in nucleated cells in HHH-syndrome, and further important pathophysiologic indicators of cellular and metabolic function have been conscientiously investigated and compared. The pathophysiological repercussions of our results as well as the recommendations for conscientious therapeutical management are discussed.

  8. Ciliated cultured dermal fibroblasts in a patient with hyperornithinemia, hyperammonemia and homocitrullinuria (HHH) syndrome. (United States)

    Haust, M D


    Hyperornithinemia, hyperammonemia and homocitrullinuria (HHH)-syndrome is a rare autosomal recessive disorder of the urea cycle, probably caused by a defect in ornithine transport across the hepatic inner mitochondrial membrane. Single rudimentary cilia were present in approximately ten percent of post-divisional or dividing fibroblasts cultured from the skin of a patient with the HHH-syndrome, whereas no such organelles were observed in dermal fibroblasts cultured from normal controls. Since single rudimentary ("primary," "oligo," "solitary") cilia have been observed in a variety of cells in animals and men but the stimuli for their formation and their significance remain controversial, a brief report on their presence in the as yet unreported condition (HHH-syndrome) was considered of interest; hopefully, it might contribute to the ultimate unravelling of some of the unresolved problems. It is of note that unlike the author's previous findings of these unusual organelles in cells affected by a pathological process (atherosclerosis), the rudimentary cilia were observed in the present instance in dividing or postdivisional cells. The implications of these (and other) observations must await further work.

  9. Diagnosis of Japanese patients with HHH syndrome by molecular genetic analysis: a common mutation, R179X. (United States)

    Miyamoto, T; Kanazawa, N; Kato, S; Kawakami, M; Inoue, Y; Kuhara, T; Inoue, T; Takeshita, K; Tsujino, S


    Patients with mitochondrial ornithine transporter deficiency (or HHH syndrome) present with various neurological symptoms, including mental retardation, spastic paraparesis with pyramidal signs, cerebellar ataxia, and episodic disturbance of consciousness or coma due to hyperammonemia. We previously described three novel mutations in the ORNT1 gene in Japanese patients with HHH syndrome. In this article, we report a new patient with HHH syndrome, a 52-year-old woman, who had the typical clinical features, except for an absence of mental retardation. When we screened this patient, as well as a previously described Japanese patient, for mutations in the ORNT1 gene, we found that both were homozygous for a nonsense mutation (R179X). Furthermore, reverse transcription (RT)-polymerase chain reaction (PCR) of fibroblast RNA from one patient showed exon 4 skipping, as had been observed in a previously reported patient with R179X. These results, together with the findings in our previous report, show that, in three of our five reported Japanese HHH patients (six of ten alleles), R179X is present, suggesting that this is a common mutation in Japanese patients with HHH syndrome.

  10. HD/H2 as a probe of the roles of gas, dust, light, metallicity and cosmic rays in promoting the growth of molecular hydrogen in the diffuse interstellar medium

    CERN Document Server

    Liszt, H S


    We modelled recent observations of UV absorption of HD and \\HH\\ in the Milky Way and toward damped/sub-damped Lyman alpha systems at z=0.18 and z $>$ 1.7. N(HD)/N(\\HH) ratios reflect the separate self-shieldings of HD and \\HH\\ and the coupling introduced by deuteration chemistry. Locally, observations are explained by diffuse molecular gas with $ 16 \\pccc \\la$ n(H) $\\la 128 \\pccc $ if the cosmic-ray ionization rate per H-nucleus \\zetaH $= 2\\times 10^{-16}\\ps$ as inferred from \\H3\\p\\ and OH\\p. The dominant influence on N(HD)/N(\\HH) is the cosmic-ray ionization rate with a much weaker downward dependence on n(H) at Solar metallicity, but dust-extinction can drive N(HD) higher as with N(\\HH). At z $>$ 1.7, N(HD) is comparable to the Galaxy but with 10x smaller N(\\HH) and somewhat smaller N(\\HH)/N(H I). Comparison of our Galaxy and the Magellanic Clouds shows that smaller \\HH/H is expected at sub-Solar metallicity and we show by modelling that HD/\\HH\\ increases with density at low metallicity, opposite to the Mil...

  11. Insights into the mutation-induced HHH syndrome from modeling human mitochondrial ornithine transporter-1.

    Directory of Open Access Journals (Sweden)

    Jing-Fang Wang

    Full Text Available Human mitochondrial ornithine transporter-1 is reported in coupling with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH syndrome, which is a rare autosomal recessive disorder. For in-depth understanding of the molecular mechanism of the disease, it is crucially important to acquire the 3D structure of human mitochondrial ornithine transporter-1. Since no such structure is available in the current protein structure database, we have developed it via computational approaches based on the recent NMR structure of human mitochondrial uncoupling protein (Berardi MJ, Chou JJ, et al. Nature 2011, 476:109-113. Subsequently, we docked the ligand L-ornithine into the computational structure to search for the favorable binding mode. It was observed that the binding interaction for the most favorable binding mode is featured by six remarkable hydrogen bonds between the receptor and ligand, and that the most favorable binding mode shared the same ligand-binding site with most of the homologous mitochondrial carriers from different organisms, implying that the ligand-binding sites are quite conservative in the mitochondrial carriers family although their sequences similarity is very low with 20% or so. Moreover, according to our structural analysis, the relationship between the disease-causing mutations of human mitochondrial ornithine transporter-1 and the HHH syndrome can be classified into the following three categories: (i the mutation occurs in the pseudo-repeat regions so as to change the region of the protein closer to the mitochondrial matrix; (ii the mutation is directly affecting the substrate binding pocket so as to reduce the substrate binding affinity; (iii the mutation is located in the structural region closer to the intermembrane space that can significantly break the salt bridge networks of the protein. These findings may provide useful insights for in-depth understanding of the molecular mechanism of the HHH syndrome and

  12. Insights into the mutation-induced HHH syndrome from modeling human mitochondrial ornithine transporter-1. (United States)

    Wang, Jing-Fang; Chou, Kuo-Chen


    Human mitochondrial ornithine transporter-1 is reported in coupling with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome, which is a rare autosomal recessive disorder. For in-depth understanding of the molecular mechanism of the disease, it is crucially important to acquire the 3D structure of human mitochondrial ornithine transporter-1. Since no such structure is available in the current protein structure database, we have developed it via computational approaches based on the recent NMR structure of human mitochondrial uncoupling protein (Berardi MJ, Chou JJ, et al. Nature 2011, 476:109-113). Subsequently, we docked the ligand L-ornithine into the computational structure to search for the favorable binding mode. It was observed that the binding interaction for the most favorable binding mode is featured by six remarkable hydrogen bonds between the receptor and ligand, and that the most favorable binding mode shared the same ligand-binding site with most of the homologous mitochondrial carriers from different organisms, implying that the ligand-binding sites are quite conservative in the mitochondrial carriers family although their sequences similarity is very low with 20% or so. Moreover, according to our structural analysis, the relationship between the disease-causing mutations of human mitochondrial ornithine transporter-1 and the HHH syndrome can be classified into the following three categories: (i) the mutation occurs in the pseudo-repeat regions so as to change the region of the protein closer to the mitochondrial matrix; (ii) the mutation is directly affecting the substrate binding pocket so as to reduce the substrate binding affinity; (iii) the mutation is located in the structural region closer to the intermembrane space that can significantly break the salt bridge networks of the protein. These findings may provide useful insights for in-depth understanding of the molecular mechanism of the HHH syndrome and developing effective

  13. Studies on a case of HHH-syndrome (hyperammonemia, hyperornithinemia, homocitrullinuria). (United States)

    Hommes, F A; Roesel, R A; Metoki, K; Hartlage, P L; Dyken, P R


    A patient with the hyperornithinemia, hyperammonemia, homocitrullinuria syndrome is described. This patient represents the 12th documented case of this rare, presumably autosomal recessive condition. Increased levels of ammonia, ornithine and homocitrulline were demonstrated in blood and cerebrospinal fluid. The blood ammonia concentration could be lowered by supplementation of the diet with low doses of arginine. High doses of arginine precipitated seizures, although plasma levels of arginine and ornithine were not altered. The uptake of ornithine by the particulate fraction of the patient's fibroblasts was lower than that of controls, but still measurable. It is suggested that HHH patients have a partial impairment of the uptake of ornithine by mitochondria.

  14. Rahvusküsimus Eesti vasakdemokraatlikus publitsistikas 1980ndate aastate lõpul - 1990ndate algul = Natsionalnõi vopross v estonskoi "levo-demokratitsheskoi" publitsistike kontsa 1980-hh - natshala 1990-hh gg / Igor Rosenfeld

    Index Scriptorium Estoniae

    Rosenfeld, Igor


    Ülevaade rahvusküsimuse vasakdemokraatliku kontseptsiooni kajastamisest vabariiklikes venekeelsetes ajalehtedes perestroika erinevatel etappidel, "uuendatud föderatsioonist", NSV Liidu lagunemise põhjustest

  15. Vía de señalización Notch durante el desarrollo de arcos branquiales en el embrión de pollo: estadios HH14 a HH18


    Francy Yomara BAYONA RODRIGUEZ


    La vía de señalización celular Notch está involucrada en procesos importantes del desarrollo embrionario, entre ellos, en el desarrollo del complejo craneofacial. Algunos estudios sugieren que esta vía de señalización podría tener algún papel en la formación de los arcos branquiales, protagonistas en la morfogénesis de la cara y el cuello. El objetivo de esta investigación es realizar el análisis cualitativo de los patrones de expresión de los genes Notch1, Serrate2, Hes1 y ...

  16. Rahvusküsimus Eesti vasakdemokraatlikus publitsistikas 1980ndate aastate lõpul - 1990ndate algul = Natsionalnõi vopross v estonskoi "levo-demokratitsheskoi" publitsistike kontsa 1980-hh - natshala 1990-hh gg / Igor Rosenfeld

    Index Scriptorium Estoniae

    Rosenfeld, Igor


    Ülevaade rahvusküsimuse vasakdemokraatliku kontseptsiooni kajastamisest vabariiklikes venekeelsetes ajalehtedes perestroika erinevatel etappidel, "uuendatud föderatsioonist", NSV Liidu lagunemise põhjustest

  17. Determination of homocitrulline in urine of patients with HHH syndrome by liquid chromatography tandem mass spectrometry. (United States)

    Al-Dirbashi, Osama Y; Al-Hassnan, Zuhair N; Rashed, Mohamed S


    A liquid chromatography tandem mass spectrometric method is described for the analysis of homocitrulline in human urine, a key metabolite in the differential diagnosis of hyperammonemia, hyperornithinemia, homocitrullinuria (HHH) syndrome. Urine samples were prepared by mere five-fold dilution with a mixture of internal standards (2H2-citrulline and 2H3-creatinine) used for the simultaneous quantification of creatinine. Analytes were separated on a cyano column and eluted isocratically within seven min. Detection was achieved by monitoring transitions of 190 > 84 and 190 > 127 for homocitrulline, 178 > 115 for 2H2-citrulline, 114 > 44 for creatinine and 117 > 47 for 2H3-creatinine. Calibration curves were linear up to 100 micromol/L. Intraday (n = 7) and interday (n = 6) variations were less than 10%. In urine samples from three siblings confirmed to have HHH syndrome, homocitrulline levels were at 13.3 (74), 21.1 (50) and 108.2 (103) mmol/mol creatinine (micromol/L). Control values were 0-9 mmol/mol creatinine (n = 120). The current method solves specificity issues in homocitrulline determination often encountered with some ninhydrin-based systems (coelution with methionine) and some o-phthalaldehyde-based ones (coelution with taurine), and presents an attractive alternative with a relatively high throughput.

  18. Differential and total cross sections of mutual neutralization in low-energy collisions of isotopes of H++H- (United States)

    Nkambule, Sifiso M.; Elander, Nils; Larson, Åsa; Lecointre, Julien; Urbain, Xavier


    Mutual neutralization in the collisions of H+ and H- is studied both theoretically and experimentally. The quantum-mechanical ab initio model includes covalent states associated with the H (1 )+H (n ≤3 ) limits and the collision energy ranges from 1 meV to 100 eV. The reaction is theoretically studied for collisions between different isotopes of the hydrogen ions. From the partial wave scattering amplitude, the differential and total cross sections are computed. The differential cross section is analyzed in terms of forward- and backward-scattering events, showing a dominance of backward scattering which can be understood by examining the phase of the scattering amplitudes for the gerade and ungerade set of states. The isotope dependence of the total cross section is compared with the one obtained using a semiclassical multistate Landau-Zener model. The final state distribution analysis emphasizes the dominance of the n =3 channel for collisions below 10 eV, while at higher collision energies, the n =2 channel starts to become important. For collisions of ions forming a molecular system with a larger reduced mass, the n =2 channel starts to dominate at lower energies. Using a merged ion-beam apparatus, the branching ratios for mutual neutralization in H+ and H- collisions in the energy range from 11 to 185 eV are measured with position- and time-sensitive particle detectors. The measured and calculated branching ratios satisfactorily agree with respect to state contributions.

  19. Proper Motions of Young Stellar Outflows in the Mid-Infrared with Spitzer. II. HH 377/Cep E

    CERN Document Server

    Noriega-Crespo, A; Moro-Martin, A; Flagey, N; Carey, S J


    We have used multiple mid-infrared observations at 4.5 micron obtained with the Infrared Array Camera, of the compact (~1.4 arcmin) young stellar bipolar outflow Cep E to measure the proper motion of its brightest condensations. The images span a period of ~6 yr and have been reprocessed to achieve a higher angular resolution (~0.8 arcsec) than their normal beam (2 arcsec). We found that for a distance of 730 pc, the tangential velocities of the North and South outflow lobes are 62+/-29 and 94+/-6 km/s respectively, and moving away from the central source roughly along the major axis of the flow. A simple 3D hydrodynamical simulation of the H2 gas in a precessing outflow supports this idea. Observations and model confirm that the molecular Hydrogen gas, traced by the pure rotational transitions, moves at highly supersonic velocities without being dissociated. This suggests either a very efficient mechanism to reform H2 molecules along these shocks or the presence of some other mechanism (e.g. strong magnetic ...

  20. Verdad y justicia en América Latina en casos de violaciones a los DD.HH

    Directory of Open Access Journals (Sweden)

    Hector Salazar Ardiles


    Full Text Available El presente artículo da cuenta de los procesos de transición de diversas dictaduras militares de Hispanoamérica a regímenes democráticos, ocurridos en las últimas tres décadas del siglo pasado, poniendo el foco de atención en la manera como en distintos países de la región se enfrentó la pesada carga en materia de violaciones a los derechos humanos heredadas de esas dictaduras, así como los diferentes grados de verdad y justicia alcanzados en cada uno de esos procesos, como las dificultades que surgieron para alcanzar dicho cometido. Especial consideración se hace con respecto al caso chileno y los resultados obtenidos en esta área.

  1. Dietary supplementation with aromatic amino acids increases protein synthesis in children wHh severe acute malnutrition (United States)

    Although 2 earlier studies reported that aromatic amino acid (AAA) supplementation of children with severe acute malnutrition (SAM) improved whole-body protein anabolism during the early postadmission (maintenance) phase of rehabilitation, it is not known whether this positive effect was maintained ...

  2. CAL3JHH: a Java program to calculate the vicinal coupling constants (3J H,H) of organic molecules. (United States)

    Aguirre-Valderrama, Alonso; Dobado, José A


    Here, we present a free web-accessible application, developed in the JAVA programming language for the calculation of vicinal coupling constant (3J(H,H)) of organic molecules with the H-Csp3-Csp3-H fragment. This JAVA applet is oriented to assist chemists in structural and conformational analyses, allowing the user to calculate the averaged 3J(H,H) values among conformers, according to its Boltzmann populations. Thus, the CAL3JHH program uses the Haasnoot-Leeuw-Altona equation, and, by reading the molecule geometry from a protein data bank (PDB) file format or from multiple pdb files, automatically detects all the coupled hydrogens, evaluating the data needed for this equation. Moreover, a "Graphical viewer" menu allows the display of the results on the 3D molecule structure, as well as the plotting of the Newman projection for the couplings.

  3. Pressure Profile in the experimental area of FCC-hh and FCC-ee calculated by an analytical code

    CERN Multimedia

    Aichinger, Ida


    Ultra high vacuum in the beam pipe is a basic requirement for the Future Circular Colliders (FCC). The dimension of the FCC and the high energy of the particles will make this requirement challenging. Simulations that predict the vacuum quality due to material and beam induced effects will allow to evaluate different designs and to choose an optimal solution. The mathematical model behind the simulations will be shown. Four coupled differential equations describe the mass conservation of the residual gas particles in the beam pipe. The sinks include all kind of distributed and local pumping. The sources are caused by synchrotron radiation, electron clouds, thermal outgassing and ion-induced desorption. The equation system is solved by an analytical method. This requires a transformation to first order equations for which a general valid solution exists. Adding a particular solution and the inclusion of appropriate boundary conditions define the solution function. The big advantage here is that an analytical...

  4. Arrangement transformation approach to state-to-state quantum reactive scattering H+DH→DH+H, HH+D

    Institute of Scientific and Technical Information of China (English)

    张怿慈; 战立欣; 谭哲民; 张庆刚; 张增辉


    Arrangement transformation approach (ATA) for doing state-to-state quantum reactive scattering calculations of atom-diatom systems is given. The state-to-state results of H + DH on LSTH potential energy surface are present. ed, and it can be deduced from the results that the ATA method can be used for the system with more than three atoms.

  5. Prospects for $D^{0} \\rightarrow h^+h^- \\mu^+ \\mu^-$ $(h=K,\\pi)$ decays at LHCb

    CERN Multimedia

    Mitzel, Dominik Stefan


    This poster presents the current experimental status and prospects for the search of rare four-body charm decays with final states consisting of two oppositely charged kaons or pions and two oppositely charged muons at LHCb.

  6. Verdad y justicia en América Latina en casos de violaciones a los DD.HH


    Hector Salazar Ardiles


    El presente artículo da cuenta de los procesos de transición de diversas dictaduras militares de Hispanoamérica a regímenes democráticos, ocurridos en las últimas tres décadas del siglo pasado, poniendo el foco de atención en la manera como en distintos países de la región se enfrentó la pesada carga en materia de violaciones a los derechos humanos heredadas de esas dictaduras, así como los diferentes grados de verdad y justicia alcanzados en cada uno de esos procesos, como las dificultades q...

  7. Jet transverse fragmentation momentum from h-h correlations in pp and p-Pb collisions arXiv

    CERN Document Server

    Viinikainen, Jussi

    QCD color coherence phenomena, like angular ordering, can be studied by looking at jet fragmentation. As the jet is fragmenting, it is expected to go through two different phases. First, there is QCD branching that is calculable in perturbative QCD. Next, the produced partons hadronize in a non-perturbative way later in a hadronization process. The jet fragmentation can be studied using the method of two particle correlations. A useful observable is the jet transverse fragmentation momentum $j_{\\mathrm{T}}$, which describes the angular width of the jet. In this contribution, a differential study will be presented in which separate $j_{\\mathrm{T}}$ components for branching and hadronization will be distinguished from the data measured by the ALICE experiment. The $p_{\\mathrm{Tt}}$ dependence of the hadronization component $\\sqrt{\\left}$ is found to be rather flat, which is consistent with universal hadronization assumption. However, the branching component shows slightly rising trend in $p_{\\mathrm{Tt}}$. The ...

  8. Prospects for Observing $t \\bar t HH$ Production with the ATLAS Experiment at the HL-LHC

    CERN Document Server

    The ATLAS collaboration


    Measuring the self-coupling of the Higgs boson is one of the primary goals of the High Luminosity-LHC. In this note, the prospects for the study of $t \\bar t H H$ production, with both Higgs bosons decaying to $H\\rightarrow b\\bar b$, using $3000\\;\\mathrm{fb}^{-1}$ of proton-proton collisions at $\\sqrt{s}=14\\;\\mathrm{T\\kern -0.1em eV}$ with an average pile-up of 200 at the ATLAS detector are presented. The study uses stable particles from generated Monte Carlo events. The energy and momentum of leptons and jets are smeared to simulate the response of the upgraded ATLAS detector and pile-up collisions. Events are selected from the semi-leptonic final state of the $t\\bar t$ system with one electron or muon, two $b$-quark jets, two light jets and missing momentum from the neutrino, along with an additional four $b$-jets from the Higgs boson decay. After applying event selections requiring at least 5 jets to be $b$-tagged, and assuming Standard Model rates of signal and background processes, 25 $t \\bar t H H$ even...

  9. Retrieve the soil moisture from radar backscattering coefficient using ALOS/PALSAR polarization (HH/VV) data (United States)

    Buho, Hoshino; Ruichen, Jia; Nawata, Hiroshi; Abdelaziz, Karamalla; Yoda, Kiyotsugu; Abdel, Babiker

    Mesquite (Prosopis spp) are ever green leguminous trees or shrubs. These species are native to North and South America. They were introduced to Sudan in 1917 from South Africa and Egypt and planted in Khartoum state in central Sudan (Broun and Massey, 1929). Mesquite was originally favored as sand dunes stabilizer and as fodder for livestock. However, sparse stands will often form impenetrable thickets formations that hinder movement of humans and animals. Many infestations are along waterways, both natural and constructed, however, plants can grow also well in drier areas away from water sites. Even in natural rangelands it is an aggressive competitor and can quickly invade upland country. Mesquite thickets can out-compete other vegetation, interfere with mustering and block access to watering places. The sharp thorns can injure animals and puncture vehicle tyres. Seeds can stay dormant for years, and therefore seedlings can re-appear in areas that have been previously cleared. The main objective of Remote Sensing Method for Mesquite Control (RSMMC) is to identify pattern and extend of mesquite spread along spatial and temporal variations using remote sensing means, as main part of mesquite control. Estimation of soil moisture by inversion of SAR data can be performed using physical or semi-empirical approaches. The physical approach uses backscattering models that are capable of reproducing the radar backscattering coefficient from the sensor configuration (wavelength, polarization, and incidence angle) and soil parameters (soil moisture and surface roughness for bare soils). This study adopted calculation of PALSAR L-band radar backscattering coefficient (dB), to estimate soil moisture distribution area based on TDR soil moisture ground measurement data. To retrieve soil moisture (mv) from a single radar configuration, it is necessary to establish a relationship between the radar backscattering coefficient (dB) and soil moisture (mv) measurement.

  10. Hh/Gli antagonist in acute myeloid leukemia with CBFA2T3-GLIS2 fusion gene

    Directory of Open Access Journals (Sweden)

    Riccardo Masetti


    Full Text Available Abstract Background CBFA2T3-GLIS2 is a fusion gene found in 17% of non-Down syndrome acute megakaryoblastic leukemia (non-DS AMKL, FAB M7 and in 8% of pediatric cytogenetically normal acute myeloid leukemia (CN-AML, in association with several French-American-British (FAB subtypes. Children with AML harboring this aberration have a poor outcome, regardless of the FAB subtype. This fusion gene drives a peculiar expression pattern and leads to overexpression of some of Hedgehog-related genes. GLI-similar protein 2 (GLIS2 is closely related to the GLI family, the final effectors of classic Hedgehog pathway. These observations lend compelling support to the application of GLI inhibitors in the treatment of AML with the aberration CBFA2T3-GLIS2. GANT61 is, nowadays, the most potent inhibitor of GLI family proteins. Methods We exposed to GANT61 AML cell lines and primary cells positive and negative for CBFA2T3-GLIS2 and analyzed the effect on cellular viability, induction of apoptosis, cell cycle, and expression profile. Results As compared to AML cells without GLIS2 fusion, GANT61 exposure resulted in higher sensitivity of both cell lines and primary AML cells carrying CBFA2T3-GLIS2 to undergo apoptosis and G1 cell cycle arrest. Remarkably, gene expression studies demonstrated downregulation of GLIS2-specific signature genes in both treated cell lines and primary cells, in comparison with untreated cells. Moreover, chromatin immunoprecipitation analysis revealed direct regulation by GLIS2 chimeric protein of DNMT1 and DNMT3B, two genes implicated in important epigenetic functions. Conclusions Our findings indicate that the GLI inhibitor GANT61 may be used to specifically target the CBFA2T3-GLIS2 fusion gene in pediatric AML.

  11. Msi2 Maintains Quiescent State of Hair Follicle Stem Cells by Directly Repressing the Hh Signaling Pathway. (United States)

    Ma, Xianghui; Tian, Yuhua; Song, Yongli; Shi, Jianyun; Xu, Jiuzhi; Xiong, Kai; Li, Jia; Xu, Wenjie; Zhao, Yiqiang; Shuai, Jianwei; Chen, Lei; Plikus, Maksim V; Lengner, Christopher J; Ren, Fazheng; Xue, Lixiang; Yu, Zhengquan


    Hair follicles (HFs) undergo precisely regulated cycles of active regeneration (anagen), involution (catagen), and relative quiescence (telogen). Hair follicle stem cells (HFSCs) play important roles in regenerative cycling. Elucidating mechanisms that govern HFSC behavior can help uncover the underlying principles of hair development, hair growth disorders, and skin cancers. RNA-binding proteins of the Musashi (Msi) have been implicated in the biology of different stem cell types, yet they have not been studied in HFSCs. Here we utilized gain- and loss-of-function mouse models to demonstrate that forced MSI2 expression retards anagen entry and consequently delays hair growth, whereas loss of Msi2 enhances hair regrowth. Furthermore, our findings show that Msi2 maintains quiescent state of HFSCs in the process of the telogen-to-anagen transition. At the molecular level, our unbiased transcriptome profiling shows that Msi2 represses Hedgehog signaling activity and that Shh is its direct target in the hair follicle. Taken together, our findings reveal the importance of Msi2 in suppressing hair regeneration and maintaining HFSC quiescence. The previously unreported Msi2-Shh-Gli1 pathway adds to the growing understanding of the complex network governing cyclic hair growth. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  12. Search for pair production of doubly charged Higgs bosons in the H++H- - -->mu+ mu+ mu- mu- final state. (United States)

    Abazov, V M; Abbott, B; Abolins, M; Acharya, B S; Adams, M; Adams, T; Aguilo, E; Ahn, S H; Ahsan, M; Alexeev, G D; Alkhazov, G; Alton, A; Alverson, G; Alves, G A; Anastasoaie, M; Ancu, L S; Andeen, T; Anderson, S; Andrieu, B; Anzelc, M S; Aoki, M; Arnoud, Y; Arov, M; Arthaud, M; Askew, A; Asman, B; Assis Jesus, A C S; Atramentov, O; Avila, C; Ay, C; Badaud, F; Baden, A; Bagby, L; Baldin, B; Bandurin, D V; Banerjee, P; Banerjee, S; Barberis, E; Barfuss, A-F; Bargassa, P; Baringer, P; Barreto, J; Bartlett, J F; Bassler, U; Bauer, D; Beale, S; Bean, A; Begalli, M; Begel, M; Belanger-Champagne, C; Bellantoni, L; Bellavance, A; Benitez, J A; Beri, S B; Bernardi, G; Bernhard, R; Bertram, I; Besançon, M; Beuselinck, R; Bezzubov, V A; Bhat, P C; Bhatnagar, V; Biscarat, C; Blazey, G; Blekman, F; Blessing, S; Bloch, D; Bloom, K; Boehnlein, A; Boline, D; Bolton, T A; Borissov, G; Bose, T; Brandt, A; Brock, R; Brooijmans, G; Bross, A; Brown, D; Buchanan, N J; Buchholz, D; Buehler, M; Buescher, V; Bunichev, V; Burdin, S; Burke, S; Burnett, T H; Buszello, C P; Butler, J M; Calfayan, P; Calvet, S; Cammin, J; Carvalho, W; Casey, B C K; Castilla-Valdez, H; Chakrabarti, S; Chakraborty, D; Chan, K; Chan, K M; Chandra, A; Charles, F; Cheu, E; Chevallier, F; Cho, D K; Choi, S; Choudhary, B; Christofek, L; Christoudias, T; Cihangir, S; Claes, D; Coadou, Y; Cooke, M; Cooper, W E; Corcoran, M; Couderc, F; Cousinou, M-C; Crépé-Renaudin, S; Cutts, D; Cwiok, M; da Motta, H; Das, A; Davies, G; De, K; de Jong, S J; De La Cruz-Burelo, E; De Oliveira Martins, C; Degenhardt, J D; Déliot, F; Demarteau, M; Demina, R; Denisov, D; Denisov, S P; Desai, S; Diehl, H T; Diesburg, M; Dominguez, A; Dong, H; Dudko, L V; Duflot, L; Dugad, S R; Duggan, D; Duperrin, A; Dyer, J; Dyshkant, A; Eads, M; Edmunds, D; Ellison, J; Elvira, V D; Enari, Y; Eno, S; Ermolov, P; Evans, H; Evdokimov, A; Evdokimov, V N; Ferapontov, A V; Ferbel, T; Fiedler, F; Filthaut, F; Fisher, W; Fisk, H E; Fortner, M; Fox, H; Fu, S; Fuess, S; Gadfort, T; Galea, C F; Gallas, E; Garcia, C; Garcia-Bellido, A; Gavrilov, V; Gay, P; Geist, W; Gelé, D; Gerber, C E; Gershtein, Y; Gillberg, D; Ginther, G; Gollub, N; Gómez, B; Goussiou, A; Grannis, P D; Greenlee, H; Greenwood, Z D; Gregores, E M; Grenier, G; Gris, Ph; Grivaz, J-F; Grohsjean, A; Grünendahl, S; Grünewald, M W; Guo, F; Guo, J; Gutierrez, G; Gutierrez, P; Haas, A; Hadley, N J; Haefner, P; Hagopian, S; Haley, J; Hall, I; Hall, R E; Han, L; Harder, K; Harel, A; Harrington, R; Hauptman, J M; Hauser, R; Hays, J; Hebbeker, T; Hedin, D; Hegeman, J G; Heinmiller, J M; Heinson, A P; Heintz, U; Hensel, C; Herner, K; Hesketh, G; Hildreth, M D; Hirosky, R; Hobbs, J D; Hoeneisen, B; Hoeth, H; Hohlfeld, M; Hong, S J; Hossain, S; Houben, P; Hu, Y; Hubacek, Z; Hynek, V; Iashvili, I; Illingworth, R; Ito, A S; Jabeen, S; Jaffré, M; Jain, S; Jakobs, K; Jarvis, C; Jesik, R; Johns, K; Johnson, C; Johnson, M; Jonckheere, A; Jonsson, P; Juste, A; Kajfasz, E; Kalinin, A M; Kalk, J M; Kappler, S; Karmanov, D; Kasper, P A; Katsanos, I; Kau, D; Kaushik, V; Kehoe, R; Kermiche, S; Khalatyan, N; Khanov, A; Kharchilava, A; Kharzheev, Y M; Khatidze, D; Kim, T J; Kirby, M H; Kirsch, M; Klima, B; Kohli, J M; Konrath, J-P; Korablev, V M; Kozelov, A V; Kraus, J; Krop, D; Kuhl, T; Kumar, A; Kupco, A; Kurca, T; Kvita, J; Lacroix, F; Lam, D; Lammers, S; Landsberg, G; Lebrun, P; Lee, W M; Leflat, A; Lellouch, J; Leveque, J; Li, J; Li, L; Li, Q Z; Lietti, S M; Lima, J G R; Lincoln, D; Linnemann, J; Lipaev, V V; Lipton, R; Liu, Y; Liu, Z; Lobodenko, A; Lokajicek, M; Love, P; Lubatti, H J; Luna, R; Lyon, A L; Maciel, A K A; Mackin, D; Madaras, R J; Mättig, P; Magass, C; Magerkurth, A; Mal, P K; Malbouisson, H B; Malik, S; Malyshev, V L; Mao, H S; Maravin, Y; Martin, B; McCarthy, R; Melnitchouk, A; Mendoza, L; Mercadante, P G; Merkin, M; Merritt, K W; Meyer, A; Meyer, J; Millet, T; Mitrevski, J; Molina, J; Mommsen, R K; Mondal, N K; Moore, R W; Moulik, T; Muanza, G S; Mulders, M; Mulhearn, M; Mundal, O; Mundim, L; Nagy, E; Naimuddin, M; Narain, M; Naumann, N A; Neal, H A; Negret, J P; Neustroev, P; Nilsen, H; Nogima, H; Novaes, S F; Nunnemann, T; O'Dell, V; O'Neil, D C; Obrant, G; Ochando, C; Onoprienko, D; Oshima, N; Osman, N; Osta, J; Otec, R; Otero y Garzón, G J; Owen, M; Padley, P; Pangilinan, M; Parashar, N; Park, S-J; Park, S K; Parsons, J; Partridge, R; Parua, N; Patwa, A; Pawloski, G; Penning, B; Perfilov, M; Peters, K; Peters, Y; Pétroff, P; Petteni, M; Piegaia, R; Piper, J; Pleier, M-A; Podesta-Lerma, P L M; Podstavkov, V M; Pogorelov, Y; Pol, M-E; Polozov, P; Pope, B G; Popov, A V; Potter, C; da Silva, W L Prado; Prosper, H B; Protopopescu, S; Qian, J; Quadt, A; Quinn, B; Rakitine, A; Rangel, M S; Ranjan, K; Ratoff, P N; Renkel, P; Reucroft, S; Rich, P; Rieger, J; Rijssenbeek, M; Ripp-Baudot, I; Rizatdinova, F; Robinson, S; Rodrigues, R F; Rominsky, M; Royon, C; Rubinov, P; Ruchti, R; Safronov, G; Sajot, G; Sánchez-Hernández, A; Sanders, M P; Santoro, A; Savage, G; Sawyer, L; Scanlon, T; Schaile, D; Schamberger, R D; Scheglov, Y; Schellman, H; Schliephake, T; Schwanenberger, C; Schwartzman, A; Schwienhorst, R; Sekaric, J; Severini, H; Shabalina, E; Shamim, M; Shary, V; Shchukin, A A; Shivpuri, R K; Siccardi, V; Simak, V; Sirotenko, V; Skubic, P; Slattery, P; Smirnov, D; Snow, G R; Snow, J; Snyder, S; Söldner-Rembold, S; Sonnenschein, L; Sopczak, A; Sosebee, M; Soustruznik, K; Spurlock, B; Stark, J; Steele, J; Stolin, V; Stoyanova, D A; Strandberg, J; Strandberg, S; Strang, M A; Strauss, E; Strauss, M; Ströhmer, R; Strom, D; Stutte, L; Sumowidagdo, S; Svoisky, P; Sznajder, A; Tamburello, P; Tanasijczuk, A; Taylor, W; Temple, J; Tiller, B; Tissandier, F; Titov, M; Tokmenin, V V; Toole, T; Torchiani, I; Trefzger, T; Tsybychev, D; Tuchming, B; Tully, C; Tuts, P M; Unalan, R; Uvarov, L; Uvarov, S; Uzunyan, S; Vachon, B; van den Berg, P J; Van Kooten, R; van Leeuwen, W M; Varelas, N; Varnes, E W; Vasilyev, I A; Vaupel, M; Verdier, P; Vertogradov, L S; Verzocchi, M; Villeneuve-Seguier, F; Vint, P; Vokac, P; Von Toerne, E; Voutilainen, M; Wagner, R; Wahl, H D; Wang, L; Wang, M H L S; Warchol, J; Watts, G; Wayne, M; Weber, G; Weber, M; Welty-Rieger, L; Wenger, A; Wermes, N; Wetstein, M; White, A; Wicke, D; Wilson, G W; Wimpenny, S J; Wobisch, M; Wood, D R; Wyatt, T R; Xie, Y; Yacoob, S; Yamada, R; Yan, M; Yasuda, T; Yatsunenko, Y A; Yip, K; Yoo, H D; Youn, S W; Yu, J; Zatserklyaniy, A; Zeitnitz, C; Zhao, T; Zhou, B; Zhu, J; Zielinski, M; Zieminska, D; Zieminski, A; Zivkovic, L; Zutshi, V; Zverev, E G


    We report the results of a search for pair production of doubly charged Higgs bosons via pp over-->H++H - - X-->mu+ mu+ mu- mu- X at sqrt s=1.96 TeV. We use a data set corresponding to an integrated luminosity of 1.1 fb(-1) collected from 2002 to 2006 by the D0 detector at the Fermilab Tevatron Collider. In the absence of an excess above the standard model background, lower mass limits of M(H L +/- +/-) >150 GeV/c2 and M(H R+/- +/-) >127 GeV/c2 at 95% C.L. are set, respectively, for left-handed and right-handed doubly charged Higgs bosons assuming a 100% branching ratio into muons.

