WorldWideScience

Sample records for hexoloy sa fails

  1. High temperature Hexoloy{trademark} SX silicon carbide. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Srinivasan, G.V.; Lau, S.K.; Storm, R.S. [Carborundum Co., Niagara Falls, NY (United States)

    1994-09-01

    HEXOLOY{reg_sign} SX-SiC, fabricated with Y and Al containing compounds as sintering aids, has been shown to possess significantly improved strength and toughness over HEXOLOY{reg_sign}SA-SiC. This study was undertaken to establish and benchmark the complete mechanical property database of a first generation material, followed by a process optimization task to further improve the properties. Mechanical characterization on the first generation material indicated that silicon-rich pools, presumably formed as a reaction product during sintering, controlled the strength from room temperature to 1,232 C. At 1,370 C in air, the material was failing due to a glass-phase formation at the surface. This glass-phase formation was attributed to the reaction of yttrium aluminates, which exist as a second phase in the material, with the ambient. This process was determined to be a time-dependent one that leads to slow crack growth. Fatigue experiments clearly indicated that the slow crack growth driven by the reaction occurred only at temperatures >1,300 C, above the melting point of the glass phase. Process optimization tasks conducted included the selection of the best SiC powder source, studies on mixing/milling conditions for SiC powder with the sintering aids, and a designed experiment involving a range of sintering and post-treatment conditions. The optimization study conducted on the densification variables indicated that lower sintering temperatures and higher post-treatment pressures reduce the Si-rich pool formation, thereby improving the room-temperature strength. In addition, it was also determined that furnacing configuration and atmosphere were critical in controlling the Si-rich formation.

  2. Failing Failed States

    DEFF Research Database (Denmark)

    Holm, Hans-Henrik

    2002-01-01

    When states are failing, when basic state functions are no longer carried out, and when people have no security, humanitarian crises erupt. In confronting this problem, the stronger states have followed an ad hoc policy of intervention and aid. In some cases, humanitarian disasters have resulted ...

  3. Failing Failed States

    DEFF Research Database (Denmark)

    Holm, Hans-Henrik

    2002-01-01

    When states are failing, when basic state functions are no longer carried out, and when people have no security, humanitarian crises erupt. In confronting this problem, the stronger states have followed an ad hoc policy of intervention and aid. In some cases, humanitarian disasters have resulted...

  4. Failing Decision

    DEFF Research Database (Denmark)

    Knudsen, Morten

    2014-01-01

    as a controlled cost for achieving organizational goals. Decisions must fail so the organization can succeed. This chapter uses two cases to elaborate on these ideas. By way of introduction, I will reflect on the notion of ‘failing decisions’ within organization and decision theory. This chapter is also propelled...... deals not with traffic delays, but with failing decisions in organizations. The assumption of this chapter is that failing decisions today are as normal as delayed trains. Instead of being the exception, failure is part of the everyday reproduction of organizations – as an uncontrolled effect but also...... by an interest in failure as one way of improving understanding of present-day decision making in organizations....

  5. Water SA

    African Journals Online (AJOL)

    Journal Home > Vol 43, No 2 (2017) ... WaterSA publishes refereed, original work in all branches of water science, technology and engineering. ... Water SA is the WRC's accredited scientific journal which contains original research articles ... via linearized calibration method in the upstream of Huaihe River Basin, China ...

  6. Failing the market, failing deliberative democracy

    DEFF Research Database (Denmark)

    Lippert, Ingmar

    2016-01-01

    Corporate carbon footprint data has become ubiquitous. This data is also highly promissory. But as this paper argues, such data fails both consumers and citizens. The governance of climate change seemingly requires a strong foundation of data on emission sources. Economists approach climate chang...

  7. Failed endotracheal intubation

    Directory of Open Access Journals (Sweden)

    Sheykhol Islami V

    1995-07-01

    Full Text Available The incidence of failed intubation is higher in obstetric than other surgical patients. Failed intubation was the 2nd commonest cause of mortality during anesthesia. Bearing in mind that failre to intubate may be unavoidable in certain circumstances, it is worth reviewing. The factors, which may contribute to a disastrous out come. Priorities of subsequent management must include maintaining oxygenation and preventing aspiration of gastric contents. Fiber optic intubation is now the technique of choice with a high success rate and with least trauma to the patient.

  8. When physical intuition fails

    OpenAIRE

    Singh, Chandralekha

    2016-01-01

    We analyze the problem solving strategies of physics professors in a case where their physical intuition fails. A non-intuitive introductory-level problem was identified and posed to twenty physics professors. The problem placed the professors in a situation often encountered by students, and their response highlights the importance of intuition and experience in problem solving. While professors had difficulty in solving the problem under the time constraint, they initially employed a system...

  9. Who fails lantern tests?

    Science.gov (United States)

    Cole, B L; Vingrys, A J

    1983-05-01

    A battery of clinical colour vision tests was given to a group of 100 observers with abnormal colour vision who were also tested on the Farnsworth lantern and the Holmes-Wright lanterns types A and B. It was found that clinical colour vision tests are imperfect predictors of lantern test performance. However, observers classified as having a 'severe' colour vision defect were found to fail the lantern tests but only one half to two-thirds of those who fail the lantern tests can be identified in this way. It is not possible to identify with certainty any of the people likely to pass the lantern tests: about one-third to two-thirds of observers classified as being mildly affected fail the lantern tests. The Farnsworth D-15 and City University tests were found to be the best predictors of lantern test performance but other tests such as the Nagel anomaloscope, the H-16, L'Anthony's desaturated test can also be used. The lack of a strong correlation between clinical tests and the recognition of the small coloured stimuli presented by the lantern tests suggests that clinical tests do not test the same aspect of colour vision that is important to the recognition of signal lights. For this reason lantern tests should be retained for occupational testing of colour vision.

  10. Failed theories of superconductivity

    CERN Document Server

    Schmalian, Joerg

    2010-01-01

    Almost half a century passed between the discovery of superconductivity by Kammerlingh Onnes and the theoretical explanation of the phenomenon by Bardeen, Cooper and Schrieffer. During the intervening years the brightest minds in theoretical physics tried and failed to develop a microscopic understanding of the effect. A summary of some of those unsuccessful attempts to understand superconductivity not only demonstrates the extraordinary achievement made by formulating the BCS theory, but also illustrates that mistakes are a natural and healthy part of the scientific discourse, and that inapplicable, even incorrect theories can turn out to be interesting and inspiring.

  11. Abortion: Strong's counterexamples fail

    DEFF Research Database (Denmark)

    Di Nucci, Ezio

    2009-01-01

    This paper shows that the counterexamples proposed by Strong in 2008 in the Journal of Medical Ethics to Marquis's argument against abortion fail. Strong's basic idea is that there are cases--for example, terminally ill patients--where killing an adult human being is prima facie seriously morally......'s scenarios have some valuable future or admitted that killing them is not seriously morally wrong. Finally, if "valuable future" is interpreted as referring to objective standards, one ends up with implausible and unpalatable moral claims....

  12. Health SA Gesondheid

    African Journals Online (AJOL)

    Health SA Gesondheid - Journal of Interdisciplinary Health Sciences is an open access, .... Chokwe M. Setati, Zerish Z. Nkosi, 130-137 ... Movement as a critical concept in model generation to attain wholeness · EMAIL FREE FULL TEXT ...

  13. SalSA status

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom)], E-mail: amyc@hep.ucl.ac.uk

    2009-06-01

    I review the status of SalSA, a proposed antenna array in a large volume salt formation for detecting ultra-high energy neutrinos. We report on measurements taken in 2007 of attenuation lengths in the 125-900 MHz frequency range at the Cote Blanche salt mine near New Iberia, Louisiana, which is the most precise in situ measurement of attenuation lengths in salt to date. We comment on the impact of these measurements on the feasibility of SalSA.

  14. When physical intuition fails

    CERN Document Server

    Singh, Chandralekha

    2016-01-01

    We analyze the problem solving strategies of physics professors in a case where their physical intuition fails. A non-intuitive introductory-level problem was identified and posed to twenty physics professors. The problem placed the professors in a situation often encountered by students, and their response highlights the importance of intuition and experience in problem solving. While professors had difficulty in solving the problem under the time constraint, they initially employed a systematic approach, e.g., visualizing the problem, considering various conservation laws, and examining limiting cases. After finding that familiar techniques were not fruitful, they made incorrect predictions based on one of two equally important factors. By contrast, other more familiar problems that require the consideration of two important principles (e.g., conservation of both energy and momentum for a ballistic pendulum) are quickly solved by the same professors. The responses of students who were given the same problem...

  15. When physical intuition fails

    Science.gov (United States)

    Singh, Chandralekha

    2002-11-01

    We analyze the problem-solving strategies of physics professors in a case where their physical intuition fails. A nonintuitive introductory-level problem was identified and posed to twenty physics professors. The problem placed the professors in a situation often encountered by students, and their response highlights the importance of intuition and experience in problem solving. Although professors had difficulty in solving the problem under the time constraint, they initially employed a systematic approach, for example, visualizing the problem, considering various conservation laws, and examining limiting cases. After finding that familiar techniques were not fruitful, they made incorrect predictions based on one of two equally important factors. In contrast, other more familiar problems that require the consideration of two important principles (for example, conservation of both energy and momentum for a ballistic pendulum) were quickly solved by the same professors. The responses of students who were given the same problem reflected no overarching strategies or systematic approaches, and a much wider variety of incorrect responses were given. This investigation highlights the importance of teaching effective problem-solving heuristics, and suggests that instructors assess the difficulty of a problem from the perspective of beginning students.

  16. To fail or not to fail : clinical trials in depression

    NARCIS (Netherlands)

    Santen, Gijs Willem Eduard

    2008-01-01

    To fail or not to fail – Clinical trials in depression investigates the causes of the high failure rate of clinical trials in depression research. Apart from the difficulties in the search for new antidepressants during drug discovery, faulty clinical trial designs hinder their evaluation during dru

  17. SA HEALTH Templete

    African Journals Online (AJOL)

    ...

    rienced by teenage mothers in the southern Hho-Hho region of Swaziland. ... teachers, church leaders and communities failed to empower the teenage mothers with knowledge and skills to prevent pregnancy or to facilitate motherhood.

  18. DECOFF Probabilities of Failed Operations

    DEFF Research Database (Denmark)

    Gintautas, Tomas

    A statistical procedure of estimation of Probabilities of Failed Operations is described and exemplified using ECMWF weather forecasts and SIMO output from Rotor Lift test case models. Also safety factor influence is investigated. DECOFF statistical method is benchmarked against standard Alpha...

  19. Lewis Porter, John Coltrane. Sa vie, sa musique

    OpenAIRE

    Parent, Emmanuel

    2008-01-01

    Les éditions Outre Mesure viennent de mettre à la disposition du lectorat français, avec la qualité de mise en page et en musique qu’on leur connaît, un nouveau livre de référence en musicologie du jazz. Salué à sa sortie par la critique en langue anglaise en 1998, John Coltrane. Sa vie, sa musique constitue en effet un ouvrage fort complet pour qui veut s’immerger dans le langage du heavyweight champion. L’auteur, enseignant à Rutgers (l’université du New Jersey abritant depuis les années 19...

  20. Meta Analisis sa Pagsusuri ng Maiikling Kwento sa mga Tesis at Disertasyon

    Directory of Open Access Journals (Sweden)

    Regina I. Cuizon

    2014-10-01

    Full Text Available Anumang mga pagbabago na makikita sa mundo ay bunga ng pananaliksik. Ang meta-analisis ay isa sa mga bunga ng pananaliksik na ginagamit sa kasalukuyan bilang teknik upang malaman iba pang mga nagsulputang informasyon. Ito’y pag-aaral sa mga pag-aaral. Isang kritikal at sistematikong pagsusuri sa istruktura ng mga pag-aaral. Maging gabay sa mga gradwadong paaralan sa pagpili ng paksang pagaaralan. Pangunahing layunin na matiyak ang mga pamamaraan sa pagsusuri ng maiikling kwento ng mga tesis at disertasyong nagawa mula sa mga piling SUCs. Desinyong kwalitatibo - kontent analisis sa pagsusuri ng: kaanyuan ayon sa suliranin, metodolohiya, paglalahad at interpretasyon ng mga datos, natuklasan, konklusyon, at rekomendasyon; kahinatnan ayon sa pagkatulad, pagkakaiba at kabuluhan; Emerging tema. Napag-alaman na ang karaniwang pinag-aralan ay 30% kahalagahang pangkatauhan, 20% larawangdiwa ng mga kababaihan at 10% gramatikang aspeto. Sa metodolohiyang ginamit, 80% desinyong kwalitatibo at 20% kwantitatibo-kwalitatibo. Sa paglikom ng datos 60% diretsahang pagsusuri, 30% talatanungan at 10% tseklis. Sa pag-analisa 90% kontent analisis at 10% gramatikal analisis. Batay sa natuklasan, ang pagsusuri ng maiikling kwento sa mga tesis at disertasyon mula sa iba’t ibang paaralan gamit ang meta analisis ay isang epektibo, mabisa, objektibong paraan at kagamitan na magagamit sa makatarungang paghatol; pamumuna sa kabuluhan at kagandahan; paghaham- bing sa mga kritikal na isyu; at pormulasyon ng panibagong pamantayan at batas.

  1. Planejamento em Saúde

    Directory of Open Access Journals (Sweden)

    Antonio José Costa CARDOSO

    2014-03-01

    Full Text Available Esse texto pretendeu subsidiar aula sobre Planejamento e Avaliação em Saúde para os Analistas Técnicos de Políticas Sociais lotados no Ministério da Saúde (MS, na perspectiva de promover uma maior compreensão dos antecedentes históricos do planejamento em saúde no Brasil e na América Latina, do referencial teórico metodológico do planejamento estratégico e participativo, e refletir sobre os avanços e desafios que se apresentam no atual contexto de construção do Sistema Único de Saúde (SUS. Neste sentido, foi estruturado na perspectiva de responder a três questões orientadoras: 1 Como tem se dado esse processo de coordenação do Planejamento Estratégico Nacional no âmbito do SUS, em cooperação técnica com os Estados, Municípios e Distrito Federal? 2 Quais são as tecnologias de gestão e planejamento em saúde adotadas pelo MS para conduzir esses processos de forma integrada? 3 Como se dá o gerenciamento das ações no MS? Como os planos, projetos e programas são monitorados pelas equipes responsáveis?

  2. Why good projects fail anyway.

    Science.gov (United States)

    Matta, Nadim F; Ashkenas, Ronald N

    2003-09-01

    Big projects fail at an astonishing rate--more than half the time, by some estimates. It's not hard to understand why. Complicated long-term projects are customarily developed by a series of teams working along parallel tracks. If managers fail to anticipate everything that might fall through the cracks, those tracks will not converge successfully at the end to reach the goal. Take a companywide CRM project. Traditionally, one team might analyze customers, another select the software, a third develop training programs, and so forth. When the project's finally complete, though, it may turn out that the salespeople won't enter in the requisite data because they don't understand why they need to. This very problem has, in fact, derailed many CRM programs at major organizations. There is a way to uncover unanticipated problems while the project is still in development. The key is to inject into the overall plan a series of miniprojects, or "rapid-results initiatives," which each have as their goal a miniature version of the overall goal. In the CRM project, a single team might be charged with increasing the revenues of one sales group in one region by 25% within four months. To reach that goal, team members would have to draw on the work of all the parallel teams. But in just four months, they would discover the salespeople's resistance and probably other unforeseen issues, such as, perhaps, the need to divvy up commissions for joint-selling efforts. The World Bank has used rapid-results initiatives to great effect to keep a sweeping 16-year project on track and deliver visible results years ahead of schedule. In taking an in-depth look at this project, and others, the authors show why this approach is so effective and how the initiatives are managed in conjunction with more traditional project activities.

  3. Adesão ao pré-natal de mulheres HIV+ que não fizeram profilaxia da transmissão vertical: um estudo sócio-comportamental e de acesso ao sistema de saúde Adherence to prenatal care by HIV-positive women who failed to receive prophylaxis for mother-to-child transmission: social and behavioral factors and healthcare access issues

    Directory of Open Access Journals (Sweden)

    Mariana de Queiroz Rocha Darmont

    2010-09-01

    Full Text Available Objetivamos compreender os fatores sócio-comportamentais e do Sistema Único de Saúde (SUS que, na visão de mulheres identificadas como HIV+ por teste rápido no parto, dificultaram ou impediram a adesão ao pré-natal. Foram incluídas 40 mulheres, das quais apenas oito tinham tido seis consultas ou mais. Foi utilizada a abordagem qualitativa, com entrevistas semi-estruturadas. Os dados foram analisados seguindo os preceitos da análise temática. Os resultados foram agrupados em dois blocos: os que dificultaram a adesão ao pré-natal: não aceitação da gestação, falta de apoio familiar, conhecimento prévio da soropositividade, contexto social adverso, experiências negativas de atendimento e práticas e concepções de descrédito em relação ao pré-natal, e os que favoreceram a adesão: apoio familiar, discurso de valorização do cuidado com a saúde, desejo de laqueadura tubária, acolhimento pela equipe de saúde e experiências positivas de assistência. Uma compreensão melhor do contexto sociocultural deveria permitir a construção de estratégias capazes de resgatar essas mulheres para um sistema de saúde mais acolhedor.This study aimed to elucidate the social and behavioral factors and public health system characteristics that influenced pregnant women's adherence to prenatal care. Forty women diagnosed as HIV-positive by rapid test at delivery were included. Socioeconomic data were collected and a semi-structured interview was conducted. Eight women had > 6 prenatal visits and 12 had no visits. Interviews were submitted to qualitative content analysis. The themes fit into two blocks: those seen as hindering adherence, like unwanted pregnancy, lack of family support, prior knowledge of serological status, adverse social context, negative experiences with prenatal care, and disbelief towards prenatal care, and those facilitating adherence, like family support, valuing healthcare, wanting a tubal ligation, receptiveness by

  4. A Robust Separation Assurance (SA) Architecture Using Integrated Airborne and Ground SA Concepts Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Automation, Inc. proposes a robust SA architecture that uses integrated airborne and ground-based SA concepts such that SA functions are switched between...

  5. Cerditos Company S.A.

    OpenAIRE

    2010-01-01

    Esta idea de negocio consiste en la adecuación de una granja, en la cual se desarrollará el proceso de levante y comercialización de carne de cerdo en pie o en canal. Cerditos Company S.A. es una empresa que busca la calidad y el buen servicio, brindando al consumidor garantías de la carne que está consumiendo. En Colombia el mercado ha sido poco explotado comparado con otros países como Chile o Europa, donde el consumo es muy significativo, Cerditos Company S.A. busca aumentar el cons...

  6. ANALISIS DAYA SAING KEDELAI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sarwono Sarwono

    2014-09-01

    Full Text Available RCA (Revealed Comparative Advantage index of soybean in Indonesia from 1983 up to 2013 is less than one, mostly. It means that the competitiveness of soybean in Indonesia is low. The purpose of this study is to analyze the factors influence the soybean competitiveness. OLS (Ordinary Least Square was used as the analysis method. Hypotheses test based on that analysis model is not bias, so that, classic divergence test is needed. It is for getting the Best Linier Unbiased Estimator (BLUE appraisal. T statistic and F statistic were also applied. The result of this research shows that production and export have positive and significant influence. In addition, exchange rate and government policy do not influence the Indonesia soybean competitiveness.Indeks RCA (Revealed Comparative Advantage kedelai Indonesia dari tahun 1983-2013 kecenderungan bernilai kurang dari satu yang berarti daya saing kedelai Indonesia rendah.Penelitian ini bertujuan untuk menganalisis faktor-faktor yang mempengaruhi daya saing kedelai Indonesia.Metode analisis yang digunakan adalah Ordinary Least Square (OLS.Pengujian hipotesis berdasarkan model analisis tersebut tidak bias maka perlu dilakukan uji penyimpangan klasik yang tujuannya agar diperoleh penaksiran yang bersifat Best Linier Unbiased Estimator (BLUE.Pengujian statistik menggunakan uji t statistikdan uji f statistik.Hasil penelitian ini menunjukkan bahwa produksi dan ekspor berpengaruh secara positif dan signifikan terhadap daya saing kedelai Indonesia. Nilai tukar rupiah dan kebijakan pemerintah tidak berpengaruh terhadap daya saing kedelai Indonesia.

  7. Saúde e desenvolvimento

    Directory of Open Access Journals (Sweden)

    Ana Luiza D'Ávila Viana

    Full Text Available Considerando que os modernos sistemas de saúde são o resultado da complexa interação de processos econômicos, políticos e sociais, o objetivo do trabalho é discutir a relação entre saúde e desenvolvimento no Brasil, mostrando que o esgotamento do modelo liberal de política econômica abre nova perspectiva para a retomada do desenvolvimento, entendido como combinação entre crescimento da economia, mudanças na estrutura produtiva e melhora das condições de vida da população. O complexo produtivo da saúde joga papel decisivo nesse processo, pois constitui um campo em que inovação tecnológica e acumulação de capital geram oportunidades de investimento, trabalho e renda, além de produzir avanços importantes para melhorar o estado de saúde das pessoas. A recente adoção de políticas públicas voltadas para articular, de forma positiva, aspectos da política econômica e da política social revela que a questão do desenvolvimento nacional ganhou nova centralidade na agenda governamental, o que abre a perspectiva de maior integração entre a lógica econômica e a lógica sanitária. Entretanto, é preciso reconhecer que o Brasil ainda não logrou alcançar uma associação virtuosa entre saúde e desenvolvimento.

  8. Varyasyong Leksikal sa mga Dayalektong Mandaya

    Directory of Open Access Journals (Sweden)

    Dr. Raymund M. Pasion

    2014-12-01

    Full Text Available Layuning panlahat sa pag-aaral na ito na tuklasin ang varyasyong leksikalsa Wikang Mandaya na matatagpuan sa Probinsyang Davao Oriental. Bilang lunsaran sa paglilikom ng mga datos, ginamit ang mga terminong kultural na pangkabuhayan tulad ng pagsasaka, pangangaso, pangingisda at paghahayupan nanababatay sa Indigenous Knowledge System and Practices (IKSP.Sinikap sagutin sa pagaaral ang suliraning ano-anong varyasyong liksikal ang makikita sa mga terminong kultural na pangkabuhayan ng Mandaya na makikita sa munisipalidad ng Caraga, Manay, Bagangaat Cateel? Disenyong kwalitatibo ginamit.Metodong indehinusat deskriptibo naman ang ginamit mula sa paglilikom hanggang sa pag-aanalisa ng mga datos. Samantalang, ang mga impormante ay pinilisa pamamagitan ng kombinasyong purposive at snow-ball sampling. Natuklasan, na ang wikang Mandaya ay nakitaan ng varyasyong lekisikal ayon sa magkakaiba ang anyo, may pagkakatulad ang anyo, at magkakatulad ang anyo subalit magkakaiba ang bigkas. Gayunpaman, pinaniniwalaang dahil sa paktor na heograpikal, sikolohikal at sosyolohikal na nagaganap sa kanilang kultura ay hindi rin maipagkailang nagyari ang varyasyong leksikal na aspekto nito.

  9. When Organization Fails: Why Authority Matters

    DEFF Research Database (Denmark)

    Blaschke, Steffen

    2015-01-01

    Review of: James R. Taylor and Elizabeth J. Van Every / When Organization Fails: Why Authority Matters. (New York: Routledge, 2014. 220 pp. ISBN: 978 0415741668)......Review of: James R. Taylor and Elizabeth J. Van Every / When Organization Fails: Why Authority Matters. (New York: Routledge, 2014. 220 pp. ISBN: 978 0415741668)...

  10. Is journalism failing on climate?

    Science.gov (United States)

    Rahmstorf, Stefan

    2012-12-01

    How can we build a reliable and affordable energy supply based on renewables? How rapidly do we need to cut greenhouse gas emissions to keep climate change within manageable bounds? What does it take to maintain a stable common currency of different nations? These are just a few examples of questions that are critical for our future and that require an understanding of complex systems—the energy system, the climate system, the financial system. Finding sound answers to these questions requires sophisticated scientific analysis and expert knowledge; a lay person's intuition will clearly not suffice. Yet, decisions in a democracy are (and should be!) taken by politicians and the voting public who are not usually scientific experts. Hence the well-being of our societies—and even more so the living conditions of future generations, which are defined by the decisions we take today—depends on the wider public being well informed about the state of scientific knowledge and discourse. The media are the most important means by which lay people obtain their information about science. Good science journalism is therefore a decisive factor for the long-term success of modern society. Good science journalism clearly must be critical journalism, and it requires journalists who know what is what, who can put things into a perspective, and who are able to make well-informed judgements. After all, the role of science journalism is not simply to act as a 'translator' who conveys the findings of scientists in a language understandable to lay people. Rather, good science journalism will provide the public with a realistic impression of what is well established in science and what are current 'hot topics', uncertainties and controversies. It will also discuss the methods and social context of the scientific endeavour. There is ample evidence that in the area of climate science, journalism too often is failing to deliver this realistic picture to its audience, despite many good

  11. Probiotic Supplements Failed to Prevent Babies' Infections

    Science.gov (United States)

    ... page: https://medlineplus.gov/news/fullstory_167008.html Probiotic Supplements Failed to Prevent Babies' Infections Benefits of ... 3, 2017 MONDAY, July 3, 2017 (HealthDay News) -- Probiotic supplements may not protect babies from catching colds ...

  12. Lingon sa Iskolarsyip sa Dulaan (1948-2007 Looking Back on Theater Scholarship (1948-2007

    Directory of Open Access Journals (Sweden)

    Apolonio B. Chua

    2012-12-01

    Full Text Available From 1948 to 2007, the academic community produced about a hundred titles of theses and dissertations on drama and theater, or made use of data from drama and theater for larger spheres of studies. The current article looked into identifying trends and points of emphasis, as the researches and studies progressed through roughly half a century of research production in the academic setting. Inductive in approach and tentative and exploratory in its analysis, the study identified four trends and points of emphasis in research production. In the fifties and sixties, the emphasis was more on studying the play text or drama; studies veered towards a literary reading and orientation. Eventually, this trend gave way to studying the larger phenomenon of mounting, and the mise en scéne and the spectator became additional units of concern for research. Studies began to have sections on props, costumes, and staging techniques. In the eighties, a larger concern for looking at theater as social production followed. Participant observation, field work and ethnography gave equal emphasis on the social context of theater. Marxism and other perspectives from the social sciences framed theater studies then; correlations between theater and society became useful. Towards the last decade of the century, theater studies aimed at a more conceptual approach, emphasizing core concepts like panata and other related or equivalent terms, elevating and defining the study of theater as a study of culture itself. Gamit ang mahigit sa sandaang tesis at disertasyon hinggil sa dula at dulaan o sinasangkot ang mga ito na lumabas sa akademya mula 1948 hanggang 2007, kapwa sa Unibersidad ng Pilipinas at sa iba pa, nilayon ng “Lingon sa Iskolarsyip sa Dulaan (1948-2007” na pulsuhan ang pangkalahatang daloy, tutok, tunguhin o kalakaran sa pagdadala ng mga pag-aaral. Panimula at exploratory sa inductive nitong lapat, nakatukoy ang pag-aaral ng apat na sapit o tutok sa daloy ng

  13. Commitment escalation to a failing family business

    OpenAIRE

    Chirico, Francesco; Salvato, Carlo; Byrne, Barbara; Akhter, Naveed; Arriaga Múzquiz, Juan

    2017-01-01

    The overarching intent of this manuscript is to heighten awareness to the concept of commitment escalation as it bears on a failing family business. Specifically, drawing on the concept of emotional ownership, together with self-justification arguments, we a) identify factors considered to be most forceful in contributing to the presence of commitment escalation and thus, resistance to change in a failing family business (i.e., emotional ownership, feeling of responsibility, investment of cap...

  14. Merger incentives and the failing firm defense

    NARCIS (Netherlands)

    Bouckaert, J.M.C.; Kort, P.M.

    2014-01-01

    The merger incentives between profitable firms differ fundamentally from the incentives of a profitable firm to merge with a failing firm. We investigate these incentives under different modes of price competition and Cournot behavior. Our main finding is that firms strictly prefer exit of the faili

  15. Merger incentives and the failing firm defense

    NARCIS (Netherlands)

    Bouckaert, J.M.C.; Kort, P.M.

    2014-01-01

    The merger incentives between profitable firms differ fundamentally from the incentives of a profitable firm to merge with a failing firm. We investigate these incentives under different modes of price competition and Cournot behavior. Our main finding is that firms strictly prefer exit of the

  16. Examination of a failed fifth wheel coupling

    CSIR Research Space (South Africa)

    Fernandes, PJL

    1998-03-01

    Full Text Available Examination of a fifth wheel coupling which had failed in service showed that it had been modified and that the operating handle had been moved from its original design position. This modification completely eliminated the safety device designed...

  17. Transcatheter Replacement of Failed Bioprosthetic Valves

    DEFF Research Database (Denmark)

    Simonato, Matheus; Webb, John; Kornowski, Ran

    2016-01-01

    Background-Transcatheter valve implantation inside failed bioprosthetic surgical valves (valve-in-valve [ViV]) may offer an advantage over reoperation. Supra-annular transcatheter valve position may be advantageous in achieving better hemodynamics after ViV. Our objective was to define targets fo...

  18. Contested Spaces of a "Failing" Elementary School

    Science.gov (United States)

    Kawai, Roi; Serriere, Stephanie; Mitra, Dana

    2014-01-01

    Amid the recent proliferation of teacher-led movements resisting high-stakes testing across the United States, the authors identify how a "failing" elementary school reclaimed local discourse by taking political action against top-down measures. Framed as competing modes of school reform, the authors offer the sociocultural framework of…

  19. Examination of a Failed Professional Learning Community

    Science.gov (United States)

    Sims, Rachel L.; Penny, G. Richard

    2015-01-01

    Schools are using various forms of professional learning communities (PLCs) in order to increase student achievement and improve educational practices through enhanced communication and collaboration among teachers. This study examined a PLC that had too narrow a focus and failed therefore to affect student achievement. A critical shortcoming of…

  20. Underachievement, Failing Youth and Moral Panics

    Science.gov (United States)

    Smith, Emma

    2010-01-01

    This paper considers contemporary "moral panics" around the underachievement of boys in school examinations in the UK and America. In the UK, in particular, the underachievement of boys is central to current "crisis accounts" about falling standards and failing pupils. "Underachievement" is a familiar word to those…

  1. Understanding Failing Schools: Perspectives from the Inside

    Science.gov (United States)

    Nicolaidou, Maria; Ainscow, Mel

    2005-01-01

    This paper analyses the experience of so-called "failing schools" in order to develop understandings that can inform improvement efforts. It reports on a study of the experiences of a small number of English primary schools placed in "special measures" as a result of being inspected. The study is unusual in that, in the past, researchers have…

  2. The preliminary study of autophagy induction of SA and MeSA by confocal

    Science.gov (United States)

    Yun, Lijuan; Chen, Wenli

    2010-02-01

    Autophagy appears to be a highly conserved process from unicellular to multicellular eukaryotes which contributes to the equilibrium of intracelluar environment. While it would be harmful to the cells when it is excessive by inducing programmed cell death (PCD). It is a protein degradation process in which cells recycle cytoplasmic contents when subjected to environmental stress conditions or during certain stages of development. Previous studies have demonstrated autophagy can be induced during abiotic or biotic stresses. salicylic acid (SA) and methyl salicytic (MeSA) are endogenous signal molecules. We found SA and MeSA can induce autophagy in Arabidopsis thaliana respectively. While autophagy was not induced by SA or MeSA in tobacco suspension cells under the same concentration and period. The differences in stuctures or physiological states may contribute to the results.

  3. SA3654 Component characterization. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Meir, G.W.

    1996-06-01

    AlliedSignal Inc., Federal Manufacturing & Technologies (FM&T), was provided with production capability assurance program (PCAP) funding to develop, characterize, and qualify purchased product components for use on the PRESS-A program. The SA3654, N-Channel, Power MOSFET was identified as a component needing such activity to support PRESS-A. This report presents the characterization activities and results for the SA3654.

  4. SaVi: satellite constellation visualization

    CERN Document Server

    Wood, Lloyd

    2012-01-01

    SaVi, a program for visualizing satellite orbits, movement, and coverage, is maintained at the University of Surrey. This tool has been used for research in academic papers, and by industry companies designing and intending to deploy satellite constellations. It has also proven useful for demonstrating aspects of satellite constellations and their geometry, coverage and movement for educational and teaching purposes. SaVi is introduced and described briefly here.

  5. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  6. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  7. Gravitational wave triggered searches for failed supernovae

    Science.gov (United States)

    Annis, James; Dark Energy Survey Collaboration

    2016-03-01

    Stellar core collapses occur to all stars of sufficiently high mass and often result in supernovae. A small fraction of supergiant stars, however, are thought to collapse directly into black holes without producing supernovae. A survey of such ``failed'' supernovae would require monitoring millions of supergiants for several years. That is very challenging even for current surveys. With the start of the Advanced LIGO science run, we investigate the possibility of detecting failed supernovae by looking for missing supergiants associated with gravitational wave triggers. We use the Dark Energy Camera (DECam). Our project is a joint effort between the community and the Dark Energy Survey (DES) collaboration. In this talk we report on our ongoing efforts and discuss prospects for future searches.

  8. Transfemoral amputation after failed knee arthroplasty

    DEFF Research Database (Denmark)

    Gottfriedsen, Tinne B; Morville Schrøder, Henrik; Odgaard, Anders

    2016-01-01

    BACKGROUND: Transfemoral amputation is considered the last treatment option for failed knee arthroplasty. The extent to which this procedure is performed is not well known. The purpose of this study was to identify the incidence and causes of amputation following failure of knee arthroplasty...... in a nationwide population. METHODS: Data were extracted from the Danish Civil Registration System, the Danish National Patient Register, and the Danish Knee Arthroplasty Register. With use of individual data linkage, 92,785 primary knee arthroplasties performed from 1997 to 2013 were identified. Of these, 258...... for causes related to failed knee arthroplasty. The 15-year cumulative incidence of amputation was 0.32% (95% confidence interval [CI], 0.23% to 0.48%). The annual incidence of amputation following arthroplasties performed from 1997 to 2002 was 0.025% compared with 0.018% following arthroplasties performed...

  9. Systems with randomly failing repairable components

    DEFF Research Database (Denmark)

    Der Kiureghian, Armen; Ditlevsen, Ove Dalager; Song, Junho

    2005-01-01

    Closed-form expressions are derived for the steady-state availability, mean rate of failure, mean duration of downtime and reliability of a general system with randomly and independently failing repairable components. Component failures are assumed to be homogeneous Poisson events in time and rep......, or reducing the mean duration of system downtime. Example applications to an electrical substation system demonstrate the use of the formulas developed in the paper....

  10. A Generalized Eigensolver based on Smoothed Aggregation (GES-SA) for Initializing Smoothed Aggregation Multigrid (SA)

    Energy Technology Data Exchange (ETDEWEB)

    Brezina, M; Manteuffel, T; McCormick, S; Ruge, J; Sanders, G; Vassilevski, P S

    2007-05-31

    Consider the linear system Ax = b, where A is a large, sparse, real, symmetric, and positive definite matrix and b is a known vector. Solving this system for unknown vector x using a smoothed aggregation multigrid (SA) algorithm requires a characterization of the algebraically smooth error, meaning error that is poorly attenuated by the algorithm's relaxation process. For relaxation processes that are typically used in practice, algebraically smooth error corresponds to the near-nullspace of A. Therefore, having a good approximation to a minimal eigenvector is useful to characterize the algebraically smooth error when forming a linear SA solver. This paper discusses the details of a generalized eigensolver based on smoothed aggregation (GES-SA) that is designed to produce an approximation to a minimal eigenvector of A. GES-SA might be very useful as a standalone eigensolver for applications that desire an approximate minimal eigenvector, but the primary aim here is for GES-SA to produce an initial algebraically smooth component that may be used to either create a black-box SA solver or initiate the adaptive SA ({alpha}SA) process.

  11. The Failed Image and the Possessed

    DEFF Research Database (Denmark)

    Suhr, Christian

    2015-01-01

    This article asks if the recurrent queries regarding the value of images in visual anthropology could find new answers by exploring responses to visual media in neo-orthodox Islam. It proposes that the visual display of the photographic image shares a curious resemblance to the bodies of people...... possessed by invisible spirits called jinn. The image as a failed example or model of reality works like the possessed body as an amplifier of invisibility pointing towards that which cannot be seen, depicted visually, or represented in writing. This suggests a negative epistemology in which images obtain...

  12. Differential mechanisms of action of the mucolipin synthetic agonist, ML-SA1, on insect TRPML and mammalian TRPML1.

    Science.gov (United States)

    Feng, Xinghua; Xiong, Jian; Lu, Yungang; Xia, Xuefeng; Zhu, Michael X

    2014-12-01

    Mucolipin synthetic agonist 1 (ML-SA1) was recently identified to activate mammalian TRPML channels and shown to alleviate lipid accumulation in lysosomes of cellular models of lysosome storage diseases, mucolipidosis type IV (MLIV) and Niemann-Pick's disease type C (NPC). Owning to its potential use in complimenting genetic studies in Drosophila melanogaster to elucidate the cellular and physiological functions of TRPML channels, we examined the effect of ML-SA1 on Drosophila TRPML expressed in HEK293 cells using whole-cell, inside-out, and whole-lysosome electrophysiological recordings. We previously showed that when expressed in HEK293 cells, Drosophila TRPML was localized and functional on both plasma membrane and endolysosome. We show here that in both inside-out patches excised from the plasma membrane and whole-lysosome recordings from enlarged endolysosome vacuoles, ML-SA1 failed to activate TRPML unless exogenous phosphatidylinositol 3,5-bisphosphate [PI(3,5)P2] was applied. At 1 μM ML-SA1, the sensitivity of TRPML to PI(3,5)P2 increased approximately by 10-fold and at 10 μM ML-SA1, the deactivation of PI(3,5)P2-evoked TRPML currents was markedly slowed. On the other hand, constitutive activation of TRPML by a mutation that mimics the varitint-waddler (Va) mutation of mouse TRPML3 rendered the insect channel sensitive to activation by ML-SA1 alone. Moreover, different from the insect TRPML, mouse TRPML1 was readily activated by ML-SA1 independent of PI(3,5)P2. Thus, our data reveal that while ML-SA1 acts as a true agonist at mouse TRPML1, it behaves as an allosteric activator of the Drosophila TRPML, showing dependence on and the ability to stabilize open conformation of the insect channels.

  13. Atlas mundial da saúde

    OpenAIRE

    Barrozo, Ligia Vizeu

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans. O Atlas mondial de la santé faz parte da série Collection Atlas/M...

  14. Multivariate predictors of failed prehospital endotracheal intubation.

    Science.gov (United States)

    Wang, Henry E; Kupas, Douglas F; Paris, Paul M; Bates, Robyn R; Costantino, Joseph P; Yealy, Donald M

    2003-07-01

    Conventionally trained out-of-hospital rescuers (such as paramedics) often fail to accomplish endotracheal intubation (ETI) in patients requiring invasive airway management. Previous studies have identified univariate variables associated with failed out-of-hospital ETI but have not examined the interaction between the numerous factors impacting ETI success. This study sought to use multivariate logistic regression to identify a set of factors associated with failed adult out-of-hospital ETI. The authors obtained clinical and demographic data from the Prehospital Airway Collaborative Evaluation, a prospective, multicentered observational study involving advanced life support (ALS) emergency medical services (EMS) systems in the Commonwealth of Pennsylvania. Providers used standard forms to report details of attempted ETI, including system and patient demographics, methods used, difficulties encountered, and initial outcomes. The authors excluded data from sedation-facilitated and neuromuscular blockade-assisted intubations. The main outcome measure was ETI failure, defined as failure to successfully place an endotracheal tube on the last out-of-hospital laryngoscopy attempt. Logistic regression was performed to develop a multivariate model identifying factors associated with failed ETI. Data were used from 45 ALS systems on 663 adult ETIs attempted during the period June 1, 2001, to November 30, 2001. There were 89 cases of failed ETI (failure rate 13.4%). Of 61 factors potentially related to ETI failure, multivariate logistic regression revealed the following significant covariates associated with ETI failure (odds ratio; 95% confidence interval; likelihood ratio p-value): presence of clenched jaw/trismus (9.718; 95% CI = 4.594 to 20.558; p endotracheal tube through the vocal cords (7.653; 95% CI = 3.561 to 16.447; p < 0.0001); inability to visualize the vocal cords (7.638; 95% CI = 3.966 to 14.707; p < 0.0001); intact gag reflex (7.060; 95% CI = 3.552 to 14

  15. A new IPSO-SA approach for cardinality constrained portfolio optimization

    Directory of Open Access Journals (Sweden)

    Marzieh Mozafari

    2011-04-01

    Full Text Available The problem of portfolio optimization has always been a key concern for investors. This paper addresses a realistic portfolio optimization problem with floor, ceiling, and cardinality constraints. This problem is a mixed integer quadratic programming where traditional optimization methods fail to find the optimal solution, efficiently. The present paper develops a new hybrid approach based on an improved particle swarm optimization (PSO and a modified simulated annealing (SA methods to find the cardinality constrained efficient frontier. The proposed algorithm benefits simple and easy characteristics of PSO with an adaptation of inertia weights and constriction factor. In addition, incorporating an SA procedure into IPSO helps escaping from local optima and improves the precision of convergence. Computational results on benchmark problems with up to 225 assets signify that our proposed algorithm exceeds not only the standard PSO but also the other heuristic algorithms previously presented to solve the cardinality constrained portfolio problem.