  13. Data of evolutionary structure change: 1EUZE-1HRDA [Confc[Archive

    Lifescience Database Archive (English)


  14. Data of evolutionary structure change: 1AHAA-3CTKA [Confc[Archive

    Lifescience Database Archive (English)


  15. Data of evolutionary structure change: 1AVSB-2CTNA [Confc[Archive

    Lifescience Database Archive (English)


  16. Data of evolutionary structure change: 1M39A-2CTNA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1M39A-2CTNA 1M39 2CTN A A ---FGDF-----LTVMTQKMSEKDTKEEILKAFKLFDDD...FDDD-ETGKI ure>HH - EEEure> ILE CA 711 2CTN A 2CT...NA IFVLGAEDGSI ...ure>HHH ure> ATOM 378 CA ILE A 26 61.411 -8.917 -7.203 1.00 0.63

  17. Structures of minimal catalytic fragments of topoisomerase V reveals conformational changes relevant for DNA binding. (United States)

    Rajan, Rakhi; Taneja, Bhupesh; Mondragón, Alfonso


    Topoisomerase V is an archaeal type I topoisomerase that is unique among topoisomerases due to presence of both topoisomerase and DNA repair activities in the same protein. It is organized as an N-terminal topoisomerase domain followed by 24 tandem helix-hairpin-helix (HhH) motifs. Structural studies have shown that the active site is buried by the (HhH) motifs. Here we show that the N-terminal domain can relax DNA in the absence of any HhH motifs and that the HhH motifs are required for stable protein-DNA complex formation. Crystal structures of various topoisomerase V fragments show changes in the relative orientation of the domains mediated by a long bent linker helix, and these movements are essential for the DNA to enter the active site. Phosphate ions bound to the protein near the active site helped model DNA in the topoisomerase domain and show how topoisomerase V may interact with DNA.

  18. Measuring Trilinear Higgs Coupling in $WHH$ and $ZHH$ Productions at the HL-LHC

    CERN Document Server

    Cao, Qing-Hong; Yan, Bin


    Determination of trilinear Higgs coupling ($\\lambda_{HHH}=\\kappa\\lambda_{HHH}^{\\rm SM}$) through Higgs pair productions is a major motivation for the LHC high luminosity phase. We perform a detailed collider simulation to explore the potential of measuring $\\lambda_{HHH}$ in the $VHH$ ($V=W,Z$) production at the HL-LHC. We find that the trilinear Higgs coupling in the SM ($\\lambda_{HHH}^{\\rm SM}$) could be measured at the level of $1.3\\sigma$. Combining with the gluon fusion, vector boson fusion and $t\\bar{t}HH$ channels, $\\lambda_{HHH}^{\\rm SM}$ is expected to be measured at the level of $3.13\\sigma$. If no evidence of Higgs pair productions were observed, the $VHH$ production, together with the gluon fusion channel, would impose a bound of $0.5\\leq \\kappa \\leq 2.2$ at the 95\\% confidence level.

  19. Measuring the 2HDM Scalar Potential at LHC14

    CERN Document Server

    Barger, Vernon; Jackson, Chris B; Peterson, Andrea D; Shaughnessy, Gabe


    After the extraordinary discovery of the Higgs boson at the LHC, the next goal is to pin down its underlying dynamics by measuring the Higgs self-couplings, along with its couplings to gauge and matter particles. As a prototype model of new physics in the scalar sector, we consider the Two Higgs Doublet Model (2HDM) with CP-conservation, and evaluate the prospects for measuring the trilinear scalar couplings among the CP-even Higgs bosons $h$ and $H$ ($\\lambda^{hhh}$, $\\lambda^{hhH}$, $\\lambda^{hHH}$) at LHC14. The continuum and resonant production of CP-even Higgs boson pairs, $hh$ and $hH$, offer complementary probes of the scalar potential away from the light-Higgs decoupling limit. We identify the viable search channels at LHC14 and estimate their expected discovery sensitivities.

  20. Summary of CARE-HHH Mini-Workshop on LHC Crab Cavity Validation, 21 August 2008

    CERN Document Server

    Calaga, R; Garoby, R; Linnecar, T; Tomás, R; Zimmermann, F; CERN. Geneva. BE Department


    A global LHC crab-cavity collaboration is rapidly advancing the R&D of a complete crab cavity cryomodule and performing the associated beam dynamics simulations compatible with a prototype test in the phase 0/I upgrade with the aim of establishing a full crab crossing scheme for the phase II upgrade of the LHC. A one day CARE-HHH mini-workshop was held on August 21, 2008 at CERN to discuss crab crossing in the LHC phase 0/I & II upgrades and this reports summarizes the activities of the four sessions that took place during the workshop. The goals of this crab-cavity workshop were fourfold: (1) to discuss prospects of crab cavities in LHC upgrades (2) to review the status of the cryomodule development and beam dynamics, (3) to establish validity requirements for LHC crab cavities which need to be demonstrated prior to their installation into the LHC, and (4) to provide guidance & coordination for the global collaborators.

  1. The structure of the XPF-ssDNA complex underscores the distinct roles of the XPF and ERCC1 helix- hairpin-helix domains in ss/ds DNA recognition. (United States)

    Das, Devashish; Folkers, Gert E; van Dijk, Marc; Jaspers, Nicolaas G J; Hoeijmakers, Jan H J; Kaptein, Robert; Boelens, Rolf


    Human XPF/ERCC1 is a structure-specific DNA endonuclease that nicks the damaged DNA strand at the 5' end during nucleotide excision repair. We determined the structure of the complex of the C-terminal domain of XPF with 10 nt ssDNA. A positively charged region within the second helix of the first HhH motif contacts the ssDNA phosphate backbone. One guanine base is flipped out of register and positioned in a pocket contacting residues from both HhH motifs of XPF. Comparison to other HhH-containing proteins indicates a one-residue deletion in the second HhH motif of XPF that has altered the hairpin conformation, thereby permitting ssDNA interactions. Previous nuclear magnetic resonance studies showed that ERCC1 in the XPF-ERCC1 heterodimer can bind dsDNA. Combining the two observations gives a model that underscores the asymmetry of the human XPF/ERCC1 heterodimer in binding at an ss/ds DNA junction.

  2. Home telemonitoring in heart failure patients: the HHH study (Home or Hospital in Heart Failure) (United States)

    Mortara, Andrea; Pinna, Gian Domenico; Johnson, Paul; Maestri, Roberto; Capomolla, Soccorso; La Rovere, Maria Teresa; Ponikowski, Piotr; Tavazzi, Luigi; Sleight, Peter


    Aims The Home or Hospital in Heart failure (HHH) study was a European Community-funded, multinational, randomized controlled clinical trial, conducted in the UK, Poland, and Italy, to assess the feasibility of a new system of home telemonitoring (HT). The HT system was used to monitor clinical and physiological parameters, and its effectiveness (compared with usual care) in reducing cardiac events in heart failure (HF) patients was evaluated. Measurements were patient-managed. Methods and results From 2002 to 2004, 461 HF patients (age 60 ± 11 years, New York Heart Association class 2.4 ± 0.6, left ventricular ejection fraction 29 ± 7%) were enrolled at 11 centres and randomized (1:2) to either usual outpatient care or HT administered as three randomized strategies: (i) monthly telephone contact; (ii) strategy 1 plus weekly transmission of vital signs; and (iii) strategy 2 plus monthly 24 h recording of cardiorespiratory activity. Patients completed 81% of vital signs transmissions, as well as 92% of cardiorespiratory recordings. Over a 12-month follow-up, there was no significant effect of HT in reducing bed-days occupancy for HF or cardiac death plus HF hospitalization. Post hoc analysis revealed a heterogeneous effect of HT in the three countries with a trend towards a reduction of events in Italy. Conclusion Home or Hospital in Heart failure indicates that self-managed HT of clinical and physiological parameters is feasible in HF patients, with surprisingly high compliance. Whether HT contributes to a reduction of cardiac events requires further investigation. PMID:19228800

  3. A novel R275X mutation of the SLC25A15 gene in a Japanese patient with the HHH syndrome. (United States)

    Torisu, Hiroyuki; Kira, Ryutaro; Kanazawa, Naomi; Takemoto, Megumi; Sanefuji, Masafumi; Sakai, Yasunari; Tsujino, Seiichi; Hara, Toshiro


    The hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome (MIM 238970) is an autosomal recessive metabolic disorder caused by a deficiency of the mitochondrial ornithine transporter, one of the urea cycle components. Mutations in the SLC25A15 gene have been coupled to the HHH syndrome. We describe a Japanese female patient with the HHH syndrome due to a novel homozygous R275X SLC25A15 mutation and male sibling who presumably carried the same mutation. He exhibited slowly progressive deterioration with seizures, a gait disturbance due to polyneuropathy, episodic confusion, and died of acute encephalopathy at 34 years of age while the proband exhibited moderate mental retardation, seizures, mild spastic paraplegia, and deafness without neurological deterioration for more than 20 years. The clinical features of previously documented patients with the homozygous SLC25A15 mutation demonstrated that genotype did not simply correlate with clinical severity. The phenotypic variability might depend on other factors, such as dietary and other genetic ones.

  4. Remarkable improvement of methylglyoxal synthase thermostability by His-His interaction. (United States)

    Mohammadi, Malihe; Kashi, Mona Atabakhshi; Zareian, Shekufeh; Mirshahi, Manoochehr; Khajeh, Khosro


    Lately it has been proposed that interaction between two positively charged side chains can stabilize the folded state of proteins. To further explore this point, we studied the effect of histidine-histidine interactions on thermostability of methylglyoxal synthase from Thermus sp. GH5 (TMGS). The crystal structure of TMGS revealed that His23, Arg22, and Phe19 are in close distance and form a surface loop. Here, two modified enzymes were produced by site-directed mutagenesis (SDM); one of them, one histidine (TMGS-HH(O)), and another two histidines (TMGS-HHH(O)) were inserted between Arg22 and His23 (H(O)). In comparison with the wild type, TMGS-HH(O) thermostability increased remarkably, whereas TMGS-HHH(O) was very unstable. To explore the role of His23 in the observed phenomenon, the original His23 in TMGS-HHH(O) was replaced with Ala (TMGS-HHA). Our data showed that the half-life of TMGS-HHA decreased in relation to the wild type. However, its half-life increased in comparison with TMGS-HHH(O). These results demonstrated that histidine-histidine interactions at position 23 in TMGS-HH(O) probably have the main role in TMGS thermostability.

  5. [A case of hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome with spastic paraparesis and severe distal muscle atrophy of lower limbs]. (United States)

    Shigeto, H; Yamada, T; Kobayashi, T; Goto, I


    A 16-year-old boy with hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome was reported. He was the second child of first-cousin consanguineous parents. Since childhood, he was mentally retarded and had frequent episodes of vomiting but no unconsciousness attack. Because of progressive gait disturbance since the age of 15, he was admitted to Kyushu University Hospital. Neurological examination revealed mental defect and spastic paraparesis with bilateral positive pathological reflexes. Moreover, severe muscle atrophy and moderate weakness were observed in the distal portion of lower extremities. The diagnosis of HHH syndrome was made by the examination of amino acids in the serum and urine and by the incorporation study of radioactive ornithine into cultured fibroblasts. EMG and nerve biopsy studies suggested that the muscle atrophy seen in this patient was caused by the degeneration of spinal anterior horn cells. Amino acid imbalance, especially elevation of glutamine and glutamic acid in the CSF, may cause dysfunction of neuronal system including anterior horn cells.

  6. Identification of novel mutations in the SLC25A15 gene in hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome: a clinical, molecular, and functional study. (United States)

    Tessa, Alessandra; Fiermonte, Giuseppe; Dionisi-Vici, Carlo; Paradies, Eleonora; Baumgartner, Matthias R; Chien, Yin-Hsiu; Loguercio, Carmela; de Baulny, Helene Ogier; Nassogne, Marie-Cecile; Schiff, Manuel; Deodato, Federica; Parenti, Giancarlo; Rutledge, S Lane; Vilaseca, M Antonia; Melone, Mariarosa A B; Scarano, Gioacchino; Aldamiz-Echevarría, Luiz; Besley, Guy; Walter, John; Martinez-Hernandez, Eugenia; Hernandez, Jose M; Pierri, Ciro L; Palmieri, Ferdinando; Santorelli, Filippo M


    Hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome is an autosomal recessive disorder of the urea cycle. With the exception of the French-Canadian founder effect, no common mutation has been detected in other populations. In this study, we collected 16 additional HHH cases and expanded the spectrum of SLC25A15/ORC1 mutations. Eleven novel mutations were identified including six new missense and one microrearrangement. We also measured the transport properties of the recombinant purified proteins in reconstituted liposomes for four new and two previously reported missense mutations and proved that the transport activities of these mutant forms of ORC1 were reduced as compared with the wild-type protein; residual activity ranged between 4% and 19%. Furthermore, we designed three-dimensional (3D)-modeling of mutant ORC1 proteins. While modeling the changes in silico allowed us to obtain new information on the pathomechanisms underlying HHH syndrome, we found no clear-cut genotype-phenotype correlations. Although patient metabolic alterations responded well to low-protein therapy, predictions concerning the long-term evolution of HHH syndrome remain uncertain. The preference for a hepatic rather than a neurological presentation at onset also continues, largely, to elude us. Neither modifications in oxidative metabolism-related energy, such as those expected in different mtDNA haplogroups, nor sequence variants in SLC25A2/ORC2 seem to be crucial. Other factors, including protein stability and function, and ORC1-ORC2 structural interactions should be further investigated.

  7. The human and mouse SLC25A29 mitochondrial transporters rescue the deficient ornithine metabolism in fibroblasts of patients with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome. (United States)

    Camacho, José A; Rioseco-Camacho, Natalia


    The hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome is a disorder of the urea cycle (UCD) and ornithine degradation pathway caused by mutations in the mitochondrial ornithine transporter (ORNT1). Unlike other UCDs, HHH syndrome is characterized by a less severe and variable phenotype that we believe may, in part, be due to genes with redundant function to ORNT1, such as the previously characterized ORNT2 gene. We reasoned that SLC25A29, a member of the same subfamily of mitochondrial carrier proteins as ORNT1 and ORNT2, might also have overlapping function with ORNT1. Here, we report that both the human and mouse SLC25A29, previously identified as mitochondrial carnitine/acyl-carnitine transporter-like, when overexpressed transiently also rescues the impaired ornithine transport in cultured HHH fibroblasts. Moreover, we observed that, in the mouse, the Slc25a29 message is more significantly expressed in the CNS and cultured astrocytes when compared with the liver and kidney. These results suggest a potential physiologic role for the SLC25A29 transporter in the oxidation of fatty acids, ornithine degradation pathway, and possibly the urea cycle. Our results show that SLC25A29 is the third human mitochondrial ornithine transporter, designated as ORNT3, which may contribute to the milder and variable phenotype seen in patients with HHH syndrome.

  8. Higgs boson pair production at the Photon Linear Collider in the two Higgs doublet model

    CERN Document Server

    Asakawa, Eri; Kanemura, Shinya; Okada, Yasuhiro; Tsumura, Koji


    We calculate the cross section of the lightest Higgs boson pair production at the Photon Linear Collider in the two Higgs doublet model. We focus on the scenario in which the lightest Higgs boson has the standard model like couplings to gauge bosons. We take into account the one-loop correction to the $hhh$ coupling as well as additional one-loop diagrams due to charged bosons to the $\\gamma\\gamma \\to hh$ helicity amplitudes. We discuss the impact of these corrections on the $hhh$ coupling measurement at the Photon Linear Collider.

  9. All Mammalian Hedgehog Proteins Interact with Cell Adhesion Molecule, Down-regulated by Oncogenes (CDO) and Brother of CDO (BOC) in a Conserved Manner*


    Kavran, Jennifer M.; Ward, Matthew D.; Oladosu, Oyindamola O.; Mulepati, Sabin; Leahy, Daniel J.


    Hedgehog (Hh) signaling proteins stimulate cell proliferation, differentiation, and tissue patterning at multiple points in animal development. A single Hh homolog is present in Drosophila, but three Hh homologs, Sonic Hh, Indian Hh, and Desert Hh, are present in mammals. Distribution, movement, and reception of Hh signals are tightly regulated, and abnormal Hh signaling is associated with developmental defects and cancer. In addition to the integral membrane proteins Patched and Smoothened, ...

  10. Real-Time, General-Purpose, High-Speed Signal Processing Systems for Underwater Research. Proceedings of a Working Level Conference held at Supreme Allied Commander, Atlantic, Anti-Submarine Warfare Research Center (SACLANTCEN) on 18-21 September 1979. Part 1. Sessions I to III. (United States)


    radar processiag (h) 8-1 to 8-6 by RKa-J~rgem Alker NARTIE - Hultiprocesser for high capacity real-time processing i 91 to 94 by TaSgvr Lumdh A modular...H * CREATE REFL. COEF. FOR RAYTRACE ........ * ...................... * * I * DISPLtA REFL. COEF FOR RAYTRACE ...IEEEEEEEEEEEEE Emlllllllllllu -EEIIIIIEEEEE -- Eh~~hh~h ALKER: Correlator for radar processing A MICRO-PROGRAMMABLE CORRELATOR FOR REAL-TIME RADAR

  11. Unitarity, analiticity, dispersion relations and resonances in strongly interacting $W_L W_L$, $Z_L Z_L$ and $hh$ scattering

    CERN Document Server

    Delgado, Rafael L; Llanes-Estrada, Felipe J


    If the Electroweak Symmetry Breaking Sector turns out to be strongly interacting, the actively investigated effective theory for longitudinal gauge bosons plus Higgs can be efficiently extended to cover the regime of saturation of unitarity (where the perturbative expansion breaks down). This is achieved by dispersion relations, whose subtraction constants and left cut contribution can be approximately obtained in different ways giving rise to different unitarization procedures. We illustrate the ideas with the Inverse Amplitude Method, one version of the N/D method and another improved version of the K-matrix. In the three cases we get partial waves which are unitary, analytical with the proper left and right cuts and in some cases poles in the second Riemann sheet that can be understood as dynamically generated resonances. In addition they reproduce at Next to Leading Order (NLO) the perturbative expansion for the five partial waves not vanishing (up to J=2) and they are renormalization scale ($\\mu$) indepe...

  12. Interconversion of η3-H2SiRR' σ-complexes and 16-electron silylene complexes via reversible H-H or C-H elimination. (United States)

    Lipke, Mark C; Neumeyer, Felix; Tilley, T Don


    Solid samples of η(3)-silane complexes [PhBP(Ph)3]RuH(η(3)-H2SiRR') (R,R' = Et2, 1a; PhMe, 1b; Ph2, 1c, MeMes, 1d) decompose when exposed to dynamic vacuum. Gas-phase H2/D2 exchange between isolated, solid samples of 1c-d3 and 1c indicate that a reversible elimination of H2 is the first step in the irreversible decomposition. An efficient solution-phase trap for hydrogen, the 16-electron ruthenium benzyl complex [PhBP(Ph)3]Ru[η(3)-CH2(3,5-Me2C6H3)] (3) reacts quantitatively with H2 in benzene via elimination of mesitylene to form the η(5)-cyclohexadienyl complex [PhBP(Ph)3]Ru(η(5)-C6H7) (4). This H2 trapping reaction was utilized to drive forward and quantify the elimination of H2 from 1b,d in solution, which resulted in the decomposition of 1b,d to form 4 and several organosilicon products that could not be identified. Reaction of {[PhBP(Ph)3]Ru(μ-Cl)}2 (2) with (THF)2Li(SiHMes2) forms a new η(3)-H2Si species [PhBP(Ph)3]Ru[CH2(2-(η(3)-H2SiMes)-3,5-Me2C6H2)] (5) which reacts with H2 to form the η(3)-H2SiMes2 complex [PhBP(Ph)3]RuH(η(3)-H2SiMes2) (1e). Complex 1e was identified by NMR spectroscopy prior to its decomposition by elimination of Mes2SiH2 to form 4. DFT calculations indicate that an isomer of 5, the 16-electron silylene complex [PhBP(Ph)3]Ru(μ-H)(═SiMes2), is only 2 kcal/mol higher in energy than 5. Treatment of 5 with XylNC (Xyl = 2,6-dimethylphenyl) resulted in trapping of [PhBP(Ph)3]Ru(μ-H)(═SiMes2) to form the 18-electron silylene complex [PhBP(Ph)3]Ru(CNXyl)(μ-H)(═SiMes2) (6). A closely related germylene complex [PhBP(Ph)3]Ru[CN(2,6-diphenyl-4-MeC6H2)](H)(═GeH(t)Bu) (8) was prepared from reaction of (t)BuGeH3 with the benzyl complex [PhBP(Ph)3]Ru[CN(2,6-diphenyl-4-MeC6H2)][η(1)-CH2(3,5-Me2C6H3)] (7). Single crystal XRD analysis indicated that unlike for 6, the hydride ligand in 8 is a terminal hydride that does not engage in 3c-2e Ru-H → Ge bonding. Complex 1b is an effective precatalyst for the catalytic Ge-H dehydrocoupling of (t)BuGeH3 to form ((t)BuGeH2)2 (85% yield) and H2.

  13. Double Higgs production from $HH\\to(b\\bar{b})(b\\bar{b})$ at a 100 TeV hadron collider

    CERN Document Server

    Hartland, Nathan P


    In this contribution we study the prospects of measuring double Higgs production at a potential 100 TeV future circular collider. We apply an analysis procedure that utilises reconstructed Higgs pairs from multiple final state event topologies in order to maintain high selection efficiencies. Signal purity is then further improved by means of a artificial neural network classifier. The results of this analysis for the high luminosity LHC show significant potential, however when applied to a 100 TeV hadron collider we find that such a measurement is likely to suffer from a very poor signal to background ratio. Such a measurement at the FCC is therefore likely to be significantly more challenging than at the high luminosity phase of the LHC.

  14. Environmental Assessment, Search and Rescue Training, HH-60 and HC-130, 920th Rescue Group, 301st and 39th Rescue Squadrons, Patrick Air Force Base, Florida (United States)


    Matagorda Bay, Laguna Madre , and the Gulf inlets of Texas (Doughty 1984, Hildebrand 1982, Shaver 1994), the Gulf of Mexico off Florida from Yankeetown...sea turtle Caretta caretta (Linnaeus 1758). U.S. Fish and Wildlife Service, Biological Report 88 (14). Doughty, R.W. 1984. Sea turtles in Texas ...III waters (recreation, fish and wildlife management). An integral part of the Indian River Lagoon (IRL) Estuary, it is one of the three basins

  15. Transcriptional Regulation and Adaptation to a High-Fiber Environment in Bacillus subtilis HH2 Isolated from Feces of the Giant Panda: e0116935

    National Research Council Canada - National Science Library

    Ziyao Zhou; Xiaoxiao Zhou; Jin Li; Zhijun Zhong; Wei Li; Xuehan Liu; Furui Liu; Huaiyi Su; Yongjiu Luo; Wuyang Gu; Chengdong Wang; Hemin Zhang; Desheng Li; Tingmei He; Hualin Fu; Suizhong Cao; Jinjiang Shi; Guangneng Peng


      In the giant panda, adaptation to a high-fiber environment is a first step for the adequate functioning of intestinal bacteria, as the high cellulose content of the gut due to the panda's vegetarian...

  16. Transcriptional regulation and adaptation to a high-fiber environment in Bacillus subtilis HH2 isolated from feces of the giant panda

    National Research Council Canada - National Science Library

    Zhou, Ziyao; Zhou, Xiaoxiao; Li, Jin; Zhong, Zhijun; Li, Wei; Liu, Xuehan; Liu, Furui; Su, Huaiyi; Luo, Yongjiu; Gu, Wuyang; Wang, Chengdong; Zhang, Hemin; Li, Desheng; He, Tingmei; Fu, Hualin; Cao, Suizhong; Shi, Jinjiang; Peng, Guangneng


    In the giant panda, adaptation to a high-fiber environment is a first step for the adequate functioning of intestinal bacteria, as the high cellulose content of the gut due to the panda's vegetarian...

  17. Preliminary design studies of a 100 MeV H-/H+ LINAC as injector for SNS synchrotron/ADS LINAC

    Indian Academy of Sciences (India)

    S A Pande; Moonooku Prasad; Nita Kulkarni; P R Hannurkar


    It is proposed to construct a spallation neutron source (SNS) at Centre for Advanced Technology (CAT) based on a 1 GeV proton synchrotron with 100 MeV H- LINAC as injector. Additionally, the LINAC can form the first 100 MeV part of a 1 GeV proton LINAC to be built in future for accelerator driven system (ADS) applications. We are exploring a configuration of the 100 MeV LINAC which will consist of an H- ion source, a 4–6 MeV RFQ followed either by a 20 MeV drift tube LINAC (DTL) and 100 MeV separated function drift tube LINAC (SDTL) or a coupled cavity drift tube LINAC (CCDTL) structure. In this paper, we present the results of our preliminary physics design studies of the RFQ–SDTL, RFQ–CCDTL and RFQ–DTL–SDTL configurations. The design of the 4.5 MeV RFQ is discussed along with the matching sections between the RFQ–SDTL/DTL and RFQ–CCDTL. The choice of the accelerator configuration and that of various parameters of the individual accelerator structures under consideration are discussed. The design objectives are to arrive at a configuration which eases heat removal for CW operation and which is less prone to halo formation in order to reduce the beam loss at higher energies.