  16. A Solution to ``Too Big to Fail''

    Science.gov (United States)

    Kohler, Susanna

    2016-10-01

    Its a tricky business to reconcile simulations of our galaxys formation with our current observations of the Milky Way and its satellites. In a recent study, scientists have addressed one discrepancy between simulations and observations: the so-called to big to fail problem.From Missing Satellites to Too Big to FailThe favored model of the universe is the lambda-cold-dark-matter (CDM) cosmological model. This model does a great job of correctly predicting the large-scale structure of the universe, but there are still a few problems with it on smaller scales.Hubble image of UGC 5497, a dwarf galaxy associated with Messier 81. In the missing satellite problem, simulations of galaxy formation predict that there should be more such satellite galaxies than we observe. [ESA/NASA]The first is the missing satellites problem: CDM cosmology predicts that galaxies like the Milky Way should have significantly more satellite galaxies than we observe. A proposed solution to this problem is the argument that there may exist many more satellites than weve observed, but these dwarf galaxies have had their stars stripped from them during tidal interactions which prevents us from being able to see them.This solution creates a new problem, though: the too big to fail problem. This problem states that many of the satellites predicted by CDM cosmology are simply so massive that theres no way they couldnt have visible stars. Another way of looking at it: the observed satellites of the Milky Way are not massive enough to be consistent with predictions from CDM.Artists illustration of a supernova, a type of stellar feedback that can modify the dark-matter distribution of a satellite galaxy. [NASA/CXC/M. Weiss]Density Profiles and Tidal StirringLed by Mihai Tomozeiu (University of Zurich), a team of scientists has published a study in which they propose a solution to the too big to fail problem. By running detailed cosmological zoom simulations of our galaxys formation, Tomozeiu and

  17. Etiologic analysis of 100 anatomically failed dacryocystorhinostomies

    Directory of Open Access Journals (Sweden)

    Dave TV

    2016-07-01

    Full Text Available Tarjani Vivek Dave, Faraz Ali Mohammed, Mohammad Javed Ali, Milind N Naik The Institute of Dacryology, L V Prasad Eye Institute, Hyderabad, India Background: The aim of this study was to assess the etiological factors contributing to the failure of a dacryocystorhinostomy (DCR. Patients and methods: Retrospective review was performed in 100 consecutive patients who were diagnosed with anatomically failed DCR at presentation to a tertiary care hospital over a 5-year period from 2010 to 2015. Patient records were reviewed for demographic data, type of past surgery, preoperative endoscopic findings, previous use of adjuvants such as intubation and mitomycin C, and intraoperative notes during the re-revision. The potential etiological factors for failure were noted. Results: Of the 100 patients with failed DCRs, the primary surgery was an external DCR in 73 and endoscopic DCR in 27 patients. Six patients in each group had multiple revisions. The mean ages at presentation in the external and endoscopic groups were 39.41 years and 37.19 years, respectively. All patients presented with epiphora. The most common causes of failure were inadequate osteotomy (69.8% in the external group and 85.1% in the endoscopic group, P=0.19 followed by inadequate or inappropriate sac marsupialization (60.2% in the external group and 77.7% in the endoscopic group, P=0.16 and cicatricial closure of the ostium (50.6% in the external group and 55.5% in the endoscopic group, P=0.83. The least common causes such as ostium granulomas and paradoxical middle turbinate (1.37%, n=1 were noted in the external group only. Conclusion: Inadequate osteotomy, incomplete sac marsupialization, and cicatricial closure of the ostium were the most common causes of failure and did not significantly differ in the external and endoscopic groups. Meticulous evaluation to identify causative factors for failure and addressing them are crucial for subsequent successful outcomes. Keywords: failed

  18. Caso Ouro Fino Saúde Animal Caso Ouro Fino Saúde Animal Ouro Fino Saúde Animal case

    Directory of Open Access Journals (Sweden)

    Bernardo Hauch Ribeiro de Castro

    2012-04-01

    . Sin embargo, fue un paso arriesgado. El principal problema del caso es evaluar las alternativas de la compra de vacunas o de producir internamente sus propias vacunas. La compañía es la Ouro Fino Saúde Animal, una industria brasileña de productos veterinarios, ubicada en el Estado de Sao Paulo, con ventas de más de R$ 100 millones anuales. Los dos personajes principales de este caso son los directores financieros e industriales de la empresa. La situación se describe en el 2005. Como herramienta de enseñanza, el caso fue diseñado para la estrategia de enseñanza en el post-grado en la gestión, los estudiantes que conducen a evaluar las ventajas y desventajas de cada alternativa. Como objetivo secundario, el caso proporciona algunos elementos para una estimación de la viabilidad financiera de la opción de desplegar una nueva unidad de producción y la posibilidad de reflexionar sobre una decisión ya tomada, para entrar en el mercado. Por último, el caso tiene una gran cantidad de información sobre el mercado y en el mercado mundial de productos veterinarios. Es posible, sobre la base de estos datos, a la discreción del profesor, trabajar las cuestiones de segmentación y posicionamiento de la compañía en la industria.The present teaching case illustrates a decision-making by company executives, on entry into a new market of vaccines for cattle. Faced with the need to take a major step toward sustainable growth, Ouro Fino Saúde Animal could not fail, as long as it represented more than half the market of veterinary products. However, it was a risky step. The main issue of the case is to evaluate wether to buy third-part vaccines or to produce internally their own vaccines. The case company is Ouro Fino Saúde Animal, a Brazilian industry of veterinary products, located in the State of São Paulo, with sales over R$ 100 million annually. The two main characters of this case are the financial and industrial directors. The situation is set in 2005. As a

  19. Fail-over file transfer process

    Science.gov (United States)

    Semancik, Susan K. (Inventor); Conger, Annette M. (Inventor)

    2005-01-01

    The present invention provides a fail-over file transfer process to handle data file transfer when the transfer is unsuccessful in order to avoid unnecessary network congestion and enhance reliability in an automated data file transfer system. If a file cannot be delivered after attempting to send the file to a receiver up to a preset number of times, and the receiver has indicated the availability of other backup receiving locations, then the file delivery is automatically attempted to one of the backup receiving locations up to the preset number of times. Failure of the file transfer to one of the backup receiving locations results in a failure notification being sent to the receiver, and the receiver may retrieve the file from the location indicated in the failure notification when ready.

  20. Salvage arthrodesis for failed total ankle arthroplasty

    Science.gov (United States)

    Zürcher, Arthur W

    2010-01-01

    Background and purpose Total ankle arthroplasty (TAA) has gained popularity in recent years. If it fails, however, salvage arthrodesis must be reliable as a rescue procedure. We therefore investigated the clinical, radiographic, and subjective outcome after salvage arthrodesis in a consecutive group of patients, and concentrated on the influence of the method of fixation on union rate and on salvage in inflammatory joint disease. Patients and methods Between 1994 and 2005, salvage arthrodesis was performed on 18 ankles (18 patients). Diagnosis was inflammatory joint disease (IJD) in 15 cases and osteoarthritis (OA) in 3. Tibio-talar fusion was performed in 7 ankles, and tibio-talocalcaneal fusion in 11. Serial radiographs were studied for time to union. Clinical outcome at latest follow-up was measured by the AOFAS score, the foot function index (FFI) and by VAS scores for pain, function, and satisfaction. Results Blade plates were used in 7 ankles (4 IJD, 3 OA); all united. Nonunion developed in 7 of the 11 rheumatic ankles stabilized by other methods. 11 patients (8 fused ankles, 3 nonunions) were available for clinical evaluation. Their mean AOFAS score was 62 and mean overall FFI was 70. VAS score for pain was 20, for function 64, and for satisfaction 74. The scores were similar in united and non-united ankles. Interpretation Blade plate fixation is successful in salvage arthrodesis for failed TAA. A high nonunion rate was found after salvage ankle arthrodesis in IJD with other methods of fixation. Clinical results were fair to good. PMID:20175648

  1. Revision of Failed Artroscopic Bankart Repairs

    Science.gov (United States)

    Muiño, José María Silberberg; Gimenez, Martín Alejandro; Salvucci, Mauro Gabriel Maroa; Ferro, Diego; Rullan, Ramón Muiña

    2017-01-01

    Objectives: To present our functional outcomes from patients treated arthroscopically for a failed Bankart repair, using suture anchors and capsulolabral tissue only. Methods: Series of 22 patients presented with a recurrence of instability after a previous stabilization surgery (3 Latarjet, Bankart 19). We treated them by a an all-arthroscopic procedure, avoiding bone grafts, when glenoid track was found to be enough to proceed. The failure was associated with trauma in 11 patients, a non-anatomic repair in 6 patients, capsular laxity in 4 patients and a non-union of the coracoid graft in 1 patient. Revision surgery included: Bankart repair with anchors in 17 cases, a posterior-inferior capsulo-labral plication in one case, and 5 remplissages. In 4 cases subscapularis augmentation was used because of poor capsular quality. Screw removal was necessary when treating the non-union case. Patients were followed-up by a minimum of 23 months (range 23-26), and evaluated by the UCLA Test, SS test and Rowe score. Results: Thirteen patients had an excellent result, 6 good, 2 satisfactory and one bad result, according to UCLA score. The mean Rowe score was 90.4, at final follow up. The Simple Shoulder Test went from an 8 preoperative to an 11 postoperative, mean scores. 19 of 22 patients returned to the same level of activity prior to the injury. Complications: recurrence in 2 cases, subluxation in 2 and one shoulder stiffness that required an arthrolysis. Conclusion: An arthroscopic revision surgery, after a failed Bankart repair, presents satisfactory results in selected patients. Arthroscopic vision allows a correct diagnosis of injuries as possible causes of failure and subsequent treatment.

  2. Studies of the aggregation of RNase Sa

    DEFF Research Database (Denmark)

    Khasa, Harshit; Kramer, Ryan; Maddux, Nathan

    2014-01-01

    Thirty-eight mutants of RNase Sa (ribonuclease from Streptomyces aureofaciens) were examined for their structure, thermal sensitivity, and tendency to aggregate. Although a biphasic correlation was seen between the effect of temperature on structure and the free energy of transfer changes in many...

  3. Proteomic analysis of membrane microdomains derived from both failing and non-failing human hearts.

    Science.gov (United States)

    Banfi, Cristina; Brioschi, Maura; Wait, Robin; Begum, Shajna; Gianazza, Elisabetta; Fratto, Pasquale; Polvani, Gianluca; Vitali, Ettore; Parolari, Alessandro; Mussoni, Luciana; Tremoli, Elena

    2006-03-01

    Eukaryotic cells plasma membranes are organized into microdomains of specialized function such as lipid rafts and caveolae, with a specific lipid composition highly enriched in cholesterol and glycosphingolipids. In addition to their role in regulating signal transduction, multiple functions have been proposed, such as anchorage of receptors, trafficking of cholesterol, and regulation of permeability. However, an extensive understanding of their protein composition in human heart, both in failing and non-failing conditions, is not yet available. Membrane microdomains were isolated from left ventricular tissue of both failing (n = 15) and non-failing (n = 15) human hearts. Protein composition and differential protein expression was explored by comparing series of 2-D maps and subsequent identification by LC-MS/MS analysis. Data indicated that heart membrane microdomains are enriched in chaperones, cytoskeletal-associated proteins, enzymes and protein involved in signal transduction pathway. In addition, differential protein expression profile revealed that 30 proteins were specifically up- or down-regulated in human heart failure membrane microdomains. This study resulted in the identification of human heart membrane microdomain protein composition, which was not previously available. Moreover, it allowed the identification of multiple proteins whose expression is altered in heart failure, thus opening new perspectives to determine which role they may play in this disease.

  4. 7 CFR 983.52 - Failed lots/rework procedure.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Failed lots/rework procedure. 983.52 Section 983.52..., ARIZONA, AND NEW MEXICO Regulations § 983.52 Failed lots/rework procedure. (a) Substandard pistachios... committee may establish, with the Secretary's approval, appropriate rework procedures. (b) Failed...

  5. 30 CFR 77.312 - Fail safe monitoring systems.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Fail safe monitoring systems. 77.312 Section 77... Thermal Dryers § 77.312 Fail safe monitoring systems. Thermal dryer systems and controls shall be protected by a fail safe monitoring system which will safely shut down the system and any related...

  6. Fail forward: Mitigating failure in energy research and innovation

    DEFF Research Database (Denmark)

    Brix, Jacob

    2015-01-01

    on participant observation and empirical field research in three case companies, the OFEI model is developed to identify inappropriate behaviors that cause energy research and innovation to fail. The OFEI model can be used to give failed (or failing) projects a second chance and the article concludes...

  7. Cognitive emotion regulation fails the stress test.

    Science.gov (United States)

    Raio, Candace M; Orederu, Temidayo A; Palazzolo, Laura; Shurick, Ashley A; Phelps, Elizabeth A

    2013-09-10

    Cognitive emotion regulation has been widely shown in the laboratory to be an effective way to alter the nature of emotional responses. Despite its success in experimental contexts, however, we often fail to use these strategies in everyday life where stress is pervasive. The successful execution of cognitive regulation relies on intact executive functioning and engagement of the prefrontal cortex, both of which are rapidly impaired by the deleterious effects of stress. Because it is specifically under stressful conditions that we may benefit most from such deliberate forms of emotion regulation, we tested the efficacy of cognitive regulation after stress exposure. Participants first underwent fear-conditioning, where they learned that one stimulus (CS+) predicted an aversive outcome but another predicted a neutral outcome (CS-). Cognitive regulation training directly followed where participants were taught to regulate fear responses to the aversive stimulus. The next day, participants underwent an acute stress induction or a control task before repeating the fear-conditioning task using these newly acquired regulation skills. Skin conductance served as an index of fear arousal, and salivary α-amylase and cortisol concentrations were assayed as neuroendocrine markers of stress response. Although groups showed no differences in fear arousal during initial fear learning, nonstressed participants demonstrated robust fear reduction following regulation training, whereas stressed participants showed no such reduction. Our results suggest that stress markedly impairs the cognitive regulation of emotion and highlights critical limitations of this technique to control affective responses under stress.

  8. Gender differences in electrophysiological gene expression in failing and non-failing human hearts.

    Directory of Open Access Journals (Sweden)

    Christina M Ambrosi

    Full Text Available The increasing availability of human cardiac tissues for study are critically important in increasing our understanding of the impact of gender, age, and other parameters, such as medications and cardiac disease, on arrhythmia susceptibility. In this study, we aimed to compare the mRNA expression of 89 ion channel subunits, calcium handling proteins, and transcription factors important in cardiac conduction and arrhythmogenesis in the left atria (LA and ventricles (LV of failing and nonfailing human hearts of both genders. Total RNA samples, prepared from failing male (n = 9 and female (n = 7, and from nonfailing male (n = 9 and female (n = 9 hearts, were probed using custom-designed Taqman gene arrays. Analyses were performed to explore the relationships between gender, failure state, and chamber expression. Hierarchical cluster analysis revealed chamber specific expression patterns, but failed to identify disease- or gender-dependent clustering. Gender-specific analysis showed lower expression levels in transcripts encoding for K(v4.3, KChIP2, K(v1.5, and K(ir3.1 in the failing female as compared with the male LA. Analysis of LV transcripts, however, did not reveal significant differences based on gender. Overall, our data highlight the differential expression and transcriptional remodeling of ion channel subunits in the human heart as a function of gender and cardiac disease. Furthermore, the availability of such data sets will allow for the development of disease-, gender-, and, most importantly, patient-specific cardiac models, with the ability to utilize such information as mRNA expression to predict cardiac phenotype.

  9. Why Lumbar Artificial Disk Replacements (LADRs) Fail.

    Science.gov (United States)

    Pettine, Kenneth; Ryu, Robert; Techy, Fernando

    2017-07-01

    A retrospective review of prospectively collected data. To determine why artificial disk replacements (ADRs) fail by examining results of 91 patients in FDA studies performed at a single investigational device exemption (IDE) site with minimum 2-year follow-up. Patients following lumbar ADR generally achieve their 24-month follow-up results at 3 months postoperatively. Every patient undergoing ADR at 1 IDE site by 2 surgeons was evaluated for clinical success. Failure was defined as Maverick, 25 patients; Charité, 31 patients; and Kineflex, 35 patients. All procedures were 1-level operations performed at L4-L5 or L5-S1. Demographics and inclusion/exclusion criteria were similar and will be discussed. Overall clinical failure occurred in 26% (24 of 91 patients) at 2-year follow-up. Clinical failure occurred in: 28% (Maverick) (7 of 25 patients), 39% (Charité) (12 of 31 patients), and 14% (Kineflex) (5 of 35 patients). Causes of failure included facet pathology, 50% of failure patients (12 of 24). Implant complications occurred in 5% of total patients and 21% of failure patients (5 of 24). Only 5 patients went from a success to failure after 3 months. Only 1 patient went from a failure to success after a facet rhizotomy 1 year after ADR. Seventy-four percent of patients after ADR met strict clinical success after 2-year follow-up. The clinical success versus failure rate did not change from their 3-month follow-up in 85 of the 91 patients (93%). Overall clinical success may be improved most by patient selection and implant type.

  10. 什么是SA8000

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(SOCIAL ACCOUT ABILTY8000的英文简称)是其中最有名的标准之

  11. DAYA SAING KAKAO INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Anggita Tresliyana

    2015-07-01

    Full Text Available Cocoa is one of the major Indonesian agricultural export products. Cocoa international market has great potential regarding world’s consumption growth, therefore Indonesia is expected to take advantage on existing opportunities. The aims of this study were to analyze the competitiveness of Indonesian cocoa beans and processed cocoa trade in the international market as well as the level of competition between cocoa exporting countries. By using Revealed Comparative Advantage (RCA and Spearman Rank Correlation, it showed that Indonesia had a comparative advantage as an cocoa exporter on the international market, the highest for cocoa beans and the lowest for cocoa paste; Indonesia also had a significant correlation to exporting countries in cocoa beans’ market (Ghana and cocoa paste’s market (Netherlands and Malaysia, the correlation suggests that there were high correlation between Indonesia and the exporting country in competing for market share.Keywords: cocoa, comparative advantage, international trade, competitiveness, market share, RCA ABSTRAKKakao merupakan salah satu komoditas pertanian unggulan ekspor Indonesia.  Pasar kakao memiliki potensi yang besar dilihat dari peningkatan konsumsi dunia, sehingga Indonesia diharapkan dapat memanfaatkan peluang yang ada.  Tujuan penelitian ini adalah menganalisis daya saing perdagangan biji kakao dan kakao olahan Indonesia di pasar internasional serta hubungan daya saing antar negara eksportir kakao. Dengan menggunakan Reavealed Comparative Advantage (RCA, dan Korelasi Rank Spearman, hasil analisis menunjukkan bahwa Indonesia memiliki keunggulan komparatif sebagai eksportir biji kakao dan kakao olahan di pasar internasional, tertinggi untuk biji kakao dan terendah untuk kakao pasta;  Indonesia juga memiliki korelasi yang signifikan di beberapa negara untuk pasar biji kakao (Ghana dan kakao pasta (Belanda dan Malaysia, korelasi tersebut menunjukkan bahwa terdapat hubungan daya saing yang cukup

  12. Atmospheric environment for ASTP (SA-210) launch

    Science.gov (United States)

    Johnson, D. L.

    1976-01-01

    A summary is presented of selected atmospheric conditions observed near ASTP/SA-210 launch time on July 15, 1975, at Kennedy Space Center, Florida. Values of ambient pressure, temperature, moisture, ground winds, visual observations (cloud), density, index of refraction, and wind/wind shear aloft are included. A final meteorological data tape for the ASTP launch, consisting of wind and thermodynamic parameters versus altitude, has been constructed.

  13. IkusaSA. Integrated Assessment for Sustainability

    CSIR Research Space (South Africa)

    Scholes, RJ

    2012-10-01

    Full Text Available , have intended and unintended consequences across a range of important issues. The IkusaSA model system comprises: ? A South African national IAM nested within one or more ?state-of-the-art? global IAMs that predict trade, climate change and human.... The desired outcome is a well-functioning interface between sectors and between technical assessments and policy action. WHAT IS AN INTEGRATED ASSESSMENT MODEL (IAM)? An IAM is a numerical simulation of the dynamic interaction between socio...

  14. Performance Evaluation Considering Iterations per Phase and SA Temperature in WMN-SA System

    Directory of Open Access Journals (Sweden)

    Shinji Sakamoto

    2014-01-01

    Full Text Available One of the key advantages of Wireless Mesh Networks (WMNs is their importance for providing cost-efficient broadband connectivity. There are issues for achieving the network connectivity and user coverage, which are related with the node placement problem. In this work, we consider Simulated Annealing Algorithm (SA temperature and Iteration per phase for the router node placement problem in WMNs. We want to find the optimal distribution of router nodes in order to provide the best network connectivity and provide the best coverage in a set of Normal distributed clients. From simulation results, we found how to optimize both the size of Giant Component and number of covered mesh clients. When the number of iterations per phase is big, the performance is better in WMN-SA System. From for SA temperature, when SA temperature is 0 and 1, the performance is almost same. When SA temperature is 2 and 3 or more, the performance decrease because there are many kick ups.

  15. Interior's Climate Science Centers: Focus or Fail

    Science.gov (United States)

    Udall, B.

    2012-12-01

    After a whirlwind two years of impressive and critical infrastructure building, the Department of Interior's Climate Science Centers are now in a position to either succeed or fail. The CSCs have a number of difficult structural problems including too many constituencies relative to the available resources, an uneasy relationship among many of the constituencies including the DOI agencies themselves, a need to do science in a new, difficult and non-traditional way, and a short timeframe to produce useful products. The CSCs have built a broad and impressive network of scientists and stakeholders. These entities include science providers of the universities and the USGS, and decision makers from the states, tribes, DOI land managers and other federal agencies and NGOs. Rather than try to support all of these constituencies the CSCs would be better served by refocusing on a core mission of supporting DOI climate related decision making. The CSCs were designed to service the climate science needs of DOI agencies, many of which lost their scientific capabilities in the 1990s due to a well-intentioned but ultimately harmful re-organization at DOI involving the now defunct National Biological Survey. Many of these agencies would like to have their own scientists, have an uneasy relationship with the nominal DOI science provider, the USGS, and don't communicate effectively among themselves. The CSCs must not succumb to pursuing science in either the traditional mode of the USGS or in the traditional mode of the universities, or worse, both of them. These scientific partners will need to be flexible, learn how to collaborate and should expect to see fewer resources. Useful CSC processes and outputs should start with the recommendations of the 2009 NRC Report Informing Decisions in a Changing Climate: (1) begin with users' needs; (2) give priority to process over products; (3) link information producers and users; (4) build connections across disciplines and organizations

  16. Rescue of failed filtering blebs with ab interno trephination.

    Science.gov (United States)

    Shihadeh, Wisam A; Ritch, Robert; Liebmann, Jeffrey M

    2006-06-01

    We evaluated the effectiveness of ab interno automated trephination as a technique for rescuing failed mature filtering blebs. A retrospective chart review of 40 failed blebs of 38 patients who had a posttrephination follow-up period of at least 3 months was done. With success defined as intraocular pressure (IOP) control with other modalities of management. Complications were few. We believe that ab interno trephination is an excellent option for rescuing selected failed filtering blebs.

  17. 20-Hydroxyecdysone activates PGRP-SA mediated immune response in Locusta migratoria.

    Science.gov (United States)

    Han, Pengfei; Han, Jiao; Fan, Jiqiao; Zhang, Min; Ma, Enbo; Li, Sheng; Fan, Renjun; Zhang, Jianzhen

    2017-02-27

    20-hydroxyecdysone (20E) has been implicated in regulating the immune response in insects. Conflicting conclusions on 20E regulating immunity have been reported in model holometabolous species. However, in hemimetabolous insects, the role of 20E as an immune-suppressor or activator and the mechanism remains unclear. The migratory locust Locusta migratoria is a representative member of hemimetabolous insects. Here, digital gene expression (DGE) profiles of Locusta migratoria treated with 20E were analyzed. Pattern recognition receptors [peptidoglycan recognition protein (PGRP-SA), PGRP-LE, and gram-negative binding protein (GNBP3)] and antimicrobial peptides (defensin, diptericin, and i-type lysozyme) were significantly induced by 20E in fat body. These immune-related genes significantly increased their mRNA levels during the high-20E stage. Antibacterial activities in plasma were enhanced after 20E injection and during the high-20E developmental stage. Conversely, when 20E signal was suppressed by RNAi of EcR (ecdysone receptor), the expression levels of these genes and antibacterial activities failed to be increased by 20E injection and during the high-20E developmental stage, and the mortality increased after being infected by entomogenous fungus. The knockdown of PGRP-SA inhibited the expression level of defensin, diptericin and i-type lysozyme in fat body and reduced antibacterial activities in plasma. 20E injection could not significantly induce the expression of antimicrobial peptides after RNAi of PGRP-SA. These results demonstrated that 20E enhanced the immune response by activating PGRP-SA in L. migratoria.

  18. DAYA SAING TEH INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Fadhilah Ramadhani

    2013-11-01

    Full Text Available Abstrak ___________________________________________________________________ Teh merupakan komoditas sub sektor perkebunan yang pernah mengalami kejayaan selama dua puluh tahun terakhir. Namun dari tahun ke tahun peringkat teh Indonesia di pasar internasional terus mengalami penurunan. Penurunan tersebut dari peringkat ke dua dunia menjadi peringkat ke enam dunia. Hal ini diduga karena lemahnya daya saing produk teh Indonesia di pasar internasional. Adapun tujuan penelitian ini untuk mengkaji perkembangan daya saing teh Indonesia di pasar internasional serta faktor yang mempengaruhi posisi daya saing tesebut. Metode analisis data yang digunakan dalam penelitian ini adalah analisis deskriptif untuk hasil uji Import Dependency Ratio (IDR, Self Sufficiency Ratio (SSR, dan  Revealed Comparative Advantage (RCA. Selanjutnya hasil nilai Revealed Comparative Advantage (RCA akan diregresi dengan metode Ordinary Least Square (OLS.  Berdasarkan hasil uji Import Dependency Ratio (IDR mendapatkan nilai 0 persen hingga 16 persen yang menunjukkan Indonesia tidak mempunyai ketergantungan terhadap produk impor teh. Sedangkan nilai Self Sufficiency Ratio (SSR menunjukkan nilai 280,015 persen, artinya produksi teh Indonesia cukup untuk memenuhi kebutuhan dalam negeri dan ekspor. Dengan nilai daya saing yang cukup kuat, dilihat dari nilai Revealed Comparative Advantage (RCA sebesar 6,790. Hasil uji regresi Ordinary Least Square (OLS terdahap Revealed Comparative Advantage (RCA, menunjukkan kurs rill dan harga riil berpengaruh secara signifikan terhadap posisi daya saing teh indonesia di pasar internasional pada α = 5%. Produksi teh Indonesia tidak berpengaruh terhadap posisi daya saing dengan α = 5%. Abstract ______________________________________________________________ Tea is plantation commodity has been experienced triumph over the last twenty years. But every years ratings Indonesia tea in international markets continues to decline. The decline Indonesia

  19. Manufacturing of JT-60SA Cryostat Base

    Energy Technology Data Exchange (ETDEWEB)

    Medrano, Mercedes, E-mail: mercedes.medrano@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Botija, José; Fernández, Pilar; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira [JAEA, Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► JT-60SA Cryostat Base has been fabricated in seven structures fastened by bolts. ► The pieces are fully welded structures further machined to get required tolerances. ► The pre-assembly of the Cryostat Base will be done at the factory to check final tolerances as well as to anticipate problems which could be encountered during final assembly. -- Abstract: JT-60SA is a superconducting tokamak to be assembled and operated at the JAEA laboratories in Naka (Japan) [1]. The tokamak has been designed to prepare, support and complement the ITER experimental programme and will be manufactured and operated under the funding of the Broader Approach Agreement (between the government of Japan and the European Commission) and of the Japan Fusion National Programme. Within the European contribution to JT-60SA, Spain has to provide the cryostat. Due to functional purposes, the cryostat has been divided in two large assemblies: the Cryostat Base (CB) and the Cryostat Vessel Body the latter subdivided into Cryostat Vessel Body Cylindrical Section (CVBCS) and the Top Lid. Spain is committed to provide the design and subsequent manufacturing of the CB and CVBCS (excluding the Top Lid) through the National Laboratory of Fusion at Ciemat. The design of both components has been concluded and the CB is currently being manufactured by a Spanish company, IDESA. This paper aims to present the status of the manufacturing and pre-assembly at the factory of the CB that has to be delivered in November 2012.

  20. Bacillus licheniformis SA03 Confers Increased Saline–Alkaline Tolerance in Chrysanthemum Plants by Induction of Abscisic Acid Accumulation

    Directory of Open Access Journals (Sweden)

    Cheng Zhou

    2017-06-01

    Full Text Available Soil saline-alkalization is a major abiotic stress that leads to low iron (Fe availability and high toxicity of sodium ions (Na+ for plants. It has recently been shown that plant growth promoting rhizobacteria (PGPR can enhance the ability of plants to tolerate multiple abiotic stresses such as drought, salinity, and nutrient deficiency. However, the possible involvement of PGPR in improving saline–alkaline tolerance of plants and the underlying mechanisms remain largely unknown. In this study, we investigated the effects of Bacillus licheniformis (strain SA03 on the growth of Chrysanthemum plants under saline–alkaline conditions. Our results revealed that inoculation with SA03 alleviated saline–alkaline stress in plants with increased survival rates, photosynthesis and biomass. The inoculated plants accumulated more Fe and lower Na+ concentrations under saline–alkaline stress compared with the non-inoculated plants. RNA-Sequencing analyses further revealed that SA03 significantly activated abiotic stress- and Fe acquisition-related pathways in the stress-treated plants. However, SA03 failed to increase saline–alkaline tolerance in plants when cellular abscisic acid (ABA and nitric oxide (NO synthesis were inhibited by treatment with fluridone (FLU and 2-(4-carboxyphenyl-4,4,5,5-tetramethylimidazoline-1-oxyl-3-oxide (c-PTIO, respectively. Importantly, we also found that NO acted downstream of SA03-induced ABA to activate a series of adaptive responses in host plants under saline–alkaline stress. These findings demonstrated the potential roles of B. licheniformis SA03 in enhancing saline–alkaline tolerance of plants and highlighted the intricate integration of microbial signaling in regulating cellular Fe and Na+ accumulation.

  1. AGREEMENT BETWEEN CERN AND UBS SA

    CERN Multimedia

    2002-01-01

    We wish to inform you that the agreement between CERN and UBS SA has been renewed for a period of five years with effect from 1st July 2002. This represents the culmination of work carried out since 1999 by a group consisting of representatives of the Finance Division, the SPL Division, the Staff Association and the Users Office. After analysis of the results of a market survey, it emerged that OVERALL the UBS offered the best conditions and guarantees for the CERN personnel. Owing to developments in the banking market, new conditions have had to be negotiated, which will be presented to you by the UBS (see article).

  2. An investigation on SA 213-Tube to SA 387-Tube plate using friction welding process

    Energy Technology Data Exchange (ETDEWEB)

    Rajan, S. Pandia; Kumaraswamidhas, L. A. [Indian Institute of Technology, Jharkhand (India); Kumaran, S. Senthil [RVS School of Engineering and Technology, Tamil Nadu (India); Muthukumaran, S. [National Institute of Technology, Tamil Nadu (India)

    2016-01-15

    Friction welding of tube to tube plate using an external tool (FWTPET) is a relatively newer solid state welding process used for joining tube to tube plate of either similar or dissimilar materials with enhanced mechanical and metallurgical properties. In the present study, FWTPET has been used to weld SA 213 (Grade T12) tube with SA 387 (Grade 22) tube plate. The welded samples are found to have satisfactory joint strength and the Energy dispersive X-ray analysis (EDX), X-ray diffraction (XRD) study showed that inter metallic compound is absent in the weld zone. The different weld joints have been identified and the phase composition is found using EDX and XRD. Microstructures have been analyzed using optical and Scanning electron microscopy (SEM). The mechanical properties such as hardness, compressive shear strength and peel test for different weld conditions are studied and the hardness survey revealed that there is increase in hardness at the weld interface due to grain refinement. The corrosion behavior for different weld conditions have been analyzed and the weld zone is found to have better corrosion resistance due to the influence of the grain refinement after FWTPET welding process. Hence, the present investigation is carried out to study the behavior of friction welded dissimilar joints of SA 213 tube and SA 387 tube plate joints and the results are presented. The present study confirms that a high quality tube to tube plate joint can be achieved using FWTPET process at 1120 rpm.

  3. Perfil de saúde dos trabalhadores de um Centro de Saúde-Escola

    Directory of Open Access Journals (Sweden)

    Nascimento Lucila Castanheira

    2002-01-01

    Full Text Available O estudo buscou descrever o perfil de saúde dos trabalhadores (184 de um Centro de Saúde-Escola de Ribeirão Preto, sob a perspectiva da Promoção de Saúde, modelo epidemiológico de Blum e fatores de risco para doenças crônico-degenerativas. Foi realizado estudo descritivo utilizando-se entrevista estruturada. Concluiu-se que os trabalhadores eram predominantemente do sexo feminino, faixa etária de 35 a 39 anos e escolaridade "superior completo". Dentre os achados, constatou-se que 61,9% tinham sobrepeso e obesidade; a hipertensão foi detectada em 33,1%; 41 (22,3% apresentaram pressão arterial acima do nível da normalidade e a obesidade mostrou-se presente em mais da metade dos indivíduos com pressão arterial alterada. Os dados possibilitaram explorar riscos autocriados para as doenças crônico-degenerativas; identificar fatores relacionados à promoção de saúde e prevenção de doenças e refletir sobre o autocuidado e auto-responsabilidade, visando à qualidade de vida que desfrutarão, em decorrência da transição demográfica e epidemiológica que vivenciamos.

  4. 7 CFR 983.152 - Failed lots/rework procedure.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Failed lots/rework procedure. 983.152 Section 983.152..., ARIZONA, AND NEW MEXICO Rules and Regulations § 983.152 Failed lots/rework procedure. (a) Inshell rework procedure for aflatoxin. If inshell rework is selected as a remedy to meet the aflatoxin regulations of...

  5. North America and South America (NA-SA) neuropathy project.

    Science.gov (United States)

    Pasnoor, Mamatha; Nascimento, Osvaldo J M; Trivedi, Jaya; Wolfe, Gil I; Nations, Sharon; Herbelin, Laura; de Freitas, M G; Quintanilha, Giseli; Khan, Saud; Dimachkie, Mazen; Barohn, Richard

    2013-08-01

    Peripheral neuropathy is a common neurological disorder. There may be important differences and similarities in the diagnosis of peripheral neuropathy between North America (NA) and South America (SA). Neuromuscular databases were searched for neuropathy diagnosis at two North American sites, University of Kansas Medical Center and University of Texas Southwestern Medical Center, and one South American site, Federal Fluminense University in Brazil. All patients were included into one of the six major categories: immune-mediated, diabetic, hereditary, infectious/inflammatory, systemic/metabolic/toxic (not diabetic) and cryptogenic. A comparison of the number of patients in each category was made between North America and South America databases. Total number of cases in North America was 1090 and in South America was 1034 [immune-mediated: NA 215 (19.7%), SA 191 (18%); diabetic: NA 148 (13.5%), SA 236 (23%); hereditary: NA 292 (26.7%), SA 103 (10%); infectious/inflammatory: NA 53 (4.8%), SA 141 (14%); systemic/metabolic/toxic: NA 71 (6.5%), SA 124 (12%); cryptogenic: NA 311 (28.5%), SA 239 (23%)]. Some specific neuropathy comparisons were hereditary neuropathies [Charcot-Marie-Tooth (CMT) cases] in NA 246/292 (84.2%) and SA 60/103 (58%); familial amyloid neuropathy in SA 31/103 (30%) and none in NA. Among infectious neuropathies, cases of human T-lymphotropic virus type 1 (HTLV-1) neuropathy in SA were 36/141(25%), Chagas disease in SA were 13/141(9%) and none for either in NA; cases of neuropathy due to leprosy in NA were 26/53 (49%) and in SA were 39/141(28%). South American tertiary care centers are more likely to see patients with infectious, diabetic and hereditary disorders such as familial amyloid neuropathies. North American tertiary centers are more likely to see patients with CMT. Immune neuropathies and cryptogenic neuropathies were seen equally in North America and South America.

  6. Saúde Coletiva: um desafio para a enfermagem

    Directory of Open Access Journals (Sweden)

    Matumoto Silvia

    2001-01-01

    Full Text Available O texto parte da saúde pública para discutir o que é saúde coletiva, seu objeto e campo de atuação, dando ênfase à concepção de homem, à discussão a respeito do âmbito individual e coletivo e ao conceito de saúde-doença, passando pelo debate da construção interdisciplinar da saúde coletiva. Em seguida, busca situar a enfermagem nesse campo, destacando aquilo que parece ser um grande desafio, compreender a enfermagem como prática de relações.

  7. The Experience of Failed Humor: Implications for Interpersonal Affect Regulation.

    Science.gov (United States)

    Williams, Michele; Emich, Kyle J

    2014-01-01

    The purpose of this study was to investigate failed interpersonal affect regulation through the lens of humor. We investigated individual differences that influenced people's affective and cognitive responses to failed humor and their willingness to persist in the interpersonal regulation of positive affect after a failed attempt. Using well-established autobiographical narrative methods and surveys, we collected data at two time points. All participants (n = 127) received identical surveys at time 1. At time 2, they were randomly assigned to complete a narrative about either successful or failed humor as well as a second survey. Using moderated regression analyses and SEM, we found significant differences between our failed and successful humor conditions. Specifically, individual differences, including gender, affective perspective taking, and humor self-efficacy, were associated with negative reactions to failed humor and the willingness of individuals to persist in the interpersonal regulation of positive affect. Moreover, affective perspective taking moderated the effect of gender in both the failed and successful humor conditions. Our results suggest that failed humor is no laughing matter. Understanding individuals' willingness to continue in attempts to regulate the affect of others contributes to the comprehension of an understudied phenomenon that has implications for interpersonal behavior in organizations such as helping, group decision making, and intragroup conflict. Studies of interpersonal affect regulation often focus on people's ability to successfully regulate others' emotions. In contrast, this is the first quantitative study to explore factors that influence individual's willingness to persist in interpersonal affect regulation after failure, and to investigate how individual differences influence the personal outcomes associated with failed attempts.

  8. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Garcia Eloi S.

    1995-01-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  9. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Eloi S. Garcia

    1995-09-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  10. Novas Tecnologias e Saúde

    OpenAIRE

    2013-01-01

    Introdução Comecemos por algo simples: lidar e combater doenças sempre pressupõe alguma forma de domínio técnico, mesmo quando as práticas para obtenção da saúde estão culturalmente associadas a meios mágicos. Um aspecto importante da magia, seu sentido ritualístico estrito, a observância de fórmulas rigorosas, constitui uma forma de racionalização da experiência empírica, que resulta em conhecimento sobre propriedades alucinógenas ou curativas de certos vegetais, por exemplo. A esse resp...

  11. Childhood obesity: parents fail to recognise, general practitioners fail to act.

    LENUS (Irish Health Repository)

    White, A

    2012-01-01

    General Practitioners (GPs) have an important role to play in recognition of and intervention against childhood obesity in Ireland. Data were collected prospectively on a cohort of children aged 4-14 and their parents (n = 101 pairs) who attended consecutively to a semi-rural group general practice. Parents estimated their child\\'s weight status. Actual weight status was determined for both parent and child using the United States Centres\\' for Disease Control\\'s BMI-for-age references. 15 (14.9%) of the children and 49 (51.6%) of the parents were overweight or obese. While 71 (95.5%) of normal weight status children were correctly identified, parents showed poor concordance in identifying their children as overweight 2 (18.2%) or obese 0 (0%). BMI was only evidently recorded in the clinical records of 1 out of 15 cases of overweight children identified. With parents failing to recognise childhood obesity, GPs have a responsibility in tackling this problem at a family level.

  12. Childhood obesity: parents fail to recognise, general practitioners fail to act.

    Science.gov (United States)

    White, A; O'Brien, B; Houlihan, T; Darker, C; O'Shea, B

    2012-01-01

    General Practitioners (GPs) have an important role to play in recognition of and intervention against childhood obesity in Ireland. Data were collected prospectively on a cohort of children aged 4-14 and their parents (n = 101 pairs) who attended consecutively to a semi-rural group general practice. Parents estimated their child's weight status. Actual weight status was determined for both parent and child using the United States Centres' for Disease Control's BMI-for-age references. 15 (14.9%) of the children and 49 (51.6%) of the parents were overweight or obese. While 71 (95.5%) of normal weight status children were correctly identified, parents showed poor concordance in identifying their children as overweight 2 (18.2%) or obese 0 (0%). BMI was only evidently recorded in the clinical records of 1 out of 15 cases of overweight children identified. With parents failing to recognise childhood obesity, GPs have a responsibility in tackling this problem at a family level.

  13. Fail-Safe Magnetic Bearing Controller Demonstrated Successfully

    Science.gov (United States)

    Choi, Benjamin B.; Provenza, Andrew J.

    2001-01-01

    The Structural Mechanics and Dynamics Branch has successfully demonstrated a fail-safe controller for the Fault-Tolerant Magnetic Bearing rig at the NASA Glenn Research Center. The rotor is supported by two 8-pole redundant radial bearings, and coil failing situations are simulated by manually shutting down their control current commands from the controller cockpit. The effectiveness of the controller was demonstrated when only two active coils from each radial bearing could be used (that is, 14 coils failed). These remaining two coils still levitated the rotor and spun it without losing stability or desired position up to the maximum allowable speed of 20,000 rpm.

  14. Pictorial essay: Role of ultrasound in failed carpal tunnel decompression

    Directory of Open Access Journals (Sweden)

    Rajesh Botchu

    2012-01-01

    Full Text Available USG has been used for the diagnosis of carpal tunnel syndrome. Scarring and incomplete decompression are the main causes for persistence or recurrence of symptoms. We performed a retrospective study to assess the role of ultrasound in failed carpal tunnel decompression. Of 422 USG studies of the wrist performed at our center over the last 5 years, 14 were for failed carpal tunnel decompression. Scarring was noted in three patients, incomplete decompression in two patients, synovitis in one patient, and an anomalous muscle belly in one patient. No abnormality was detected in seven patients. We present a pictorial review of USG findings in failed carpal tunnel decompression.