  18. Search for pair production of doubly-charged Higgs bosons in the H^{++}H^{--}^ to mu^+mu^+mu^-mu^- final state at D0

    CERN Document Server

    Abazov, V M; Abolins, M; Acharya, B S; Adams, M; Adams, T; Aguiló, E; Ahn, S H; Ahsan, M; Alexeev, G D; Alkhazov, G; Alton, A; Alverson, G; Alves, G A; Anastasoaie, M; Ancu, L S; Andeen, T; Anderson, S; Andrieu, B; Anzelc, M S; Aoki, M; Arnoud, Y; Arov, M; Arthaud, M; Askew, A; sman, B; Assis-Jesus, A C S; Atramentov, O; Avila, C; Ay, C; Badaud, F; Baden, AA; Bagby, L; Baldin, B; Bandurin, D V; Banerjee, P; Banerjee, S; Barberis, E; Barfuss, A F; Bargassa, P; Baringer, P; Barreto, J; Bartlett, J F; Bassler, U; Bauer, D; Beale, S; Bean, A; Begalli, M; Begel, M; Belanger-Champagne, C; Bellantoni, L; Bellavance, A; Benítez, J A; Beri, S B; Bernardi, G; Bernhard, R; Bertram, I; Besançon, M; Beuselinck, R; Bezzubov, V A; Bhat, P C; Bhatnagar, V; Biscarat, C; Blazey, G; Blekman, F; Blessing, S; Bloch, D; Bloom, K; Böhnlein, A; Boline, D; Bolton, T A; Borissov, G; Bose, T; Brandt, A; Brock, R; Brooijmans, G; Bross, A; Brown, D; Buchanan, N J; Buchholz, D; Bühler, M; Büscher, V; Bunichev, V; Burdin, S; Burke, S; Burnett, T H; Buszello, C P; Butler, J M; Calfayan, P; Calvet, S; Cammin, J; Carvalho, W; Casey, B C K; Castilla-Valdez, H; Chakrabarti, S; Chakraborty, D; Chan, K; Chan, K M; Chandra, A; Charles, F; Cheu, E; Chevallier, F; Cho, D K; Choi, S; Choudhary, B; Christofek, L; Christoudias, T; Cihangir, S; Claes, D; Coadou, Y; Cooke, M; Cooper, W E; Corcoran, M; Couderc, F; Cousinou, M C; Crepe-Renaudin, S; Cutts, D; Cwiok, M; Da Motta, H; Das, A; Davies, G; De, K; De Jong, S J; De La Cruz-Burelo, E; De Oliveira Martins, C; Degenhardt, J D; Dliot, F; Demarteau, M; Demina, R; Denisov, D; Denisov, S P; Desai, S; Diehl, H T; Diesburg, M; Dominguez, A; Dong, H; Dudko, L V; Duflot, L; Dugad, S R; Duggan, D; Duperrin, A; Dyer, J; Dyshkant, A; Eads, M; Edmunds, D; Ellison, J; Elvira, V D; Enari, Y; Eno, S; Ermolov, P; Evans, H; Evdokimov, A; Evdokimov, V N; Ferapontov, A V; Ferbel, T; Fiedler, F; Filthaut, F; Fisher, W; Fisk, H E; Fortner, M; Fox, H; Fu, S; Fuess, S; Gadfort, T; Galea, C F; Gallas, E; García, C; García-Bellido, A; Gavrilov, V; Gay, P; Geist, W; Gel, D; Gerber, C E; Gershtein, Yu; Gillberg, D; Ginther, G; Gollub, N; Gmez, B; Goussiou, A; Grannis, P D; Greenlee, H; Greenwood, Z D; Gregores, E M; Grenier, G; Gris, P; Grivaz, J F; Grohsjean, A; Grünendahl, S; Grünewald, M W; Guo, F; Guo, J; Gutíerrez, G; Gutíerrez, P; Haas, A; Hadley, N J; Haefner, P; Hagopian, S; Haley, J; Hall, I; Hall, R E; Han, L; Harder, K; Harel, A; Harrington, R; Hauptman, J M; Hauser, R; Hays, J; Hebbeker, T; Hedin, D; Hegeman, J G; Heinmiller, J M; Heinson, A P; Heintz, U; Hensel, C; Herner, K; Hesketh, G; Hildreth, M D; Hirosky, R; Hobbs, J D; Hoeneisen, B; Hoeth, H; Hohlfeld, M; Hong, S J; Hossain, S; Houben, P; Hu, Y; Hubacek, Z; Hynek, V; Iashvili, I; Illingworth, R; Ito, A S; Jabeen, S; Jaffré, M; Jain, S; Jakobs, K; Jarvis, C; Jesik, e R; Johns, K; Johnson, C; Johnson, M; Jonckheere, A; Jonsson, P; Juste, A; Kajfasz, E; Kalinin, A M; Kalk, J M; Kappler, S; Karmanov, D; Kasper, P A; Katsanos, I; Kau, D; Kaushik, V; Kehoe, R; Kermiche, S; Khalatyan, N; Khanov, A; Kharchilava, A; Kharzheev, Yu M; Khatidze, D; Kim, T J; Kirby, M H; Kirsch, M; Klima, B; Kohli, J M; Konrath, J P; Korablev, V M; Kozelov, A V; Kraus, J; Krop, D; Kühl, T; Kumar, A; Kupco, A; Kura, T; Kvita, J; Lacroix, F; Lam, cD; Lammers, S; Landsberg, G; Lebrun, P; Lee, W M; Leflat, A; Lellouch, J; Lévêque, J; Li, J; Li, L; Li, Q Z; Lietti, S M; Lima, J G R; Lincoln, D; Linnemann, J; Lipaev, V V; Lipton, R; Liu, Y; Liu, Z; Lobodenko, A; Lokajícek, M; Love, P; Lubatti, H J; Luna, R; Lyon, A L; Maciel, A K A; Mackin, D; Madaras, R J; Mättig, P; Magass, C; Magerkurth, A; Mal, P K; Malbouisson, H B; Malik, S; Malyshev, V L; Mao, H S; Maravin, Y; Martin, B; McCarthy, R; Melnitchouk, A; Mendoza, L; Mercadante, P G; Merkin, M; Merritt, K W; Meyer, A; Meyer, J; Millet, T; Mitrevski, J; Molina, J; Mommsen, R K; Mondal, N K; Moore, R W; Moulik, T; Muanza, G S; Mulders, M; Mulhearn, M; Mundal, O; Mundim, L; Nagy, E; Naimuddin, M; Narain, M; Naumann, N A; Neal, H A; Negret, J P; Neustroev, P; Nilsen, H; Nogima, H; Novaes, S F; Nunnemann, T; O'Dell, V; O'Neil, D C; Obrant, G; Ochando, C; Onoprienko, D; Oshima, N; Osman, N; Osta, J; Otec, R; Oteroy-Garzon, G J; Owen, M; Padley, P; Pangilinan, M; Parashar, N; Park, S J; Park, S K; Parsons, J; Partridge, R; Parua, N; Patwa, A; Pawloski, G; Penning, B; Perfilov, M; Peters, K; Peters, Y; Pétroff, P; Petteni, M; Piegaia, R; Piper, J; Pleier, M A; Podesta-Lerma, P L M; Podstavkov, V M; Pogorelov, Y; Pol, M E; Polozov, P; Pope, B G; Popov, A V; Potter, C; Prado da Silva, W L; Prosper, H B; Protopopescu, S; Qian, J; Quadt, A; Quinn, B; Rakitine, A; Rangel, M S; Ranjan, K; Ratoff, P N; Renkel, P; Reucroft, S; Rich, P; Rieger, J; Rijssenbeek, M; Ripp-Baudot, I; Rizatdinova, F; Robinson, S; Rodrigues, R F; Rominsky, M; Royon, C; Rubinov, P; Ruchti, R; Safronov, G; Sajot, G; Sánchez-Hernández, A; Sanders, M P; Santoro, A; Savage, G; Sawyer, L; Scanlon, T; Schaile, A D; Schamberger, R D; Scheglov, Y; Schellman, H; Schliephake, T; Schwanenberger, C; Schwartzman, A; Schwienhorst, R; Sekaric, J; Severini, H; Shabalina, E; Shamim, M; Shary, V; Shchukin, A A; Shivpuri, R K; Siccardi, V; Simák, V; Sirotenko, V; Skubic, P; Slattery, P; Smirnov, D; Snow, G R; Snow, J; Snyder, S; Söldner-Rembold, S; Sonnenschein, L; Sopczak, A; Sosebee, M; Soustruznik, K; Spurlock, B; Stark, J; Steele, J; Stolin, V; Stoyanova, D A; Strandberg, J; Strandberg, S; Strang, M A; Strauss, E; Strauss, M; Ströhmer, R; Strom, D; Stutte, L; Sumowidagdo, S; Svoisky, P; Sznajder, A; Tamburello, P; Tanasijczuk, A; Taylor, W; Temple, J; Tiller, B; Tissandier, F; Titov, M; Tokmenin, V V; Toole, T; Torchiani, I; Trefzger, T; Tsybychev, D; Tuchming, B; Tully, C; Tuts, P M; Unalan, R; Uvarov, L; Uvarov, S; Uzunyan, S; Vachon, B; vanden Berg, P J; Van Kooten, R; Van Leeuwen, W M; Varelas, N; Varnes, E W; Vasilyev, I A; Vaupel, M; Verdier, P; Vertogradov, L S; Verzocchi, M; Villeneuve-Séguier, F; Vint, P; Vokac, P; Von Törne, E; Voutilainen, M; Wagner, R; Wahl, H D; Wang, L; Wang, M H L S; Warchol, J; Watts, G; Wayne, M; Weber, G; Weber, M; Welty-Rieger, L; Wenger, A; Wermes, N; Wetstein, M; White, A; Wicke, D; Wilson, G W; Wimpenny, S J; Wobisch, M; Wood, D R; Wyatt, T R; Xie, Y; Yacoob, S; Yamada, R; Yan, M; Yasuda, T; Yatsunenko, Y A; Yip, K; Yoo, H D; Youn, S W; Yu, J; Zatserklyaniy, A; Zeitnitz, C; Zhao, T; Zhou, B; Zhu, J; Zielinski, M; Zieminska, D; Zieminski, A; Zivkovic, L; Zutshi, V; Zverev, E G


    We report the results of a search for pair production of doubly-charged Higgs bosons via ppbar to H^{++}H^{--}X to mu^+mu^+mu^-mu^-X at sqrt{s} = 1.96 TeV. We use a dataset corresponding to an integrated luminosity of 1.1 fb^{-1} collected from 2002 to 2006 by the D0 detector at the Fermilab Tevatron Collider. In the absence of an excess above the standard model background, lower mass limits of M(H^{pmpm}_L) > 150 GeV/c^2 and M(H^{pmpm}_R) > 127 GeV/c^2 at 95% C.L. are set, respectively, for left-handed and right-handed doubly-charged Higgs bosons assuming a 100% branching ratio into muons.

  19. La concepción del sujeto en los tratados de DD. HH. : Implicancias para la psicología en el ámbito forense


    Angelini, Silvio O.


    El presente trabajo tiene por objetivo reflexionar sobre la concepción de sujeto que plantean los tratados internacionales de derechos humanos, el nuevo marco filosófico sobre el que se sustenta dicha concepción y las consecuencias que ello tiene para el ejercicio profesional de la psicología en el ámbito forense en particular. A los fines operativos se analizaron algunos que han sido sancionados por las NN.UU. y ratificados o en proceso de ratificación por la República Argentina.

  20. HH domain of Alzheimer's disease Abeta provides structural basis for neuronal binding in PC12 and mouse cortical/hippocampal neurons.

    Directory of Open Access Journals (Sweden)

    Joseph F Poduslo

    Full Text Available A key question in understanding AD is whether extracellular Abeta deposition of parenchymal amyloid plaques or intraneuronal Abeta accumulation initiates the AD process. Amyloid precursor protein (APP is endocytosed from the cell surface into endosomes where it is cleaved to produce soluble Abeta which is then released into the brain interstitial fluid. Intraneuronal Abeta accumulation is hypothesized to predominate from the neuronal uptake of this soluble extracellular Abeta rather than from ER/Golgi processing of APP. We demonstrate that substitution of the two adjacent histidine residues of Abeta40 results in a significant decrease in its binding with PC12 cells and mouse cortical/hippocampal neurons. These substitutions also result in a dramatic enhancement of both thioflavin-T positive fibril formation and binding to preformed Abeta fibrils while maintaining its plaque-binding ability in AD transgenic mice. Hence, alteration of the histidine domain of Abeta prevented neuronal binding and drove Abeta to enhanced fibril formation and subsequent amyloid plaque deposition--a potential mechanism for removing toxic species of Abeta. Substitution or even masking of these Abeta histidine residues might provide a new therapeutic direction for minimizing neuronal uptake and subsequent neuronal degeneration and maximizing targeting to amyloid plaques.

  1. A peptide mimic of an antigenic loop of alpha-human chorionic gonadotropin hormone: solution structure and interaction with a llama V-HH domain

    NARCIS (Netherlands)

    Ferrat, G.; Renisio, J.G.; Morelli, X.; Slootstra, J.W.; Meloen, R.; Cambillau, C.; Darbon, H.


    The X-ray structure of a ternary complex between human chorionic gonadotropin hormone (hCG) and two Fvs recognizing its alpha and beta subunits has been recently determined. The Fvs recognize the elongated hCG molecule by its two ends, one being the Leu-12-Cys-29 loop of the alpha subunit. We have d

  2. Integration of stable carbon isotope, microbial community, dissolved hydrogen gas, and 2HH2O tracer data to assess bioaugmentation for chlorinated ethene degradation in fractured rocks (United States)

    Révész, Kinga M.; Lollar, Barbara Sherwood; Kirshtein, Julie D.; Tiedeman, Claire R.; Imbrigiotta, Thomas E.; Goode, Daniel J.; Shapiro, Allen M.; Voytek, Mary A.; Lacombe, Pierre J.; Busenberg, Eurybiades


    An in situ bioaugmentation (BA) experiment was conducted to understand processes controlling microbial dechlorination of trichloroethene (TCE) in groundwater at the Naval Air Warfare Center (NAWC), West Trenton, NJ. In the BA experiment, an electron donor (emulsified vegetable oil and sodium lactate) and a chloro-respiring microbial consortium were injected into a well in fractured mudstone of Triassic age. Water enriched in 2H was also injected as a tracer of the BA solution, to monitor advective transport processes. The changes in concentration and the δ13C of TCE, cis-dichloroethene (cis-DCE), and vinyl chloride (VC); the δ2H of water; changes in the abundance of the microbial communities; and the concentration of dissolved H2 gas compared to pre- test conditions, provided multiple lines of evidence that enhanced biodegradation occurred in the injection well and in two downgradient wells. For those wells where the biodegradation was stimulated intensively, the sum of the molar chlorinated ethene (CE) concentrations in post-BA water was higher than that of the sum of the pre-BA background molar CE concentrations. The concentration ratios of TCE/(cis-DCE + VC) indicated that the increase in molar CE concentration may result from additional TCE mobilized from the rock matrix in response to the oil injection or due to desorption/diffusion. The stable carbon isotope mass-balance calculations show that the weighted average 13C isotope of the CEs was enriched for around a year compared to the background value in a two year monitoring period, an effective indication that dechlorination of VC was occurring. Insights gained from this study can be applied to efforts to use BA in other fractured rock systems. The study demonstrates that a BA approach can substantially enhance in situ bioremediation not only in fractures connected to the injection well, but also in the rock matrix around the well due to processes such as diffusion and desorption. Because the effect of the BA was intensive only in wells where an amendment was distributed during injection, it is necessary to adequately distribute the amendments throughout the fractured rock to achieve substantial bioremediation. The slowdown in BA effect after a year is due to some extend to the decrease abundant of appropriate microbes, but more likely the decreased concentration of electron donor.

  3. Time-dependent MHD shocks and line intensity ratios in the HH 30 jet: A focus on cooling function and numerical resolution

    CERN Document Server

    Tesileanu, O; Mignone, A; Bodo, G; Bacciotti, F


    The coupling between time-dependent, multidimensional MHD numerical codes and radiative line emission is of utmost importance in the studies of the interplay between dynamical and radiative processes in many astrophysical environments, with particular interest for problems involving radiative shocks. There is a widespread consensus that line emitting knots observed in Herbig-Haro jets can be interpreted as radiative shocks. In this paper we address two different aspects relevant to the time-dependent calculations of the line intensity ratios of forbidden transitions, resulting from the excitation by planar, time-dependent radiative shocks traveling in a stratified medium. The first one concerns the impact of the radiation and ionization processes included in the cooling model, and the second one the effects of the numerical grid resolution. In this paper we apply the AMR methodology to the treatment of radiating shocks and show how this method is able to vastly reduce the integration time. The technique is ap...

  4. C-H and H-H Bond Activation via Ligand Dearomatization/Rearomatization of a PN3P-Rhodium(I) Complex

    KAUST Repository

    Huang, Kuo-Wei


    A neutral complex PN3P-Rh(I)Cl (2) was prepared from a reaction of the PN3P pincer ligand (1) with [Rh(COD)Cl]2 (COD = 1,5-cyclooctadiene). Upon treatment with a suitable base, H–H and Csp2–H activation reactions can be achieved through the deprotonation/reprotonation of one of the N–H arms and dearomatization/rearomatization of the central pyridine ring with the oxidation state of Rh remaining I.

  5. An Oomycete CRN Effector Reprograms Expression of Plant HSP Genes by Targeting their Promoters.

    Directory of Open Access Journals (Sweden)

    Tianqiao Song


    Full Text Available Oomycete pathogens produce a large number of CRN effectors to manipulate plant immune responses and promote infection. However, their functional mechanisms are largely unknown. Here, we identified a Phytophthora sojae CRN effector PsCRN108 which contains a putative DNA-binding helix-hairpin-helix (HhH motif and acts in the plant cell nucleus. Silencing of the PsCRN108 gene reduced P. sojae virulence to soybean, while expression of the gene in Nicotiana benthamiana and Arabidopsis thaliana enhanced plant susceptibility to P. capsici. Moreover, PsCRN108 could inhibit expression of HSP genes in A. thaliana, N. benthamiana and soybean. Both the HhH motif and nuclear localization signal of this effector were required for its contribution to virulence and its suppression of HSP gene expression. Furthermore, we found that PsCRN108 targeted HSP promoters in an HSE- and HhH motif-dependent manner. PsCRN108 could inhibit the association of the HSE with the plant heat shock transcription factor AtHsfA1a, which initializes HSP gene expression in response to stress. Therefore, our data support a role for PsCRN108 as a nucleomodulin in down-regulating the expression of plant defense-related genes by directly targeting specific plant promoters.

  6. An Oomycete CRN Effector Reprograms Expression of Plant HSP Genes by Targeting their Promoters. (United States)

    Song, Tianqiao; Ma, Zhenchuan; Shen, Danyu; Li, Qi; Li, Wanlin; Su, Liming; Ye, Tingyue; Zhang, Meixiang; Wang, Yuanchao; Dou, Daolong


    Oomycete pathogens produce a large number of CRN effectors to manipulate plant immune responses and promote infection. However, their functional mechanisms are largely unknown. Here, we identified a Phytophthora sojae CRN effector PsCRN108 which contains a putative DNA-binding helix-hairpin-helix (HhH) motif and acts in the plant cell nucleus. Silencing of the PsCRN108 gene reduced P. sojae virulence to soybean, while expression of the gene in Nicotiana benthamiana and Arabidopsis thaliana enhanced plant susceptibility to P. capsici. Moreover, PsCRN108 could inhibit expression of HSP genes in A. thaliana, N. benthamiana and soybean. Both the HhH motif and nuclear localization signal of this effector were required for its contribution to virulence and its suppression of HSP gene expression. Furthermore, we found that PsCRN108 targeted HSP promoters in an HSE- and HhH motif-dependent manner. PsCRN108 could inhibit the association of the HSE with the plant heat shock transcription factor AtHsfA1a, which initializes HSP gene expression in response to stress. Therefore, our data support a role for PsCRN108 as a nucleomodulin in down-regulating the expression of plant defense-related genes by directly targeting specific plant promoters.

  7. Joint CARE-ELAN, CARE-HHH-APD, and EUROTEV-WP3 Workshop on Electron Cloud Clearing

    CERN Document Server

    Scandale, Walter; Schulte, D; Zimmermann, F; Electron Cloud Effects and Technological Consequences; ECL2


    This report contains the Proceedings of the joint CARE-HHH-APD, CARE-ELAN, and EUROTEV-WP3 Mini-Workshop on 'Electron Cloud Clearing - Electron Cloud and Technical Consequences', "ECL2", held at CERN in Geneva, Switzerland, 1-2 March 2007). The ECL2 workshop explored novel technological remedies against electron-cloud formation in an accelerator beam pipe. A primary motivation for the workshop was the expected harmful electron-cloud effects in the upgraded LHC injectors and in future linear colliders, as well as recent beam observations in operating facilities like ANKA, CESR, KEKB, RHIC, and SPS. The solutions discussed at ECL2 included enamel-based clearing electrodes, slotted vacuum chambers, NEG coating, and grooves. Several of the proposed cures were assessed in terms of their clearing efficiency and the associated beam impedance. The workshop also reviewed new simulation tools like the 3D electron-ion build-up 'Faktor', modeling assumptions, analytical calculations, beam experiments, and laboratory meas...

  8. Summary of the Mini BNL/LARP/CARE-HHH Workshop on Crab Cavities for the LHC (LHC-CC08)

    Energy Technology Data Exchange (ETDEWEB)

    Ben-Zvi,I.; Calaga, R.; Zimmermann, F.


    The first mini-workshop on crab compensation for the LHC luminosity upgrade (LHC-CC08) was held February 24-25, 2008 at the Brookhaven National Laboratory. A total of 35 participants from 3 continents and 15 institutions from around the world participated to discuss the exciting prospect of a crab scheme for the LHC. If realized it will be the first demonstration in hadron colliders. The workshop is organized by joint collaboration of BNL, US-LARP and CARE-HHH. The enormous interest in the subject of crab cavities for the international linear collider and future light sources has resulted in a large international collaboration to exchange aspects of synergy and expertise. A central repository for this exchange of information documenting the latest design effort for LHC crab cavities is consolidated in a wiki page: The main goal of this workshop was to define a road-map for a prototype crab cavity to be installed in the LHC and to discuss the associated R&D and beam dynamics challenges. The diverse subject of implementing the crab scheme resulted in a scientific program with a wide range of subtopics which were divided into 8 sessions. Each session was given a list of fundamental questions to be addressed and used as a guideline to steer the discussions.

  9. CARE-HHH-APD Workshop on Finalizing the Roadmap for the Upgrade of the CERN and GSI Accelerator Complex

    CERN Document Server

    Zimmermann, Frank; BEAM'07; BEAM 2007; Finalizing the Roadmap for the Upgrade of the LHC and GSI Accelerator Complex


    This report contains the Proceedings of the CARE-HHH-APD Event BEAM’07, “Finalizing the Roadmap for the Upgrade of the CERN & GSI Accelerator Complex,” which was held at CERN in Geneva, Switzerland, from 1 to 5 October 2007. BEAM’07 was primarily devoted to beam dynamics limitations for the two, or three, alternative baseline scenarios of the LHC luminosity upgrade and to critical design choices for the upgrade of the LHC injector complex at CERN and for the FAIR complex at GSI. It comprised five parts: (1) a Mini-Workshop on LHC+ Beam Performance, (2) a CERN-GSI Meeting on Collective Effects, (3) the Francesco Ruggiero Memorial Symposium, (4) a Mini-Workshop on the LHC Injectors Upgrade, and (5) the BEAM’07 Summaries. Topics addressed in the first mini-workshop of BEAM’07 ranged from the luminosity performance reach of the upgraded LHC in different scenarios, over the generation and stability of the future LHC beams, the turnaround time, beam–beam effects, luminosity levelling methods, and ...

  10. CARE-HHH-APD Workshop on Interaction Regions for the LHC Upgrade, DAFNE, and SuperB

    CERN Document Server

    Zimmermann, Frank; IR'07; IR 2007


    This report contains the Proceedings of the CARE-HHH-APD Mini-Workshop “IR’07,” which was held in Frascati, Italy, from 7 to 9 November 2007. The central theme of the IR’07 Mini-Workshop was the upgrade of the LHC interaction region (IR). A second topic was the experience with the upgraded DAFNE IR as well as the ongoing plans and studies for SuperB, plus possible applications of crab-waist collisions for the LHC upgrade. Discussions during the workshop addressed the performance and limitations of the IR-upgrade optics performance, the optimization of new LHC triplet magnets, the US-LARP magnet strategy (response to Lucio Rossi’s “challenge”), heat deposition, earlyseparation dipoles, detector-integrated quadrupoles, strategy for crab cavities, beam–beam wire compensators, and crab-waist collisions. At IR’07 all auxiliary systems, e.g. wires and crab cavities, received a strong boost. Energy deposition was shown to add an important criterion to the optics requirements—in a first attempt a ...

  11. Hyperornithinemia-hyperammonemia-homocitrullinuria (HHH)-syndrome. Ultrastructural changes of mitochondria in cultured dermal fibroblasts of three patients. (United States)

    Haust, M D; Dewar, R A; Gatfield, D P; Gordon, B A


    Mitochondria of fibroblasts cultured from the skin obtained at biopsy from three patients with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH)-syndrome, one of the autosomal recessive, heritable urea cycle disorders, were studied with appropriate controls ultrastructurally. The patients were two severely retarded 10- and 12-year-old boys, and a 22-year-old sister of the former whose mental status was at the low normal range; she never had motor impairments or seizures. The mitochondria, similar in all three patients, were increased in number, very long, branching and/or "looping," and tortuous. "Spurs" or "buddings" extended from their lateral surfaces and the terminal segments were often bulbous. Other unusual configurations were also present. In addition, giant forms with large diameter contained innumerable closely-packed and parallel cristae which traversed the entire width of these mitochondria; at times they assumed a "whirled" pattern. The mitochondrial matrix was usually of high electron density. These changes were not a feature of fibroblastic mitochondria of controls. Several changes resembled those of hepatic mitochondria in this disorder. All features are interpreted as an attempt at expanding the mitochondrial volume (via structural substratum) to compensate for the metabolic incompetence of these organelles (a block in transmembranous transfer of ornithine from hyaloplasm into mitochondria for conversion to citrulline).

  12. Long-term monitoring of sleep apnea at home in heart failure patients: preliminary results from the HHH study. (United States)

    Pinna, G D; Maestri, R; Gobbi, E; Capomolla, S; Campana, C; Emdin, M; Di Lenarda, A; La Rovere, M T; Andrews, D; Johnson, P; Mortara, A; Sleight, P


    Sleep apnea is very common in patients with chronic heart failure (CHF) and has important implications in terms of morbidity, mortality and clinical management. Home respiratory telemonitoring might constitute a potential low-cost, widely-applicable alternative to traditional polysomnography in the evaluation and long-term monitoring of breathing disorders in these patients. In this paper we briefly describe the technological infrastructure and present preliminary results of the European Community multicountry trial HHH (Home or Hospital in Heart Failure), which is currently testing a novel system for home telemonitoring of cardiorespiratory signals in CHF patients. The recording and transmitting devices are suitable to be self-managed by the patient. We give a detailed report on the prevalence of nocturnal respiratory disorders at the beginning of the one-year follow-up and on their persistency over the following recordings (one per month). These preliminary findings clearly indicate that intermittent home telemonitoring of respiratory signals based on patient's self-management is feasible in CHF patients and the compliance is high. Reported statistics unambiguously confirm the high prevalence of nocturnal breathing disorders in these patients and clearly show that this phenomenon tends to persist over time.

  13. Signalni put HH-GLI i njegova interakcija s genima BRCA1 i BRCA2 u zloćudnim epitelnim novotvorinama jajnika [Interaction of the Hh-Gli signaling pathway with BRCA1 and BRCA2 gene in ovarian cancer


    Maurac, Ivana


    Uvod: Zloćudna novotvorina jajnika ili karcinom jajnika je sedmi po redu karcinom u žena, čineći 3% svih maligniteta i 6% svih smrtnosti od karcinoma u žena. Uzrok nastanka karcinoma jajnika, još uvijek, nije razjašnjen. Postoji nekoliko čimbenika koji su povezani s povećanom ili smanjenom opasnošću od nastanka zloćudnog tumora (rađanje, dojenje, neplodnost, oralna kontracepcija, hormonsko nadomjesno liječenje, K-ras i HER-2/neu onkogeni, BRCA1 i BRCA2 te p53 tumor supresor gen...

  14. Ornithine and Homocitrulline Impair Mitochondrial Function, Decrease Antioxidant Defenses and Induce Cell Death in Menadione-Stressed Rat Cortical Astrocytes: Potential Mechanisms of Neurological Dysfunction in HHH Syndrome. (United States)

    Zanatta, Ângela; Rodrigues, Marília Danyelle Nunes; Amaral, Alexandre Umpierrez; Souza, Débora Guerini; Quincozes-Santos, André; Wajner, Moacir


    Hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome is caused by deficiency of ornithine translocase leading to predominant tissue accumulation and high urinary excretion of ornithine (Orn), homocitrulline (Hcit) and ammonia. Although affected patients commonly present neurological dysfunction manifested by cognitive deficit, spastic paraplegia, pyramidal and extrapyramidal signs, stroke-like episodes, hypotonia and ataxia, its pathogenesis is still poorly known. Although astrocytes are necessary for neuronal protection. Therefore, in the present study we investigated the effects of Orn and Hcit on cell viability (propidium iodide incorporation), mitochondrial function (thiazolyl blue tetrazolium bromide-MTT-reduction and mitochondrial membrane potential-ΔΨm), antioxidant defenses (GSH) and pro-inflammatory response (NFkB, IL-1β, IL-6 and TNF-α) in unstimulated and menadione-stressed cortical astrocytes that were previously shown to be susceptible to damage by neurotoxins. We first observed that Orn decreased MTT reduction, whereas both amino acids decreased GSH levels, without altering cell viability and the pro-inflammatory factors in unstimulated astrocytes. Furthermore, Orn and Hcit decreased cell viability and ΔΨm in menadione-treated astrocytes. The present data indicate that the major compounds accumulating in HHH syndrome impair mitochondrial function and reduce cell viability and the antioxidant defenses in cultured astrocytes especially when stressed by menadione. It is presumed that these mechanisms may be involved in the neuropathology of this disease.

  15. Clinical trials update from the joint European Society and World Congress of Cardiology meeting: PEP-CHF, ACCLAIM and the HHH study. (United States)

    Cleland, John G F; Coletta, Alison P; Clark, Andrew L


    This article provides information and a commentary on trials relevant to the pathophysiology, prevention and treatment of heart failure, presented at the joint European Society and World Congress of Cardiology meeting held in Barcelona in September 2006. All reports should be considered as preliminary data, as analyses may change in the final publication. The PEP-CHF study suggests that perindopril improves symptoms and functional capacity and may reduce heart failure hospitalisations in patients with diastolic heart failure. Although immune modulation therapy failed to reduce the incidence of all-cause mortality and cardiovascular hospitalisations in the ACCLAIM study, the observed differences in outcome in some heart failure patients warrants further investigation. The HHH study failed to show a beneficial effect of telemonitoring over usual care in patients with heart failure but potentially important country interactions were observed.

  16. Projected sensitivity to non-resonant Higgs boson pair production in the $b\\bar{b}b\\bar{b}$ final state using proton–proton collisions at HL-LHC with the ATLAS detector

    CERN Document Server

    The ATLAS collaboration


    Estimates of the sensitivity to non-resonant Higgs boson pair production using the $HH\\to b\\bar{b}b\\bar{b}$ channel with the full HL-LHC dataset of 3000 fb$^{-1}$ of proton--proton collisions at $\\sqrt{s} = 14\\,$TeV. These estimates are based on the extrapolation of current results obtained with the 2016 dataset, comprising $\\int Ldt = 10.1\\,$fb$^{-1}$ of proton-proton collisions at $\\sqrt{s} = 13\\,$TeV. In the absence of any signal and without (with) systematics, cross-sections 1.5 times (5.2 times) greater than the Standard Model prediction are excluded at the 95% confidence level. The Higgs boson self-coupling, $\\lambda_{HHH}$ can be constrained to $0.2 < \\lambda_{HHH}/\\lambda^{SM}_{HHH} < 7.0$ $(−3.5 < \\lambda_{HHH}/\\lambda^{SM}_{HHH} < 11)$. The sensitivity of the analysis to increasing trigger thresholds has been studied. The jet pT requirement of the projected High-Luminosity LHC trigger increases the cross-section limit by a factor 1.3 (2.2).

  17. Screening and High Throughput Identification of Nitration Bacteria in Hospital Sewage%医院污水中硝化细菌的筛选及高通量鉴定

    Institute of Scientific and Technical Information of China (English)

    赵翠娟; 宋文军; 朱高雄; 魏纪平; 李博志; 张军


    为了减轻医院污水中氮元素对环境的污染,经富集驯化从医院污水样品中筛选出了呈硝化阳性的硝化菌菌群HH-C、HH-E、HH-I、HH-J,采用高通量方法对硝化菌群进行鉴定,用氨氮、亚硝酸盐和硝酸盐快速测定试剂盒对其进行定性测定,再经单菌筛选纯化出10株呈硝化阳性的硝化细菌HH-3、HH-6、HH-8、HH-12、HH-13、HH-16、HH-18、HH-19、HH-21、HH-22,经复筛对这10株菌进行功能验证,选出了3株COD和氨氮降解率高的菌HH-12、HH-13和HH-22并应用到医院污水的处理中.%In order to reduce hospital sewage nitrogen pollution to the environment, this experiment had screened nitration bacteria (NB) groups HH-C, HH-E, HH-I, HH-J that were nitration positive through enrichment and domestication from hospital sewage samples, the NB were identified using high-throughput methods and determined qualitatively by ammonia nitrogen, nitrite, and nitrate rapid determination kit. Then they were screened and purified into 10 nitration-positive NB strains HH-3, HH-6, HH-8, HH-12, HH-13, HH-16, HH-18, HH-19, HH-21, HH-22 with single strain screening and purification, they were verified functionally through rescreening, and elected three high COD and ammonia nitrogen degradation rate of bacterial strains HH-12, HH-13 and HH-22 and applied to the hospital sewage treatment.