  15. Saúde oral: um desafio para a equipe de saúde

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Oliveira Gomes

    2001-03-01

    Full Text Available Esta pesquisa teve como objetivo desvelar o conhecimento dos formandos dos cursos de Enfermagem e Medicina de uma Universidade do Rio Grande do Sul acerca da promoção da Saúde Oral. Participaram do estudo 58 acadêmicos, sendo 26 do Curso de Enfermagem e 32 do Curso de Medicina, estes responderam a um questionário com três perguntas semi-estruturadas. Através da triangulação constatamos que esse conhecimento entre os formandos dos referidos cursos é deficitário. Sabemos que é grande a dificuldade de acesso da população infantil carente aos gabinetes dentários, por esse motivo, acreditamos ser indispensável que os profissionais de Enfermagem e Medicina tenham conhecimentos referentes à promoção de saúde oral em crianças.

  16. Rheumatoid arthritis specific anti-Sa antibodies target citrullinated vimentin

    NARCIS (Netherlands)

    Vossenaar, E.R.; Despres, N.; Lapointe, E.; Heijden, A.G. van der; Lora, M.; Senshu, T.; Venrooij, W.J.W. van; Menard, H.A.

    2004-01-01

    Antibodies directed to the Sa antigen are highly specific for rheumatoid arthritis ( RA) and can be detected in approximately 40% of RA sera. The antigen, a doublet of protein bands of about 50 kDa, is present in placenta and in RA synovial tissue. Although it has been stated that the Sa antigen is

  17. Projetos PET-Saúde e Educando para a Saúde: construindo saberes e práticas

    Directory of Open Access Journals (Sweden)

    Pâmela Leites de Souza

    Full Text Available Buscando alcançar ações intersetoriais efetivas e inovadoras, o projeto Educando para a Saúde, vem envolvendo as escolas, academia e serviços de saúde locais no desafio de construir uma sólida relação entre saúde-escola. O presente relato de experiência socializa a trajetória do projeto Educando para a Saúde, uma parceria entre a Equipe de Saúde da Família (ESF de um bairro de Pelotas - RS, a comunidade docente de duas escolas do território e acadêmicos do Programa de Educação pelo Trabalho para a Saúde - PET-Saúde. O objetivo é refletir o papel da ESF e dos acadêmicos do Projeto PET-Saúde na integração saúde-educação. Os temas discutidos são relacionados à educação em sexualidade, direitos sexuais e reprodutivos com ênfase nas DSTs e métodos contraceptivos, prevenção, promoção e recuperação da saúde. A participação do acadêmico nas atividades de integração saúde-educação veio a acrescentar ideias, valores e conceitos, possibilitando a (reconstrução das relações interpessoais, promovendo a reciclagem do processo de trabalho. Pelos laços multiprofissionais e interdisciplinares, essa parceria consiste em aprendizado mútuo, cujos frutos refletem diretamente na melhoria da assistência prestada à comunidade.

  18. Gasto privado com saúde por classes de renda

    Directory of Open Access Journals (Sweden)

    KILSZTAJN SAMUEL

    2002-01-01

    Full Text Available OBJETIVO: O artigo analisa a participação do gasto privado com saúde das famílias no PIB e no total da renda familiar per capita e a distribuição do gasto privado com saúde das famílias por classes de renda. MÉTODOS: A pesquisa utilizou os microdados da Pesquisa Nacional por Amostra de Domicílios de 1998, com a divisão da população em quatro classes de renda familiar per capita e a distribuição dos gastos em planos de saúde, consultas médicas, consultas com outros profissionais de saúde, exames, medicamentos, artigos ortopédicos e aparelhos médicos, óculos e lentes, odontologia, hospitais, enfermagem domiciliar e outros gastos com saúde. RESULTADOS: Apenas 7,2% da população com renda familiar per capita até 1 salário mínimo em 1998 tinha direito a algum plano de saúde, e o gasto privado com saúde das famílias desta classe, que representava 52,5% da população, era em média de R$ 5,36 por pessoa. Para as pessoas com renda familiar per capita acima de 9 salários mínimos, os planos de saúde atingiam 83,2% da população e o gasto privado com saúde das famílias R$ 133,04. CONCLUSÕES: A implantação do Sistema Único de Saúde foi acompanhada pelo crescimento expressivo dos planos de saúde nos anos 90. Mesmo se todo o gasto público com saúde fosse destinado à população sem planos de saúde, ainda assim o gasto destas pessoas em 1998 só alcançaria R$ 352,62, ou seja, 43% do gasto com saúde das pessoas com planos, R$ 819,08.

  19. High rate of virological re-suppression among patients failing ...

    African Journals Online (AJOL)

    [9] In Khayelitsha, where routine viral load (VL) testing is available, targeted genotyping .... plans made were noted in the patient's folder .... n=1. Fig. 2. Flow diagram of outcomes of patients failing second-line antiretroviral therapy enrolled in a.

  20. Heterotopic Pregnancy in a Natural Conception Following Failed ...

    African Journals Online (AJOL)

    2011-02-23

    Feb 23, 2011 ... Heterotopic Pregnancy in a Natural Conception Following Failed. Contraceptive Practice ... her husband vehemently rejected surgical treatment of the ectopic pregnancy ... He also posited that her doctor only referred her for.

  1. Failing The Final Exam In Equal Employment And Opportunity

    Directory of Open Access Journals (Sweden)

    Greg Tower

    2011-07-01

    Full Text Available Anglo-American educational global leaders are failing the final exam for overall transparency of EEO activities with over 90% non-disclosure.  Australian entities should be modeled as important communication exemplars.

  2. Saúde mental e trabalho: os problemas que persistem

    Directory of Open Access Journals (Sweden)

    Leny Sato

    Full Text Available Este artigo toma por objeto a Saúde Mental e Trabalho como uma subárea do campo da Saúde do Trabalhador. Parte da constatação de que os problemas de saúde mental e trabalho, já identificados em meados da década de 1980, persistem. Após retomar a taxonomia de tais problemas, busca evidenciar algumas de suas expressões atuais a partir da assistência e da vigilância em saúde do trabalhador, bem como pela perspectiva de alguns sindicatos mais atentos à questão. Para tal, toma como ponto de partida o Centro de Referência em Saúde do Trabalhador (CRST de Campinas. Por fim, pontua algumas características do trabalho no contexto atual para compreender as motivações dessa persistência.

  3. Failing the market, failing deliberative democracy: How scaling up corporate carbon reporting proliferates information asymmetries

    Directory of Open Access Journals (Sweden)

    Ingmar Lippert

    2016-10-01

    Full Text Available Corporate carbon footprint data has become ubiquitous. This data is also highly promissory. But as this paper argues, such data fails both consumers and citizens. The governance of climate change seemingly requires a strong foundation of data on emission sources. Economists approach climate change as a market failure, where the optimisation of the atmosphere is to be evidence based and data driven. Citizens or consumers, state or private agents of control, all require deep access to information to judge emission realities. Whether we are interested in state-led or in neoliberal ‘solutions’ for either democratic participatory decision-making or for preventing market failure, companies’ emissions need to be known. This paper draws on 20 months of ethnographic fieldwork in a Fortune 50 company’s environmental accounting unit to show how carbon reporting interferes with information symmetry requirements, which further troubles possibilities for contesting data. A material-semiotic analysis of the data practices and infrastructures employed in the context of corporate emissions disclosure details the situated political economies of data labour along the data processing chain. The explicit consideration of how information asymmetries are socially and computationally shaped, how contexts are shifted and how data is systematically straightened out informs a reflexive engagement with Big Data. The paper argues that attempts to automatise environmental accounting’s veracity management by means of computing metadata or to ensure that data quality meets requirements through third-party control are not satisfactory. The crossover of Big Data with corporate environmental governance does not promise to trouble the political economy that hitherto sustained unsustainability.

  4. Failing the market, failing deliberative democracy: How scaling up corporate carbon reporting proliferates information asymmetries

    Directory of Open Access Journals (Sweden)

    Ingmar Lippert

    2016-10-01

    Full Text Available Corporate carbon footprint data has become ubiquitous. This data is also highly promissory. But as this paper argues, such data fails both consumers and citizens. The governance of climate change seemingly requires a strong foundation of data on emission sources. Economists approach climate change as a market failure, where the optimisation of the atmosphere is to be evidence based and data driven. Citizens or consumers, state or private agents of control, all require deep access to information to judge emission realities. Whether we are interested in state-led or in neoliberal ‘solutions’ for either democratic participatory decision-making or for preventing market failure, companies’ emissions need to be known. This paper draws on 20 months of ethnographic fieldwork in a Fortune 50 company’s environmental accounting unit to show how carbon reporting interferes with information symmetry requirements, which further troubles possibilities for contesting data. A material-semiotic analysis of the data practices and infrastructures employed in the context of corporate emissions disclosure details the situated political economies of data labour along the data processing chain. The explicit consideration of how information asymmetries are socially and computationally shaped, how contexts are shifted and how data is systematically straightened out informs a reflexive engagement with Big Data. The paper argues that attempts to automatise environmental accounting’s veracity management by means of computing metadata or to ensure that data quality meets requirements through third-party control are not satisfactory. The crossover of Big Data with corporate environmental governance does not promise to trouble the political economy that hitherto sustained unsustainability.

  5. US Intervention in Failed States: Bad Assumptions=Poor Outcomes

    Science.gov (United States)

    2002-01-01

    NATIONAL DEFENSE UNIVERSITY NATIONAL WAR COLLEGE STRATEGIC LOGIC ESSAY US INTERVENTION IN FAILED STATES: BAD ASSUMPTIONS = POOR ...2002 2. REPORT TYPE 3. DATES COVERED 00-00-2002 to 00-00-2002 4. TITLE AND SUBTITLE US Intervention in Failed States: Bad Assumptions= Poor ...country remains in the grip of poverty , natural disasters, and stagnation. Rwanda Rwanda, another small African country, is populated principally

  6. The Failed State and the State of Failure

    Directory of Open Access Journals (Sweden)

    Peter Hitchcock

    2008-01-01

    Full Text Available What does Marx have to say about the “failed state”? Less than one might think. Peter Hitchcock seizes on the problem of the organic composition of capital to bring theories of state sovereignty and its dissolution into chiastic relation with Marxist political economy. This flexibly-bound double of Marxism and failed-state theory then offers a new perspective on our current moment and its possible futures.

  7. Em busca de uma Teologia Pública da Saúde

    Directory of Open Access Journals (Sweden)

    Alex Villas Boas

    2016-03-01

    Full Text Available A proposta de uma teologia pública da saúde visa o diálogo entre antropologia teológica e antropologias médicas e da saúde de modo a ampliar a percepção da saúde, não somente como fato, mas como valor. Mesmo um Estado Laico, suas tradições religiosas possuem hermenêuticas de saúde, ao interpretar a doença e a morte com razões religiosas distintas, ora conflitantes, ora cooperativas com as ciências da saúde. Ampliar essas hermenêuticas religiosas compondo a sabedoria de vida presente nas expressões religiosas e o conhecimento científico da área de saúde visa uma cooperação para interesses de bem comum da sociedade civil, como é a questão da saúde. Para essa reflexão, a escola de Cós combina a sabedoria mítica asclepíade e a ciência jônia. Os mitos de saúde nomeados no juramento hipocrático pertencem à tradição da teologia poética grega e indica uma espécie de credo no qual a medicina hipocrática professa, no qual o médico além de profissional também possui fé na vida e exerce o ofício de sacerdote da esperança. Interessa ainda o modo como o a teologia da saúde grega foi recebida pela teologia cristã, e como ambas desconstruíram suas teodiceias. Nessa recepção há um caminho para pensar uma teologia pública da saúde. 

  8. [Predictors of failed trial of labor in obese nulliparous].

    Science.gov (United States)

    Carassou-Maillan, A; Mulliez, A; Curinier, S; Houlle, C; Canis, M; Lemery, D; Gallot, D

    2014-11-01

    To identify predictors of failed trial of labour (TOL) in obese nulliparous at term. Retrospective study about 213 nulliparous with a body mass index (BMI) greater than 30kg/m(2) who delivered a vertex singleton after 37 weeks of gestation (WG). Planned caesarean sections were excluded. Maternal, sonographic, per-partum and neonatal characteristics were analyzed according to the mode of entry into labor and delivery route. Univariate and multivariate logistic regression analysis were performed. The cesarean delivery rate was 28%. Induction of labor (aOR=4.3 [1.8-10.7]), prolonged pregnancy (aOR=10.8 [1.7-67.6]), macrosomia (aOR=5.6 [1.1-27.3]), meconium-stained amniotic fluid (aOR: 2.57 [1.03-6.42]), use of trinitrine (aOR=5.5 [1.39-21.6]) and neonatal head circumference greater than 35cm (aOR=3.1 [1.2-8.0]) were predictors of failed TOL. There was no significant correlation between failed TOL and preconceptional BMI. Univariate analysis revealed an association between excessive weight gain and failed TOL. Predictors of failed TOL are the same in obese and non-obese women. Preconceptional BMI does not predict failed TOL in this nulliparous obese population. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  9. On SA, CA, and GA numbers

    CERN Document Server

    Caveney, Geoffrey; Sondow, Jonathan

    2011-01-01

    Gronwall's function $G$ is defined for $n>1$ by $G(n)=\\frac{\\sigma(n)}{n \\log\\log n}$ where $\\sigma(n)$ is the sum of the divisors of $n$. We call an integer $N>1$ a \\emph{GA1 number} if $N$ is composite and $G(N) \\ge G(N/p)$ for all prime factors $p$ of $N$. We say that $N$ is a \\emph{GA2 number} if $G(N) \\ge G(aN)$ for all multiples $aN$ of $N$. In arXiv 1110.5078, we used Robin's and Gronwall's theorems on $G$ to prove that the Riemann Hypothesis (RH) is true if and only if 4 is the only number that is both GA1 and GA2. Here, we study GA1 numbers and GA2 numbers separately. We compare them with superabundant (SA) and colossally abundant (CA) numbers (first studied by Ramanujan). We give algorithms for computing GA1 numbers; the smallest one with more than two prime factors is 183783600, while the smallest odd one is 1058462574572984015114271643676625. We find nineteen GA2 numbers $\\le 5040$, and prove that a GA2 number $N>5040$ exists if and only if RH is false, in which case $N$ is even and $>10^{8576}$.

  10. Triagem em saúde mental infantil

    Directory of Open Access Journals (Sweden)

    Fabiana Vieira Gauy

    Full Text Available Este estudo foi conduzido para comparar os resultados de um procedimento grupal aberto e um procedimento individual estruturado para avaliação do comportamento da criança conforme o relato materno. Participaram deste estudo 29 mães que buscavam atendimento para seus filhos em uma unidade de saúde mental infanto-juvenil. As primeiras 15 mães que procuraram o serviço foram entrevistadas individualmente conforme um roteiro estruturado desenvolvido a partir do CBCL e depois foram entrevistadas em grupo, em formato aberto. As outras 14 mães participaram da entrevista grupal aberta e em seguida participaram da entrevista individual estruturada. Os resultados das entrevistas foram comparados tomando como referência as 67 categorias comportamentais identificadas a partir do roteiro individual e quatro variáveis contextuais relatadas nos dois procedimentos. Os resultados mostram que um número substancialmente maior de comportamentos-problema foi identificado através de entrevista individual estruturada do que através de entrevista grupal aberta realizada com os mesmos informantes. É possível que o uso de um roteiro estruturado em entrevistas grupais possa oferecer mais informações com otimização do tempo de avaliação.

  11. Marimuthu Munien V BMW Financial Services (SA (PTY LTD Unreported

    Directory of Open Access Journals (Sweden)

    C van Heerden

    2009-12-01

    Full Text Available Section 129(1(a read with section 130(1 and 130(3 of the National Credit Act 34 of 2005 (the NCA provides that, as a required procedure before debt enforcement, a credit provider must draw the default to the consumer's notice in writing and propose that the consumer refer the credit agreement to a debt counsellor, alternative dispute resolution agent, consumer court or ombud with jurisdiction, with the intent that the parties resolve any dispute under the agreement or develop and agree on a plan to bring the payments under the agreement up to date. Even though section 129(1(a is silent as to the method by which the default should be brought to the consumer's notice, section 130(1(a provides clarity by requiring the section 129(1(a notice to be delivered. It appears that a credit provider who fails to comply with the provisions of section 129(1(a prior to debt enforcement by means of litigation will be in a procedural predicament as the credit provider will not possess a complete cause of action thus, for instance, rendering the summons excipiable. The crucial question thus appears to be whether or not in a given situation one may say that there was proper compliance with section 129(1(a as this directly affects the existence or absence of a complete and proper cause of action. A number of factors has to be considered in order to address this question, the most important being if the section 129(1(a notice was duly 'delivered'. In this regard two questions are especially relevant:a When exactly can it be said that a section 129(1(a notice was 'delivered' for purposes of the NCA?b Is it necessary for such notice to be received by the consumer in order to constitute proper compliance with the delivery requirement pertaining to section 129(1(a?The above questions were decided on in a recent judgment, Marimuthu Munien v BMW Financial Services (SA (Pty Ltd Case no 16103/08 (KZD (unreported. This article will analyse section 129(1(a of the NCA by inter

  12. Saúde e meio ambiente nas cidades: os desafios da saúde ambiental

    Directory of Open Access Journals (Sweden)

    Nelson Gouveia

    1999-02-01

    Full Text Available Dentro de alguns poucos anos, nosso planeta contará com mais habitantes em áreas urbanas do que em áreas rurais. A urbanização desenfreada, sem mecanismos regulatórios e de controle, típica dos países periféricos, trouxe consigo enormes repercussões na saúde da população. Problemas como a insuficiência dos serviços básicos de saneamento, coleta e destinação adequada do lixo e condições precárias de moradia, tradicionalmente relacionados com a pobreza e o subdesenvolvimento, somam-se agora à poluição química e física do ar, da água e da terra, problemas ambientais antes considerados "modernos". Novamente, é sobre as populações mais carentes que recai a maior parte dos efeitos negativos da urbanização, gerando uma situação de extrema desigualdade e iniqüidade ambiental e em saúde. Para reverter esse quadro é preciso que haja uma reincorporação das questões do meio ambiente nas políticas de saúde, e a integração dos objetivos da saúde ambiental numa ampla estratégia de desenvolvimento sustentável. Uma abordagem mais integrada, com mecanismos intersetoriais que possibilitem um diálogo amplo entre as partes, trará enormes benefícios na conquista de melhores condições de vida nas cidades. A saúde ambiental hoje tem o desafio de promover uma melhor qualidade de vida e saúde nas cidades e a oportunidade de enfrentar o absurdo quadro de exclusão social, sob a perspectiva da eqüidade.In a matter of few years there will be more urban than rural dwellers worldwide. The rapid urbanisation lacking adequate control and regulatory mechanisms typical of developing countries, brought along huge effects to the health of the population Environmental problems traditionally related to poverty and underdevelopment such as insufficient provision of sanitation services, waste collection and disposal, and precarious housing conditions, are now added to environmental problems considered of "modern life" such as the

  13. 77 FR 49702 - Airworthiness Directives; Embraer S.A. Airplanes

    Science.gov (United States)

    2012-08-17

    ... with a failed air management system (AMS) controller card. This new AD requires replacing the AMS... Eng 1 Fail'' ``A-I Eng 2 Fail'', if the engines inlet ice protection system is not manually activated... reports of the possible loss of automatic activation of the engine inlet ice protection system. We...

  14. A saúde mental em cuidados de saúde primários

    OpenAIRE

    Santos, Ana Isabel Monteiro dos

    2009-01-01

    As perturbações psiquiátricas no contexto da Clínica Geral / Medicina Geral e Familiar constituem um tema que tem vindo a ser estudado desde a década de 1960, sendo uma matéria complexa e com múltiplas implicações. Os estudos epidemiológicos mais recentes demonstram que as perturbações psiquiátricas e os problemas de saúde mental se tornaram a principal causa de incapacidade e uma das principais causas de morbilidade nas sociedades modernas. E, para além dos indivíduos que apresentam uma ...

  15. Educação em saúde como principal alternativa para promover a saúde do idoso

    Directory of Open Access Journals (Sweden)

    Danielli Gavião Mallmann

    2015-06-01

    Full Text Available Trata-se de uma revisão integrativa que objetivou identificar as evidências científicas sobre as ações educativas em saúde voltadas à promoção da saúde do idoso. A busca dos artigos foi realizada nas bases de dados Medline, Lilacs, BDENF, CINAHL e biblioteca virtual SciELO, por meio do cruzamento dos descritores Educação em Saúde, Idoso, Envelhecimento, Saúde do Idoso, Promoção da Saúde e Qualidade de vida, incluindo-se artigos publicados no período de 2003 a 2013, nos idiomas inglês, espanhol e português, realizados com idosos. Foram selecionados oito artigos, dos quais percebeu-se a qualidade de vida e a promoção do envelhecimento saudável como fatores resultantes das estratégias de educação em saúde. As ações de educação em saúde para idosos necessitam de metodologias que atentem para a complexidade do processo de envelhecimento e relacionem os fatores que cercam o indivíduo, como as crenças, os valores, as normas e os modos de vida.