  18. AcEST: BP916422 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 31 2.5 sp|P22807|SLOU_DROME Homeobox protein slou OS=Drosophila melanog... 30 3.3 sp|A4ZNR4|NKD2_DANRE Protein naked...rotei... 29 9.6 sp|Q1ZXC2|PABPA_DICDI Polyadenylate-binding protein 1-A OS=Dicty... 29 9.6 sp|Q9VVV9|NKD_DROME Protein naked...S 12 SSS P P S Sbjct: 244 SSSSTAPPSPATSPLS 259 >sp|A4ZNR4|NKD2_DANRE Protein naked cuticle homolog 2 OS=Dani...TH +H +H+H +P HH+H + Sbjct: 32 SVATQPPQSQIPPQPQYQYQMAPPPQTHHVHPHHVHPHHQQHPGYVPSHHHHHQ 85 >sp|Q9VVV9|NKD_DROME Protein naked

  19. X-ray diffraction investigations of adherent and free standing TiN coatings deposited by magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Valvoda, V.; Kuzel, R. Jr.; Dobiasova, L.; Cerny, R. (Charles Univ., Prague (Czechoslovakia). Faculty of Mathematics and Physics); Poulek, V.; Musil, J. (Czechoslovak Academy of Sciences, Prague (Czechoslovakia). Inst. of Physics)


    TiN coatings deposited on steel substrates at different biases and temperatures, and with different nitrogen contents, were studied by conventional X-ray powder diffractometry. The diffraction peaks were separated by profile fitting. In adherent films different kinds of texture and a large anisotropy of lattice parameters (a(hhh) < a(h00) < a(hh0)) were detected. In corresponding free-standing films lower average values of lattice parameters were found and their anisotropy decreased considerably. The microstrain determined from X-ray line broadening remained unchanged, which proves its inelastic nature owing to the lattice defects.

  20. Quimera de ADN polimerasa del fago ϕ29



    Quimera de ADN polimerasa del fago 29. La presente invención se encuadra dentro del campo de la biotecnología. Específicamente, se refiere a una quimera de ADN polimerasa que comprende una región aminoterminal (N-terminal), que codifica para una ADN polimerasa del tipo 29, y una región carboxilo-terminal (C-terminal), que comprende, al menos, un dominio HhH, que se encuentran unidas mediante una secuencia aminoacídica conectora y a su uso para la replicación, amplifi...

  1. Higgs Pair Production in the $H(\\rightarrow \\tau\\tau)H(\\rightarrow b\\bar{b})$ channel at the High-Luminosity LHC

    CERN Document Server

    The ATLAS collaboration


    Prospects studies are presented for the observation of double Higgs production in the channel $H(\\rightarrow b \\overline{b})H(\\rightarrow \\tau \\tau)$ for a total integrated luminosity of 3000~fb$ ^{-1}$ of $\\sqrt{s}=$14~TeV proton-proton collisions at the HL-LHC. A cut-based analysis strategy using MC data and a parametrisation of the ATLAS detector provide assessment to the measurement prospects performed under different assumptions for the trilinear Higgs couplings values. Assuming SM background and SM signal, we expect to set an upper limit of the cross section for the di-Higgs production of $4.3 \\times \\sigma(HH \\rightarrow b\\bar{b}\\tau^+\\tau^-)$ at 95\\% Confidence Level. Using an effective Lagrangian for the Higgs potential, and allowing its trilinear coupling to vary, we can project an exclusion of $\\lambda_{HHH}/\\lambda_{SM} \\leq -4$ and $\\lambda_{HHH}/\\lambda_{SM} \\geq 12$.

  2. Higgs boson pair production at a photon-photon collision in the two Higgs doublet model

    CERN Document Server

    Asakawa, Eri; Kanemura, Shinya; Okada, Yasuhiro; Tsumura, Koji


    We calculate the cross section of Higgs boson pair production at a photon collider in the two Higgs doublet model. We focus on the scenario in which the lightest CP even Higgs boson ($h$) has the standard model like couplings to the gauge bosons. We take into account the one-loop correction to the $hhh$ coupling as well as additional one-loop diagrams due to charged Higgs bosons to the $\\gamma\\gamma\\to hh$ helicity amplitudes. It is found that the full cross section can be enhanced by both these effects to a considerable level. We discuss the impact of these corrections on the $hhh$ coupling measurement at the photon collider.

  3. Ornithine In Vivo Administration Disrupts Redox Homeostasis and Decreases Synaptic Na(+), K (+)-ATPase Activity in Cerebellum of Adolescent Rats: Implications for the Pathogenesis of Hyperornithinemia-Hyperammonemia-Homocitrullinuria (HHH) Syndrome. (United States)

    Zanatta, Ângela; Viegas, Carolina Maso; Hickmann, Fernanda Hermes; de Oliveira Monteiro, Wagner; Sitta, Angela; de Moura Coelho, Daniela; Vargas, Carmen Regla; Leipnitz, Guilhian; Wajner, Moacir


    Hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome is an inborn error of metabolism caused by a defect in the transport of ornithine (Orn) into mitochondrial matrix leading to accumulation of Orn, homocitrulline (Hcit), and ammonia. Affected patients present a variable clinical symptomatology, frequently associated with cerebellar symptoms whose pathogenesis is poorly known. Although in vitro studies reported induction of oxidative stress by the metabolites accumulating in HHH syndrome, so far no report evaluated the in vivo effects of these compounds on redox homeostasis in cerebellum. Therefore, the present work was carried out to investigate the in vivo effects of intracerebellar administration of Orn and Hcit on antioxidant defenses (reduced glutathione concentrations and the activities of superoxide dismutase, catalase, glutathione peroxidase, glutathione reductase, and glucose-6-phosphate dehydrogenase), lipid oxidation (malondialdehyde concentrations), as well as on the activity of synaptic Na(+), K(+)-ATPase, an enzyme highly vulnerable to free radical attack, in the cerebellum of adolescent rats. Orn significantly increased malondialdehyde levels and the activities of all antioxidant enzymes, and reduced Na(+), K(+)-ATPase activity. In contrast, glutathione concentrations were not changed by Orn treatment. Furthermore, intracerebellar administration of Hcit was not able to alter any of these parameters. The present data show for the first time that Orn provokes in vivo lipid oxidative damage, activation of the enzymatic antioxidant defense system, and reduction of the activity of a crucial enzyme involved in neurotransmission. It is presumed that these pathomechanisms may contribute at least partly to explain the neuropathology of cerebellum abnormalities and the ataxia observed in patients with HHH syndrome.

  4. The activation and function of Hh signaling pathway in oral squamous cell carcinoma%Hh信号通路在口腔鳞状细胞癌中的激活及意义

    Institute of Scientific and Technical Information of China (English)

    王俊菊; 宋令岗; 张凯; 刘艳平


    目的:研究口腔鳞状细胞癌中Shh、Ptch、Gli-1在基因及蛋白水平的表达,并探讨其阳性表达与口腔鳞状细胞癌生物学特性之间的关系.方法:采用免疫组织化学方法分别检测40例口腔鳞癌和30例正常口腔黏膜中Shh、Ptch、Gli-1蛋白的表达;RT-PCR法检测10例口腔鳞癌组织及5例正常口腔黏膜组织中Shh、Gli-1和Ptch mRNA的表达.结果:免疫组织化学结果显示,Shh、Ptch和Gli-1蛋白在口腔鳞癌中阳性表达率分别为62.5%、60.0%和65.0%,在正常口腔黏膜中3种蛋白均不表达.非参数统计分析示,Shh及Gli-1的阳性表达与肿瘤的大小、淋巴结转移及临床分期相关 (P<0.05),Ptch蛋白的表达与淋巴结转移呈显著正相关(P<0.05).RT-PCR结果显示,Shh、Ptch、Gli-1 mRNA在口腔鳞癌组织中的阳性表达分别为60%、50%、70%,明显高于正常口腔黏膜,差异有统计学意义 (P<0.05).结论:Hh信号通路在口腔鳞状细胞癌组织中被激活并与口腔鳞癌的发生、发展、转移关系密切.%OBJECTIVE: To examine the expressions of Shh,Gli1 and Ptch,the key elements of Hedgehog signaling pathway in oral squamous cell carcinoma and normal oral mucosa,and to explore the relationship between their expressions and biological parameters. METHODS:The expressions of Shh,Ptch,Gli1 were examined in 40 cases of oral squamous cell carcinoma and 30 normal oral mucosa (as control) by immunohistochemistry. The expressions of Shh,Gli1,Ptch mRNA were analyzed in specimens from 10 oral squamous cell carcinoma and 5 nomal oral specimens by RT-PCR . RESULTS:There was no expression of Shh,Ptch,Gli1 in 30 specimens of normal oral mucosa. The positive expression rates of Shh,Ptch,Gli-1 in oral squamous cell carcinoma were 62.5%,60.0%,65.0%, respectively. Nonparametric Mann-Whitney test showed that the expressions of Shh and Gli-1 were related to the tumor size,lymph node metastasis and clinical stages (P<0.05). But the expression of Ptch was related to metastasis (P<0.05). A statistically significant correlation was found among the expressions of Shh,Ptch and Gli-1 (rs=0.527,0.406,0.578, respectively, P<0.01). Shh,Ptch and Gli-1 mRNA in 60%,50%,70%,respectively,of oral squamous cell c arcinoma were h igher t han i n n omal o ral m ucosa,the d ifference w as s tatistically s ignificant ( P<0.05). C ONCLUSION:The activation of hedgehog signaling pathway in oral squamous cell carcinoma and hedgehog signaling pathway may be related to the development and metastasis of oral squamous cell carcinoma.

  5. Resonances in W_L W_L, Z_L Z_L and hh scattering from dispersive analysis of the non-linear Electroweak+Higgs Effective Theory

    CERN Document Server

    Dobado, Antonio; Llanes-Estrada, Felipe J


    If new resonances of the electroweak symmetry breaking sector (longitudinal-gauge and Higgs) bosons are found in the 1-3 TeV region, the right tool to assess their properties and confront experimental data in a largely model-independent yet simple manner is Unitarized Effective Theory. Its ingredients are: 1) custodial symmetry and the Equivalence Theorem, that allow to approximate W_L and Z_L by an isospin-triplet of Goldstone bosons omega^a in the 1-TeV region. 2) The effective coupling of a generic, approximately massless scalar-isoscalar h to those Goldstone bosons, and the chiral Lagrangian describing them, valid up to about 3 TeV. 3) The Inverse Amplitude or other unitarization techniques that allow to extend the reach of perturbation theory to the first resonance in each partial wave. We highlight some of the parameter space that can give rise to 2-TeV resonances, for example a simultaneous scalar-isoscalar and a vector-isovector ones (motivated by the ATLAS excess) and also the potential importance of...

  6. A model-independent Dalitz plot analysis of $B^\\pm \\to D K^\\pm$ with $D \\to K^0_{\\rm S} h^+h^-$ ($h=\\pi, K$) decays and constraints on the CKM angle $\\gamma$

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voss, H; Voß, C; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A


    A binned Dalitz plot analysis of $B^\\pm \\to D K^\\pm$ decays, with $D \\to K^0_{\\rm S} \\pi^+\\pi^-$ and $D \\to K^0_{\\rm S} K^+ K^-$, is performed to measure the $CP$-violating observables $x_{\\pm}$ and $y_{\\pm}$ which are sensitive to the CKM angle $\\gamma$. The analysis exploits 1.0~$\\rm fb^{-1}$ of data collected by the LHCb experiment. The study makes no model-based assumption on the variation of the strong phase of the $D$ decay amplitude over the Dalitz plot, but uses measurements of this quantity from CLEO-c as input. The values of the parameters are found to be $x_- = (0.0 \\pm 4.3 \\pm 1.5 \\pm 0.6) \\times 10^{-2}$, $y_- = (2.7 \\pm 5.2 \\pm 0.8 \\pm 2.3) \\times 10^{-2}$, $x_+ = ( -10.3 \\pm 4.5 \\pm 1.8 \\pm 1.4 )\\times 10^{-2}$ and $y_+ = (-0.9 \\pm 3.7 \\pm 0.8 \\pm 3.0)\\times 10^{-2}$. The first, second, and third uncertainties are the statistical, the experimental systematic, and the error associated with the precision of the strong-phase parameters measured at CLEO-c, respectively. These results correspond to ...

  7. 超声波提取红景天鞣质工艺的优化%Optimization of Ultrasonic Extraction Process of TanninS from Rhodiola crenulata ( Hook. f. et Thomms. ) HH. Ohba

    Institute of Scientific and Technical Information of China (English)

    龚钢明; 何晓静


    [ Objective ] To optimize the ultrasonic extraction conditions of tannins from Rhodiola crenulata ( Hook. f. et Thomms. ) H. Ohba.[ Method ] The extraction conditions were optimized by orthogonal test based on single factor test, and the content of tannins was determined with casein method. [ Result ] The optimal extraction conditions for tannins from Rhodiola crenulata ( Hook. f. et Thomms. ) H. Ohba. were determined to be: extraction solvent of 70% acetone, solid-to-liquid ratio of 1∶ 10, ulttasonic power of 450 W and extraction duration of 15 min.Under the optimum extraction process, the content of tannins from Rhodiola crenulata (Hook. f. et Thorns. )H. Ohba reached as high as 5.17 nmg/ml. [ Conclusion] The study provides theoretical evidence for the extraction of tannins from Rhodiola crenulata ( Hook. f. et Thomms. ) H.Ohba.%[目的]对红景天[Rhodiola crenulata ( Thoms.)H.Ohba]鞣质超声波提取工艺进行优化.[方法]在单因素试验的基础上,采用正交试验优化红景天鞣质提取的工艺;采用干酪素法测定鞣质含量.[结果]红景天鞣质的提取最佳工艺条件为:70%丙酮溶剂,料液比为1:10,超声功率为450 W,提取时间15 min.在最佳工艺条件下,红景天鞣质提取率为5.17 mg/ml.[结论]该研究为红景天鞣质的进一步开发利用提供了理论依据.

  8. Analysis of Hopf Bifurcation Caused by Leakage Conductance g1 in the H-H Model in Muscles%肌肉中的HH模型的漏电导g1Hopf分岔分析

    Institute of Scientific and Technical Information of China (English)

    王江; 邓斌; 曾启明; 张骅



  9. On non-linear dynamics and an optimal control synthesis of the action potential of membranes (ideal and non-ideal cases) of the Hodgkin-Huxley (HH) mathematical model

    Energy Technology Data Exchange (ETDEWEB)

    Chavarette, Fabio Roberto [Department of Mechanical Design, State University of Campinas, 13083-970 Campinas, SP (Brazil); State University of Sao Paulo at Rio Claro, C.P. 178, 13500-230 Rio Claro, SP (Brazil); Balthazar, Jose Manoel [Department of Mechanical Design, State University of Campinas, 13083-970 Campinas, SP (Brazil); State University of Sao Paulo at Rio Claro, C.P. 178, 13500-230 Rio Claro, SP (Brazil)], E-mail:; Rafikov, Marat [Universidade Regional do Noroeste do Estado do Rio Grande do Sul 98700-000, C.P. 560, Ijui, RS (Brazil); Hermini, Helder Anibal [Department of Mechanical Design, State University of Campinas, 13083-970 Campinas, SP (Brazil)


    In this paper, we have studied the plasmatic membrane behavior using an electric circuit developed by Hodgkin and Huxley in 1952 and have dealt with the variation of the amount of time related to the potassium and sodium conductances in the squid axon. They developed differential equations for the propagation of electric signals; the dynamics of the Hodgkin-Huxley model have been extensively studied both from the view point of its their biological implications and as a test bed for numerical methods, which can be applied to more complex models. Recently, an irregular chaotic movement of the action potential of the membrane was observed for a number of techniques of control with the objective to stabilize the variation of this potential. This paper analyzes the non-linear dynamics of the Hodgkin-Huxley mathematical model, and we present some modifications in the governing equations of the system in order to make it a non-ideal one (taking into account that the energy source has a limited power supply). We also developed an optimal linear control design for the action potential of membranes. Here, we discuss the conditions that allow the use of control linear feedback for this kind of non-linear system.

  10. Sociocognitive determinants of observed and self-reported compliance to hand hygiene guidelines in child day care centers

    NARCIS (Netherlands)

    Zomer, T.P.; Erasmus, V.; Empelen, P. van; Looman, C.; Beeck, E.F. van; Tjon-A-Tsien, A.; Richardus, J.H.; Voeten, H.A.C.M.


    Background: Although hand hygiene (HH) has proven to be an effective measure to prevent infections, HH compliance is generally low. We assessed sociocognitive determinants of caregivers' HH behavior in child day care centers (DCCs) to develop an effective HH intervention. Methods: Caregivers' compli

  11. Hedgehog pathway activity in the LADY prostate tumor model


    Kasper Susan; Crylen Curtis; Gu Guangyu; Gipp Jerry; Bushman Wade


    Abstract Background Robust Hedgehog (Hh) signaling has been implicated as a common feature of human prostate cancer and an important stimulus of tumor growth. The role of Hh signaling has been studied in several xenograft tumor models, however, the role of Hh in tumor development in a transgenic prostate cancer model has never been examined. Results We analyzed expression of Hh pathway components and conserved Hh target genes along with progenitor cell markers and selected markers of epitheli...

  12. Higgs Boson Self-Coupling at High Energy $\\gamma \\gamma$ Collider

    CERN Document Server

    Gutierrez-Rodriguez, A; Sampayo, O A


    We analyzed the double production and the triple self-coupling of the standard model Higgs boson at future $\\gamma \\gamma$ collider energies, with the reactions $\\gamma\\gamma \\rightarrow f \\bar f HH$ $(f=b, t)$. We evaluated the total cross section for $f\\bar fHH$ and calculated the total number of events considering the complete set of Feynman diagrams at tree-level and for different values of the triple coupling $\\kappa\\lambda_{HHH}$. We have also analyzed the sensitivity for the considered reaction and we show the results as 95% C.L. regions in the $\\kappa-M_H$ plane for different values of the center of mass energy and different levels of background. The numerical computation was done for the energies which are expected to be available at a possible Future Linear $\\gamma\\gamma$ Collider with a center-of-mass energy 500-3000 $GeV$ and luminosities of 1 and $5 ab^{-1}$. We found that the number of events for the process $\\gamma\\gamma \\rightarrow t \\bar t HH$, taking into account the decay products of both $...

  13. The Rashba effect on a double-barrier spin polarizer

    Energy Technology Data Exchange (ETDEWEB)

    Makler, Sergio S. [Instituto de Fisica, Universidade Federal Fluminense, Campus da Praia Vermelha, 24210-340 Niteroi-RJ (Brazil)]. E-mail:; Guilherme Zelcovit, Joao [Instituto de Fisica, Universidade do Estado de Rio de Janeiro, RJ (Brazil); Boselli, Marco A. [Departamento de Fisica, Universidade Federal de Ouro Preto, MG (Brazil); Cunha Lima, Ivan C. da [Instituto de Fisica, Universidade do Estado de Rio de Janeiro, RJ (Brazil)


    The Rashba effect on a double-barrier spin polarizer is considered using a formalism that produces accurate results with little computational effort. In previous articles, we proposed a spin polarizer consisting of a well made of a dilute magnetic semiconductor (DMS) enclosed by two non-magnetic barriers. In the absence of Rashba effect, the magnetization of the well produces totally polarized electronic levels separated by 0.15eV. The highest steady magnetic field obtained in a laboratory could not produce a Zeeman splitting so big. As a consequence the calculated currents are almost totally polarized. The Rashba spin-orbit Hamiltonian produces a spin flip. Therefore, the levels at the well have not well-defined spin polarization and the currents are less polarized. The device presented here would be useful for spintronics because there are DMS ferromagnetic at room temperature. Our tight-binding Hamiltonian, including the Rashba term, isH=HK+HP+HE+HM+Hh-i+Hh-h+HR.The first term is the kinetic energy. HP describes the double-barrier profile and the third term represent the electric field due to the applied bias. The magnetic HM, the hole-impurity Hh-i and the hole-hole Hh-h terms are included in the mean field approximation. The profile and the charge distribution are calculated self-consistently.By using a decimation formalism, all these terms are treated exactly. Finally, the Rashba term HR is very small. Therefore, it is treated using second order perturbation theory. The calculation confirm that the Rashba effect on the currents is of second order. Consequently, the resulting depolarization is very small.

  14. Quantitative analysis of Hedgehog gradient formation using an inducible expression system

    Directory of Open Access Journals (Sweden)

    Brodsky Michael


    Full Text Available Abstract Background The Hedgehog (Hh family of secreted growth factors are morphogens that act in development to direct growth and patterning. Mutations in human Hh and other Hh pathway components have been linked to human diseases. Analysis of Hh distribution during development indicates that cholesterol modification and receptor mediated endocytosis affect the range of Hh signaling and the cellular localization of Hh. Results We have used an inducible, cell type-specific expression system to characterize the three-dimensional distribution of newly synthesized, GFP-tagged Hh in the developing Drosophila wing. Following induction of Hh-GFP expression in posterior producing cells, punctate structures containing Hh-GFP were observed in the anterior target cells. The distance of these particles from the expressing cells was quantified to determine the shape of the Hh gradient at different time points following induction. The majority of cholesterol-modified Hh-GFP was found associated with cells near the anterior/posterior (A/P boundary, which express high levels of Hh target genes. Without cholesterol, the Hh gradient was flatter, with a lower percentage of particles near the source and a greater maximum distance. Inhibition of Dynamin-dependent endocytosis blocked formation of intracellular Hh particles, but did not prevent movement of newly synthesized Hh to the apical or basolateral surfaces of target cells. In the absence of both cholesterol and endocytosis, Hh particles accumulated in the extracellular space. Staining for the Hh receptor Ptc revealed four categories of Hh particles: cytoplasmic with and without Ptc, and cell surface with and without Ptc. Interestingly, mainly cholesterol-modified Hh is detected in the cytoplasmic particles lacking Ptc. Conclusion We have developed a system to quantitatively analyze Hh distribution during gradient formation. We directly demonstrate that inhibition of Dynamin-dependent endocytosis is not

  15. Large-Scale Distribution of Herbig-Haro Objects in Taurus

    Institute of Scientific and Technical Information of China (English)

    Ke-Feng Sun; Ji Yang; Shao-Guang Luo; Min Wang; Li-Cai Deng; Xu Zhou; Jian-Sheng Chen


    We report our new results on Herbig-Haro (HH) objects in the star forming region of Taurus from a wide-field survey with the 60/90 cm Schmidt telescope of the Beijing Astronomical Observatory. This survey using CCD imaging with a narrow band [SⅡ] filter and an intermediate band [BATC10] filter covered approximately 30 square degrees in Taurus. Besides confirming the known HH Objects in the region, we discovered seven new HH candidates, and groups. Six of these are HH 701A-B, HH 702A-D, HH 703, HH 704A-D, HH 705, HH 706 and the seventh is a group, a new component of HH 319, labeled HH 319B-D. Based on the large-scale distribution of pre-main-sequence (PMS) stars in Taurus, we analyze statistically the most probable distance from the HH objects to each PMS star,from which we estimate the typical timescale of these HH objects to be between(1.3 - 2.0) × 104 yrs; and we also obtain the birth rates of HH objects: 0.447±0.198 for Class Ⅰ PMS stars, 0.360±0.222 for Class Ⅱ PMS stars, and -0.148±0.234 for Class Ⅲ PMS stars.

  16. Fitting the Two-Higgs-Doublet model of type II

    CERN Document Server

    Eberhardt, Otto


    We present the current status of the Two-Higgs-Doublet model of type II. Taking into account all available relevant information, we exclude at $95$% CL sizeable deviations of the so-called alignment limit, in which all couplings of the light CP-even Higgs boson $h$ are Standard-Model-like. While we can set a lower limit of $240$ GeV on the mass of the pseudoscalar Higgs boson at $95$% CL, the mass of the heavy CP-even Higgs boson $H$ can be even lighter than $200$ GeV. The strong constraints on the model parameters also set limits on the triple Higgs couplings: the $hhh$ coupling in the Two-Higgs-Doublet model of type II cannot be larger than in the Standard Model, while the $hhH$ coupling can maximally be $2.5$ times the size of the Standard Model $hhh$ coupling, assuming an $H$ mass below $1$ TeV. The selection of benchmark scenarios which maximize specific effects within the allowed regions for further collider studies is illustrated for the $H$ branching fraction to fermions and gauge bosons. As an exampl...

  17. Neutral Higgs Boson Pair-Production and Trilinear Self-Couplings in the MSSM at ILC and CLIC Energies

    CERN Document Server

    Gutiérrez-Rodríguez, A; Sampayo, O A


    We study pair-production as well as the triple self-couplings of the neutral Higgs bosons of the Minimal Supersymmetric Standard Model (MSSM) at the Future International Linear $e^{+}e^{-}$ Collider (ILC) and Compact Linear Collider (CLIC). The analysis is based on the reactions $e^{+}e^{-}\\to b \\bar b h_ih_i, t \\bar t h_ih_i$ with $h_i=h, H, A$. We evaluate the total cross-section for both $b\\bar bh_ih_i$, $t\\bar th_ih_i$ and calculate the total number of events considering the complete set of Feynman diagrams at tree-level. We vary the triple couplings $\\kappa\\lambda_{hhh}$, $\\kappa\\lambda_{Hhh}$, $\\kappa\\lambda_{hAA}$, $\\kappa\\lambda_{HAA}$, $\\kappa\\lambda_{hHH}$ and $\\kappa\\lambda_{HHH}$ within the range $\\kappa=-1$ and +2. The numerical computation is done for the energies expected at the ILC with a center-of-mass energy 500, 1000, 1600 $GeV$ and a luminosity 1000 $fb^{-1}$. The channels $e^{+}e^{-}\\to b \\bar b h_ih_i$ and $e^{+}e^{-}\\to t \\bar t h_ih_i$ are also discussed to a center-of-mass energy of 3...

  18. Non-HFE hemochromatosis (United States)

    Santos, Paulo Caleb Júnior de Lima; Dinardo, Carla Luana; Cançado, Rodolfo Delfini; Schettert, Isolmar Tadeu; Krieger, José Eduardo; Pereira, Alexandre Costa


    Hereditary hemochromatosis (HH) is an autosomal recessive disorder classically related to HFE mutations. However, since 1996, it is known that HFE mutations explain about 80% of HH cases, with the remaining around 20% denominated non-HFE hemochromatosis. Nowadays, four main genes are implicated in the pathophysiology of clinical syndromes classified as non-HFE hemochromatosis: hemojuvelin (HJV, type 2Ajuvenile HH), hepcidin (HAMP, type 2B juvenile HH), transferrin receptor 2 (TFR2, type 3 HH) and ferroportin (SLC40A1, type 4 HH). The aim of this review is to explore molecular, clinical and management aspects of non-HFE hemochromatosis. PMID:23049448

  19. Non-HFE hemochromatosis

    Directory of Open Access Journals (Sweden)

    Paulo Caleb Júnior de Lima Santos


    Full Text Available Hereditary hemochromatosis (HH is an autosomal recessive disorder classically related to HFE mutations. However, since 1996, it is known that HFE mutations explain about 80% of HH cases, with the remaining around 20% denominated non-HFE hemochromatosis. Nowadays, four main genes are implicated in the pathophysiology of clinical syndromes classified as non-HFE hemochromatosis: hemojuvelin (HJV, type 2Ajuvenile HH, hepcidin (HAMP, type 2B juvenile HH, transferrin receptor 2 (TFR2, type 3 HH and ferroportin (SLC40A1, type 4 HH. The aim of this review is to explore molecular, clinical and management aspects of non-HFE hemochromatosis.

  20. Secretion and Signaling Activities of Lipoprotein-Associated Hedgehog and Non-Sterol-Modified Hedgehog in Flies and Mammals (United States)

    Kumari, Veena; Ehrhart-Bornstein, Monika; Bornstein, Stefan R.; Eaton, Suzanne


    Hedgehog (Hh) proteins control animal development and tissue homeostasis. They activate gene expression by regulating processing, stability, and activation of Gli/Cubitus interruptus (Ci) transcription factors. Hh proteins are secreted and spread through tissue, despite becoming covalently linked to sterol during processing. Multiple mechanisms have been proposed to release Hh proteins in distinct forms; in Drosophila, lipoproteins facilitate long-range Hh mobilization but also contain lipids that repress the pathway. Here, we show that mammalian lipoproteins have conserved roles in Sonic Hedgehog (Shh) release and pathway repression. We demonstrate that lipoprotein-associated forms of Hh and Shh specifically block lipoprotein-mediated pathway inhibition. We also identify a second conserved release form that is not sterol-modified and can be released independently of lipoproteins (Hh-N*/Shh-N*). Lipoprotein-associated Hh/Shh and Hh-N*/Shh-N* have complementary and synergistic functions. In Drosophila wing imaginal discs, lipoprotein-associated Hh increases the amount of full-length Ci, but is insufficient for target gene activation. However, small amounts of non-sterol-modified Hh synergize with lipoprotein-associated Hh to fully activate the pathway and allow target gene expression. The existence of Hh secretion forms with distinct signaling activities suggests a novel mechanism for generating a diversity of Hh responses. PMID:23554573

  1. Dicty_cDB: VSH527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tnc*syclh*hh*insyy*iksnpfdlgk*ifsrck egfn*frikisflkftrftkilfkin*ilysfnfkn*xx--- ---vnkstkicnfk*khrqsmecft*fr...fpiknlpsnrkfny*r*lntnhcwshpcfkve nw*nq*tkiirtl*sft*nhl*in*k*tnc*syclh*hh*insyy*iksnpfdlgk*ifs rckegfn*frikis

  2. Dicty_cDB: VSD151 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rfpiknlpsnrkfny*r*lntnhcwshpcfkvenw *nq*tkiirtl*sft*nhl*in*k*tnc*syclh*hh*insyy*iksnpfdlgk*ifsrc kegfn**k*tnc*syclh*hh*insyy*iksnpfdlgk*ifsrcke gfn*frikisflkftrftkilfkin*ilysfnfkkk--

  3. Dicty_cDB: VSH795 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tnc*syclh*hh*insyy*iksnpfdl gk*ifsrckegfn*frikisflkftrftkilfkin*il Frame B: nvnkstkicnfk*khrqsmecft*frfpiknl...psnrkfny*r*lntnhcwshpcfkvenw *nq*tkiirtl*sft*nhl*in*k*tnc*syclh*hh*insyy*iksnpfdlgk*ifsrc kegfn*frikis

  4. 78 FR 40271 - Medicare and Medicaid Programs; Home Health Prospective Payment System Rate Update for CY 2014... (United States)


    ... payment . POC Plan of care. PRRB Provider Reimbursement Review Board. PT Physical therapy. QAP Quality...-day episode rate includes the six HH disciplines (skilled nursing, HH aide, physical therapy (PT...

  5. Smoothened transduces Hedgehog signal by forming a complex with Evc/Evc2


    Yang, Cuiping; Chen, Wenlin; Chen, Yongbin; Jiang, Jin


    Hedgehog (Hh) signaling plays pivotal roles in embryonic development and adult tissue homeostasis in species ranging from Drosophila to mammals. The Hh signal is transduced by Smoothened (Smo), a seven-transmembrane protein related to G protein coupled receptors. Despite a conserved mechanism by which Hh activates Smo in Drosophila and mammals, how mammalian Hh signal is transduced from Smo to the Gli transcription factors is poorly understood. Here, we provide evidence that two ciliary prote...

  6. Small-molecule modulators of Hedgehog signaling: identification and characterization of Smoothened agonists and antagonists

    Directory of Open Access Journals (Sweden)

    Shulok Janine


    Full Text Available Abstract Background The Hedgehog (Hh signaling pathway is vital to animal development as it mediates the differentiation of multiple cell types during embryogenesis. In adults, Hh signaling can be activated to facilitate tissue maintenance and repair. Moreover, stimulation of the Hh pathway has shown therapeutic efficacy in models of neuropathy. The underlying mechanisms of Hh signal transduction remain obscure, however: little is known about the communication between the pathway suppressor Patched (Ptc, a multipass transmembrane protein that directly binds Hh, and the pathway activator Smoothened (Smo, a protein that is related to G-protein-coupled receptors and is capable of constitutive activation in the absence of Ptc. Results We have identified and characterized a synthetic non-peptidyl small molecule, Hh-Ag, that acts as an agonist of the Hh pathway. This Hh agonist promotes cell-type-specific proliferation and concentration-dependent differentiation in vitro, while in utero it rescues aspects of the Hh-signaling defect in Sonic hedgehog-null, but not Smo-null, mouse embryos. Biochemical studies with Hh-Ag, the Hh-signaling antagonist cyclopamine, and a novel Hh-signaling inhibitor Cur61414, reveal that the action of all these compounds is independent of Hh-protein ligand and of the Hh receptor Ptc, as each binds directly to Smo. Conclusions Smo can have its activity modulated directly by synthetic small molecules. These studies raise the possibility that Hh signaling may be regulated by endogenous small molecules in vivo and provide potent compounds with which to test the therapeutic value of activating the Hh-signaling pathway in the treatment of traumatic and chronic degenerative conditions.