  16. A interdisciplinaridade vivenciada no PET-Saúde = The interdisciplinarity experienced in the PET- Saúde program

    Directory of Open Access Journals (Sweden)

    Assega, Mariana Lieka

    2010-01-01

    Full Text Available Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste em parte integrante e inseparável da saúde do indivíduo. A interação dos profissionais da saúde torna-se possível por meio de iniciativas como o PET-Saúde, o qual fomenta a formação profissional articulada com os profissionais da ESF, bem como, o processo de integração ensino-serviço-comunidade na perspectiva da interdisciplinaridade. Objetivo: Relatar a vivência de estudantes ao realizar uma pesquisa interdisciplinar. Descrição da experiência: Esse relato foi vivenciado no projeto PET-Saúde da Faculdade de Medicina de Marília, no sub projeto Saúde do Homem, visando construir e validar um instrumento de coleta de dados por meio da Técnica Delphi, para auxiliar a equipe de saúde detectar precocemente agravos odontológicos, visto que no Brasil, o perfil de saúde bucal, na faixa etária de 35 a 44 anos, está comprometido. Os participantes, deste estudo, são discentes de enfermagem e medicina, preceptora cirurgiã-dentista e tutora docente enfermeira. Para as atividades educacionais utilizou-se a metodologia ativa de ensino-aprendizagem. Conclusão: Os movimentos reflexivos, os espaços de diálogos propiciaram o desenvolvimento da investigação científica. Além disso, a aproximação do processo de validação pela Técnica Delphi, também permitiu ampliação do conhecimento multidisciplinar sobre saúde bucal. Esta vivência possibilitou qualificar a formação acadêmico-profissional na linha da interdisciplinaridade, sendo importante sua multiplicação para o fortalecimento da interação entre os profissionais e a articulação das ações de saúde

  17. Failed MTR Fuel Element Detect in a Sipping Tests

    Energy Technology Data Exchange (ETDEWEB)

    Zeituni, C.A.; Terremoto, L.A.A.; da Silva, J.E.R.

    2004-10-06

    This work describes sipping tests performed on Material Testing Reactor (MTR) fuel elements of the IEA-R1 research reactor, in order to find out which one failed in the core during a routine operation. Radioactive iodine isotopes {sup 131}I and {sup 133}I, employed as failure monitors, were detected in samples corresponding to the failed fuel element. The specific activity of each sample, as well as the average leaking rate, were measured for {sup 137}Cs. The nuclear fuels U{sub 3}O{sub 8} - Al dispersion and U - Al alloy were compared concerning their measured average leaking rates of {sup 137}Cs.

  18. Cumulative Production Per Township - SaMiRa

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains a selected township grid within the Sagebrush Mineral Resource Assessment project (SaMiRa) study area attributed with cumulative oil and gas...

  19. Desenvolvimento econômico, desigualdade e saúde

    Directory of Open Access Journals (Sweden)

    Pedro Reginaldo Prata

    1994-09-01

    Full Text Available O autor se refere a dimensão socioeconômica, individual e coletiva do fenômeno saúde-doença. Refere-se também ao fato das populações estarem sobre a influência desigual de fatores de risco e de proteção à saúde. Discute as desigualdades no desenvolvimento e a relação entre desenvolvimento, riqueza, saúde e justiça social. Questiona as teorias de desenvolvimento econômico, diferenciando desenvolvimento de crescimento. Cunha os conceitos de armadilha do desenvolvimento e refugiados sociais. Define uma comunidade saudável. Propõe a necessidade de mudança no modelo de desenvolvimento. Baliza o papel e as limitações do setor saúde no que diz respeito a iniqüidade social.

  20. Discussion of CoSA: Clustering of Sparse Approximations

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, Derek Elswick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-07

    The purpose of this talk is to discuss the possible applications of CoSA (Clustering of Sparse Approximations) to the exploitation of HSI (HyperSpectral Imagery) data. CoSA is presented by Moody et al. in the Journal of Applied Remote Sensing (“Land cover classification in multispectral imagery using clustering of sparse approximations over learned feature dictionaries”, Vol. 8, 2014) and is based on machine learning techniques.

  1. Desigualdade social e saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Neri Marcelo

    2002-01-01

    Full Text Available Esse artigo estuda a relação entre desigualdade social e saúde no Brasil. A estratégia usada foi avaliar as necessidades e o consumo dos serviços de saúde, bem como o acesso a seguro saúde ao longo da distribuição de renda. Adicionalmente, por meio da estimação de uma regressão logística, foram avaliados outros determinantes do consumo dos serviços de saúde, com o intuito de se conhecer aonde e quem utiliza esses serviços no país. Os dados foram extraídos da Pesquisas Nacional de Amostra por Domicilio da Fundação Instituto Brasileiro de Geografia e Estatística levada a campo em 1998. Em geral, observou-se que os indivíduos nos primeiros décimos da distribuição de renda têm pior acesso a seguro saúde, necessitam de maiores cuidados médicos, mas consomem menos os serviços de saúde. As outras características extra rendimento indicam que os principais determinantes para o consumo dos serviços de saúde estariam fortemente associados aos grupos sociais mais privilegiados (de maior escolaridade, acesso a seguro saúde, água, esgoto, luz, coleta de lixo e a fatores que apontam para capacidade de geração de oferta desses serviços no país.

  2. Review of underground salt attenuation measurements for SalSA

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy, E-mail: connolly@mps.ohio-state.edu [1040 Physics Research Building, 191 West Woodruff Avenue, Columbus, OH 43210-1117 (United States)

    2012-01-11

    We report on the status of the Salt Sensor Array (SalSA), a proposed experiment for detecting ultra-high energy neutrinos through the radio Cherenkov technique with an array of radio-microwave antennas embedded in a large, naturally occurring salt formation. We review the measurements to date aimed at assessing SalSA's feasibility, including a return visit of the Hockley Salt Mine in Hockley, Texas, and discuss the current status of the project.

  3. Apoio social e saúde entre idosos

    Directory of Open Access Journals (Sweden)

    Ramos Marília P.

    2002-01-01

    Full Text Available O presente artigo trata da relação entre a saúde dos idosos e relacionamentos sociais, bem como na interpretação e entendimento desta problemática sob a luz de dois enfoques teóricos: um macro, centrado na Teoria da Integração Social de Emile Durkheim e outro micro, centrado na Teoria das Trocas, de Peter Blau, com ênfase na Teoria da Eqüidade. A integração social (freqüência de contatos pode ter efeitos negativos na saúde, mas isto tem de ser medido pela qualidade dos contatos. Algumas conclusões apresentadas indicam que as relações sociais têm um efeito na saúde, no sentido de que as pessoas, nas sociedades modernas, esperam a reciprocidade, e, quando isto não é possível, principalmente na fase do envelhecimento, as pessoas sentem-se dependentes, e isso pode afetar a saúde de diferentes maneiras. Por outro lado, quando as pessoas têm problemas de saúde, elas experienciam uma falta de relações sociais balanceadas devido à incapacidade para trocar em bases iguais. Sendo assim, conclui-se que a relação entre relações sociais e saúde na população idosa pode ser uma relação recíproca.

  4. Ballooning osteolysis in 71 failed total ankle arthroplasties.

    Science.gov (United States)

    Singh, Gurpal; Reichard, Theresa; Hameister, Rita; Awiszus, Friedemann; Schenk, Katja; Feuerstein, Bernd; Roessner, Albert; Lohmann, Christoph

    2016-08-01

    Background and purpose - Aseptic loosening is a major cause of failure in total ankle arthroplasty (TAA). In contrast to other total joint replacements, large periarticular cysts (ballooning osteolysis) have frequently been observed in this context. We investigated periprosthetic tissue responses in failed TAA, and performed an element analysis of retrieved tissues in failed TAA. Patients and methods - The study cohort consisted of 71 patients undergoing revision surgery for failed TAA, all with hydroxyapatite-coated implants. In addition, 5 patients undergoing primary TAA served as a control group. Radiologically, patients were classified into those with ballooning osteolysis and those without, according to defined criteria. Histomorphometric, immunohistochemical, and elemental analysis of tissues was performed. Von Kossa staining and digital microscopy was performed on all tissue samples. Results - Patients without ballooning osteolysis showed a generally higher expression of lymphocytes, and CD3+, CD11c+, CD20+, and CD68+ cells in a perivascular distribution, compared to diffuse expression. The odds of having ballooning osteolysis was 300 times higher in patients with calcium content >0.5 mg/g in periprosthetic tissue than in patients with calcium content ≤0.5 mg/g (p < 0.001). Interpretation - There have been very few studies investigating the pathomechanisms of failed TAA and the cause-effect nature of ballooning osteolysis in this context. Our data suggest that the hydroxyapatite coating of the implant may be a contributory factor.

  5. Failing Boys! Beyond Crisis, Moral Panic and Limiting Stereotypes

    Science.gov (United States)

    Martino, Wayne

    2011-01-01

    For some time now, school boards, Ministries of Education, and the popular media have been expressing concerns about failing boys and how best to meet their needs, framing these concerns in terms of a crisis in which boys are the "new disadvantaged". This perspective does not provide an accurate representation of the problem and, in fact, detracts…

  6. The Failing Heart Relies on Ketone Bodies as a Fuel.

    Science.gov (United States)

    Aubert, Gregory; Martin, Ola J; Horton, Julie L; Lai, Ling; Vega, Rick B; Leone, Teresa C; Koves, Timothy; Gardell, Stephen J; Krüger, Marcus; Hoppel, Charles L; Lewandowski, E Douglas; Crawford, Peter A; Muoio, Deborah M; Kelly, Daniel P

    2016-02-23

    Significant evidence indicates that the failing heart is energy starved. During the development of heart failure, the capacity of the heart to utilize fatty acids, the chief fuel, is diminished. Identification of alternate pathways for myocardial fuel oxidation could unveil novel strategies to treat heart failure. Quantitative mitochondrial proteomics was used to identify energy metabolic derangements that occur during the development of cardiac hypertrophy and heart failure in well-defined mouse models. As expected, the amounts of proteins involved in fatty acid utilization were downregulated in myocardial samples from the failing heart. Conversely, expression of β-hydroxybutyrate dehydrogenase 1, a key enzyme in the ketone oxidation pathway, was increased in the heart failure samples. Studies of relative oxidation in an isolated heart preparation using ex vivo nuclear magnetic resonance combined with targeted quantitative myocardial metabolomic profiling using mass spectrometry revealed that the hypertrophied and failing heart shifts to oxidizing ketone bodies as a fuel source in the context of reduced capacity to oxidize fatty acids. Distinct myocardial metabolomic signatures of ketone oxidation were identified. These results indicate that the hypertrophied and failing heart shifts to ketone bodies as a significant fuel source for oxidative ATP production. Specific metabolite biosignatures of in vivo cardiac ketone utilization were identified. Future studies aimed at determining whether this fuel shift is adaptive or maladaptive could unveil new therapeutic strategies for heart failure. © 2016 American Heart Association, Inc.

  7. The ugly twins: Failed global sourcing projects and their substitutes

    NARCIS (Netherlands)

    Schiele, Holger; Horn, Philipp; Horn, Philipp; Werner, Welf

    2010-01-01

    Purpose of the paper and literature addressed: Analyzing the impact of failed global sourcing projects on the entire commodity group and exploring isomorphism as potential antecedent to the observed phenomenon. The paper is embedded in the global sourcing literature, as well as isomorphism and total

  8. Civil Liability for Failing to Report Child Abuse.

    Science.gov (United States)

    Lehto, Neil J.

    1977-01-01

    The article examines the Landeros decision (which ruled that a doctor who fails to report a child abuse victim can be held liable for subsequent injuries inflicted on the child) and discusses three theories of proving civil liability for the failure to report child abuse victims. Addressed are the following topics: the problem of child abuse and…

  9. Why Young People Fail To Get and Hold Jobs.

    Science.gov (United States)

    New York State Dept. of Labor, Albany.

    This booklet provides advice to young people seeking their first jobs on how to avoid the pitfalls that have caused others to lose jobs or fail to be hired. Topics discussed in short, one-page sections include appearance, attitude and behavior, ignorance of labor market facts, misrepresentation, sensitivity about a physical defect, unrealistic…

  10. Preventing Suicide: A Mission Too Big to Fail

    Science.gov (United States)

    2013-03-01

    Preventing Suicide: A Mission Too Big to Fail by Ms. Gloria Duck Lieutenant Colonel Timothy Holman Ms. Jennifer Jessup...Lieutenant Colonel Timothy Holman United States Army Ms. Jennifer Jessup Department of Veterans Affairs Civilian Colonel Keith...Gloria Duck Department of the Army Civilian Lieutenant Colonel Timothy Holman United States Army Ms. Jennifer Jessup Department of Veterans Affairs

  11. Super-Earths as Failed Cores in Orbital Migration Traps

    Science.gov (United States)

    Hasegawa, Yasuhiro

    2016-11-01

    I explore whether close-in super-Earths were formed as rocky bodies that failed to grow fast enough to become the cores of gas giants before the natal protostellar disk dispersed. I model the failed cores’ inward orbital migration in the low-mass or type I regime to stopping points at distances where the tidal interaction with the protostellar disk applies zero net torque. The three kinds of migration traps considered are those due to the dead zone's outer edge, the ice line, and the transition from accretion to starlight as the disk's main heat source. As the disk disperses, the traps move toward final positions near or just outside 1 au. Planets at this location exceeding about 3 M ⊕ open a gap, decouple from their host traps, and migrate inward in the high-mass or type II regime to reach the vicinity of the star. I synthesize the population of planets that formed in this scenario, finding that a fraction of the observed super-Earths could have been failed cores. Most super-Earths that formed this way have more than 4 M ⊕, so their orbits when the disks dispersed were governed by type II migration. These planets have solid cores surrounded by gaseous envelopes. Their subsequent photoevaporative mass loss is most effective for masses originally below about 6 M ⊕. The failed core scenario suggests a division of the observed super-Earth mass-radius diagram into five zones according to the inferred formation history.

  12. Establishing Pass/Fail Criteria for Bronchoscopy Performance

    DEFF Research Database (Denmark)

    Konge, Lars; Clementsen, Paul; Larsen, Klaus Richter;

    2012-01-01

    Background: Several tools have been created to assess competence in bronchoscopy. However, educational guidelines still use an arbitrary number of performed procedures to decide when basic competency is acquired. Objectives: The purpose of this study was to define pass/fail scores for two...

  13. Finite element analysis of bone loss around failing implants

    NARCIS (Netherlands)

    Wolff, J.; Narra, N.; Antalainen, A.K.; Valášek, J.; Kaiser, J.; Sandór, G.K.; Marcián, P.

    2014-01-01

    Dental implants induce diverse forces on their surrounding bone. However, when excessive unphysiological forces are applied, resorption of the neighbouring bone may occur. The aim of this study was to assess possible causes of bone loss around failing dental implants using finite element analysis. A

  14. Evidence of a "Failing Newspaper" under the Newspaper Preservation Act.

    Science.gov (United States)

    Picard, Robert G.

    The Newspaper Preservation Act of 1970 makes it possible for competing newspapers to combine advertising, production, circulation and management functions into a single newspaper corporation. For the attorney general and the courts to authorize a joint operating agreement (JOA) for a "failing newspaper," certain conditions must be met and certain…

  15. "Badminton Player-Coach" Interactions between Failing Students

    Science.gov (United States)

    Mascret, Nicolas

    2011-01-01

    Background: Physical education teachers often use the player-coach dyad in individual opposition sports so that students can obtain information on their actions and then better regulate them. This type of work also develops methodological and social skills. However, the task of observing a partner often poses problems for failing students, who…

  16. 78 FR 54373 - Records of Failed Insured Depository Institutions

    Science.gov (United States)

    2013-09-04

    .../individual/failed/pls/ ; www.fdic.gov/regulations/compliance/manual/pdf/II-8.1.pdf . The ``reasonably... instances where the FDIC issues a final rule as defined by the APA (5 U.S.C. 551 et seq.). Because the FDIC is issuing a final rule as defined by the APA, the FDIC will file the reports required by the SBREFA...

  17. Age of failed restorations: A deceptive longevity parameter

    NARCIS (Netherlands)

    Opdam, N.J.M.; Bronkhorst, E.M.; Cenci, M.S.; Huysmans, M.C.D.N.J.M.; Wilson, N.H.F.

    2011-01-01

    There is pressing need to enhance evidence base in respect of longevity of restorations. Currently, there is lack of appreciation of differences between survival data based on the age of failed restorations as compared to gold standard Kaplan-Meier statistics. OBJECTIVES: This study was undertaken t

  18. Government failings on energy efficiency and fuel poverty

    Energy Technology Data Exchange (ETDEWEB)

    Warren, A. [Association for the Conservation of Energy (United Kingdom)

    2008-09-15

    The author delivered this year's Melchett Lecture as part of the EI's Energy in transition event in July, having been awarded the 72nd Melchett Award about the organizing for energy efficiency and the Government's current failing on fuel poverty strategy. 3 figs.

  19. "It's All Human Error!": When a School Science Experiment Fails

    Science.gov (United States)

    Viechnicki, Gail Brendel; Kuipers, Joel

    2006-01-01

    This paper traces the sophisticated negotiations to re-inscribe the authority of Nature when a school science experiment fails during the enactment of a highly rated science curriculum unit. Drawing on transcriptions from classroom videotapes, we identify and describe four primary patterns of interaction that characterize this process, arguing…

  20. Organization Theory: Bright Prospects for a Permanently Failing Field

    NARCIS (Netherlands)

    P.P.M.A.R. Heugens (Pursey)

    2008-01-01

    textabstractOrganization theory is a paradoxical field of scientific inquiry. It has struggled for more than fifty years to develop a unified theory of organizational effectiveness under girded by a coherent set of assumptions, and it has thus far failed to produce one. Yet, by other standards it is

  1. "It's All Human Error!": When a School Science Experiment Fails

    Science.gov (United States)

    Viechnicki, Gail Brendel; Kuipers, Joel

    2006-01-01

    This paper traces the sophisticated negotiations to re-inscribe the authority of Nature when a school science experiment fails during the enactment of a highly rated science curriculum unit. Drawing on transcriptions from classroom videotapes, we identify and describe four primary patterns of interaction that characterize this process, arguing…

  2. Saúde, direito à saúde e justiça sanitária

    Directory of Open Access Journals (Sweden)

    João Arriscado Nunes

    2012-10-01

    Full Text Available Propõe‑se uma abordagem preliminar dos processos heterogéneos e contingentes através dos quais se definem e constituem mutuamente a saúde e o direito à saúde. São apresentadas e discutidas duas manifestações recentes dessa dinâmica. A primeira situa‑se na linha das transformações associadas às orientações de inspiração neoliberal no campo da saúde, apontando para a passagem da saúde como direito à saúde como imperativo, centrado na responsabilização individual e na centralidade da vigilância e da prevenção. A segunda, designada justiça sanitária, é exemplificada através de situações em que cidadãos, através da acção colectiva e mobilizando os vocabulários dos direitos e da justiça, procuram o reconhecimento como portadores de uma doença, os direitos associados a essa condição e a acção pública sobre situações que afectam a sua saúde.

  3. Why Insurgents Fail: Examining Post-World War II Failed Insurgencies Utilizing the Prerequisites of Successful Insurgencies as a Framework

    Science.gov (United States)

    2007-03-01

    Baylis and Son, 1970. Geyer, Georgie A. “Why Guevara Failed: An Interview with Regis Debray.” Saturday Review. August 24, 1968. 156 Gonzalez...1949): 8-11, 34-35. Howard , Harry N. Greece and the United Nations, 1946-1949; A Summary Record. Report of the U.N. Special Committee on the

  4. Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas

    Directory of Open Access Journals (Sweden)

    F. P. A. Demeterio

    2010-06-01

    Full Text Available Maraming paraan ang pagsusuri sa problema ng pulitika sa Pilipinas.Para sa mga moralista at ideyalista, halimbawa, maaari itong tingnangamit ang perspektibo ng sistema ng pagpapahalaga (values at moralidad; para sa mga materyalista naman, maaari din itong himayin gamit ang perspektibo ng pagka-di-pantay-pantay ng kayamanan at kapangyarihan(unequal wealth and power ng ating mga mamamayan; o hindi kaya para sa mga eksperto sa sistema at istraktura, maaari din itong dalumatin gamit ang perspektibo ng ating marupok na burukrasya. Susubukan ng papel na ito na pag-aralan ang paksa sa pamamagitan ng pagsusuri sa konsepto ng pamumuno na hinihiling ng ating demokratikong sistema at sa kaparehong konseptong umiiiral naman sa kamalayan ng ating mga kababayan. Gagamitin ng pagsusuring ito, bilang teoretikal na balangkas, ang isang uri ng antropolohikalna teorya at pamamaraan na kilala bilang “kognitibong antropolohiya”(cognitive anthropology.