  7. Differential role of Hedgehog signaling in human pancreatic (patho-) physiology: An up to date review


    Klieser, Eckhard; SWIERCZYNSKI, STEFAN; Mayr, Christian; Jäger, Tarkan; Schmidt, Johanna; Neureiter, Daniel; KIESSLICH, TOBIAS; Illig, Romana


    Since the discovery of the Hedgehog (Hh) pathway in drosophila melanogaster, our knowledge of the role of Hh in embryonic development, inflammation, and cancerogenesis in humans has dramatically increased over the last decades. This is the case especially concerning the pancreas, however, real therapeutic breakthroughs are missing until now. In general, Hh signaling is essential for pancreatic organogenesis, development, and tissue maturation. In the case of acute pancreatitis, Hh has a prote...

  8. Hedgehog signalling in myeloid cells impacts on body weight, adipose tissue inflammation and glucose metabolism. (United States)

    Braune, Julia; Weyer, Ulrike; Matz-Soja, Madlen; Hobusch, Constance; Kern, Matthias; Kunath, Anne; Klöting, Nora; Kralisch, Susann; Blüher, Matthias; Gebhardt, Rolf; Zavros, Yana; Bechmann, Ingo; Gericke, Martin


    Recently, hedgehog (Hh) was identified as a crucial player in adipose tissue development and energy expenditure. Therefore, we tested whether Hh ligands are regulated in obesity. Further, we aimed at identifying potential target cells of Hh signalling and studied the functional impact of Hh signalling on adipose tissue inflammation and glucose metabolism. Hh ligands and receptors were analysed in adipose tissue or serum from lean and obese mice as well as in humans. To study the impact on adipose tissue inflammation and glucose metabolism, Hh signalling was specifically blocked in myeloid cells using a conditional knockout approach (Lys-Smo (-/-)). Desert Hh (DHH) and Indian Hh (IHH) are local Hh ligands, whereas Sonic Hh is not expressed in adipose tissue from mice or humans. In mice, obesity leads to a preferential upregulation of Hh ligands (Dhh) and signalling components (Ptch1, Smo and Gli1) in subcutaneous adipose tissue. Further, adipose tissue macrophages are Hh target cells owing to the expression of Hh receptors, such as Patched1 and 2. Conditional knockout of Smo (which encodes Smoothened, a mandatory Hh signalling component) in myeloid cells increases body weight and adipose tissue inflammation and attenuates glucose tolerance, suggesting an anti-inflammatory effect of Hh signalling. In humans, adipose tissue expression of DHH and serum IHH decrease with obesity and type 2 diabetes, which might be explained by the intake of metformin. Interestingly, metformin reduced Dhh and Ihh expression in mouse adipose tissue explants. Hh signalling in myeloid cells affects adipose tissue inflammation and glucose metabolism and may be a potential target to treat type 2 diabetes.

  9. A simplified prevention bundle with dual hand hygiene audit reduces early-onset ventilator-associated pneumonia in cardiovascular surgery units: An interrupted time-series analysis. (United States)

    Su, Kang-Cheng; Kou, Yu Ru; Lin, Fang-Chi; Wu, Chieh-Hung; Feng, Jia-Yih; Huang, Shiang-Fen; Shiung, Tao-Fen; Chung, Kwei-Chun; Tung, Yu-Hsiu; Yang, Kuang-Yao; Chang, Shi-Chuan


    To investigate the effect of a simplified prevention bundle with alcohol-based, dual hand hygiene (HH) audit on the incidence of early-onset ventilation-associated pneumonia (VAP). This 3-year, quasi-experimental study with interrupted time-series analysis was conducted in two cardiovascular surgery intensive care units in a medical center. Unaware external HH audit (eHH) performed by non-unit-based observers was a routine task before and after bundle implementation. Based on the realistic ICU settings, we implemented a 3-component bundle, which included: a compulsory education program, a knowing internal HH audit (iHH) performed by unit-based observers, and a standardized oral care (OC) protocol with 0.1% chlorhexidine gluconate. The study periods comprised 4 phases: 12-month pre-implementation phase 1 (eHH+/education-/iHH-/OC-), 3-month run-in phase 2 (eHH+/education+/iHH+/OC+), 15-month implementation phase 3 (eHH+/education+/iHH+/OC+), and 6-month post-implementation phase 4 (eHH+/education-/iHH+/OC-). A total of 2553 ventilator-days were observed. VAP incidences (events/1000 ventilator days) in phase 1-4 were 39.1, 40.5, 15.9, and 20.4, respectively. VAP was significantly reduced by 59% in phase 3 (vs. phase 1, incidence rate ratio [IRR] 0.41, P = 0.002), but rebounded in phase 4. Moreover, VAP incidence was inversely correlated to compliance of OC (r2 = 0.531, P = 0.001) and eHH (r2 = 0.878, P audit provides better improvement in HH practice. Accordingly, we suggest dual HH audit and consistent bundle performance does matter in quality-of-care VAP prevention.

  10. Probing anomalous couplings using di-Higgs production in electron–proton collisions

    Directory of Open Access Journals (Sweden)

    Mukesh Kumar


    Full Text Available A proposed high energy Future Circular Hadron-Electron Collider would provide sufficient energy in a clean environment to probe di-Higgs production. Using this channel we show that the azimuthal angle correlation between the missing transverse energy and the forward jet is a very good probe for the non-standard hhh and hhWW couplings. We give the exclusion limits on these couplings as a function of integrated luminosity at a 95% C.L. using the fiducial cross sections. With appropriate error fitting methodology we find that the Higgs boson self coupling could be measured to be ghhh(1=1.00−0.17(0.12+0.24(0.14 of its expected Standard Model value at s=3.5(5.0 TeV for an ultimate 10 ab−1 of integrated luminosity.

  11. Probing anomalous couplings using di-Higgs production in electron-proton collisions (United States)

    Kumar, Mukesh; Ruan, Xifeng; Islam, Rashidul; Cornell, Alan S.; Klein, Max; Klein, Uta; Mellado, Bruce


    A proposed high energy Future Circular Hadron-Electron Collider would provide sufficient energy in a clean environment to probe di-Higgs production. Using this channel we show that the azimuthal angle correlation between the missing transverse energy and the forward jet is a very good probe for the non-standard hhh and hhWW couplings. We give the exclusion limits on these couplings as a function of integrated luminosity at a 95% C.L. using the fiducial cross sections. With appropriate error fitting methodology we find that the Higgs boson self coupling could be measured to be ghhh(1) = 1.00-0.17(0.12)+0.24(0.14) of its expected Standard Model value at √{ s} = 3.5 (5.0) TeV for an ultimate 10 ab-1 of integrated luminosity.

  12. Probing anomalous couplings using di-Higgs production in electron-proton collisions

    CERN Document Server

    Kumar, Mukesh; Islam, Rashidul; Cornell, Alan S; Klein, Max; Klein, Uta; Mellado, Bruce


    A proposed high energy Future Circular Hadron-Electron Collider would provide sufficient energy in a clean environment to probe di-Higgs production. Using this channel we show that the azimuthal angle correlation between the missing transverse energy and the forward jet is a very good probe for the non-standard $hhh$ and $hhWW$ couplings. We give the exclusion limits on these couplings as a function of integrated luminosity at 95\\% C.L. using the fiducial cross sections. The Higgs self-coupling could be measured to be within factors of $0.84 \\, (0.89) < \\gonehhh < 1.19 \\, (1.12)$ of its expected Standard Model value at $\\sqrt{s} = 3.5 \\,(5.0)$ TeV for an ultimate 10 $\\abinv$ of integrated luminosity.

  13. Leukotriene synthesis is required for hedgehog-dependent neurite projection in neuralized embryoid bodies but not for motor neuron differentiation

    NARCIS (Netherlands)

    Bijlsma, Maarten F.; Peppelenbosch, Maikel P.; Spek, C. Arnold; Roelink, Henk


    The hedgehog (Hh) pathway is required for many developmental processes,. as well as for adult homeostasis. Although all known effects of Hh signaling affecting patterning and differentiation are mediated by members of the Gli family of zinc ringer transcription factors, we demonstrate that the Hh-de

  14. Hedgehog morphogen in cardiovascular disease

    NARCIS (Netherlands)

    Bijlsma, Maarten F.; Peppelenbosch, Maikel P.; Spek, C. Arnold


    In this review, we focus on the basic biology of the important developmental Hedgehog ( Hh) protein family, its general function in development, pathway mechanisms, and gene discovery and nomenclature. Hh function in cardiovascular development and recent findings concerning Hh signaling in ischemia

  15. Relevance of dietary iron intake and bioavailability in the management of HFE hemochromatosis: a systematic review

    NARCIS (Netherlands)

    Moretti, D.; Doorn, van G.M.; Swinkels, D.W.; Boonstra, A.


    Background: Hereditary hemochromatosis (HH) leads to iron loading because of a disturbance in the negative-feedback mechanism between dietary iron absorption and iron status. The management of HH is achieved by repeated phlebotomies. Objective: We investigated whether HH patients would benefit from

  16. Methylene Bridged Group 13-15 Compounds, R2MCH2PPh2 (R = CH2CMe3, CH2SiMe3; M = Ga, In). Crystal Structure of ((Me3CCH2)2InCH2PPh2)2.C6D6, a Molecule Containing an In-C-P-In-C-P Ring in a Chair Conformation (United States)


    1L8, ’lot 6248. 3. Karsch , H.H.; Appelt, A.; Khler, F.H.; Huller, G. Organometallics 128 4, 231. 4. Karsch , H.H.; Appelt, A.; Huller, G. J. Chem. Soc...Chem. Cozmuun. 198M, 11415. 5. Karsch , H.H.; Appelt, A.; Mller, G. Organometallics 1 , 14, 1624. 6. Beachley, O.T., Jr.; Pazik, J.C

  17. Characterization of primary cilia and Hedgehog signaling during development of the human pancreas and in human pancreatic duct cancer cell lines

    DEFF Research Database (Denmark)

    Nielsen, Sonja K; Møllgård, Kjeld; Clement, Christian A


    Hedgehog (Hh) signaling controls pancreatic development and homeostasis; aberrant Hh signaling is associated with several pancreatic diseases. Here we investigated the link between Hh signaling and primary cilia in the human developing pancreatic ducts and in cultures of human pancreatic duct...

  18. Relevance of dietary iron intake and bioavailability in the management of HFE hemochromatosis: a systematic review

    NARCIS (Netherlands)

    Moretti, D.; Doorn, van G.M.; Swinkels, D.W.; Boonstra, A.


    Background: Hereditary hemochromatosis (HH) leads to iron loading because of a disturbance in the negative-feedback mechanism between dietary iron absorption and iron status. The management of HH is achieved by repeated phlebotomies. Objective: We investigated whether HH patients would benefit from

  19. Structure-function studies of an unusual 3-methyladenine DNA glycosylase II (AlkA) from Deinococcus radiodurans. (United States)

    Moe, Elin; Hall, David R; Leiros, Ingar; Monsen, Vivi Talstad; Timmins, Joanna; McSweeney, Sean


    3-Methyladenine DNA glycosylase II (AlkA) is a DNA-repair enzyme that removes alkylated bases in DNA via the base-excision repair (BER) pathway. The enzyme belongs to the helix-hairpin-helix (HhH) superfamily of DNA glycosylases and possesses broad substrate specificity. In the genome of Deinococcus radiodurans, two genes encoding putative AlkA have been identified (Dr_2074 and Dr_2584). Dr_2074 is a homologue of human AlkA (MPG or AAG) and Dr_2584 is a homologue of bacterial AlkAs. Here, the three-dimensional structure of Dr_2584 (DrAlkA2) is presented and compared with the previously determined structure of Escherichia coli AlkA (EcAlkA). The results show that the enzyme consists of two helical-bundle domains separated by a wide DNA-binding cleft and contains an HhH motif. Overall, the protein fold is similar to the two helical-bundle domains of EcAlkA, while the third N-terminal mixed α/β domain observed in EcAlkA is absent. Substrate-specificity analyses show that DrAlkA2, like EcAlkA, is able to remove both 3-methyladenine (3meA) and 7-methylguanine (7meG) from DNA; however, the enzyme possesses no activity towards 1,N(6)-ethenoadenine (ℇA) and hypoxanthine (Hx). In addition, it shows activity towards the AlkB dioxygenase substrates 3-methylcytosine (3meC) and 1-methyladenine (1meA). Thus, the enzyme seems to preferentially repair methylated bases with weakened N-glycosidic bonds; this is an unusual specificity for a bacterial AlkA protein and is probably dictated by a combination of the wide DNA-binding cleft and a highly accessible specificity pocket.

  20. N.M.R. study of organo-phosphorus compounds: non equivalence of methylenic protons in the {alpha} position of an asymmetric phosphorus atom. Application to study of coupling constants J{sub P,H} and J{sub H,H}; R.M.N. de composes organo-phosphores: non equivalence de protons methyleniques en {alpha} d'un phosphore asymetrique. Application a l'etude des constantes de couplage J{sub P,H} et J{sub H,H}

    Energy Technology Data Exchange (ETDEWEB)

    Albrand, J.P. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires


    Non-equivalent methylenic protons, with respect to an asymmetric center, have been observed in the n.m.r. spectra of some three- and tetra-coordinated phosphorus compounds. The analysis of these spectra yield the following results: in the studied secondary phosphines, the inversion rate at the phosphorus atom is slow on the n.m.r. time scale; the geminal coupling constant, for a free-rotating methylene group attached to a phosphorus atom, is negative; in phosphines the non equivalence of methylenic protons reveals two {sup 2}J{sub P-C-H} coupling constants which differ by about 5 Hz. This result is in agreement with previous studies on cyclic phosphines. In phosphine oxides, the {sup 2}J{sub P-C-H} values are negative. The {sup 3}J{sub H-P-C-H} coupling constant is positive in both phosphines and phosphine oxides. In phosphines, the non-equivalent methylenic protons exhibit two nearly equal values for this coupling constant. (author) [French] La non-equivalence de protons methyleniques observee dans quelques composes phosphores tricoordines et tetracoordines a apporte les resultats suivants, concernant la stereochimie et les constantes de couplage dans ces composes: dans les phosphines secondaires, la structure pyramidale des liaisons issues du phosphore est fixe a l'echelle de temps de mesure de la R.M.N.; la constante de couplage {sup 2}J{sub H-C-H}, pour un methylene en libre rotation en {alpha} d'un atome de phosphore, est negative; dans les phosphines etudiees, la non-equivalence. observee pour les protons methyleniques s'accompagne d'une difference importante (5 Hz) entre les deux constantes de couplage {sup 2}J{sub P-C-H} determinees par l'analyse; ce resultat est en accord avec la stereospecificite deja observee pour ce couplage dans les phosphines cycliques. Les valeurs observees pour {sup 2}J{sub P-C-H} dans les oxydes de phosphines sont negatives. Les valeurs de la constante de couplage {sup 3}J{sub H-P-C-H}, dans les phosphines et oxydes de phosphine etudies sont, toutes positives. Dans les phosphines, la non-equivalence des protons methyleniques n'entraine qu'une faible difference (0.5 Hz) entre les deux valeurs observees pour ce couplage. (auteur)

  1. Searching heavier Higgs boson via di-Higgs production at LHC Run-2 (United States)

    Lü, Lan-Chun; Du, Chun; Fang, Yaquan; He, Hong-Jian; Zhang, Huijun


    The discovery of a light Higgs particle h0 (125 GeV) opens up new prospect for searching heavier Higgs boson(s) at the LHC Run-2, which will unambiguously point to new physics beyond the standard model (SM). We study the detection of a heavier neutral Higgs boson H0 via di-Higgs production channel at the LHC (14 TeV), H0 →h0h0 → WW* γγ. This directly probes the Hhh cubic Higgs interaction, which exists in most extensions of the SM Higgs sector. For the decay products of final states WW*, we include both pure leptonic mode WW* → ℓ ν bar ℓ bar ν and semi-leptonic mode WW* → qqbar‧ ℓν. We analyze signals and backgrounds by performing fast detector simulation for the full process pp → H → hh → WW* γγ → ℓ ν bar ℓ bar νγγ and pp → H → hh → WW* γγ → ℓνqqbar‧ γγ, over the mass range MH = 250- 600 GeV. For generic two-Higgs-doublet models (2HDM), we present the discovery reach of the heavier Higgs boson at the LHC Run-2, and compare it with the current Higgs global fit of the 2HDM parameter space.

  2. Implementation of WHO multimodal strategy for improvement of hand hygiene: a quasi-experimental study in a Traditional Chinese Medicine hospital in Xi'an, China. (United States)

    Shen, Li; Wang, Xiaoqing; An, Junming; An, Jialu; Zhou, Ning; Sun, Lu; Chen, Hong; Feng, Lin; Han, Jing; Liu, Xiaorong


    Hand hygiene (HH) is an essential component for preventing and controlling of healthcare-associated infection (HAI), whereas compliance with HH among health care workers (HCWs) is frequently poor. This study aimed to assess compliance and correctness with HH before and after the implementation of a multimodal HH improvement strategy launched by the World Health Organization (WHO). A quasi-experimental study design including questionnaire survey generalizing possible factors affecting HH behaviors of HCWs and direct observation method was used to evaluate the effectiveness of WHO multimodal HH strategy in a hospital of Traditional Chinese Medicine. Multimodal HH improvement strategy was drawn up according to the results of questionnaire survey. Compliance and correctness with HH among HCWs were compared before and after intervention. Also HH practices for different indications based on WHO "My Five Moments for Hand Hygiene" were recorded. In total, 553 HCWs participated in the questionnaire survey and multimodal HH improvement strategy was developed based on individual, environment and management levels. A total of 5044 observations in 23 wards were recorded in this investigation. The rate of compliance and correctness with HH improved from 66.27% and 47.75% at baseline to 80.53% and 88.35% after intervention. Doctors seemed to have better compliance with HH after intervention (84.04%) than nurses and other HCWs (81.07% and 69.42%, respectively). When stratified by indication, compliance with HH improved for all indications after intervention (P < 0.05) except for "after body fluid exposure risk" and "after touching patient surroundings". Implementing the WHO multimodal HH strategy can significantly improve HH compliance and correctness among HCWs.

  3. Cloning of zebrafish nkx6.2 and a comprehensive analysis of the conserved transcriptional response to Hedgehog/Gli signaling in the zebrafish neural tube. (United States)

    Guner, Burcu; Karlstrom, Rolf O


    Sonic Hedgehog (Shh) signaling helps pattern the vertebrate neural tube, in part by regulating the dorsal/ventral expression of a number of homeodomain containing transcription factors. These Hh responsive genes have been divided into two classes, with Class II genes being activated by Hh signaling and Class I genes being repressed by Hh signaling. While the transcriptional response to varying Hh levels is well defined in chick and mouse, it is only partially described in zebrafish, despite the fact that zebrafish has emerged as a powerful genetic system for the study of neural patterning. To better characterize the Hh response in the zebrafish neural tube, we cloned the zebrafish Class II Hh target genes nkx2.9 and nkx6.2. We then analyzed the expression of a number of Class I and Class II Hh responsive genes in wild type, Hh mutant, and Hh over-expressing zebrafish embryos. We show that expression of Class I and Class II genes is highly conserved in the vertebrate neural tube. Further, ventral-most Class II gene expression was completely lost in all Hh pathway mutants analyzed, indicating high levels of Hh signaling are blocked in all of these mutants. In contrast, more dorsally expressed genes were variably affected in different Hh pathway mutants, indicating mid-levels of Hh signaling are differentially affected. This comprehensive expression study provides an important tool for the characterization of Hh signaling in zebrafish and provides a sensitive assay for determining the degree to which newly identified zebrafish mutants affect Hh signaling.

  4. Dynamic interpretation of hedgehog signaling in the Drosophila wing disc.

    Directory of Open Access Journals (Sweden)

    Marcos Nahmad


    Full Text Available Morphogens are classically defined as molecules that control patterning by acting at a distance to regulate gene expression in a concentration-dependent manner. In the Drosophila wing imaginal disc, secreted Hedgehog (Hh forms an extracellular gradient that organizes patterning along the anterior-posterior axis and specifies at least three different domains of gene expression. Although the prevailing view is that Hh functions in the Drosophila wing disc as a classical morphogen, a direct correspondence between the borders of these patterns and Hh concentration thresholds has not been demonstrated. Here, we provide evidence that the interpretation of Hh signaling depends on the history of exposure to Hh and propose that a single concentration threshold is sufficient to support multiple outputs. Using mathematical modeling, we predict that at steady state, only two domains can be defined in response to Hh, suggesting that the boundaries of two or more gene expression patterns cannot be specified by a static Hh gradient. Computer simulations suggest that a spatial "overshoot" of the Hh gradient occurs, i.e., a transient state in which the Hh profile is expanded compared to the Hh steady-state gradient. Through a temporal examination of Hh target gene expression, we observe that the patterns initially expand anteriorly and then refine, providing in vivo evidence for the overshoot. The Hh gene network architecture suggests this overshoot results from the Hh-dependent up-regulation of the receptor, Patched (Ptc. In fact, when the network structure was altered such that the ptc gene is no longer up-regulated in response to Hh-signaling activation, we found that the patterns of gene expression, which have distinct borders in wild-type discs, now overlap. Our results support a model in which Hh gradient dynamics, resulting from Ptc up-regulation, play an instructional role in the establishment of patterns of gene expression.

  5. Health Belief Model pada Kepatuhan Hand Hygiene di Bangsal Berisiko Tinggi Healthcare Acquired Infections (HAIs (Studi Kasus Pada Rumah Sakit X

    Directory of Open Access Journals (Sweden)

    Merita Arini


    Full Text Available as a global problem, patient morbidity and mortality in hospital caused by Healthcare Acquired Infections (HAIs can be prevented by implementation of Hand Hygiene (HH. This research aims to know the influence of Health Belief Model variables to HH compliance. there was a quantitative study by survey approach and cross-sectional design. The population consisted all of nurses in high risk HAIs ward (ICU and surgical ward, 30 respondents. HCW’s perceptions were measured through self-administered questioner. The compliance of HCWs was measured by observation form of HH. HH compliance should be increase. Workplace factor had significant influence to HH compliance.

  6. Feedback control of mammalian Hedgehog signaling by the Hedgehog-binding protein, Hip1, modulates Fgf signaling during branching morphogenesis of the lung


    Chuang, Pao-Tien; Kawcak, T'Nay; McMahon, Andrew P.


    Hedgehog (Hh) signaling plays a major role in multiple aspects of embryonic development. A key issue is how negative regulation of Hh signaling might contribute to generating differential responses over tens of cell diameters. In cells that respond to Hh, two proteins that are up-regulated are Patched1 (Ptch1), the Hh receptor, a general target in both invertebrate and vertebrate organisms, and Hip1, a Hh-binding protein that is vertebrate specific. To address the developmental role of Hip1 i...

  7. Prenatal exclusion of the HHH syndrome. (United States)

    Gray, R G; Green, A; Hall, S; McKeown, C


    Prenatal diagnosis of the hyperornithinaemia, hyperammonaemia, and homocitrullinuria syndrome is described by the analysis of ornithine incorporation in second-trimester cultured amniotic fluid cells. An unaffected fetus was predicted and confirmed in the newborn child. This is the third reported prenatal diagnosis for this disorder and the second predicting an unaffected fetus.

  8. One-loop corrections to the Higgs self-couplings in the singlet extension

    CERN Document Server

    Kanemura, Shinya; Yagyu, Kei


    We investigate predictions on the triple Higgs boson couplings with radiative corrections in the model with an additional real singlet scalar field. In this model, the second physical scalar state ($H$) appears in addition to the Higgs boson ($h$) with the mass 125 GeV. The $hhh$ vertex is calculated at the one-loop level, and its possible deviation from the predictions in the standard model is evaluated under various theoretical constraints. The decay rate of $H \\to hh$ is also computed at the one-loop level. We also take into account the bound from the precise measurement of the $W$ boson mass, which gives the upper limit on the mixing angle $\\alpha$ between two physical Higgs bosons for a given value of the mass of $H$ ($m_H^{}$). We find that the deviation in the $hhh$ coupling from the prediction in the standard model can maximally be about 250\\%, 150\\% and 75\\% for $m_H^{}=300$, 500 and 1000 GeV, respectively, under the requirement that the cutoff scale of the model is higher than 3 TeV. We also discuss...

  9. One-loop corrections to the Higgs self-couplings in the singlet extension (United States)

    Kanemura, Shinya; Kikuchi, Mariko; Yagyu, Kei


    We investigate predictions on the triple Higgs boson couplings with radiative corrections in the model with an additional real singlet scalar field. In this model, the second physical scalar state (H) appears in addition to the Higgs boson (h) with the mass 125 GeV. The hhh vertex is calculated at the one-loop level, and its possible deviation from the predictions in the standard model is evaluated under various theoretical constraints. The decay rate of H → hh is also computed at the one-loop level. We also take into account the bound from the precise measurement of the W boson mass, which gives the upper limit on the mixing angle α between two physical Higgs bosons for a given value of the mass of H (mH). We find that the deviation in the hhh coupling from the prediction in the standard model can maximally be about 250%, 150% and 75% for mH = 300, 500 and 1000 GeV, respectively, under the requirement that the cutoff scale of the model is higher than 3 TeV. We also discuss deviations from the standard model prediction in double Higgs boson production from the gluon fusion at the LHC using the one-loop corrected Higgs boson vertices.

  10. Study about composite dyeing of natural dyes%植物染料复合染色的若干问题

    Institute of Scientific and Technical Information of China (English)

    罗勇; 王璐; 贾舜华; 张新龙; 周启澄; 胡晓峰; 赵国瑛



  11. Differential role of Hedgehog signaling in human pancreatic (patho-) physiology: An up to date review. (United States)

    Klieser, Eckhard; Swierczynski, Stefan; Mayr, Christian; Jäger, Tarkan; Schmidt, Johanna; Neureiter, Daniel; Kiesslich, Tobias; Illig, Romana


    Since the discovery of the Hedgehog (Hh) pathway in drosophila melanogaster, our knowledge of the role of Hh in embryonic development, inflammation, and cancerogenesis in humans has dramatically increased over the last decades. This is the case especially concerning the pancreas, however, real therapeutic breakthroughs are missing until now. In general, Hh signaling is essential for pancreatic organogenesis, development, and tissue maturation. In the case of acute pancreatitis, Hh has a protective role, whereas in chronic pancreatitis, Hh interacts with pancreatic stellate cells, leading to destructive parenchym fibrosis and atrophy, as well as to irregular tissue remodeling with potency of initiating cancerogenesis. In vitro and in situ analysis of Hh in pancreatic cancer revealed that the Hh pathway participates in the development of pancreatic precursor lesions and ductal adenocarcinoma including critical interactions with the tumor microenvironment. The application of specific inhibitors of components of the Hh pathway is currently subject of ongoing clinical trials (phases 1 and 2). Furthermore, a combination of Hh pathway inhibitors and established chemotherapeutic drugs could also represent a promising therapeutic approach. In this review, we give a structured survey of the role of the Hh pathway in pancreatic development, pancreatitis, pancreatic carcinogenesis and pancreatic cancer as well as an overview of current clinical trials concerning Hh pathway inhibitors and pancreas cancer.

  12. Differential role of Hedgehog signaling in human pancreatic(patho-) physiology:An up to date review

    Institute of Scientific and Technical Information of China (English)

    Eckhard Klieser; Stefan Swierczynski; Christian Mayr; Tarkan J?ger; Johanna Schmidt; Daniel Neureiter; Tobias Kiesslich; Romana Illig


    Since the discovery of the Hedgehog(Hh)pathway in drosophila melanogaster,our knowledge of the role of Hh in embryonic development,inflammation,and cancerogenesis in humans has dramatically increased over the last decades.This is the case especially concerning the pancreas,however,real therapeutic breakthroughs are missing until now.In general,Hh signaling is essential for pancreatic organogenesis,development,and tissue maturation.In the case of acute pancreatitis,Hh has a protective role,whereas in chronic pancreatitis,Hh interacts with pancreatic stellate cells,leading to destructive parenchym fibrosis and atrophy,as well as to irregular tissue remodeling with potency of initiating cancerogenesis.In vitro and in situ analysis of Hh in pancreatic cancer revealed that the Hh pathway participates in the development of pancreatic precursor lesions and ductal adenocarcinoma including critical interactions with the tumor microenvironment.The application of specific inhibitors of components of the Hh pathway is currently subject of ongoing clinical trials(phases 1 and 2).Furthermore,a combination of Hh pathway inhibitors and established chemotherapeutic drugs could also represent a promising therapeutic approach.In this review,we give a structured survey of the role of the Hh pathway in pancreatic development,pancreatitis,pancreatic carcinogenesis and pancreatic cancer as well as an overview of current clinical trials concerning Hh pathway inhibitors and pancreas cancer.

  13. Dicty_cDB: Contig-U01788-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available type hh4 16S ribosom... 42 0.73 2 ( EU622433 ) Mandarina hahajimana haplotype hh17 16S ribosomal... 42 0.73 ...2 ( EU622432 ) Mandarina hahajimana haplotype hh16 16S ribosomal... 42 0.73 2 ( EU622431 ) Mandarina hahajim...ana haplotype hh15 16S ribosomal... 42 0.73 2 ( EU622430 ) Mandarina hahajimana h...aplotype hh14 16S ribosomal... 42 0.73 2 ( EU622429 ) Mandarina hahajimana haplotype hh13 16S ribosomal... 4...2 0.73 2 ( EU622428 ) Mandarina hahajimana haplotype hh12 16S ribosomal... 42 0.73 2 ( EU622427 ) Mandarina hahaji

  14. Bodilisant-a novel fluorescent, highly affine histamine h3 receptor ligand. (United States)

    Tomasch, Miriam; Schwed, J Stephan; Paulke, Alexander; Stark, Holger


    A piperidine-based lead structure for the human histamine H3 receptor (hH3R) was coupled with the BODIPY fluorophore and resulted in a strong green fluorescent (quantum yield, 0.92) hH3R ligand with affinity in the nanomolar concentration range (K i hH3R = 6.51 ± 3.31 nM), named Bodilisant. Screening for affinities at histamine and dopamine receptor subtypes showed high hH3R preference. Bodilisant was used for visualization of hH3R in hH3R overexpressing HEK-293 cells with fluorescence confocal laser scanning microscopy. In addition, in native human brain tissues, Bodilisant showed clear and displaceable images of labeled hH3R.

  15. New prospects for drug development: the hedgehog pathway revealed. Focus on hematologic malignancies. (United States)

    Pimentel, Agustin; Velez, Michel; Barahona, Luz J; Swords, Ronan; Lekakis, Lazaros


    The hedgehog (Hh) pathway is a critical regulator of vertebrate embryonic development and is involved in the function of processes such as stem cell maintenance and differentiation, tissue polarity and cell proliferation. Given how critical these functions are, it is not surprising that mutations in Hh pathway components are often implicated in the tumorigenesis of a variety of human cancers. Promotion of tumor growth has recently been shown by activated Hh signaling in the tumor itself, as well as by pathway activation within surrounding cells comprising the tumor microenvironment. Targeted disruption of various Hh pathway proteins has been successfully employed as an anticancer strategy with several synthetic Hh antagonists now available. Here, the molecular basis of Hh signaling, the therapeutic rationales for targeting this pathway and the current status of Hh pathway inhibitors in the clinic are reviewed.

  16. Identification and characterization of the genes encoding the core histones and histone variants of Neurospora crassa.


    Hays, Shan M.; Swanson, Johanna; Selker, Eric U.


    We have identified and characterized the complete complement of genes encoding the core histones of Neurospora crassa. In addition to the previously identified pair of genes that encode histones H3 and H4 (hH3 and hH4-1), we identified a second histone H4 gene (hH4-2), a divergently transcribed pair of genes that encode H2A and H2B (hH2A and hH2B), a homolog of the F/Z family of H2A variants (hH2Az), a homolog of the H3 variant CSE4 from Saccharomyces cerevisiae (hH3v), and a highly diverged ...

  17. Identification and characterization of the genes encoding the core histones and histone variants of Neurospora crassa.


    Hays, Shan M.; Swanson, Johanna; Selker, Eric U.


    We have identified and characterized the complete complement of genes encoding the core histones of Neurospora crassa. In addition to the previously identified pair of genes that encode histones H3 and H4 (hH3 and hH4-1), we identified a second histone H4 gene (hH4-2), a divergently transcribed pair of genes that encode H2A and H2B (hH2A and hH2B), a homolog of the F/Z family of H2A variants (hH2Az), a homolog of the H3 variant CSE4 from Saccharomyces cerevisiae (hH3v), and a highly diverged ...