  5. MimoSA: a system for minimotif annotation

    Directory of Open Access Journals (Sweden)

    Kundeti Vamsi

    2010-06-01

    Full Text Available Abstract Background Minimotifs are short peptide sequences within one protein, which are recognized by other proteins or molecules. While there are now several minimotif databases, they are incomplete. There are reports of many minimotifs in the primary literature, which have yet to be annotated, while entirely novel minimotifs continue to be published on a weekly basis. Our recently proposed function and sequence syntax for minimotifs enables us to build a general tool that will facilitate structured annotation and management of minimotif data from the biomedical literature. Results We have built the MimoSA application for minimotif annotation. The application supports management of the Minimotif Miner database, literature tracking, and annotation of new minimotifs. MimoSA enables the visualization, organization, selection and editing functions of minimotifs and their attributes in the MnM database. For the literature components, Mimosa provides paper status tracking and scoring of papers for annotation through a freely available machine learning approach, which is based on word correlation. The paper scoring algorithm is also available as a separate program, TextMine. Form-driven annotation of minimotif attributes enables entry of new minimotifs into the MnM database. Several supporting features increase the efficiency of annotation. The layered architecture of MimoSA allows for extensibility by separating the functions of paper scoring, minimotif visualization, and database management. MimoSA is readily adaptable to other annotation efforts that manually curate literature into a MySQL database. Conclusions MimoSA is an extensible application that facilitates minimotif annotation and integrates with the Minimotif Miner database. We have built MimoSA as an application that integrates dynamic abstract scoring with a high performance relational model of minimotif syntax. MimoSA's TextMine, an efficient paper-scoring algorithm, can be used to

  6. Looked-but-failed-to-see-errors in traffic

    DEFF Research Database (Denmark)

    Herslund, Mai-Britt; Jørgensen, N O

    2003-01-01

    until immediately before the collision even though the bicycle must have been clearly visible.Similar types of accidents have been the subject of studies elsewhere. In literature they are labelled "looked-but-failed-to-see", because it seems clear that in many cases the car drivers have actually been......Danish studies of traffic accidents at priority intersections have shown a particular type of accidents. In these accidents a car driver supposed to give way has collided with a bicycle rider on the priority road. Often the involved car drivers have maintained that they did not see the bicycle...... looking in the direction where the other parties were but have not seen (i.e. perceived the presence of) the other road user. This paper describes two studies approaching this problem.One study is based on 10 self-reported near accidents. It does show that "looked-but-failed-to-see" events do occur...

  7. A survey of failed post-retained restorations

    DEFF Research Database (Denmark)

    Peutzfeldt, A; Sahafi, A; Asmussen, E

    2008-01-01

    Survival of endodontically treated, post-restored teeth depends on a multitude of factors, all of which are practically impossible to include in a randomized, controlled clinical study. The purpose of this survey was to characterize and analyze reported failures of post-retained restorations...... to identify factors critical to failure and to type of failure. A questionnaire was mailed to private practitioners in Denmark with a request to complete the questionnaire whenever a patient presented with a failed post-retained restoration. Information was gathered on factors related to the patient...... increased with the functioning time until failure. Fracture of the post was more common among male than female patients. On the basis of this survey of failed post-retained restorations, it was concluded that tapered posts were associated with a higher risk of tooth fracture than were parallel-sided posts....

  8. Failed total carpometacarpal joint prosthesis of the thumb

    DEFF Research Database (Denmark)

    Hansen, Torben Bæk; Homilius, Morten

    2010-01-01

    . The male:female ratio was 1:4 and the mean duration of observation 32 months (range 6-52). In three patients the revised implant was a MOJE uncemented carpometacarpal joint prosthesis and in seven patients an Elektra uncemented one. At follow-up grip strength was reduced to less than 90% of the other hand...... in eight of 10 patients, but the mean Disabilities of the arm, shoulder, and hand (DASH) scores, self-reported pinch-grip-related function, and pain were comparable with our earlier published results with the Elektra carpometacarpal total joint prosthesis.......Total joint prosthesis in carpometacarpal joint arthritis of the thumb often fails. Loosening of the implant is often treated by resection arthroplasty, and we reviewed 10 patients, mean age 54 years (range 47-63) who were treated by resection arthroplasty after a failed total joint prosthesis...

  9. Etiology, Diagnosis, and Management of Failed SLAP Repair.

    Science.gov (United States)

    Werner, Brian C; Brockmeier, Stephen F; Miller, Mark D

    2014-09-01

    In general, favorable outcomes have been achieved with arthroscopic repair of superior labral anterior-posterior (SLAP) tears. However, some patients remain dissatisfied or suffer further injury after SLAP repair and may seek additional treatment to alleviate their symptoms. The cause of persistent pain or recurrent symptoms after repair is likely multifactorial; therefore, careful preoperative workup is required to elucidate the cause of pain. Review of the details of previous surgical procedures is crucial because certain fixation methods are prone to failure or can cause additional injury. Failed SLAP repair can be managed with nonsurgical or surgical options. Nonsurgical modalities include physical therapy and strengthening programs, anti-inflammatory agents, and activity modification. Surgical options include revision SLAP repair and biceps tenotomy or tenodesis with or without revision SLAP repair. Outcomes after surgical management of failed SLAP repair are inferior to those of primary repair. Select patients may be better served by primary biceps tenodesis rather than SLAP repair.

  10. Counterterrorism in African Failed States: Challenges and Potential Solutions

    Science.gov (United States)

    2006-04-01

    observed in these three failed states were able to operate without attracting the attention or effective sanction of the United States or its allies...anecdotal rather than quantitative in methology .14 Sageman’s two-celled terrorist model discriminates between “hubs” and “nodes” in describing the... observing “its lack of a functioning central government” and “the absence of functioning police, immigration, customs, and intelligence agencies

  11. Why Do Insurance-Linked Exchange-Traded Derivatives Fail?

    OpenAIRE

    Sylvie Bouriaux; Michael J. Tomas III

    2014-01-01

    This paper analyzes the reasons why exchange-traded insurance-linked derivatives like catastrophe insurance futures and options have failed to attract interest from financial market participants. There are various risk components embedded in exchange-traded catastrophe insurance derivatives—namely, basis risk, liquidity risk, and development risk—which may limit their appeal to the hedging and investing communities. Our analysis suggests that the choice of an industry loss index as a trigger ...

  12. Medical Support to Failed States: Start with the Prisons

    Science.gov (United States)

    2011-03-11

    population can be significant. In Russia overcrowded prisons have bred new drug-resistant strains of tuberculosis that have proliferated virulently...among the general public.26 Similarly in the early 1990‟s the Los Angeles Jail experienced an outbreak of cerebral meningitis that spread to the local...community.27 In the Failed States of Africa, the spread of drug resistant Tuberculosis and HIV in the prisons now pose a grave threat to the region

  13. Late sodium current in failing heart: friend or foe?

    Science.gov (United States)

    Maltsev, Victor A; Undrovinas, Albertas

    2008-01-01

    Most cardiac Na+ channels open transiently upon membrane depolarization and then are quickly inactivated. However, some channels remain active, carrying the so-called persistent or late Na+ current (INaL) throughout the action potential (AP) plateau. Experimental data and the results of numerical modeling accumulated over the past decade show the emerging importance of this late current component for the function of both normal and failing myocardium. INaL is produced by special gating modes of the cardiac-specific Na+ channel isoform. Heart failure (HF) slows channel gating and increases INaL, but HF-specific Na+ channel isoform underlying these changes has not been found. Na+ channels represent a multi-protein complex and its activity is determined not only by the pore-forming alpha subunit but also by its auxiliary beta subunits, cytoskeleton, calmodulin, regulatory kinases and phosphatases, and trafficking proteins. Disruption of the integrity of this protein complex may lead to alterations of INaL in pathological conditions. Increased INaL and the corresponding Na+ flux in failing myocardium contribute to abnormal repolarization and an increased cell Ca2+ load. Interventions designed to correct INaL rescue normal repolarization and improve Ca2+ handling and contractility of the failing cardiomyocytes. This review considers (1) quantitative integration of INaL into the established electrophysiological and Ca2+ regulatory mechanisms in normal and failing cardiomyocytes and (2) a new therapeutic strategy utilizing a selective inhibition of INaL to target both arrhythmias and impaired contractility in HF.

  14. Paying for innovation. Failed strategies add to hospitals' reimbursement losses.

    Science.gov (United States)

    Pallarito, K

    Hospitals across the country are struggling to balance revenue shortfalls and cost increases as the lid on government and private-payer payments closes tighter. They're also grappling with losses on failed physician and HMO investments, the expense of new medical technologies and larger-than-planned costs related to "millennium bug" cures. This is the second part of a two-part series on financial turmoil in healthcare.

  15. Reorganized PKA-AKAP associations in the failing human heart.

    Science.gov (United States)

    Aye, Thin-Thin; Soni, Siddarth; van Veen, Toon A B; van der Heyden, Marcel A G; Cappadona, Salvatore; Varro, Andras; de Weger, Roel A; de Jonge, Nicolaas; Vos, Marc A; Heck, Albert J R; Scholten, Arjen

    2012-02-01

    Here we reveal that the characterization of large-scale re-arrangements of signaling scaffolds induced by heart failure can serve as a novel concept to identify more specific therapeutic targets. In the mammalian heart, the cAMP pathway, with the cAMP-dependent protein kinase (PKA) in a central role, acts directly downstream of adrenergic receptors to mediate cardiac contractility and rhythm. Heart failure, characterized by severe alterations in adrenergic stimulation is, amongst other interventions, often treated with β-blockers. Contrasting results, however, have shown both beneficial and detrimental effects of decreased cAMP levels in failing hearts. We hypothesize that the origin of this behavior lies in the complex spatiotemporal organization of the regulatory subunit of PKA (PKA-R), which associates tightly with various A-kinase anchoring proteins (AKAPs) to specifically localize PKA's activity. Using chemical proteomics directly applied to human patient and control heart tissue we demonstrate that the association profile of PKA-R with several AKAPs is severely altered in the failing heart, for instance effecting the interaction between PKA and the novel AKAP SPHKAP was 6-fold upregulated upon failing heart conditions. Also a significant increase in captured cGMP-dependent protein kinase (PKG) and phosphodiesterase 2 (PDE2) was observed. The observed altered profiles can already explain many aspects of the aberrant cAMP-response in the failing human heart, validating that this dataset may provide a resource for several novel, more specific, treatment options. This article is part of a Special Issue entitled "Local Signaling in Myocytes".

  16. Fail-safe designs for large capacity battery systems

    Science.gov (United States)

    Kim, Gi-Heon; Smith, Kandler; Ireland, John; Pesaran, Ahmad A.; Neubauer, Jeremy

    2016-05-17

    Fail-safe systems and design methodologies for large capacity battery systems are disclosed. The disclosed systems and methodologies serve to locate a faulty cell in a large capacity battery, such as a cell having an internal short circuit, determine whether the fault is evolving, and electrically isolate the faulty cell from the rest of the battery, preventing further electrical energy from feeding into the fault.

  17. Organizational crisis management - crisis communication when IT fails

    OpenAIRE

    Glad, Jutta

    2009-01-01

    HELSINKI SCHOOL OF ECONOMICS ABSTRACT International Business, Master’s Thesis Jutta Glad 08.05.2009 ORGANIZATIONAL CRISIS MANAGEMENT – CRISIS COMMUNICATION WHEN INFORMATION TECHNOLOGY FAILS Objectives of the thesis The objective of this study is to find out what different factors an organization should consider when responding to an organizational crisis that has been caused by an information technology failure. The study also tries to find out whether crisis communicat...

  18. Why Not Let IT Fail? The IT Project Success Paradox

    OpenAIRE

    Ambrose, Paul,; Munro, David

    2013-01-01

    Part 7: Shorter Papers; International audience; Is a focus on information systems or information technology success a myopic view of evaluating IT success and failure? Are success and failure the opposite ends of a continuum for evaluating IT projects? Conventional measures of success such as meeting cost, time, budgets, and user needs do not address positives that can emerge from failures. We contend that a focus on success and failing to factor the possibility of failure actually hamper IT ...

  19. Study on characteristics of base isolation system with fail-safe devices. ; Fundamental dynamic characteristic of fail-safe devices. Menshin sochi no fail-safe kiko ni kansuru kenkyu. ; Fail-safe sochi no kihon dotokusei

    Energy Technology Data Exchange (ETDEWEB)

    Teramura, A.; Nakamura, T.; Suzuki, T.; Nohata, A.; Tsunoda, T.; Okada, H.; Yasui, Y. (Obayashi, Corp., Tokyo (Japan))

    1990-08-10

    This study describes fail-safe mechanisms to be built in the laminated rubber base isolation devices for the purpose of developing a base isolation system necessary for the application to nuclear fuel facilities. There are two types of fail-safe devices developed in the fundamental study; a landing type on which the bottom of the building is supported and a stopper type for restricting excessive development. The basic characteristics of these devices were investigated through static and dynamic fundamental tests and input of earthquake force on a shaking table. As a result of these tests and analyses, it was proved that the whole restoring force characteristics of the two types of fail-safe devices were almost the same as expected, and their earthquake response characteristics met the initially designed performance. Moreover, it was shown that they prevent buckling of rubber bearings under input of excessive earthquake forces and consequently enhance safety of superstructures of the buildings. 4 refs., 19 figs., 1 tab.

  20. Failed magnetic resonance imaging examinations due to claustrophobia

    Energy Technology Data Exchange (ETDEWEB)

    Sarji, S.A.; Abdullah, B.J.J.; Kumar, G.; Tan, A.H.; Narayanan, P. [University of malaya Centre, Kuala Lumpar (Malaysia). Department of Radiology

    1998-11-01

    A recognised cause of incomplete or cancelled MRI examinations is anxiety and claustrophobic symptoms in patients undergoing MR scanning. This appears to be a problem in many MRI centres in Western Europe and North America, where it is said to be costly in terms of loss of valuable scan time, and has led to researchers suggesting several anxiety reducing approaches for MRI. To determine the incidence of failed MRI examination among our patients and if there are any associations with a patient`s sex, age and education level, we studied claustrophobia that led to premature termination of the MRI examination in the University Malaya Medical Centre (UMMC) in 3324 patients over 28 months. The incidence of failed MRI examinations due to claustrophobia in the UMMC was found to be only 0.54%. There are associations between claustrophobia in MRI with the patients` sex, age and level of education. The majority of those affected were male patients and young patients in the 25-45-year age group. The patients` education level appears to be the strongest association with failed MRI examinations due to claustrophobia, where the majority of the affected were highly educated individuals. Claustrophobia in MRI is more of a problem among the educated individuals or patients from a higher socio-economic group, which may explain the higher incidence in Western European and North American patients. Copyright (1998) Blackwell Science Pty Ltd 9 refs.

  1. Palmitoylethanolamide in the Treatment of Failed Back Surgery Syndrome

    Directory of Open Access Journals (Sweden)

    Antonella Paladini

    2017-01-01

    Full Text Available Introduction. This observational study was designed to evaluate the efficacy of ultramicronized palmitoylethanolamide (um-PEA (Normast® administration, as add-on therapy for chronic pain, in the management of pain-resistant patients affected by failed back surgery syndrome. Methods. A total of 35 patients were treated with tapentadol (TPD and pregabalin (PGB. One month after the start of standard treatment, um-PEA was added for the next two months. Pain was evaluated by the Visual Analogue Scale (VAS at the time of enrollment (T0 and after one (T1, two (T2, and three (T3 months. Results. After the first month with TDP + PGB treatment only, VAS score decreased significantly from 5.7±0.12 at the time of enrollment (T0 to 4.3 ± 0.11 (T1 (p<0.0001; however, it failed to provide significant subjective improvement in pain symptoms. Addition of um-PEA led to a further and significant decrease in pain intensity, reaching VAS scores of 2.7 ± 0.09 (T2 and 1.7 ± 0.11 (T3, end of treatment (p<0.0001 without showing any side effects. Conclusions. This observational study provides evidence, albeit preliminary, for the efficacy and safety of um-PEA (Normast as part of a multimodal therapeutic regimen in the treatment of pain-resistant patients suffering from failed back surgery syndrome.

  2. Super-Earths as Failed Cores in Orbital Migration Traps

    CERN Document Server

    Hasegawa, Yasuhiro

    2016-01-01

    We explore whether close-in super-Earths were formed as rocky bodies that failed to grow fast enough to become the cores of gas giants before the natal protostellar disk dispersed. We model the failed cores' inward orbital migration in the low-mass or type I regime, to stopping points at distances where the tidal interaction with the protostellar disk applies zero net torque. The three kinds of migration traps considered are those due to the dead zone's outer edge, the ice line, and the transition from accretion to starlight as the disk's main heat source. As the disk disperses, the traps move toward final positions near or just outside 1~au. Planets at this location exceeding about 3~M$_\\oplus$ open a gap, decouple from their host trap, and migrate inward in the high-mass or type II regime to reach the vicinity of the star. We synthesize the population of planets formed in this scenario, finding that some fraction of the observed super-Earths can be failed cores. Most super-Earths formed this way have more t...

  3. Evidence of structural remodeling in the dyssynchronous failing heart.

    Science.gov (United States)

    Helm, Patrick A; Younes, Laurent; Beg, Mirza F; Ennis, Daniel B; Leclercq, Christophe; Faris, Owen P; McVeigh, Elliot; Kass, David; Miller, Michael I; Winslow, Raimond L

    2006-01-01

    Ventricular remodeling of both geometry and fiber structure is a prominent feature of several cardiac pathologies. Advances in MRI and analytical methods now make it possible to measure changes of cardiac geometry, fiber, and sheet orientation at high spatial resolution. In this report, we use diffusion tensor imaging to measure the geometry, fiber, and sheet architecture of eight normal and five dyssynchronous failing canine hearts, which were explanted and fixed in an unloaded state. We apply novel computational methods to identify statistically significant changes of cardiac anatomic structure in the failing and control heart populations. The results demonstrate significant regional differences in geometric remodeling in the dyssynchronous failing heart versus control. Ventricular chamber dilatation and reduction in wall thickness in septal and some posterior and anterior regions are observed. Primary fiber orientation showed no significant change. However, this result coupled with the local wall thinning in the septum implies an altered transmural fiber gradient. Further, we observe that orientation of laminar sheets become more vertical in the early-activated septum, with no significant change of sheet orientation in the late-activated lateral wall. Measured changes in both fiber gradient and sheet structure will affect both the heterogeneity of passive myocardial properties as well as electrical activation of the ventricles.

  4. Tungo sa Hardin ng Tao: “Si Bonifacio ang pinakauna, hindi lamang sa Pilipinas, kundi sa buong Indonesia, oo, sa buong Asia na nanggaling sa, at edukado bilang, proletaryado, na nag-organisa ng mga proletaryo.” ni Tan Malaka

    Directory of Open Access Journals (Sweden)

    Ramon Guillermo

    2013-06-01

    Full Text Available Salin ito ng sanaysay na “Ke Taman Manusia” (sinulat taong 1943 nakathang-isip ng Indones na lider komunista na si Tan Malaka o Ibrahimgelar Datuk Tan Malaka (1897-1949 hinggil sa isang “Taman Manusia”o “Hardin ng Tao” na itatayo ng darating na Republika ng Indonesia sahinaharap. Dahil sa futuristiko nitong perspektiba, maihahalintuladang obrang ito ni Tan Malaka sa sanaysay ni Jose Rizal na “Filipinasdentro de cien años” (Ang Pilipinas sa loob ng isang dantaon (1891.Galing ito sa napakalaking akdang pilosopikal ni Tan Malaka napinamagatang Madilog: Materialisme, Dialektika, Logika (1948(Larawan 1 at tila tumatayo bilang pansarang mga repleksyon nito(Magnis-Suseno, 2005, pp. 205-233. Ang akdang ito ay unanginilathala noong 1951 ng Terbitan Widjaya sa Jakarta.

  5. SA8000标准的来历

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    社会道德责任标准Social Accoutability 8000或简称SA8000。自1997年问世以来,受到了公众极大的关注,在美欧工商界引起了强烈反响。专家们认为,SA8000是ISO9000、ISO14000之后出现的又一个重要的国际性标准,并迟早会转化为ISO标准;通过SA8000认证将成为国际市场竞争中的又一重要武器。有远见的组织家应未

  6. Efficacy of repeated 5-fluorouracil needling for failing and failed filtering surgeries based on simple gonioscopic examination

    Directory of Open Access Journals (Sweden)

    Rashad MA

    2012-12-01

    Full Text Available Mohammad A RashadOphthalmology Department, Faculty of Medicine, Ain Shams University, Cairo, EgyptPurpose: To evaluate the success rate of a modified bleb needling technique in eyes with previous glaucoma surgery that had elevated intraocular pressure.Methods: A retrospective study of 24 eyes of 24 patients that underwent repeated bleb needling performed for failing and failed blebs on slit lamp with 5-fluorouracil (5-FU injections on demand. This was performed after gonioscopic examination to define levels of filtration block.Results: There was significant reduction of mean IOP from 36.91 mmHg to 14.73 mmHg at the final follow-up (P < 0.001. The overall success rate was 92%.Conclusion: Repeated needling with adjunctive 5-FU proved a highly effective, safe alternative to revive filtration surgery rather than another medication or surgery.Keywords: bleb, failure, 5-FU, needling, gonioscopy

  7. PET-Saúde: micropolítica, formação e o trabalho em saúde

    Directory of Open Access Journals (Sweden)

    Kathleen Tereza da Cruz

    2015-12-01

    Full Text Available O presente artigo analisa os efeitos que podem ser coletados das múltiplas experiências cotidianas vivenciadas pelos tutores/as, preceptores/as e alunos/as participantes do Programa de Educação pelo Trabalho para Saúde (PET-Saúde quando se trata de utilizá-las para se pensarem transformações na micropolítica da formação universitária e no trabalho em saúde. Tem como eixo uma pergunta: O Programa Pet-Saúde, nos seus processos cotidianos, é capaz de produzir efeitos que alargam a matriz de formação que tem como característica principal os processos de ensignação? Mais do que polarizar entre o sim e o não, temos como objetivo colocar em discussão as apostas na formação e atuação do campo da produção do cuidado em saúde, tentando pensar o que têm sido esses campos no âmbito da educação brasileira, e como é possível re-inventar processos de formação que tomam muito mais as desaprendizagens e as potencialidades dos diferentes atores envolvidos.