  18. Household expenditures on dietary supplements sold for weight loss, muscle building, and sexual function: Disproportionate burden by gender and income

    Directory of Open Access Journals (Sweden)

    S. Bryn Austin


    Full Text Available Dietary supplements sold for weight loss (WL, muscle building (MB, and sexual function (SF are not medically recommended. They have been shown to be ineffective in many cases and pose serious health risks to consumers due to adulteration with banned substances, prescription pharmaceuticals, and other dangerous chemicals. Yet no prior research has investigated how these products may disproportionately burden individuals and families by gender and socioeconomic position across households. We investigated household (HH cost burden of dietary supplements sold for WL, MB, and SF in a cross-sectional study using data from 60,538 U.S. households (HH in 2012 Nielsen/IRi National Consumer Panel, calculating annual HH expenditures on WL, MB, and SF supplements and expenditures as proportions of total annual HH income. We examined sociodemographic patterns in HH expenditures using Wald tests of mean differences across subgroups. Among HH with any expenditures on WL, MB, or SF supplements, annual HH first and ninth expenditure deciles were, respectively: WL $5.99, $145.36; MB $6.99, $141.93; and SF $4.98, $88.52. Conditional on any purchases of the products, female-male-headed HH spent more on WL supplements and male-headed HH spend more on MB and SF supplements compared to other HH types (p-values < 0.01. High-income ($30,000 < annual income < $100,000, compared to low-income (annual income < $30,000 HH, spent more on all three supplements types (p-values < 0.01; however, proportional to income, low-income HH spent 2–4 times more than high-income HH on WL and MB supplements (p-values < 0.01. Dietary supplements sold for WL, MB, and SF disproportionately burden HH by income and gender.

  19. Neutron scattering investigations of frustated magnets (United States)

    Fennell, Tom

    This thesis describes the experimental investigation of frustrated magnetic systems based on the pyrochlore lattice of corner-sharing tetrahedra. Ho2Ti207 and Dy2Ti207 are examples of spin ices, in which the manifold of disordered magnetic groundstates maps onto that of the proton positions in ice. Using single crystal neutron scattering to measure Bragg and diffuse scattering, the effect of applying magnetic fields along different directions in the crystal was investigated. Different schemes of degeneracy removal were observed for different directions. Long and short range order, and the coexistence of both could be observed by this technique.The field and temperature dependence of magnetic ordering was studied in Ho2Ti207 and Dy2Ti207. Ho2Ti2()7 has been more extensively investigated. The field was applied on [00l], [hh0], [hhh] and [hh2h]. Dy2Ti207 was studied with the field applied on [00l] and [hho] but more detailed information about the evolution of the scattering pattern across a large area of reciprocal space was obtained.With the field applied on [00l] both materials showed complete degeneracy removal. A long range ordered structure was formed. Any magnetic diffuse scattering vanished and was entirely replaced by strong magnetic Bragg scattering. At T =0.05 K both materials show unusual magnetization curves, with a prominent step and hysteresis. This was attributed to the extremely slow dynamics of spin ice materials at this temperature.Both materials were studied in greatest detail with the field applied on [hh0]. The coexistence of long and short range order was observed when the field was raised at T = 0.05 K. The application of a field in this direction separated the spin system into two populations. One could be ordered by the field, and one remained disordered. However, via spin-spin interactions, the field restricted the degeneracy of the disordered spin population. The neutron scattering pattern of Dy2Ti207 shows that the spin system was separated

  20. Searches for a heavy scalar boson $ \\mathrm{H} $ decaying to a pair of 125 GeV Higgs bosons $ \\mathrm{ hh } $ or for a heavy pseudoscalar boson $ \\mathrm{A} $ decaying to $ \\mathrm{Zh} $, in the final states with $\\mathrm{h} \\to \\tau \\tau$

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Aşılar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hartl, Christian; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Knünz, Valentin; König, Axel; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Matsushita, Takashi; Mikulec, Ivan; Rabady, Dinyar; Rahbaran, Babak; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Strauss, Josef; Treberer-Treberspurg, Wolfgang; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Alderweireldt, Sara; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Knutsson, Albert; Lauwers, Jasper; Luyckx, Sten; Ochesanu, Silvia; Rougny, Romain; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; Daci, Nadir; De Bruyn, Isabelle; Deroover, Kevin; Heracleous, Natalie; Keaveney, James; Lowette, Steven; Moreels, Lieselotte; Olbrechts, Annik; Python, Quentin; Strom, Derek; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Van Parijs, Isis; Barria, Patrizia; Brun, Hugues; Caillol, Cécile; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Fasanella, Giuseppe; Favart, Laurent; Gay, Arnaud; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Léonard, Alexandre; Maerschalk, Thierry; Marinov, Andrey; Perniè, Luca; Randle-conde, Aidan; Reis, Thomas; Seva, Tomislav; Vander Velde, Catherine; Vanlaer, Pascal; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Beernaert, Kelly; Benucci, Leonardo; Cimmino, Anna; Crucy, Shannon; Dobur, Didar; Fagot, Alexis; Garcia, Guillaume; Gul, Muhammad; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Poyraz, Deniz; Ryckbosch, Dirk; Salva Diblen, Sinem; Sigamani, Michael; Strobbe, Nadja; Tytgat, Michael; Van Driessche, Ward; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Beluffi, Camille; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Castello, Roberto; Caudron, Adrien; Ceard, Ludivine; Da Silveira, Gustavo Gil; Delaere, Christophe; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Jafari, Abideh; Jez, Pavel; Komm, Matthias; Lemaitre, Vincent; Mertens, Alexandre; Nuttens, Claude; Perrini, Lucia; Pin, Arnaud; Piotrzkowski, Krzysztof; Popov, Andrey; Quertenmont, Loic; Selvaggi, Michele; Vidal Marono, Miguel; Beliy, Nikita; Hammad, Gregory Habib; Aldá Júnior, Walter Luiz; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Hamer, Matthias; Hensel, Carsten; Mora Herrera, Clemencia; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Da Costa, Eliza Melo; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; De Souza Santos, Angelo; Dogra, Sunil; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Moon, Chang-Seong; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Vutova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Cheng, Tongguang; Du, Ran; Jiang, Chun-Hua; Plestina, Roko; Romeo, Francesco; Shaheen, Sarmad Masood; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Zhang, Huaqiao; Asawatangtrakuldee, Chayanit; Ban, Yong; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Zou, Wei; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Kadija, Kreso; Luetic, Jelena; Micanovic, Sasa; Sudic, Lucija; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Bodlak, Martin; Finger, Miroslav; Finger Jr, Michael; Abdelalim, Ahmed Ali; Awad, Adel; El Sawy, Mai; Mahrous, Ayman; Radi, Amr; Calpas, Betty; Kadastik, Mario; Murumaa, Marion; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Pekkanen, Juska; Voutilainen, Mikko; Härkönen, Jaakko; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Favaro, Carlotta; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Rander, John; Rosowsky, André; Titov, Maksym; Zghiche, Amina; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Chapon, Emilien; Charlot, Claude; Dahms, Torsten; Davignon, Olivier; Filipovic, Nicolas; Florent, Alice; Granier de Cassagnac, Raphael; Lisniak, Stanislav; Mastrolorenzo, Luca; Miné, Philippe; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Regnard, Simon; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Aubin, Alexandre; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Goetzmann, Christophe; Le Bihan, Anne-Catherine; Merlin, Jeremie Alexandre; Skovpen, Kirill; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Bouvier, Elvire; Carrillo Montoya, Camilo Andres; Chierici, Roberto; Contardo, Didier; Courbon, Benoit; Depasse, Pierre; El Mamouni, Houmani; Fan, Jiawei; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Ruiz Alvarez, José David; Sabes, David; Sgandurra, Louis; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Edelhoff, Matthias; Feld, Lutz; Heister, Arno; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Ostapchuk, Andrey; Preuten, Marius; Raupach, Frank; Schael, Stefan; Schulte, Jan-Frederik; Verlage, Tobias; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Brodski, Michael; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Knutzen, Simon; Kreuzer, Peter; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Olschewski, Mark; Padeken, Klaas; Papacz, Paul; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Künsken, Andreas; Lingemann, Joschka; Nehrkorn, Alexander; Nowack, Andreas; Nugent, Ian Michael; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Asin, Ivan; Bartosik, Nazar; Behnke, Olaf; Behrens, Ulf; Bell, Alan James; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Choudhury, Somnath; Costanza, Francesco; Diez Pardos, Carmen; Dolinska, Ganna; Dooling, Samantha; Dorland, Tyler; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Flucke, Gero; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Gunnellini, Paolo; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Karacheban, Olena; Kasemann, Matthias; Katsas, Panagiotis; Kieseler, Jan; Kleinwort, Claus; Korol, Ievgen; Lange, Wolfgang; Leonard, Jessica; Lipka, Katerina; Lobanov, Artur; Lohmann, Wolfgang; Mankel, Rainer; Marfin, Ihar; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Nayak, Aruna; Ntomari, Eleni; Perrey, Hanno; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Roland, Benoit; Sahin, Mehmet Özgür; Saxena, Pooja; Schoerner-Sadenius, Thomas; Schröder, Matthias; Seitz, Claudia; Spannagel, Simon; Trippkewitz, Karim Damun; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Erfle, Joachim; Garutti, Erika; Goebel, Kristin; Gonzalez, Daniel; Görner, Martin; Haller, Johannes; Hoffmann, Malte; Höing, Rebekka Sophie; Junkes, Alexandra; Klanner, Robert; Kogler, Roman; Lapsien, Tobias; Lenz, Teresa; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Nowatschin, Dominik; Ott, Jochen; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Pietsch, Niklas; Poehlsen, Jennifer; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schwandt, Joern; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baus, Colin; Berger, Joram; Böser, Christian; Butz, Erik; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Fink, Simon; Frensch, Felix; Giffels, Manuel; Gilbert, Andrew; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Katkov, Igor; Kornmayer, Andreas; Lobelle Pardo, Patricia; Maier, Benedikt; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Röcker, Steffen; Roscher, Frank; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Psallidas, Andreas; Topsis-Giotis, Iasonas; Agapitos, Antonis; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Loukas, Nikitas; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Bencze, Gyorgy; Hajdu, Csaba; Hazi, Andras; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Makovec, Alajos; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Mal, Prolay; Mandal, Koushik; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Gupta, Ruchi; Bhawandeep, Bhawandeep; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kumar, Ramandeep; Mehta, Ankita; Mittal, Monika; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Nishu, Nishu; Ranjan, Kirti; Sharma, Ramkrishna; Sharma, Varun; Banerjee, Sunanda; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dey, Sourav; Dutta, Suchandra; Jain, Sandhya; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukherjee, Swagata; Mukhopadhyay, Supratik; Roy, Ashim; Roy, Debarati; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Banerjee, Sudeshna; Bhowmik, Sandeep; Chatterjee, Rajdeep Mohan; Dewanjee, Ram Krishna; Dugad, Shashikant; Ganguly, Sanmay; Ghosh, Saranya; Guchait, Monoranjan; Gurtu, Atul; Kole, Gouranga; Kumar, Sanjeev; Mahakud, Bibhuprasad; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mitra, Soureek; Mohanty, Gagan Bihari; Parida, Bibhuti; Sarkar, Tanmay; Sudhakar, Katta; Sur, Nairit; Sutar, Bajrang; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Sharma, Seema; Bakhshiansohi, Hamed; Behnamian, Hadi; Etesami, Seyed Mohsen; Fahim, Ali; Goldouzian, Reza; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Caputo, Claudio; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Travaglini, Riccardo; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Gonzi, Sandro; Gori, Valentina; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Lo Vetere, Maurizio; Monge, Maria Roberta; Robutti, Enrico; Tosi, Silvano; Brianza, Luca; Dinardo, Mauro Emanuele; Dini, Paolo; Fiorendi, Sara; Gennai, Simone; Gerosa, Raffaele; Ghezzi, Alessio; Govoni, Pietro; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Marzocchi, Badder; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Esposito, Marco; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lanza, Giuseppe; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Margoni, Martino; Meneguzzo, Anna Teresa; Montecassiano, Fabio; Passaseo, Marina; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Zanetti, Marco; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Mantovani, Giancarlo; Menichelli, Mauro; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Donato, Silvio; Fedi, Giacomo; Foà, Lorenzo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; D'imperio, Giulia; Del Re, Daniele; Diemoz, Marcella; Gelli, Simone; Jorda, Clara; Longo, Egidio; Margaroli, Fabrizio; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Traczyk, Piotr; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Finco, Linda; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Musich, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Tamponi, Umberto; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; La Licata, Chiara; Marone, Matteo; Schizzi, Andrea; Zanetti, Anna; Kropivnitskaya, Anna; Nam, Soon-Kwon; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Kong, Dae Jung; Lee, Sangeun; Oh, Young Do; Sakharov, Alexandre; Son, Dong-Chul; Brochero Cifuentes, Javier Andres; Kim, Hyunsoo; Kim, Tae Jeong; Ryu, Min Sang; Song, Sanghyeon; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Yongsun; Lee, Byounghoon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Park, Sung Keun; Roh, Youn; Yoo, Hwi Dong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Ryu, Geonmo; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Donghyun; Kwon, Eunhyang; Lee, Jongseok; Yu, Intae; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Komaragiri, Jyothsna Rani; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Casimiro Linares, Edgar; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Hernandez-Almada, Alberto; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Khan, Wajid Ali; Khurshid, Taimoor; Shoaib, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Leonardo, Nuno; Lloret Iglesias, Lara; Nguyen, Federico; Rodrigues Antunes, Joao; Seixas, Joao; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Vischia, Pietro; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Konoplyanikov, Viktor; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Vlasov, Evgueni; Zhokin, Alexander; Bylinkin, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Bunichev, Viacheslav; Dubinin, Mikhail; Dudko, Lev; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Ekmedzic, Marko; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Navarro De Martino, Eduardo; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Soares, Mara Senghi; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Palencia Cortezon, Enrique; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Castiñeiras De Saa, Juan Ramon; De Castro Manzano, Pablo; Duarte Campderros, Jordi; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benaglia, Andrea; Bendavid, Joshua; Benhabib, Lamia; Benitez, Jose F; Berruti, Gaia Maria; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Colafranceschi, Stefano; D'Alfonso, Mariarosaria; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Guio, Federico; De Roeck, Albert; De Visscher, Simon; Di Marco, Emanuele; Dobson, Marc; Dordevic, Milos; Dorney, Brian; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Franzoni, Giovanni; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Girone, Maria; Glege, Frank; Guida, Roberto; Gundacker, Stefan; Guthoff, Moritz; Hammer, Josef; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Kirschenmann, Henning; Kortelainen, Matti J; Kousouris, Konstantinos; Krajczar, Krisztian; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Magini, Nicolo; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moortgat, Filip; Morovic, Srecko; Mulders, Martijn; Nemallapudi, Mythra Varun; Neugebauer, Hannes; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuelle; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Piparo, Danilo; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Ruan, Manqi; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Sharma, Archana; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Steggemann, Jan; Stieger, Benjamin; Stoye, Markus; Takahashi, Yuta; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veres, Gabor Istvan; Wardle, Nicholas; Wöhri, Hermine Katharina; Zagoździńska, Agnieszka; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Renker, Dieter; Rohe, Tilman; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Buchmann, Marco-Andrea; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Eller, Philipp; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Martinez Ruiz del Arbol, Pablo; Masciovecchio, Mario; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrozzi, Luca; Quittnat, Milena; Rossini, Marco; Starodumov, Andrei; Takahashi, Maiko; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Wallny, Rainer; Aarrestad, Thea Klaeboe; Amsler, Claude; Caminada, Lea; Canelli, Maria Florencia; Chiochia, Vincenzo; De Cosa, Annapaola; Galloni, Camilla; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Lange, Clemens; Ngadiuba, Jennifer; Pinna, Deborah; Robmann, Peter; Ronga, Frederic Jean; Salerno, Daniel; Yang, Yong; Cardaci, Marco; Chen, Kuan-Hsin; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Konyushikhin, Maxim; Kuo, Chia-Ming; Lin, Willis; Lu, Yun-Ju; Yu, Shin-Shan; Kumar, Arun; Bartek, Rachel; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Dietz, Charles; Fiori, Francesco; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Miñano Moya, Mercedes; Petrakou, Eleni; Tsai, Jui-fa; Tzeng, Yeng-Ming; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Suwonjandee, Narumon; Adiguzel, Aytul; Bakirci, Mustafa Numan; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Onengut, Gulsen; Ozdemir, Kadri; Polatoz, Ayse; Sunar Cerci, Deniz; Tali, Bayram; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Bilin, Bugra; Bilmis, Selcuk; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Yetkin, Elif Asli; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Yetkin, Taylan; Cankocak, Kerem; Sen, Sercan; Vardarlı, Fuat Ilkehan; Grynyov, Boris; Levchuk, Leonid; Sorokin, Pavel; Aggleton, Robin; Ball, Fionn; Beck, Lana; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Meng, Zhaoxia; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Sakuma, Tai; Seif El Nasr-storey, Sarah; Senkin, Sergey; Smith, Dominic; Smith, Vincent J; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Thomas, Laurent; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Worm, Steven; Baber, Mark; Bainbridge, Robert; Buchmuller, Oliver; Bundock, Aaron; Burton, Darren; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Cripps, Nicholas; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Dunne, Patrick; Elwood, Adam; Ferguson, William; Fulcher, Jonathan; Futyan, David; Hall, Geoffrey; Iles, Gregory; Kenzie, Matthew; Lane, Rebecca; Lucas, Robyn; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Seez, Christopher; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Kasmi, Azeddine; Liu, Hongxuan; Pastika, Nathaniel; Charaf, Otman; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Gastler, Daniel; Lawson, Philip; Rankin, Dylan; Richardson, Clint; Rohlf, James; St John, Jason; Sulak, Lawrence; Zou, David; Alimena, Juliette; Berry, Edmund; Bhattacharya, Saptaparna; Cutts, David; Dhingra, Nitish; Ferapontov, Alexey; Garabedian, Alex; Hakala, John; Heintz, Ulrich; Laird, Edward; Landsberg, Greg; Mao, Zaixing; Narain, Meenakshi; Piperov, Stefan; Sagir, Sinan; Sinthuprasith, Tutanon; Syarif, Rizki; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Gardner, Michael; Ko, Winston; Lander, Richard; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Ricci-Tam, Francesca; Shalhout, Shalhout; Smith, John; Squires, Michael; Stolp, Dustin; Tripathi, Mani; Wilbur, Scott; Yohay, Rachel; Cousins, Robert; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Saltzberg, David; Takasugi, Eric; Valuev, Vyacheslav; Weber, Matthias; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Heilman, Jesse; Ivova PANEVA, Mirena; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Luthra, Arun; Malberti, Martina; Olmedo Negrete, Manuel; Shrinivas, Amithabh; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; D'Agnolo, Raffaele Tito; Holzner, André; Kelley, Ryan; Klein, Daniel; Letts, James; Macneill, Ian; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Welke, Charles; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Barge, Derek; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Flowers, Kristen; Franco Sevilla, Manuel; Geffert, Paul; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Incandela, Joe; Justus, Christopher; Mccoll, Nickolas; Mullin, Sam Daniel; Richman, Jeffrey; Stuart, David; Suarez, Indara; To, Wing; West, Christopher; Yoo, Jaehyeok; Anderson, Dustin; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Duarte, Javier; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Pierini, Maurizio; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Azzolini, Virginia; Calamba, Aristotle; Carlson, Benjamin; Ferguson, Thomas; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Ford, William T; Gaz, Alessandro; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Mulholland, Troy; Nauenberg, Uriel; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Eggert, Nicholas; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Sun, Werner; Tan, Shao Min; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Weng, Yao; Wittich, Peter; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Hare, Daryl; Harris, Robert M; Hirschauer, James; Hu, Zhen; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Jung, Andreas Werner; Klima, Boaz; Kreis, Benjamin; Kwan, Simon; Lammel, Stephan; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Martinez Outschoorn, Verena Ingrid; Maruyama, Sho; Mason, David; McBride, Patricia; Merkel, Petra; Mishra, Kalanand; Mrenna, Stephen; Nahn, Steve; Newman-Holmes, Catherine; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Yang, Fan; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Carnes, Andrew; Carver, Matthew; Curry, David; Das, Souvik; Di Giovanni, Gian Piero; Field, Richard D; Furic, Ivan-Kresimir; Hugon, Justin; Konigsberg, Jacobo; Korytov, Andrey; Low, Jia Fu; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Milenovic, Predrag; Mitselmakher, Guenakh; Rank, Douglas; Rossin, Roberto; Shchutska, Lesya; Snowball, Matthew; Sperka, David; Terentyev, Nikolay; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Hewamanage, Samantha; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Jordon Rowe; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Diamond, Brendan; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Khatiwada, Ajeeta; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Bhopatkar, Vallary; Hohlmann, Marcus; Kalakhety, Himali; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Bucinskaite, Inga; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Kurt, Pelin; O'Brien, Christine; Sandoval Gonzalez, Irving Daniel; Silkworth, Christopher; Turner, Paul; Varelas, Nikos; Wu, Zhenbin; Zakaria, Mohammed; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tan, Ping; Tiras, Emrah; Wetzel, James; Yi, Kai; Anderson, Ian; Barnett, Bruce Arnold; Blumenfeld, Barry; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Martin, Christopher; Osherson, Marc; Swartz, Morris; Xiao, Meng; Xin, Yongjie; You, Can; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Bruner, Christopher; Kenny III, Raymond Patrick; Majumder, Devdatta; Malek, Magdalena; Murray, Michael; Sanders, Stephen; Stringer, Robert; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Lange, David; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Ferraioli, Charles; Gomez, Jaime; Hadley, Nicholas John; Jabeen, Shabnam; Kellogg, Richard G; Kolberg, Ted; Kunkle, Joshua; Lu, Ying; Mignerey, Alice; Shin, Young Ho; Skuja, Andris; Tonjes, Marguerite; Tonwar, Suresh C; Apyan, Aram; Barbieri, Richard; Baty, Austin; Bierwagen, Katharina; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; Demiragli, Zeynep; Di Matteo, Leonardo; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Gulhan, Doga; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Niu, Xinmei; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Sumorok, Konstanty; Varma, Mukund; Velicanu, Dragos; Veverka, Jan; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Yang, Mingming; Zhukova, Victoria; Dahmes, Bryan; Evans, Andrew; Finkel, Alexey; Gude, Alexander; Hansen, Peter; Kalafut, Sean; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Claes, Daniel R; Dominguez, Aaron; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Keller, Jason; Knowlton, Dan; Kravchenko, Ilya; Lazo-Flores, Jose; Meier, Frank; Monroy, Jose; Ratnikov, Fedor; Siado, Joaquin Emilo; Snow, Gregory R; Alyari, Maral; Dolen, James; George, Jimin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kaisen, Josh; Kharchilava, Avto; Kumar, Ashish; Rappoccio, Salvatore; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Zhang, Jinzhong; Hahn, Kristan Allan; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Brinkerhoff, Andrew; Dev, Nabarun; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Pearson, Tessa; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Taroni, Silvia; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Antonelli, Louis; Brinson, Jessica; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Hart, Andrew; Hill, Christopher; Hughes, Richard; Ji, Weifeng; Kotov, Khristian; Ling, Ta-Yung; Liu, Bingxuan; Luo, Wuming; Puigh, Darren; Rodenburg, Marissa; Winer, Brian L; Wulsin, Howard Wells; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Koay, Sue Ann; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Palmer, Christopher; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Malik, Sudhir; Barnes, Virgil E; Benedetti, Daniele; Bortoletto, Daniela; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Kurt; Kress, Matthew; Miller, David Harry; Neumeister, Norbert; Radburn-Smith, Benjamin Charles; Shi, Xin; Shipsey, Ian; Silvers, David; Sun, Jian; Svyatkovskiy, Alexey; Wang, Fuqiang; Xie, Wei; Xu, Lingshan; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Chen, Zhenyu; Ecklund, Karl Matthew; Geurts, Frank JM; Guilbaud, Maxime; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Rorie, Jamal; Tu, Zhoudunming; Zabel, James; Betchart, Burton; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Harel, Amnon; Hindrichs, Otto; Khukhunaishvili, Aleko; Petrillo, Gianluca; Verzetti, Mauro; Demortier, Luc; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Lath, Amitabh; Nash, Kevin; Panwalkar, Shruti; Park, Michael; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Foerster, Mark; Riley, Grant; Rose, Keith; Spanier, Stefan; York, Andrew; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Krutelyov, Vyacheslav; Mueller, Ryan; Osipenkov, Ilya; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Rose, Anthony; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Cowden, Christopher; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Faulkner, James; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Undleeb, Sonaina; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Mao, Yaxian; Melo, Andrew; Ni, Hong; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Lin, Chuanzhe; Neu, Christopher; Wang, Yanchu; Wolfe, Evan; Wood, John; Xia, Fan; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sturdy, Jared; Belknap, Donald; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Friis, Evan; Gomber, Bhawna; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Perry, Thomas; Pierro, Giuseppe Antonio; Polese, Giovanni; Ruggles, Tyler; Sarangi, Tapas; Savin, Alexander; Sharma, Archana; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel


    A search for a heavy scalar boson $ \\mathrm{H} $ decaying into a pair of lighter standard-model-like 125 GeV Higgs bosons $ \\mathrm{h} $ and a search for a heavy pseudoscalar boson $ \\mathrm{A} $ decaying into a $ \\mathrm{Z} $ and an $ \\mathrm{h} $ boson are presented. The searches are performed on a dataset corresponding to an integrated luminosity of 19.7 fb$^{-1}$ of pp collision data at a centre-of-mass energy of 8 TeV, collected by CMS in 2012. A final state consisting of two $\\tau$ leptons and two b jets is used to search for the $\\mathrm{ H \\to h h }$ decay. A final state consisting of two $\\tau$ leptons from the $ \\mathrm{h} $ boson decay, and two additional leptons from the $ \\mathrm{Z} $ boson decay, is used to search for the decay $\\mathrm{ A \\to Z h } $. The results are interpreted in the context of both the minimal supersymmetric extension of the standard model and two-Higgs-doublet models. No excess is found above the standard model expectation and upper limits are set on the heavy boson product...

  1. 不同碳、氮源对优势藻株HhW总脂含量及脂肪酸成分的影响%Effects of Carbon and Nitrogen Sources on the Lipid and Fatty Acid Composition of Hhw

    Institute of Scientific and Technical Information of China (English)

    马帅; 胡小文; 付莉莉; 弓淑芬; 谭德冠; 张家明


    为了寻找适合用于开发生物质能源的优势藻株,对分离得到的藻株Hhw进行深入研究,分析其生长情况,不同碳、氮源对其总脂含量及脂肪酸成分的影响.结果表明,Hhw生长速度快、生物量高、适应性广;硝态氮、碳源的添加促进Hhw中性脂的积累,Hhw总脂含量高达干重的36.45%;Hhw脂肪酸成分较为单一,以棕榈酸、亚麻酸、EPA等9种脂肪酸为主;不同碳、氮源对其脂肪酸组成成份的影响不大,但对各组分的含量有一定影响,如铵基氮对EPA的积累有一定促进作用.综合分析认为,Hhw是一株极具开发潜力能源微藻.%In order to find an advantage algae strain for biomass energy, Hhw, a preponderant microalgae,which isolated by the author was researched. The effect of carbon and nitrogen sources on the lipid and fatty acid composition of Hhw was analyzed. The results showed that Hhw had numerous advantages such as wide environmental adaptability, fast growth, high biomass production. Adding NO3-or carbon sources promoted the accumulation of lipids of Hhw. Total fat content of Hhw was up to 36.45% by dry weight. The fatty acid compositions of Hhw was relatively simple, contained mainly 9 types: palmitic acid, inolenic acid, EPA, and so on. The effect of different carbon and nitrogen source to fatty acid composition was not big, but to the content of composition was relatively strong. For example, the effect of EPA to the accumulation of amino nitrogen was stimulative in a certain extent. The analysis showed that Hhw was a superior microalgae for biomass energy.

  2. Evolution of hedgehog and hedgehog-related genes, their origin from Hog proteins in ancestral eukaryotes and discovery of a novel Hint motif

    Directory of Open Access Journals (Sweden)

    Bürglin Thomas R


    Full Text Available Abstract Background The Hedgehog (Hh signaling pathway plays important roles in human and animal development as well as in carcinogenesis. Hh molecules have been found in both protostomes and deuterostomes, but curiously the nematode Caenorhabditis elegans lacks a bona-fide Hh. Instead a series of Hh-related proteins are found, which share the Hint/Hog domain with Hh, but have distinct N-termini. Results We performed extensive genome searches of the cnidarian Nematostella vectensis and several nematodes to gain further insights into Hh evolution. We found six genes in N. vectensis with a relationship to Hh: two Hh genes, one gene with a Hh N-terminal domain fused to a Willebrand factor type A domain (VWA, and three genes containing Hint/Hog domains with distinct novel N-termini. In the nematode Brugia malayi we find the same types of hh-related genes as in C. elegans. In the more distantly related Enoplea nematodes Xiphinema and Trichinella spiralis we find a bona-fide Hh. In addition, T. spiralis also has a quahog gene like C. elegans, and there are several additional hh-related genes, some of which have secreted N-terminal domains of only 15 to 25 residues. Examination of other Hh pathway components revealed that T. spiralis - like C. elegans - lacks some of these components. Extending our search to all eukaryotes, we recovered genes containing a Hog domain similar to Hh from many different groups of protists. In addition, we identified a novel Hint gene family present in many eukaryote groups that encodes a VWA domain fused to a distinct Hint domain we call Vint. Further members of a poorly characterized Hint family were also retrieved from bacteria. Conclusion In Cnidaria and nematodes the evolution of hh genes occurred in parallel to the evolution of other genes that contain a Hog domain but have different N-termini. The fact that Hog genes comprising a secreted N-terminus and a Hog domain are also found in many protists suggests that this

  3. The Drosophila WIF1 homolog Shifted maintains glypican-independent Hedgehog signaling and interacts with the Hedgehog co-receptors Ihog and Boi. (United States)

    Avanesov, Andrei; Blair, Seth S


    Hedgehog (Hh) family proteins are secreted signaling ligands whose short- and long-range activities transform cellular fates in multiple contexts in organisms ranging from metazoans to humans. In the developing Drosophila wing, extracellular Hh binds to cell-bound glypican heparan sulfate proteoglycans (HSPGs) and the secreted protein Shifted (Shf), a member of Wnt inhibitory factor 1 (WIF1) family. The glypicans and Shf are required for long-range Hh movement and signaling; it has been proposed that Shf promotes long-range Hh signaling by reinforcing binding between Hh and the glypicans, and that much or all of glypican function in Hh signaling requires Shf. However, we will show here that Shf maintains short-range Hh signaling in the wing via a mechanism that does not require the presence of or binding to the Drosophila glypicans Dally and Dally-like protein. Conversely, we demonstrate interactions between Hh and the glypicans that are maintained, and even strengthened, in the absence of Shf. We present evidence that Shf binds to the CDO/BOC family Hh co-receptors Interference hedgehog (Ihog) and Brother of Ihog, suggesting that Shf regulates short-range Hh signaling through interactions with the receptor complex. In support of a functional interaction between Ihog and members of the Shf/WIF1 family, we show that Ihog can increase the Wnt-inhibitory activity of vertebrate WIF1; this result raises the possibility of interactions between WIF1 and vertebrate CDO/BOC family members.

  4. Cameron lesions in patients with hiatal hernias: prevalence, presentation, and treatment outcome. (United States)

    Gray, D M; Kushnir, V; Kalra, G; Rosenstock, A; Alsakka, M A; Patel, A; Sayuk, G; Gyawali, C P


    Cameron lesions, as defined by erosions and ulcerations at the diaphragmatic hiatus, are found in the setting of gastrointestinal (GI) bleeding in patients with a hiatus hernia (HH). The study aim was to determine the epidemiology and clinical manifestations of Cameron lesions. We performed a retrospective cohort study evaluating consecutive patients undergoing upper endoscopy over a 2-year period. Endoscopy reports were systematically reviewed to determine the presence or absence of Cameron lesions and HH. Inpatient and outpatient records were reviewed to determine prevalence, risk factors, and outcome of medical treatment of Cameron lesions. Of 8260 upper endoscopic examinations, 1306 (20.2%) reported an HH. When categorized by size, 65.6% of HH were small (Cameron lesions, with a prevalence of 3.3% in the presence of HH. Prevalence was highest with large HH (12.8%). On univariate analysis, large HH, frequent non-steroidal anti-inflammatory drug (NSAID) use, GI bleeding (both occult and overt), and nadir hemoglobin level were significantly greater with Cameron lesions compared with HH without Cameron lesions (P ≤ 0.03). Large HH size and NSAID use were identified as independent risk factors for Cameron lesions on multivariate logistic regression analysis. Cameron lesions are more prevalent in the setting of large HH and NSAID use, can be associated with GI bleeding, and can respond to medical management. © 2014 International Society for Diseases of the Esophagus.

  5. Effectiveness of hand hygiene education in a basic nursing school curricula. (United States)

    Kelcíkova, Simona; Skodova, Zuzana; Straka, Stefan


    Although hand hygiene (HH) is the cheapest and simplest tool for the prevention of hospital-acquired infections, poor HH compliance has been reported among health care professionals. A variety of factors influence the compliance with HH guidelines, the most important being the quality of the basic nursing education. The aims of this study were to analyze the effectiveness of the basic nursing education in relation to HH, and to explore the skills and attitudes toward HH among nursing students in praxis. A mixed-method approach using a cross-sectional survey combined with observation and curricular analysis was used. A total of 188 nursing students participated in the study. Content analysis revealed significant deficits in the quality of HH-related information in basic nursing educational programs. Our results correlate directly with the reported insufficient levels of HH knowledge and the associated poor HH compliance by students during their training in clinical settings; as shown in observation and questionnaire-based surveys. The lack of compliance with HH standards among students lead to poor compliance among health care professionals in praxis. Consequently, the role of educational institutions in the prevention of hospital-acquired infections is significant, if the effectiveness of HH education is to be improved. © 2011 Wiley Periodicals, Inc.

  6. Hedgehog signaling pathway regulated the target genes for adipogenesis in silkworm Bombyx mori. (United States)

    Liang, Shuang; Chen, Rui-Ting; Zhang, Deng-Pan; Xin, Hu-Hu; Lu, Yan; Wang, Mei-Xian; Miao, Yun-Gen


    Hedgehog (Hh) signals regulate invertebrate and vertebrate development, yet the role of the pathway in adipose development remains poorly understood. In this report, we found that Hh pathway components are expressed in the fat body of silkworm larvae. Functional analysis of these components in a BmN cell line model revealed that activation of the Hh gene stimulated transcription of Hh pathway components, but inhibited the expression of the adipose marker gene AP2. Conversely, specific RNA interference-mediated knockdown of Hh resulted in increased AP2 expression. This further showed the regulation of Hh signal on the adipose marker gene. In silkworm larval models, enhanced adipocyte differentiation and an increase in adipocyte cell size were observed in silkworms that had been treated with a specific Hh signaling pathway antagonist, cyclopamine. The fat-body-specific Hh blockade tests were consistent with Hh signaling inhibiting silkworm adipogenesis. Our results indicate that the role of Hh signaling in inhibiting fat formation is conserved in vertebrates and invertebrates.

  7. The Hedgehog signalling pathway in bone formation

    Institute of Scientific and Technical Information of China (English)

    Jing Yang; Philipp Andre; Ling Ye; Ying-Zi Yang


    The Hedgehog (Hh) signalling pathway plays many important roles in development, homeostasis and tumorigenesis. The critical function of Hh signalling in bone formation has been identified in the past two decades. Here, we review the evolutionarily conserved Hh signalling mechanisms with an emphasis on the functions of the Hh signalling pathway in bone development, homeostasis and diseases. In the early stages of embryonic limb development, Sonic Hedgehog (Shh) acts as a major morphogen in patterning the limb buds. Indian Hedgehog (Ihh) has an essential function in endochondral ossification and induces osteoblast differentiation in the perichondrium. Hh signalling is also involved intramembrane ossification. Interactions between Hh and Wnt signalling regulate cartilage development, endochondral bone formation and synovial joint formation. Hh also plays an important role in bone homeostasis, and reducing Hh signalling protects against age-related bone loss. Disruption of Hh signalling regulation leads to multiple bone diseases, such as progressive osseous heteroplasia. Therefore, understanding the signalling mechanisms and functions of Hh signalling in bone development, homeostasis and diseases will provide important insights into bone disease prevention, diagnoses and therapeutics.

  8. Detergent-solubilized Patched purified from Sf9 cells fails to interact strongly with cognate Hedgehog or Ihog homologs. (United States)

    Cleveland, Thomas E; McCabe, Jacqueline M; Leahy, Daniel J


    Patched (Ptc) is a twelve-pass transmembrane protein that functions as a receptor for the Hedgehog (Hh) family of morphogens. In addition to Ptc, several accessory proteins including the CDO/Ihog family of co-receptors are necessary for proper Hh signaling. Structures of Hh proteins bound to members of the CDO/Ihog family are known, but the nature of the full Hh receptor complex is not well understood. We have expressed the Drosophila Patched and Mouse Patched-1 proteins in Sf9 cells and find that Sonic Hedgehog will bind to Mouse Patched-1 in isolated Sf9 cell membranes but that purified, detergent-solubilized Ptc proteins do not interact strongly with cognate Hh and CDO/Ihog homologs. These results may reflect a nonnative conformation of detergent-solubilized Ptc or that an additional factor or factors lost during purification are required for high-affinity Ptc binding to Hh.

  9. Zebrafish ift57, ift88, and ift172 intraflagellar transport mutants disrupt cilia but do not affect hedgehog signaling. (United States)

    Lunt, Shannon C; Haynes, Tony; Perkins, Brian D


    Cilia formation requires intraflagellar transport (IFT) proteins. Recent studies indicate that mammalian Hedgehog (Hh) signaling requires cilia. It is unclear, however, if the requirement for cilia and IFT proteins in Hh signaling represents a general rule for all vertebrates. Here we examine zebrafish ift57, ift88, and ift172 mutants and morphants for defects in Hh signaling. Although ift57 and ift88 mutants and morphants contained residual maternal protein, the cilia were disrupted. In contrast to previous genetic studies in mouse, mutations in zebrafish IFT genes did not affect the expression of Hh target genes in the neural tube and forebrain and had no quantitative effect on Hh target gene expression. Zebrafish IFT mutants also exhibited no dramatic changes in the craniofacial skeleton, somite formation, or motor neuron patterning. Thus, our data indicate the requirement for cilia in the Hh signal transduction pathway may not represent a universal mechanism in vertebrates.

  10. Hedgehog signaling acts with the temporal cascade to promote neuroblast cell cycle exit.

    Directory of Open Access Journals (Sweden)

    Phing Chian Chai

    Full Text Available In Drosophila postembryonic neuroblasts, transition in gene expression programs of a cascade of transcription factors (also known as the temporal series acts together with the asymmetric division machinery to generate diverse neurons with distinct identities and regulate the end of neuroblast proliferation. However, the underlying mechanism of how this "temporal series" acts during development remains unclear. Here, we show that Hh signaling in the postembryonic brain is temporally regulated; excess (earlier onset of Hh signaling causes premature neuroblast cell cycle exit and under-proliferation, whereas loss of Hh signaling causes delayed cell cycle exit and excess proliferation. Moreover, the Hh pathway functions downstream of Castor but upstream of Grainyhead, two components of the temporal series, to schedule neuroblast cell cycle exit. Interestingly, hh is likely a target of Castor. Hence, Hh signaling provides a link between the temporal series and the asymmetric division machinery in scheduling the end of neurogenesis.

  11. Hedgehog signaling and gastrointestinal cancer (United States)

    Saqui-Salces, Milena; Merchant, Juanita L.


    Hedgehog (Hh) signaling is critical for embryonic development and in differentiation, proliferation, and maintenance of multiple adult tissues. De-regulation of the Hh pathway is associated with birth defects and cancer. In the gastrointestinal tract, Hh ligands Sonic (Shh) and Indian (Ihh), as well as the receptor Patched (Ptch1), and transcription factors of Glioblastoma family (Gli) are all expressed during development. In the adult, Shh expression is restricted to the stomach and colon, while Ihh expression occurs throughout the luminal gastrointestinal tract, its expression being highest in the proximal duodenum. Several studies have demonstrated a requirement for Hh signaling during gastrointestinal tract development. However to date, the specific role of the Hh pathway in the adult stomach and intestine is not completely understood. The current review will place into context the implications of recent published data related to the biochemistry and cell biology of Hh signaling on the luminal gastrointestinal tract during development, normal physiology and subsequently carcinogenesis. PMID:20307590

  12. Clinical implications of hedgehog signaling pathway inhibitors

    Institute of Scientific and Technical Information of China (English)

    Hailan Liu; Dongsheng Gu; Jingwu Xie


    Hedgehog was first described in Drosophila melanogaster by the Nobel laureates Eric Wieschaus and Christiane Nusslein-Volhard. The hedgehog (Hh) pathway is a major regulator of cell differentiation,proliferation, tissue polarity, stem cell maintenance, and carcinogenesis. The first link of Hh signaling to cancer was established through studies of a rare familial disease, Gorlin syndrome, in 1996. Follow-up studies revealed activation of this pathway in basal cell carcinoma, medulloblastoma and, leukemia as well as in gastrointestinal, lung, ovarian, breast, and prostate cancer. Targeted inhibition of Hh signaling is now believed to be effective in the treatment and prevention of human cancer. The discovery and synthesis of specific inhibitors for this pathway are even more exciting. In this review, we summarize major advances in the understanding of Hh signaling pathway activation in human cancer, mouse models for studying Hhmediated carcinogenesis, the roles of Hh signaling in tumor development and metastasis, antagonists for Hh signaling and their clinical implications.

  13. Hydraulic hammer drilling technology: Developments and capabilities

    Energy Technology Data Exchange (ETDEWEB)

    Melamed, Y.; Kiselev, A. [SKB Geotechnika, Moscow (Russian Federation); Gelfgat, M. [Aquatic Co., Moscow (Russian Federation); Dreesen, D.; Blacic, J. [Los Alamos National Lab., NM (United States). GeoEngineering Group


    Percussion drilling technology was considered many years ago as one of the best approaches for hard rock drilling. Unfortunately the efficiency of most hydraulic hammer (HH) designs was very low (8% maximum), so they were successfully used in shallow boreholes only. Thirty years of research and field drilling experience with HH application in Former Soviet Union (FSU) countries led to the development of a new generation of HH designs with a proven efficiency of 40%. That advance achieved good operational results in hard rock at depths up to 2,000 m and more. The most recent research has shown that there are opportunities to increase HH efficiency up to 70%. This paper presents HH basic design principles and operational features. The advantages of HH technology for coiled-tubing drilling is shown on the basis of test results recently conducted in the US.

  14. Hedgehog pathway as a drug target: Smoothened inhibitors in development

    Directory of Open Access Journals (Sweden)

    Lin TL


    Full Text Available Tara L Lin1, William Matsui21Division of Hematology/Oncology, Department of Internal Medicine, University of Kansas, Kansas City, MO, USA; 2Division of Hematologic Malignancies, The Sidney Kimmel Comprehensive Cancer Center, Johns Hopkins University School of Medicine, Baltimore, MD, USAAbstract: Emerging laboratory and clinical investigations demonstrate that Hedgehog signaling (Hh represents a novel therapeutic target in various human cancers. This conserved signaling pathway precisely regulates self-renewal and terminal differentiation in embryonic development, but is typically silenced in adult tissues, with reactivation usually only during tissue repair. Aberrant Hh pathway signaling has been implicated in the pathogenesis, self-renewal, and chemotherapy resistance of a growing number of solid and hematologic malignancies. Major components of the Hh pathway include the Hh ligands (Sonic, Desert, and Indian, the transmembrane receptor Patched, the signal transducer Smoothened (Smo, and transcription factors Gli1–3 which regulate the transcription of Hh target genes. Mutations in Hh pathway genes, increased Hh signaling in tumor stroma, and Hh overexpression in self-renewing cells (cancer stem cells have been described, and these different modes of Hh signaling have implications for the design of Hh pathway inhibitors and their integration into conventional treatment regimens. Discovery of a naturally-occurring Smo inhibitor, cyclopamine, and the identification of Hh pathway mutations and over expression in cancer cells prompted the development of several cyclopamine derivatives. Encouraging laboratory and in vivo data has resulted in Phase I and II clinical trials of Smo inhibitors. In this review, we will discuss the current understanding of Hh pathway signaling in malignancy and Smo antagonists in development. Recent data with these agents shows that they are well-tolerated and may be effective for subsets of patients. Challenges remain

  15. Synergism between Hedgehog-GLI and EGFR signaling in Hedgehog-responsive human medulloblastoma cells induces downregulation of canonical Hedgehog-target genes and stabilized expression of GLI1.

    Directory of Open Access Journals (Sweden)

    Frank Götschel

    Full Text Available Aberrant activation of Hedgehog (HH signaling has been identified as a key etiologic factor in many human malignancies. Signal strength, target gene specificity, and oncogenic activity of HH signaling depend profoundly on interactions with other pathways, such as epidermal growth factor receptor-mediated signaling, which has been shown to cooperate with HH/GLI in basal cell carcinoma and pancreatic cancer. Our experimental data demonstrated that the Daoy human medulloblastoma cell line possesses a fully inducible endogenous HH pathway. Treatment of Daoy cells with Sonic HH or Smoothened agonist induced expression of GLI1 protein and simultaneously prevented the processing of GLI3 to its repressor form. To study interactions between HH- and EGF-induced signaling in greater detail, time-resolved measurements were carried out and analyzed at the transcriptomic and proteomic levels. The Daoy cells responded to the HH/EGF co-treatment by downregulating GLI1, PTCH, and HHIP at the transcript level; this was also observed when Amphiregulin (AREG was used instead of EGF. We identified a novel crosstalk mechanism whereby EGFR signaling silences proteins acting as negative regulators of HH signaling, as AKT- and ERK-signaling independent process. EGFR/HH signaling maintained high GLI1 protein levels which contrasted the GLI1 downregulation on the transcript level. Conversely, a high-level synergism was also observed, due to a strong and significant upregulation of numerous canonical EGF-targets with putative tumor-promoting properties such as MMP7, VEGFA, and IL-8. In conclusion, synergistic effects between EGFR and HH signaling can selectively induce a switch from a canonical HH/GLI profile to a modulated specific target gene profile. This suggests that there are more wide-spread, yet context-dependent interactions, between HH/GLI and growth factor receptor signaling in human malignancies.

  16. Self-Esteem of Deaf and Hard of Hearing Students in Regular and Special Schools (United States)

    Lesar, Irena; Smrtnik Vitulic, Helena


    The study focuses on the self-esteem of deaf and hard of hearing (D/HH) students from Slovenia. A total of 80 D/HH students from regular and special primary schools (grades 6-9) and from regular and special secondary schools (grades 1-4) completed the Self-Esteem Questionnaire (Lamovec 1994). For the entire group of D/HH students, the results of…

  17. Gap Junctions Contribute to Ictal/Interictal Genesis in Human Hypothalamic Hamartomas. (United States)

    Wu, Jie; Gao, Ming; Rice, Stephen G; Tsang, Candy; Beggs, John; Turner, Dharshaun; Li, Guohui; Yang, Bo; Xia, Kunkun; Gao, Fenfei; Qiu, Shenfeng; Liu, Qiang; Kerrigan, John F


    Human hypothalamic hamartoma (HH) is a rare subcortical lesion associated with treatment-resistant epilepsy. Cellular mechanisms responsible for epileptogenesis are unknown. We hypothesized that neuronal gap junctions contribute to epileptogenesis through synchronous activity within the neuron networks in HH tissue. We studied surgically resected HH tissue with Western-blot analysis, immunohistochemistry, electron microscopy, biocytin microinjection of recorded HH neurons, and microelectrode patch clamp recordings with and without pharmacological blockade of gap junctions. Normal human hypothalamus tissue was used as a control. Western blots showed increased expression of both connexin-36 (Cx36) and connexin-43 (Cx43) in HH tissue compared with normal human mammillary body tissue. Immunohistochemistry demonstrated that Cx36 and Cx43 are expressed in HH tissue, but Cx36 was mainly expressed within neuron clusters while Cx43 was mainly expressed outside of neuron clusters. Gap-junction profiles were observed between small HH neurons with electron microscopy. Biocytin injection into single recorded small HH neurons showed labeling of adjacent neurons, which was not observed in the presence of a neuronal gap-junction blocker, mefloquine. Microelectrode field recordings from freshly resected HH slices demonstrated spontaneous ictal/interictal-like discharges in most slices. Bath-application of gap-junction blockers significantly reduced ictal/interictal-like discharges in a concentration-dependent manner, while not affecting the action-potential firing of small gamma-aminobutyric acid (GABA) neurons observed with whole-cell patch-clamp recordings from the same patient's HH tissue. These results suggest that neuronal gap junctions between small GABAergic HH neurons participate in the genesis of epileptic-like discharges. Blockade of gap junctions may be a new therapeutic strategy for controlling seizure activity in HH patients.

  18. PTSD Trajectory, Co-morbidity, and Utilization of Mental Health Services among National Guard Forces (United States)


    without seatbelts (15.4% compared to 5.7%), but not new-onset depression, suicidal ideation or drunk driving or at time 2. Implications: These...1 2 3 4 8 9 HH4 ….to cry about or for this individual? 1 2 3 4 8 9 HH5 ….to feel sadness? 1 2 3 4 8 9 HH6. ….to feel loss of enjoyment ? 1 2 3 4

  19. On weakly D-differentiable operators

    DEFF Research Database (Denmark)

    Christensen, Erik


    Let DD be a self-adjoint operator on a Hilbert space HH and aa a bounded operator on HH. We say that aa is weakly DD-differentiable, if for any pair of vectors ξ,ηξ,η from HH the function 〈eitDae−itDξ,η〉〈eitDae−itDξ,η〉 is differentiable. We give an elementary example of a bounded operator aa, suc...

  20. Newly Discovered Herbig-Haro Objects near Haro 4-255

    Institute of Scientific and Technical Information of China (English)

    WANG Min; ZHAO Bing; DENG Li-Cai; CHEN Jian-Sheng


    We have performed CCD (charge coupled device) imaging toward the region near Haro 4-255 with a narrow band [SⅡ] filter and an intermediate band [BATC10] filter (BATC: the “Beijing-Arizona-Taiwan-Connecticut”multi-color sky survey project) and have discovered two Herbig-Haro (HH) objects, HH469 and HH470. They are identified to be driven by the Haro 4-255 (far-infrared) source and the T Tauri star Haro 4-255, respectively.

  1. Gap Junctions Contribute to Ictal/Interictal Genesis in Human Hypothalamic Hamartomas

    Directory of Open Access Journals (Sweden)

    Jie Wu


    Full Text Available Human hypothalamic hamartoma (HH is a rare subcortical lesion associated with treatment-resistant epilepsy. Cellular mechanisms responsible for epileptogenesis are unknown. We hypothesized that neuronal gap junctions contribute to epileptogenesis through synchronous activity within the neuron networks in HH tissue. We studied surgically resected HH tissue with Western-blot analysis, immunohistochemistry, electron microscopy, biocytin microinjection of recorded HH neurons, and microelectrode patch clamp recordings with and without pharmacological blockade of gap junctions. Normal human hypothalamus tissue was used as a control. Western blots showed increased expression of both connexin-36 (Cx36 and connexin-43 (Cx43 in HH tissue compared with normal human mammillary body tissue. Immunohistochemistry demonstrated that Cx36 and Cx43 are expressed in HH tissue, but Cx36 was mainly expressed within neuron clusters while Cx43 was mainly expressed outside of neuron clusters. Gap-junction profiles were observed between small HH neurons with electron microscopy. Biocytin injection into single recorded small HH neurons showed labeling of adjacent neurons, which was not observed in the presence of a neuronal gap-junction blocker, mefloquine. Microelectrode field recordings from freshly resected HH slices demonstrated spontaneous ictal/interictal-like discharges in most slices. Bath-application of gap-junction blockers significantly reduced ictal/interictal-like discharges in a concentration-dependent manner, while not affecting the action-potential firing of small gamma-aminobutyric acid (GABA neurons observed with whole-cell patch-clamp recordings from the same patient's HH tissue. These results suggest that neuronal gap junctions between small GABAergic HH neurons participate in the genesis of epileptic-like discharges. Blockade of gap junctions may be a new therapeutic strategy for controlling seizure activity in HH patients.

  2. Analysis of hemochromatosis gene mutations in 52 consecutive patients with polycythemia vera. (United States)

    Franchini, Massimo; de Matteis, Giovanna; Federici, Francesca; Solero, Pietro; Veneri, Dino


    A literature review reports increased erythrocyte indices [hemoglobin concentration, hematocrit, mean corpuscular volume, mean corpuscular hemoglobin (MCH), MCH concentration] in subjects with hereditary hemochromatosis (HH). We, therefore, screened 52 consecutive patients with polycythemia vera for 12 HH gene mutations, comparing iron status and red cell parameters between patients positive or negative for HH gene mutations. Our results support the evidence that there is no association between these two conditions.

  3. Self-Esteem of Deaf and Hard of Hearing Students in Regular and Special Schools (United States)

    Lesar, Irena; Smrtnik Vitulic, Helena


    The study focuses on the self-esteem of deaf and hard of hearing (D/HH) students from Slovenia. A total of 80 D/HH students from regular and special primary schools (grades 6-9) and from regular and special secondary schools (grades 1-4) completed the Self-Esteem Questionnaire (Lamovec 1994). For the entire group of D/HH students, the results of…

  4. Pirfenidone exerts antifibrotic effects through inhibition of GLI transcription factors. (United States)

    Didiasova, Miroslava; Singh, Rajeev; Wilhelm, Jochen; Kwapiszewska, Grazyna; Wujak, Lukasz; Zakrzewicz, Dariusz; Schaefer, Liliana; Markart, Philipp; Seeger, Werner; Lauth, Matthias; Wygrecka, Malgorzata


    Pirfenidone is an antifibrotic drug, recently approved for the treatment of patients suffering from idiopathic pulmonary fibrosis (IPF). Although pirfenidone exhibits anti-inflammatory, antioxidant, and antifibrotic properties, the molecular mechanism underlying its protective effects remains unknown. Here, we link pirfenidone action with the regulation of the profibrotic hedgehog (Hh) signaling pathway. We demonstrate that pirfenidone selectively destabilizes the glioma-associated oncogene homolog (GLI)2 protein, the primary activator of Hh-mediated gene transcription. Consequently, pirfenidone decreases overall Hh pathway activity in patients with IPF and in patient-derived primary lung fibroblasts and leads to diminished levels of Hh target genes such as GLI1, Hh receptor Patched-1, α-smooth muscle actin, and fibronectin and to reduced cell migration and proliferation. Interestingly, Hh-triggered TGF-β1 expression potentiated Hh responsiveness of primary lung fibroblasts by elevating the available pool of glioma-associated oncogene homolog (GLI)1/GLI2, thus creating a vicious cycle of amplifying fibrotic processes. Because GLI transcription factors are not only crucial for Hh-mediated changes but are also required as mediators of TGF-β signaling, our findings suggest that pirfenidone exerts its clinically beneficial effects through dual Hh/TGF-β inhibition by targeting the GLI2 protein.-Didiasova, M., Singh, R., Wilhelm, J., Kwapiszewska, G., Wujak, L., Zakrzewicz, D., Schaefer, L., Markart, P., Seeger, W., Lauth, M., Wygrecka, M. Pirfenidone exerts antifibrotic effects through inhibition of GLI transcription factors.

  5. Analysis of cCx39 expression pattern during chick development. (United States)

    Nicotra, Annalisa; Cicirata, Federico; Martinez, Salvador


    The present study reports the expression pattern of connexin39 (cCx39) in chick embryos at different stages of central nervous system development. We examined the expression between HH17 and HH40 developmental stages of chicken embryos by in situ hybridization (ISH) technique. Connexin39 was first expressed at HH17. It stained neuroepithelial cells in the optic (OV) and telencephalic (TEL) vesicles, plus in the superficial mesenchyme of the two rostral branchial arches (maxilar and mandibular). These cells probably originated from the neural crest. This expression pattern changed drastically between stages HH17 and HH23, while it showed relatively little modifications from HH23 to HH29. At these times, connexin39 was expressed in three regions: the telencephalic vesicle, the diencephalon and the isthmus. At later stages, HH35 and HH40, connexin39 was mainly expressed in the ventricular epithelium and three cell layers of the stratum griseum and fibrosum superficialis (SGFS) in the optic tectum, as well as in granular and nuclear cells in the cerebellum. In conclusion, the expression pattern of connexin39 in embryonic nervous system is dynamic. This pattern is different from, and in some aspects complementary to, those showed by other connexins during brain development.

  6. Repurposing the antihelmintic mebendazole as a hedgehog inhibitor (United States)

    Larsen, Andrew R.; Bai, Ren-Yuan; Chung, Jon H.; Borodovsky, Alexandra; Rudin, Charles M.; Riggins, Gregory J.; Bunz, Fred


    The hedgehog (Hh) signaling pathway is activated in many types of cancer and therefore presents an attractive target for new anticancer agents. Here we show that mebendazole (MBZ), a benzamidazole with a long history of safe use against nematode infestations and hydatid disease, potently inhibited Hh signaling and slowed the growth of Hh-driven human medulloblastoma cells at clinically attainable concentrations. As an antiparasitic, MBZ avidly binds nematode tubulin and causes inhibition of intestinal microtubule synthesis. In human cells, MBZ suppressed the formation of the primary cilium, a microtubule-based organelle that functions as a signaling hub for Hh pathway activation. The inhibition of Hh signaling by MBZ was unaffected by mutants in the gene that encodes the Hh pathway signaling protein SMO, which are selectively propagated in cell clones that survive treatment with the Hh inhibitor vismodegib. Combination of vismodegib and MBZ resulted in additive Hh signaling inhibition. Because MBZ can be safely administered to adults and children at high doses over extended time periods, we propose that MBZ could be rapidly repurposed and clinically tested as a prospective therapeutic agent for many tumors that are dependent on Hh signaling. PMID:25376612

  7. Research advances in Hedgehog signaling pathway in hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    LIU Jia


    Full Text Available Hedgehog (Hh signaling pathway is present in many animals and plays an important role in regulating embryonic development and differentiation. Aberrant activation of Hh signaling contributes to the pathogenesis of many malignancies. Recent studies have shown that dysregulated Hh signaling pathway participates in the tumorigenesis, tumor invasion, and metastasis of hepatocellular carcinoma (HCC. Investigation of the relationship between Hh signaling pathway and HCC will help elucidate the molecular mechanism of pathogenesis of HCC and provide a new insight into the development of novel anticancer therapy and therapeutic target.

  8. Hedgehog signaling antagonist promotes regression of both liver fibrosis and hepatocellular carcinoma in a murine model of primary liver cancer.

    Directory of Open Access Journals (Sweden)

    George M Philips

    Full Text Available OBJECTIVE: Chronic fibrosing liver injury is a major risk factor for hepatocarcinogenesis in humans. Mice with targeted deletion of Mdr2 (the murine ortholog of MDR3 develop chronic fibrosing liver injury. Hepatocellular carcinoma (HCC emerges spontaneously in such mice by 50-60 weeks of age, providing a model of fibrosis-associated hepatocarcinogenesis. We used Mdr2(-/- mice to investigate the hypothesis that activation of the hedgehog (Hh signaling pathway promotes development of both liver fibrosis and HCC. METHODS: Hepatic injury and fibrosis, Hh pathway activation, and liver progenitor populations were compared in Mdr2(-/- mice and age-matched wild type controls. A dose finding experiment with the Hh signaling antagonist GDC-0449 was performed to optimize Hh pathway inhibition. Mice were then treated with GDC-0449 or vehicle for 9 days, and effects on liver fibrosis and tumor burden were assessed by immunohistochemistry, qRT-PCR, Western blot, and magnetic resonance imaging. RESULTS: Unlike controls, Mdr2(-/- mice consistently expressed Hh ligands and progressively accumulated Hh-responsive liver myofibroblasts and progenitors with age. Treatment of aged Mdr2-deficient mice with GDC-0449 significantly inhibited hepatic Hh activity, decreased liver myofibroblasts and progenitors, reduced liver fibrosis, promoted regression of intra-hepatic HCCs, and decreased the number of metastatic HCC without increasing mortality. CONCLUSIONS: Hh pathway activation promotes liver fibrosis and hepatocarcinogenesis, and inhibiting Hh signaling safely reverses both processes even when fibrosis and HCC are advanced.

  9. Kinematics of powerful jets from intermediate-mass protostars in the Carina nebula

    CERN Document Server

    Reiter, Megan


    We present measurements of proper motions and radial velocities of four powerful Herbig-Haro (HH) jets in the Carina nebula: HH 666, HH 901, HH 902, and HH 1066. Two epochs of Hubble Space Telescope (HST) imaging separated by a time baseline of ~4.4 years provide proper motions that allow us to measure the transverse velocities of the jets, while ground-based spectra sample their Doppler velocities. Together these yield full three-dimensional space velocities. Aside from HH 666, their identification as outflows was previously inferred only from morphology in images. Proper motions now show decisively that these objects are indeed jets, and confirm that the intermediate-mass protostars identified as the candidate driving sources for HH 666 and HH 1066 are indeed the origin of these outflows. The appearance of two new knots in the HH 1066 jet suggest recent (~35 yr) changes in the accretion rate, underscoring the variable nature of accretion and outflow in the formation of intermediate-mass stars. In fact, kine...

  10. Hereditary hemochromatosis (HFE) genotypes in heart failure: relation to etiology and prognosis

    DEFF Research Database (Denmark)

    Møller, Daniel Vega; Pecini, Redi; Gustafsson, Finn;


    It is believed that hereditary hemochromatosis (HH) might play a role in cardiac disease (heart failure (HF) and ischemia). Mutations within several genes are HH-associated, the most common being the HFE gene. In a large cohort of HF patients, we sought to determine the etiological role and the p......It is believed that hereditary hemochromatosis (HH) might play a role in cardiac disease (heart failure (HF) and ischemia). Mutations within several genes are HH-associated, the most common being the HFE gene. In a large cohort of HF patients, we sought to determine the etiological role...

  11. Concomitant presentation of collagenous sprue and HFE hemochromatosis. (United States)

    Parisian, Keely R; Plesec, Thomas P; Fairbanks, Kyrsten D; Tavill, Anthony S; Shen, Bo


    Collagenous sprue (CS) is a progressive malabsorptive disorder characterized by collagen deposition beneath the basement membrane of small bowel epithelium in refractory celiac sprue. CS is a pathologically distinct entity from celiac disease, despite a similar clinical presentation. The etiology of CS is unclear, although there are speculations that CS and celiac disease may share similar pathogenetic pathways. On the other hand, HFE hemochromatosis (HH) is a distinct disease entity. Celiac disease and HH are common HLA-associated genetic disorders in Northern European populations. There are a few case reports linking celiac disease and HH. We present a patient diagnosed with concurrent CS and HH.

  12. Hedgehog signaling antagonist promotes regression of both liver fibrosis and hepatocellular carcinoma in a murine model of primary liver cancer. (United States)

    Philips, George M; Chan, Isaac S; Swiderska, Marzena; Schroder, Vanessa T; Guy, Cynthia; Karaca, Gamze F; Moylan, Cynthia; Venkatraman, Talaignair; Feuerlein, Sebastian; Syn, Wing-Kin; Jung, Youngmi; Witek, Rafal P; Choi, Steve; Michelotti, Gregory A; Rangwala, Fatima; Merkle, Elmar; Lascola, Christopher; Diehl, Anna Mae


    Chronic fibrosing liver injury is a major risk factor for hepatocarcinogenesis in humans. Mice with targeted deletion of Mdr2 (the murine ortholog of MDR3) develop chronic fibrosing liver injury. Hepatocellular carcinoma (HCC) emerges spontaneously in such mice by 50-60 weeks of age, providing a model of fibrosis-associated hepatocarcinogenesis. We used Mdr2(-/-) mice to investigate the hypothesis that activation of the hedgehog (Hh) signaling pathway promotes development of both liver fibrosis and HCC. Hepatic injury and fibrosis, Hh pathway activation, and liver progenitor populations were compared in Mdr2(-/-) mice and age-matched wild type controls. A dose finding experiment with the Hh signaling antagonist GDC-0449 was performed to optimize Hh pathway inhibition. Mice were then treated with GDC-0449 or vehicle for 9 days, and effects on liver fibrosis and tumor burden were assessed by immunohistochemistry, qRT-PCR, Western blot, and magnetic resonance imaging. Unlike controls, Mdr2(-/-) mice consistently expressed Hh ligands and progressively accumulated Hh-responsive liver myofibroblasts and progenitors with age. Treatment of aged Mdr2-deficient mice with GDC-0449 significantly inhibited hepatic Hh activity, decreased liver myofibroblasts and progenitors, reduced liver fibrosis, promoted regression of intra-hepatic HCCs, and decreased the number of metastatic HCC without increasing mortality. Hh pathway activation promotes liver fibrosis and hepatocarcinogenesis, and inhibiting Hh signaling safely reverses both processes even when fibrosis and HCC are advanced.

  13. Magnetic field effects on the Rabi splitting and radiative decay rates of the exciton-polariton states in a semiconductor microcavity (United States)

    Fenniche, H.; Jaziri, S.; Bennaceur, R.


    We study theoretically a particular type of semiconductor microcavity formed by a quantum well embedded inside it and the distributed Bragg reflectors presenting a gradual structure. We apply to this structure a static magnetic field along the growth direction. In the strong coupling regime between the confined exciton and cavity modes, we evaluate the polariton Rabi splitting corresponding to the two lowest lying exciton states: HH1-CB1 and HH2-CB2 as a function of the applied magnetic field. In high magnetic field and for distinct reflectivities, we find that the Rabi splitting magnitude of the HH2-CB2 exciton is close to the fundamental one (HH1-CB1). In the presence of the magnetic field, the polariton Rabi splitting can be obtained even in low reflectivity. The dispersion polariton radiative decay rates related to the two lowest lying exciton states: HH1-CB1 and HH2-CB2 are calculated for different magnetic field values. At k //=0 and in the weak coupling regime, the polariton radiative decay rates are evaluated for both the HH1-CB1 and HH2-CB2 excitons. We show that for the fundamental excitonic state, the magnetic field value which determines the transition from the weak to the strong coupling regime is different from the HH2-CB2 exciton state.

  14. Resonant behaviour of GaAs LO phonons in a GaAs-AlAs superlattice (United States)

    Zhang, Shulin; T, A. Gant; M, Delaney; M, V. Klein; J, Klem; H, Morkoc


    Resonant Raman scattering from GaAs LO phonons in a 59Å GaAs/20Å AlAs superlattice was studied. The relevant intersubband energies were determined. The results suggest that all of the exciton transitions from the hole subbands HH1, LH1, HH2, HH3, LH2 and HH4 to the electron subbands CB1 and CB2 in the energy region covered by our incident dye laser were observed and a justificative analysis may involve effects due to valence band mixing and to 3D electronic miniband structure.

  15. Patient symptoms correlate poorly with objective measures among patients with gastroesophageal reflux disease. (United States)

    Levy, Salomon; Plymale, Margaret; Davenport, Daniel L; Moreno Ponte, Oscar I; Roth, J Scott


    Presentation of gastroesophageal reflux disease (GERD) varies among patients. To attempt to understand the patient's perception of the severity of their reflux symptoms, we developed a questionnaire on which patients rated symptom severity at each office visit. After receiving Institutional Review Board approval, we retrospectively reviewed patient charts of all patients seen by one surgeon for GERD symptoms and/or presence of hiatal hernia (HH) from September 2012 to April 2013. Data from patient questionnaires combined with objective findings from subsequent or prior workup and eventual operative information were recorded. A total of 144 questionnaires were reviewed from 108 patients. Frequencies were calculated for categorical variables. Patients were divided into four categories based on size of the HH on the endoscopic report; 10 patients had no HH, 15 had small HH, 20 had medium HH, and 31 patients had large HH. Size of HH was not available for three patients. Pre- and postoperative questionnaire responses were obtained for 15 patients. A combined reflux score was calculated using the median for each symptom. Patient perception of severity of symptoms does not necessarily predict presence of pathological reflux or HH nor is there a perfect combination of symptoms to predict the presence of pathological reflux or HH based on our sample. The workup of this pathology must be comprehensive, and the confirmation of reflux is imperative when the diagnosis is unclear.

  16. Hyperinsulinemic Hypoglycaemia in a Turner Syndrome with Ring (X

    Directory of Open Access Journals (Sweden)

    Michela Cappella


    Full Text Available Hyperinsulinemic hypoglycaemia (HH is a group of clinically, genetically, and morphologically heterogeneous disorders characterized by dysregulation of insulin secretion by pancreatic beta cells. HH can either be congenital genetic hyperinsulinism or associated with metabolic disorder and syndromic condition. Early identification and meticulous management of these patients is vital to prevent neurological insult. There are only three reported cases of HH associated with a mosaic, r(X Turner syndrome. We report the four cases of an infant with a mosaic r(X Turner genotype and HH responsive to diazoxide therapy.

  17. Hedgehog signalling controls zebrafish neural keel morphogenesis via its level-dependent effects on neurogenesis. (United States)

    Takamiya, Masanari; Campos-Ortega, Jose A


    We investigated the role of hedgehog (Hh) signalling on zebrafish neurulation, focusing on the intimate relationship between neurogenesis and morphogenesis during the neural keel stage. Through the analyses of Hh loss- and gain-of-function phenotypes, we found that Hh signalling controls the neural keel morphogenesis. To investigate underlying mechanisms, we examined cellular elongation polarity in the neural keel of Hh loss- and gain-of-function phenotypes and compared this with the deficient phenotype of a planar cell polarity (PCP) molecule, Trilobite/Strabismus. We found that Hh signalling controls cell elongation polarity of the neuroepithelium at least in part by means of PCP pathway; however, its effects are not strong enough per se to affect keel morphogenesis; instead Hh signalling mainly controls keel morphogenesis by means of affecting both medial and lateral neurogenesis. We devised a method for precise evaluation of neurogenesis in loss- and gain-of-Hh phenotypes that compensates for its delay caused by disturbed morphogenesis. We present a model that Hh signalling exerts level-dependent and binary-opposite effects on medial neurogenesis, whose modification to explain lateral neurogenesis reveals regional differences of underlying mechanisms between the two proneural domains. Such differences seem to be created in part by regional effector signalling; the effects of high Hh-signalling on medial neurogenesis can be reversed in accordance to medial Tri/Stbm level, in a polarity independent manner.

  18. Unidirectional synchronization of Hodgkin-Huxley neurons exposed to ELF electric field

    Energy Technology Data Exchange (ETDEWEB)

    Wang Jiang [School of Electrical Engineering and Automation, Tianjin University, Tianjin 300072 (China)], E-mail:; Che Yanqiu; Zhou Sisi; Deng Bin [School of Electrical Engineering and Automation, Tianjin University, Tianjin 300072 (China)


    In this paper, a hybrid control strategy, H{sub {infinity}} variable universe adaptive fuzzy control, is derived and applied to synchronize two Hodgkin-Huxley (HH) neurons exposed to external electric field. Firstly, the modified model of HH neuron exposed to extremely low frequency (ELF) external electric field is established and its periodic and chaotic dynamics in response to sinusoidal electric field stimulation are described. And then the statement of the problem for unidirectional synchronization of two HH neurons is given. Finally H{sub {infinity}} variable universe adaptive fuzzy control is designed to synchronize the HH systems and the simulation results demonstrate the effectiveness of the proposed control method.

  19. Sexual dimorphism of the feto-placental phenotype in response to a high fat and control maternal diets in a rabbit model.

    Directory of Open Access Journals (Sweden)

    Anne Tarrade

    Full Text Available Maternal environment during early developmental stages plays a seminal role in the establishment of adult phenotype. Using a rabbit model, we previously showed that feeding dams with a diet supplemented with 8% fat and 0.2% cholesterol (HH diet from the prepubertal period and throughout gestation induced metabolic syndrome in adult offspring. Here, we examined the effects of the HH diet on feto-placental phenotype at 28 days post-coïtum (term = 31 days in relation to earlier effects in the blastocyst (Day 6. At 28 days, both male and female HH fetuses were intrauterine growth retarded and dyslipidemic, with males more affected than females. Lipid droplets accumulated in the HH placentas' trophoblast, consistent with the increased concentrations in cholesteryl esters (3.2-fold, triacylglycerol (2.5-fold and stored FA (2.12-fold. Stored FA concentrations were significantly higher in female compared to male HH placentas (2.18-fold, p<0.01, whereas triacylglycerol was increased only in HH males. Trophoblastic lipid droplet accumulation was also observed at the blastocyst stage. The expression of numerous genes involved in lipid pathways differed significantly according to diet both in term placenta and at the blastocyst stage. Among them, the expression of LXR-α in HH placentas was reduced in HH males but not females. These data demonstrate that maternal HH diet affects the blastocyst and induces sex-dependent metabolic adaptations in the placenta, which appears to protect female fetuses from developing severe dyslipidemia.

  20. Targeted Cancer Therapy with a Novel Anti-CD37 Beta-Particle Emitting Radioimmunoconjugate for Treatment of Non-Hodgkin Lymphoma.

    Directory of Open Access Journals (Sweden)

    Ada H V Repetto-Llamazares

    Full Text Available 177Lu-DOTA-HH1 (177Lu-HH1 is a novel anti-CD37 radioimmunoconjugate developed to treat non-Hodgkin lymphoma. Mice with subcutaneous Ramos xenografts were treated with different activities of 177Lu-HH1, 177Lu-DOTA-rituximab (177Lu-rituximab and non-specific 177Lu-DOTA-IgG1 (177Lu-IgG1 and therapeutic effect and toxicity of the treatment were monitored. Significant tumor growth delay and increased survival of mice were observed in mice treated with 530 MBq/kg 177Lu-HH1 as compared with mice treated with similar activities of 177Lu-rituximab or non-specific 177Lu-IgG1, 0.9% NaCl or unlabeled HH1. All mice injected with 530 MBq/kg of 177Lu-HH1 tolerated the treatment well. In contrast, 6 out of 10 mice treated with 530 MBq/kg 177Lu-rituximab experienced severe radiation toxicity. The retention of 177Lu-rituximab in organs of the mononuclear phagocyte system was longer than for 177Lu-HH1, which explains the higher toxicity observed in mice treated with 177Lu-rituximab. In vitro internalization studies showed that 177Lu-HH1 internalizes faster and to a higher extent than 177Lu-rituximab which might be the reason for the better therapeutic effect of 177Lu-HH1.

  1. Targeted Cancer Therapy with a Novel Anti-CD37 Beta-Particle Emitting Radioimmunoconjugate for Treatment of Non-Hodgkin Lymphoma (United States)

    Repetto-Llamazares, Ada H. V.; Larsen, Roy H.; Patzke, Sebastian; Fleten, Karianne G.; Didierlaurent, David; Pichard, Alexandre; Pouget, Jean Pierre; Dahle, Jostein


    177Lu-DOTA-HH1 (177Lu-HH1) is a novel anti-CD37 radioimmunoconjugate developed to treat non-Hodgkin lymphoma. Mice with subcutaneous Ramos xenografts were treated with different activities of 177Lu-HH1, 177Lu-DOTA-rituximab (177Lu-rituximab) and non-specific 177Lu-DOTA-IgG1 (177Lu-IgG1) and therapeutic effect and toxicity of the treatment were monitored. Significant tumor growth delay and increased survival of mice were observed in mice treated with 530 MBq/kg 177Lu-HH1 as compared with mice treated with similar activities of 177Lu-rituximab or non-specific 177Lu-IgG1, 0.9% NaCl or unlabeled HH1. All mice injected with 530 MBq/kg of 177Lu-HH1 tolerated the treatment well. In contrast, 6 out of 10 mice treated with 530 MBq/kg 177Lu-rituximab experienced severe radiation toxicity. The retention of 177Lu-rituximab in organs of the mononuclear phagocyte system was longer than for 177Lu-HH1, which explains the higher toxicity observed in mice treated with 177Lu-rituximab. In vitro internalization studies showed that 177Lu-HH1 internalizes faster and to a higher extent than 177Lu-rituximab which might be the reason for the better therapeutic effect of 177Lu-HH1. PMID:26066655

  2. Interaktionen von Histamin H1-Rezeptoragonisten und –antagonisten mit dem humanen Histamin H4-Rezeptor



    Der humane Histamin H(4)-Rezeptor (hH(4)R) zeichnet sich durch hohe konstitutive Aktivität aus und ist wie der humane H(1)-Rezeptor (hH(1)R) in die Pathogenese von allergischen Reaktionen vom Typ I involviert. Die Ziele der Untersuchungen waren die Evaluierung des Wertes von dualen H(1)/H(4)R Antagonisten als antiallergische Medikamente und die Klärung der Frage, ob H(1)R Liganden an den hH(4)R binden. Am in Sf9-Insektenzellen exprimierten hH(4)R zeigten 18 H(1)R Antagonisten und 22 H(1)R Ago...

  3. A Joint Less Ordinary: Intriguing Roles for Hedgehog Signalling in the Development of the Temporomandibular Synovial Joint

    Directory of Open Access Journals (Sweden)

    Malgorzata Kubiak


    Full Text Available This review highlights the essential role of Hedgehog (Hh signalling in the developmental steps of temporomandibular joint (TMJ formation. We review evidence for intra- and potentially inter-tissue Hh signaling as well as Glioma-Associated Oncogene Homolog (GLI dependent and independent functions. Morphogenesis and maturation of the TMJ’s individual components and the general landscape of Hh signalling is also covered. Comparison of the appendicular knee and axial TMJ also reveals interesting differences and similarities in their mechanisms of development, chondrogenesis and reliance on Hh signalling.

  4. New physics in resonant production of Higgs boson pairs

    CERN Document Server

    Barger, Vernon; Jackson, C B; Peterson, Andrea; Shaughnessy, Gabe


    We advocate a search for an extended scalar sector at the LHC via $hh$ production, where $h$ is the 125 GeV Higgs boson. A resonance feature in the $hh$ invariant mass is a smoking gun of an $s$-channel heavy Higgs resonance, $H$. With one $h$ decaying to two photons and the other decaying to $b$-quarks, the resonant signal may be discoverable above the $hh$ continuum background for $M_H<$ 1 TeV. The product of the scalar and top Yukawa couplings can be measured to better than $10-20\\%$ accuracy, and its sign can be inferred from the $hh$ lineshape via interference effects.

  5. Potential role of Hedgehog pathway in liver response to radiation.

    Directory of Open Access Journals (Sweden)

    Sihyung Wang

    Full Text Available Radiation-induced fibrosis constitutes a major problem that is commonly observed in the patients undergoing radiotherapy; therefore, understanding its pathophysiological mechanism is important. The Hedgehog (Hh pathway induces the proliferation of progenitors and myofibroblastic hepatic stellate cells (MF-HSCs and promotes the epithelial-to-mesenchymal transition (EMT, thereby regulating the repair response in the damaged liver. We examined the response of normal liver to radiation injury. Male mice were sacrificed at 6 weeks and 10 weeks after exposure to a single dose of 6 Gy and the livers were collected for biochemical analysis. Irradiated (IR and control mice were compared for progenitors, fibrosis, Hh pathway, and EMT at 6 and 10 weeks post irradiation. Fatty hepatocytes were observed and the expressions of Hh ligand, Indian Hh. were greater in the livers at 6 weeks, whereas expression of another Hh ligand, Sonic Hh, increased at 10 weeks post irradiation. Both Smoothened, Hh receptor, and Gli2, Hh-target gene, were up-regulated at 6 and 10 weeks after irradiation. Accumulation of progenitors (CD44, Pan-cytokeratin, and Sox9 was significant in IR livers at 6 and 10 weeks. RNA analysis showed enhanced expression of the EMT-stimulating factor, tgf-β, in the IR livers at 6 weeks and the upregulation of mesenchymal markers (α-SMA, collagen, N-cadherin, and s100a4, but down-regulation of EMT inhibitors, in IR mouse livers at 6 and 10 weeks. Increased fibrosis was observed in IR mouse livers at 10 weeks. Treatment of mice with Hh inhibitor, GDC-0449, suppressed Hh activity and block the proliferation of hepatic progenitor and expression of EMT-stimulating genes in irradiated mice. Therefore, those results demonstrated that the Hh pathway increased in response to liver injury by radiation and promoted a compensatory proliferation of MF-HSCs and progenitors, thereby regulating liver remodeling.

  6. The Mode of Hedgehog Binding to Ihog Homologues is Not Conserved Across Different Phyla

    Energy Technology Data Exchange (ETDEWEB)

    McLellan, J.; Zheng, X; Hauk, G; Ghirlando, R; Beachy, P; Leahy, D


    Hedgehog (Hh) proteins specify tissue pattern in metazoan embryos by forming gradients that emanate from discrete sites of expression and elicit concentration-dependent cellular differentiation or proliferation responses1, 2. Cellular responses to Hh and the movement of Hh through tissues are both precisely regulated, and abnormal Hh signalling has been implicated in human birth defects and cancer3, 4, 5, 6, 7. Hh signalling is mediated by its amino-terminal domain (HhN), which is dually lipidated and secreted as part of a multivalent lipoprotein particle8, 9, 10. Reception of the HhN signal is modulated by several cell-surface proteins on responding cells, including Patched (Ptc), Smoothened (Smo), Ihog (known as CDO or CDON in mammals) and the vertebrate-specific proteins Hip (also known as Hhip) and Gas1 (ref. 11). Drosophila Ihog and its vertebrate homologues CDO and BOC contain multiple immunoglobulin and fibronectin type III (FNIII) repeats, and the first FNIII repeat of Ihog binds Drosophila HhN in a heparin-dependent manner12, 13. Surprisingly, pull-down experiments suggest that a mammalian Sonic hedgehog N-terminal domain (ShhN) binds a non-orthologous FNIII repeat of CDO12, 14. Here we report biochemical, biophysical and X-ray structural studies of a complex between ShhN and the third FNIII repeat of CDO. We show that the ShhN-CDO interaction is completely unlike the HhN-Ihog interaction and requires calcium, which binds at a previously undetected site on ShhN. This site is conserved in nearly all Hh proteins and is a hotspot for mediating interactions between ShhN and CDO, Ptc, Hip and Gas1. Mutations in vertebrate Hh proteins causing holoprosencephaly and brachydactyly type A1 map to this calcium-binding site and disrupt interactions with these partners.

  7. Identification of Hedgehog pathway responsive glioblastomas by isocitrate dehydrogenase mutation. (United States)

    Gerardo Valadez, J; Grover, Vandana K; Carter, Melissa D; Calcutt, M Wade; Abiria, Sunday A; Lundberg, Christopher J; Williams, Thomas V; Cooper, Michael K


    The Hedgehog (Hh) pathway regulates the growth of a subset of adult gliomas and better definition of Hh-responsive subtypes could enhance the clinical utility of monitoring and targeting this pathway in patients. Somatic mutations of the isocitrate dehydrogenase (IDH) genes occur frequently in WHO grades II and III gliomas and WHO grade IV secondary glioblastomas. Hh pathway activation in WHO grades II and III gliomas suggests that it might also be operational in glioblastomas that developed from lower-grade lesions. To evaluate this possibility and to better define the molecular and histopathological glioma subtypes that are Hh-responsive, IDH genes were sequenced in adult glioma specimens assayed for an operant Hh pathway. The proportions of grades II-IV specimens with IDH mutations correlated with the proportions that expressed elevated levels of the Hh gene target PTCH1. Indices of an operational Hh pathway were measured in all primary cultures and xenografts derived from IDH-mutant glioma specimens, including IDH-mutant glioblastomas. In contrast, the Hh pathway was not operational in glioblastomas that lacked IDH mutation or history of antecedent lower-grade disease. IDH mutation is not required for an operant pathway however, as significant Hh pathway modulation was also measured in grade III gliomas with wild-type IDH sequences. These results indicate that the Hh pathway is operational in grades II and III gliomas and glioblastomas with molecular or histopathological evidence for evolvement from lower-grade gliomas. Lastly, these findings suggest that gliomas sharing this molecularly defined route of progression arise in Hh-responsive cell types.

  8. Expression of zebrafish hip: response to Hedgehog signalling, comparison with ptc1 expression, and possible role in otic patterning. (United States)

    Hammond, Katherine L; Whitfield, Tanya T


    In zebrafish, Hedgehog (Hh) signalling is required to specify posterior otic identity. This presents a conundrum, as the nearest source of Hh to the developing inner ear is the ventral midline, in the notochord and floorplate. How can a source of Hh that is ostensibly constant with respect to the anteroposterior axis of the otic vesicle specify posterior otic identity? One possibility is that localised inhibition of Hh signalling is involved. Here we show that genes coding for three inhibitors of Hh signalling, su(fu), dzip1 and hip, are expressed in and around the developing otic vesicle. su(fu) and dzip1 are ubiquitously expressed and unaffected by Hh levels. The expression of hip, however, is positively regulated by Hh signalling and has a complex, dynamic pattern. It is detectable in the neural tube, otic vesicle, statoacoustic ganglion, brain, fin buds, mouth, somites, pronephros and branchial arches. These expression domains bear some similarity, but are not identical, to those of ptc1, a Hh receptor gene that is also positively regulated by Hh signalling. In the neural tube, for instance, hip is expressed in a subset of the ptc1 expression domain, while in other regions, including the otic vesicle, hip and ptc1 expression domains differ. Significantly, we find that initial expression of hip is higher in and adjacent to anterior otic regions, while ptc1 expression becomes progressively restricted to the posterior of the ear. Hip-mediated inhibition of Hh signalling may therefore be important in restricting the effects of Hh to posterior regions of the developing inner ear.

  9. Visualization of Gli activity in craniofacial tissues of hedgehog-pathway reporter transgenic zebrafish.

    Directory of Open Access Journals (Sweden)

    Tyler Schwend

    Full Text Available BACKGROUND: The Hedgehog (Hh-signaling pathway plays a crucial role in the development and maintenance of multiple vertebrate and invertebrate organ systems. Gli transcription factors are regulated by Hh-signaling and act as downstream effectors of the pathway to activate Hh-target genes. Understanding the requirements for Hh-signaling in organisms can be gained by assessing Gli activity in a spatial and temporal fashion. METHODOLOGY/PRINCIPAL FINDINGS: We have generated a Gli-dependent (Gli-d transgenic line, Tg(Gli-d:mCherry, that allows for rapid and simple detection of Hh-responding cell populations in both live and fixed zebrafish. This transgenic line expresses a mCherry reporter under the control of a Gli responsive promoter, which can be followed by using fluorescent microscopy and in situ hybridization. Expression of the mCherry transgene reporter during embryogenesis and early larval development faithfully replicated known expression domains of Hh-signaling in zebrafish, and abrogating Hh-signaling in transgenic fish resulted in the suppression of reporter expression. Moreover, ectopic shh expression in Tg(Glid:mCherry fish led to increased transgene production. Using this transgenic line we investigated the nature of Hh-pathway response during early craniofacial development and determined that the neural crest skeletal precursors do not directly respond to Hh-signaling prior to 48 hours post fertilization, suggesting that earlier requirements for pathway activation in this population of facial skeleton precursors are indirect. CONCLUSION/SIGNIFICANCE: We have determined that early Hh-signaling requirements in craniofacial development are indirect. We further demonstrate the Tg(Gli-d:mCherry fish are a highly useful tool for studying Hh-signaling dependent processes during embryogenesis and larval stages.

  10. An Analysis of Deaf Students' Spelling Skills during a Year-Long Instructional Writing Approach (United States)

    Bowers, Lisa M.; Dostal, Hannah; McCarthy, Jillian H.; Schwarz, Ilsa; Wolbers, Kimberly


    Numerous studies have shown that spelling presents unique challenges for children who are deaf or hard of hearing (d/hh), and most do not develop age appropriate spelling skills. Spelling errors from 29 middle school d/hh students were analyzed from writing samples that were gathered at the beginning, middle, and end of a year-long writing…

  11. High-resolution in vivo imaging of the cross-sectional deformations of contracting embryonic heart loops using optical coherence tomography

    DEFF Research Database (Denmark)

    Männer, J.; Thrane, Lars; Norozi, K.


    tubes as concentric narrowing and widening of tubes of circular cross-section. We have visualized the cross-sectional deformations of contracting embryonic hearts in chick embryos (HH-stages 9-17) using real-time high-resolution optical coherence tomography. Cardiac contractions are detected from HH...

  12. Impact of Hunt-Hess grade on the glycemic status of aneurysmal subarachnoid hemorrhage patients

    Directory of Open Access Journals (Sweden)

    Sayantani Ghosh


    Full Text Available Objective: This study has explored the impact of Hunt-Hess (H-H grade of aneurysmal subarachnoid hemorrhage (aSAH on the glycemic status of such patients during their intensive care unit (ICU stay and has also analyzed whether H-H grade predicts their outcome independent of their glycemic status. Materials and Methods: This was a retrospective case record review of prospectively maintained database of 1090 previously non-diabetic aSAH patients admitted to Thomas Jefferson University Hospital, Philadelphia. H-H grade of SAH, serum and CSF glucose on admission, serum glucose on the day of surgery and 14 days post-surgery, as well as the extended Glasgow Outcome Score (GOS-E score at discharge were noted. After univariate analysis, significant variables (P 200 mg/dl (P < 0.001 during the 14-day period of ICU stay. Also, the relationship between serum and CSF glucose levels at admission increased with HH grades 1 through 4, but became negative and more tightly bound at H-H grade 5. Admission H-H grades 4-5 contributed to poor outcome compared to lower H-H grades (P < 0.0001. Conclusion: Poor admission H-H grades lead to poor immediate glycemic status as well as poor short-term outcome, and it is dependent on serum glucose but independent of CSF glucose in predicting the outcome.

  13. A genome-wide RNAi screen identifies regulators of cholesterol-modified hedgehog secretion in Drosophila.

    Directory of Open Access Journals (Sweden)

    Reid Aikin

    Full Text Available Hedgehog (Hh proteins are secreted molecules that function as organizers in animal development. In addition to being palmitoylated, Hh is the only metazoan protein known to possess a covalently-linked cholesterol moiety. The absence of either modification severely disrupts the organization of numerous tissues during development. It is currently not known how lipid-modified Hh is secreted and released from producing cells. We have performed a genome-wide RNAi screen in Drosophila melanogaster cells to identify regulators of Hh secretion. We found that cholesterol-modified Hh secretion is strongly dependent on coat protein complex I (COPI but not COPII vesicles, suggesting that cholesterol modification alters the movement of Hh through the early secretory pathway. We provide evidence that both proteolysis and cholesterol modification are necessary for the efficient trafficking of Hh through the ER and Golgi. Finally, we identified several putative regulators of protein secretion and demonstrate a role for some of these genes in Hh and Wingless (Wg morphogen secretion in vivo. These data open new perspectives for studying how morphogen secretion is regulated, as well as provide insight into regulation of lipid-modified protein secretion.

  14. Kodune energiakulu kontrolli alla / Leo Backman, Heigo Ensling

    Index Scriptorium Estoniae

    Backman, Leo


    Energiakulumõõturite test: Axxel HH-549, Efergy e2 (juhtmevaba mõõtur), Electric EMT707CTL, Electronic PM 498, Electronic UPM DEM1379, Energy Meter LX-0805, Eco Line EM235, Energy Saving Meter HH-549, Art.35-617 (multifunktsionaalne mõõtur), EMT7110/EMR7370 (juhtmevaba mõõtur)

  15. Smoothened transduces Hedgehog signal by forming a complex with Evc/Evc2

    Institute of Scientific and Technical Information of China (English)

    Cuiping Yang; Wenlin Chen; Yongbin Chen; Jin Jiang


    Hedgehog (Hh) signaling plays pivotal roles in embryonic development and adult tissue homeostasis in species ranging from Drosophila to mammals.The Hh signal is transduced by Smoothened (Smo),a seven-transmembrane protein related to G protein coupled receptors.Despite a conserved mechanism by which Hh activates Smo in Drosophila and mammals,how mammalian Hh signal is transduced from Smo to the Gli transcription factors is poorly understood.Here,we provide evidence that two ciliary proteins,Evc and Evc2,the products of human disease genes responsible for the Ellis-van Creveld syndrome,act downstream of Smo to transduce the Hh signal.We found that loss of Evc/Evc2 does not affect Sonic Hedgehog-induced Smo phosphorylation and ciliary localization but impedes Hh pathway activation mediated by constitutively active forms of Smo.Evc/Evc2 are dispensable for the constitutive Gli activity in Sufu-/- cells,suggesting that Evc/Evc2 act upstream of Sufu to promote Gli activation.Furthermore,we demonstrated that Hh stimulates binding of Evc/Evc2 to Smo depending on phosphorylation of the Smo C-terminal intracellular tail and that the binding is abolished in Kif3a-/- cilium-deficient cells.We propose that Hh activates Smo by inducing its phosphorylation,which recruits Evc/Evc2 to activate Gli proteins by antagonizing Sufu in the primary cilia.

  16. Smoothened transduces Hedgehog signal by forming a complex with Evc/Evc2. (United States)

    Yang, Cuiping; Chen, Wenlin; Chen, Yongbin; Jiang, Jin


    Hedgehog (Hh) signaling plays pivotal roles in embryonic development and adult tissue homeostasis in species ranging from Drosophila to mammals. The Hh signal is transduced by Smoothened (Smo), a seven-transmembrane protein related to G protein coupled receptors. Despite a conserved mechanism by which Hh activates Smo in Drosophila and mammals, how mammalian Hh signal is transduced from Smo to the Gli transcription factors is poorly understood. Here, we provide evidence that two ciliary proteins, Evc and Evc2, the products of human disease genes responsible for the Ellis-van Creveld syndrome, act downstream of Smo to transduce the Hh signal. We found that loss of Evc/Evc2 does not affect Sonic Hedgehog-induced Smo phosphorylation and ciliary localization but impedes Hh pathway activation mediated by constitutively active forms of Smo. Evc/Evc2 are dispensable for the constitutive Gli activity in Sufu(-/-) cells, suggesting that Evc/Evc2 act upstream of Sufu to promote Gli activation. Furthermore, we demonstrated that Hh stimulates binding of Evc/Evc2 to Smo depending on phosphorylation of the Smo C-terminal intracellular tail and that the binding is abolished in Kif3a(-/-) cilium-deficient cells. We propose that Hh activates Smo by inducing its phosphorylation, which recruits Evc/Evc2 to activate Gli proteins by antagonizing Sufu in the primary cilia.

  17. Computing the Effects of Strain on Electronic States: A Survey of Methods and Issues (United States)


    023202. 35. Steiger, S.; Povolotskyi, M.; Park, H.-H.; Kubis , T.; Klimeck, G. NEMO5: Parallel Multiscale Nanoelectronics Modeling Tool. IEEE...Povolotskyi, M.; Park, H.-H.; Kubis T.; Klimeck, G. NEMO5: Parallel Multiscale Nanoelectronics Modeling Tool. IEEE Transactions on Nanotechnology 2011

  18. Literacy Sign Language Application Using Visual Phonics: A Theoretical Framework (United States)

    Abdulghafoor, Maath S.; Ahmad, Azlina; Huang, Jiung-Yao


    Literacy is the ability to read and write. Being able to read and write is an important skill in modern society. Deaf and hard of hearing (D/HH) students' literacy achievement has been reported as lower than that of hearing students. This research focuses on the literacy skills of D/HH students, aiming to determine their reading/writing skills and…

  19. The Half-Half Plot

    NARCIS (Netherlands)

    Einmahl, J.H.J.; Gantner, M.


    The Half-Half (HH) plot is a new graphical method to investigate qualitatively the shape of a regression curve. The empirical HH-plot counts observations in the lower and upper quarter of a strip that moves horizontally over the scatter plot. The plot displays jumps clearly and reveals further featu

  20. Gonadal status and outcome of bariatric surgery in obese men

    NARCIS (Netherlands)

    Aarts, E.O.; Wageningen, B. van; Loves, S.C.; Janssen, I.; Berends, F.; Sweep, F.C.; Boer, H. de


    BACKGROUND: Obesity-related hypogonadotrophic hypogonadism (OrHH) occurs in over 40% of morbidly obese men. Obesity-related hypogonadotrophic hypogonadism may reduce the beneficial effects of bariatric surgery. OBJECTIVE: To assess the impact of OrHH on the outcome of bariatric surgery in men. PATIE