  8. Sindicalismo, SUS e planos de saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    Full Text Available Este artigo discute a interlocução do sindicalismo brasileiro com o Sistema Único de Saúde (SUS e os planos e seguros privados de saúde. São ponderadas algumas teses na Saúde Coletiva à luz de estudos mais recentes nas Ciências Sociais sobre o sindicalismo e realizada análise documental para o caso da Central Única dos Trabalhadores (CUT, tomado aqui como referência. Aponta-se a necessidade de considerar os pesos relativos que a ação sindical atribuiu a cada um dos aspectos da relação, SUS e planos privados de saúde, pelas distintas conjunturas do país. O conflito entre trabalhadores e empresas somado ao desemprego e à precarização do trabalho expõe os limites das coberturas assistenciais privadas e impele a representação sindical a pleitear a intervenção estatal. O trabalho refletiu sobre as distintas modalidades de ação sindical na empresa e no Estado. A complexidade dessa dinâmica fez emergir um setor sindical interessado na gestão da previdência complementar e dos planos de saúde e, ao mesmo tempo, recria as circunstâncias e traz novas possibilidades de as organizações sindicais se colocarem na cena política e aglutinar os interesses de amplos segmentos dos trabalhadores para pressionar o Estado na defesa da melhoria do sistema público de saúde.

  9. Innovative drugs to treat depression: did animal models fail to be predictive or did clinical trials fail to detect effects?

    Science.gov (United States)

    Belzung, Catherine

    2014-04-01

    Over recent decades, encouraging preclinical evidence using rodent models pointed to innovative pharmacological targets to treat major depressive disorder. However, subsequent clinical trials have failed to show convincing results. Two explanations for these rather disappointing results can be put forward, either animal models of psychiatric disorders have failed to predict the clinical effectiveness of treatments or clinical trials have failed to detect the effects of these new drugs. A careful analysis of the literature reveals that both statements are true. Indeed, in some cases, clinical efficacy has been predicted on the basis of inappropriate animal models, although the contrary is also true, as some clinical trials have not targeted the appropriate dose or clinical population. On the one hand, refinement of animal models requires using species that have better homological validity, designing models that rely on experimental manipulations inducing pathological features, and trying to model subtypes of depression. On the other hand, clinical research should consider carefully the results from preclinical studies, in order to study these compounds at the correct dose, in the appropriate psychiatric nosological entity or symptomatology, in relevant subpopulations of patients characterized by specific biomarkers. To achieve these goals, translational research has to strengthen the dialogue between basic and clinical science.

  10. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  11. FaSa: A Fast and Stable Quadratic Placement Algorithm

    Institute of Scientific and Technical Information of China (English)

    HOU WenTing(侯文婷); HONG XianLong(洪先龙); WU WeiMin(吴为民); CAI YiCi(蔡懿慈)

    2003-01-01

    Placement is a critical step in VLSI design because it dominates overall speed andquality of design flow. In this paper, a new fast and stable placement algorithm called FaSa is pro-posed. It uses quadratic programming model and Lagrange multiplier method to solve placementproblems. And an incremental LU factorization method is used to solve equations for speeding up.The experimental results show that FaSa is very stable, much faster than previous algorithms andits total wire length is comparable with other algorithms.

  12. SaRDIn - A Safe Reconfigurable Distributed Interlocking

    DEFF Research Database (Denmark)

    Fantechi, A.; Gnesi, S.; Haxthausen, Anne Elisabeth;

    2016-01-01

    Current computer-based interlocking systems most often have a centralized design, with all logic residing in a single computer. Centralized interlockings are complex to design. Following the general trend in Cyber-Physical Systems, the SaRDIn (Safe Reconfigurable Distributed Interlockings) concept...... promises a radically simpler solution. The novelty of the SaRDIn concept is a fine-grained distribution of the logic over all processors deployed at the sensors and actuators along the track layout, i.e. within the track circuits, point machines, signals, etc. The advantages and drawbacks...

  13. For-LySa: UML for Authentication Analysis

    DEFF Research Database (Denmark)

    Buchholtz, Mikael; Montangero, Carlo; Perrone, Lara;

    2005-01-01

    The DEGAS project aims at enriching standard UML-centred development environments in such a way that the developers of global applications can exploit automated formal analyses with minimal overhead. In this paper, we present For-LySa, an instantiation of the DEGAS approach for authentication...... analysis, which exploits an existing analysis tool developed for the process calculus LySa. We discuss what information is needed for the analysis, and how to build the UML model of an authentication protocol in such a way that the needed information can be extracted from the model. We then present our...

  14. Total hip arthroplasty following failed fixation of proximal hip fractures

    Directory of Open Access Journals (Sweden)

    Srivastav Shekhar

    2008-01-01

    Full Text Available Background: Most proximal femoral fractures are successfully treated with internal fixation but a failed surgery can be very distressing for the patient due to pain and disability. For the treating surgeon it can be a challenge to perform salvage operations. The purpose of this study was to evaluate the short-term functional outcome and complications of total hip arthroplasty (THA following failed fixation of proximal hip fracture. Materials and Methods: In a retrospective study, 21 hips in 20 patients (13 females and seven males with complications of operated hip fractures as indicated by either established nonunion or fracture collapse with hardware failure were analysed. Mean age of the patients was 62 years (range 38 years to 85 years. Nine patients were treated for femoral neck fracture, 10 for intertrochanteric (I/T fracture and two for subtrochanteric (S/T fracture of the hip. Uncemented THA was done in 11 cases, cemented THA in eight hip joints and hybrid THA in two patients. Results: The average duration of follow-up was four years (2-13 years. The mean duration of surgery was 125 min and blood loss was 1300 ml. There were three dislocations postoperatively. Two were managed conservatively and one was operated. There was one superficial infection and one deep infection. Only one patient required a walker while four required walking stick for ambulation. The mean Harris Hip score increased from 32 preoperatively to 79 postoperatively at one year interval. Conclusion: Total hip arthroplasty is an effective salvage procedure after failed osteosynthesis of hip fractures. Most patients have good pain relief and functional improvements inspite of technical difficulties and high complication rates than primary arthroplasty.

  15. Ressignificando Promoção de Saúde em Grupos para Profissionais da Saúde

    Directory of Open Access Journals (Sweden)

    Siegrid Kurzawa Zwiener dos Santos

    Full Text Available RESUMO Diferenças entre os conceitos de promoção e prevenção não estão claras para parte dos profissionais de saúde, incluindo médicos e estudantes de Medicina. Este trabalho objetivou problematizar o conceito de grupos de promoção de saúde para contribuir com o desenvolvimento da autonomia de profissionais de modo a avaliarem criticamente a maneira como vinham realizando educação em saúde e a refletirem sobre novas práticas. Foram realizados seis encontros no formato de círculos de cultura com profissionais da Estratégia Saúde da Família (ESF. Após esse trabalho, o grupo compreendeu a diferença entre promoção e prevenção. Promoção foi entendida como abordagem de condições de vida, cidadania, moradia, dinâmica familiar, como um processo que capacita para enfrentamentos, desenvolvimento do afeto, da discussão, do ouvir, do aceitar, do opinar e do oferecer. Os profissionais concluíram que é necessário desenvolver a autonomia dos grupos e indivíduos, ouvir a comunidade para compreender suas necessidades, resgatar o saber que a população possui e ver a saúde como um todo. Fatores biológicos foram relacionados à prevenção, e os sociais e psicológicos à promoção. O grupo é um instrumento importante para a promoção de saúde e deve ter uma metodologia problematizadora.

  16. Fail-safe neutron shutter used for thermal neutron radiography

    Energy Technology Data Exchange (ETDEWEB)

    Sachs, R.D.; Morris, R.A.

    1976-11-01

    A fail-safe, reliable, easy-to-use neutron shutter was designed, built, and put into operation at the Omega West Reactor, Los Alamos Scientific Laboratory. The neutron shutter will be used primarily to perform thermal neutron radiography, but is also available for a highly collimated source of thermal neutrons (neutron flux = 3.876 x 10/sup 6/ (neutrons)/(cm/sup 2/.s)). Neutron collimator sizes of either 10.16 by 10.16 cm or 10.16 by 30.48 cm are available.

  17. Google+ is Google's Facebook killer doomed to fail?

    CERN Document Server

    Dino, G

    2012-01-01

    Do you have a Facebook profile? How about a Google+ page? Which do you prefer: Facebook or Google+? You may have both, but not use one as often as the other. You may have just one while waiting for the right time to join the other. The question is: When is the right time? Are you waiting to see which one is the better product? This issue has been the talk of the cybersphere since Google+ was released - will it be the Facebook killer that a number of other social media sites in the past have failed to become?

  18. A Novel Endoscopic Technique for Failed Nasogastric Tube Placement.

    Science.gov (United States)

    Boston, Andrew G

    2015-10-01

    Direct visualization of the nasopharynx gives the otolaryngologist a unique advantage for addressing difficult nasopharyngeal anatomy. One common situation is being consulted to assist when the blind placement of a nasogastric tube has failed. A novel technique for managing a patient with a nasogastric tube embedded in the adenoid remnant is described with illustrations. The atraumatic method is easily employed by a resident armed with a portable nasolaryngoscope and plain suture. By using a repeated pull-through technique, the nasogastric tube can be guided past difficult nasopharyngeal anatomy and into a position from where it can be advanced into the patient's esophagus.

  19. Surgical management of vestibular schwannomas after failed radiation treatment.

    Science.gov (United States)

    Nonaka, Yoichi; Fukushima, Takanori; Watanabe, Kentaro; Friedman, Allan H; Cunningham, Calhoun D; Zomorodi, Ali R

    2016-04-01

    Increasing numbers of patients with vestibular schwannoma (VS) have been treated with focused-beam stereotactic radiation treatment (SRT) including Gamma knife, CyberKnife, X-knife, Novalis, or proton beam therapy. The purpose of this study was to document the incidence of tumor regrowth or symptoms that worsened or first developed following SRT and to discuss surgical strategies for patients who have failed SRT for VS. A consecutive series of 39 patients with SRT failed VS were surgically treated. Clinical symptoms, tumor regrowth at follow-up, intraoperative findings, and surgical outcome were evaluated. There were 15 males and 24 females with a mean age of 51.8 years. Thirty-six patients (92.3%) demonstrated steady tumor growth after SRT. Two (5.1%) patients with slight increase of the mass underwent surgical resection because of development of unbearable facial pain. Symptoms that worsened or newly developed following SRT in this series were deafness (41%), dizziness (35.9%), facial numbness (25.6%), tinnitus (20.5%), facial nerve palsy (7.7%), and facial pain (7.7%). Intraoperative findings demonstrated fibrous changes of the tumor mass, cyst formation, and brownish-yellow or purple discoloration of the tumor capsule. Severe adhesions between the tumor capsule and cranial nerves, vessels, and the brainstem were observed in 69.2%. Additionally, the facial nerve was more fragile and irritable in all cases. Gross total resection (GTR) was achieved in 33.3% of patients, near-total resection (NTR) in 35.9%, and subtotal resection (STR) in 30.8% of patients. New facial nerve palsy was seen in seven patients (19.4%) postoperatively. Our findings suggest that patients with VS who fail SRT with either tumor progression or worsening of clinical symptoms will have an increased rate of adhesions to the neurovascular structures and may have radiation-influenced neuromalacia. Salvage surgery of radiation-failed tumors is more difficult and will have a higher risk of

  20. Has Multiculturalism Really Failed? A Canadian Muslim Perspective

    Directory of Open Access Journals (Sweden)

    Baljit Nagra

    2013-12-01

    Full Text Available In recent years, claims that multiculturalism has created segregated communities, encouraged terrorism, and failed to foster shared national identities in western nations have gained popularity. In this paper, we use young Canadian Muslims’ lived experience of multiculturalism to reflect on this debate. Contrary to popular rhetoric, our interviews of 50 young Muslim adults show that many maintain a dual Canadian-Muslim identity by utilizing the ideology of multiculturalism, even though they are increasingly stigmatized for their religion. These findings lead us to problematize the discourse surrounding the ‘failure’ of multiculturalism and to highlight the contradictions within it.

  1. A Perplexed Economist Confronts 'too Big to Fail'

    Directory of Open Access Journals (Sweden)

    Scherer, F. M.

    2010-12-01

    Full Text Available This paper examines premises and data underlying the assertion that some financial institutions in the U.S. economy were "too big to fail" and hence warranted government bailout. It traces the merger histories enhancing the dominance of six leading firms in the U. S. banking industry and he sharp increases in the concentration of financial institution assets accompanying that merger wave. Financial institution profits are found to have soared in tandem with rising concentration. The paper advances hypotheses why these phenomena might be related and surveys relevant empirical literature on the relationships between market concentration, interest rates received and charged by banks, and economies of scale in banking.

  2. Mga Kuwento-Kuwento ng Baliw: Lihis na Pagkilos sa Mga Maikling-Kuwentong Tagalog

    Directory of Open Access Journals (Sweden)

    Diana Ziganay

    1990-12-01

    Full Text Available Ang sulating ito ay nalikha upang magbigay ng isang pagsusuri at pagtatalakay sa pagbuo ng konsepto ng abnormalidad o kakaibang kilos o pananaw buhat sa mga piling uri ng panitikang Pilipinong naisulat sa wikang Ingles noong ika-1900 hanggang 1945. Pag-uukulan ng pansin dito ang panahon at kalagayang binanggit, ang mga suliraning binanggit, ang maga suliranin ng pagbuo ng panitikang Pilipino sa Ingles, at ang daloy ng kaisipan ng mga manunulat na may kaugnayan sa pag-unawa ng konsepto ng abnormalidad na sumasalamin sa ilang mga piling sulatin, tuwiran man o di tuwiran.

  3. Saúde mental nas práticas em saúde: a experiência do PROLIG

    Directory of Open Access Journals (Sweden)

    Samantha Mucci

    Full Text Available O presente trabalho apresenta o relato de experiências do Serviço de Atenção Psicossocial Integrada em Saúde (SAPIS nos Programas de Ligação (PROLIG. O SAPIS foi implantado em junho de 2002, no Hospital São Paulo (HSP, com o objetivo de promover uma atenção mais ampla às necessidades gerais e específicas do hospital no que diz respeito aos aspectos psicossociais bem como de reorganizar a inclusão de profissionais de saúde mental nas enfermarias e ambulatórios. Esse estudo tem como objetivo descrever a atuação do psicólogo como profissional de ligação em saúde mental no atendimento às demandas específicas de unidades do HSP. A tarefa do profissional de ligação em saúde mental envolve a assistência psicológica ao paciente e seu familiar assim como o desempenho do papel de especialista em saúde mental junto à equipe multiprofissional. Temos encontrado em nossa prática, no entanto, algumas dificuldades para a implementação e a manutenção de algumas propostas. Concluímos que a atuação do psicólogo como profissional de ligação de saúde mental tem promovido mudanças nos cuidados em saúde nessa instituição, porém ainda exige uma profunda reflexão e maior envolvimento da instituição e de políticas de saúde que viabilizem mudanças estruturais para a construção de uma efetiva prática integral e integrada nessa área.

  4. Programa de saúde mental Programme in mental health

    Directory of Open Access Journals (Sweden)

    Cid Guimarães

    1975-12-01

    Full Text Available É apresentado o programa de Saúde Mental decorrente de convênio estabelecido pela Secretaria da Saúde do Estado de São Paulo com a Universidade de São Paulo, através da Faculdade de Saúde Pública. Este convênio tem por finalidade a realização de estudos na área de Saúde Mental, tais como assistência psiquiátrica preventiva e pesquisas visando a medir transtornos mentais através de casos de óbito e na população da cidade e de cursos e atividades curriculares e extra-curriculares.The School of Public Health is conducting a project, sponsored by the Health Department of the State of S. Paulo Government, aiming at: studying the integration of a team of mental health workers in a polivalent community health center; carrying out two large surveys on the incidence and prevalence of mental disorders and some of their characteristics; promoting courses and seminars on Mental Health for the personnel of Community Health Centers.

  5. Fonoaudiologia em saúde pública

    Directory of Open Access Journals (Sweden)

    Regina M. Freire

    1992-06-01

    Full Text Available Objetivou-se obter o entendimento das funções do fonoaudiólogo enquanto profissional da saúde. Discutem-se as dificuldades ligadas à implantação de um serviço novo, estranho às Unidades Básicas de Saúde. A seguir, analisa-se a demanda pelo serviço de Fonoaudiologia em postos de saúde, e verifica-se que 32% da população que busca esse serviço está em idade escolar e vem encaminhada pelas escolas, com queixa de problemas de aprendizagem. Uma aproximação maior dessas crianças, através do atendimento fonoaudiológico, delineia uma outra realidade: a de que não se pode considerar como distúrbio/desvio/problema/patologia marcas gráficas que se constituem como indícios do choque entre o processo de letramento e o de alfabetização. Entendendo a problemática do ponto de vista da saúde pública, propõe-se um programa de atendimento ao professor, cujo objetivo é o esclarecimento da escola com relação ao seu papel de co-construtora do processo de letramento da criança, devolvendo-lhe a responsabilidade pelo sucesso e/ou fracasso da alfabetização.

  6. Predictors of failed enema reduction in childhood intussusception.

    Science.gov (United States)

    Fike, Frankie B; Mortellaro, Vincent E; Holcomb, George W; St Peter, Shawn D

    2012-05-01

    Initial management of intussusception is enema reduction. Data are scarce on predicting which patients are unlikely to have a successful reduction. Therefore, we reviewed our experience to identify factors predictive of enema failure. A retrospective review of all episodes of intussusception over the past 10 years was conducted. Demographics, presentation variables, colonic extent of intussusceptions, and hospital course were collected. Extent of intussusception was classified as right, transverse, descending, and rectosigmoid. Episodes were grouped as success or failure of enema reduction and compared using the Student t test for continuous variables and χ(2) test for dichotomous variables. Significance was P less than .05. We identified 405 episodes of intussusception and 371 attempts at enema reduction. There were 285 successful enema reductions. There was no difference between groups in age; sex; or the presence of emesis, fever, or abdominal mass. The failed enema group was more likely to have had symptoms over 24 hours before presentation (P = .006), bloody diarrhea (P Predictors of failed enema reduction of intussusception include presence of symptoms over 24 hours, diarrhea, lethargy, and distal extent of intussusception. Copyright © 2012 Elsevier Inc. All rights reserved.

  7. We still fail to account for Mendel's observations

    Directory of Open Access Journals (Sweden)

    Porteous John W

    2004-08-01

    Full Text Available Abstract Background The present article corrects common textbook accounts of Mendel's experiments by re-establishing what he wrote and how he accounted for his observations. It notes the long-established tests for the validity of any explanations that purport to explain observations obtained by experiment. Application of these tests to Mendel's paper shows that the arguments he used to explain his observations were internally consistent but were, on one crucial issue, implausible. The same tests are applied to the currently accepted explanation for Mendel's observations. Conclusions The currently favoured explanation for Mendel's observations is untenable. It misrepresents Mendel, fails to distinguish between the parameters and the variables of any system of interacting components, its arguments are inconsistent, it repeats the implausibility in Mendel's paper, fails to give a rational explanation for his observed 3:1 trait ratio and cannot explain why this ratio is not always observed in experimental practice. A rational explanation for Mendel's observations is initiated. Readers are challenged to complete the process before a further article appears.

  8. Adult cancer clinical trials that fail to complete: an epidemic?

    Science.gov (United States)

    Stensland, Kristian D; McBride, Russell B; Latif, Asma; Wisnivesky, Juan; Hendricks, Ryan; Roper, Nitin; Boffetta, Paolo; Hall, Simon J; Oh, William K; Galsky, Matthew D

    2014-09-01

    The number and diversity of cancer therapeutics in the pipeline has increased over the past decade due to an enhanced understanding of cancer biology and the identification of novel therapeutic targets. At the same time, the cost of bringing new drugs to market and the regulatory burdens associated with clinical drug development have progressively increased. The finite number of eligible patients and limited financial resources available to evaluate promising new therapeutics represent rate-limiting factors in the effort to translate preclinical discoveries into the next generation of standard therapeutic approaches. Optimal use of resources requires understanding and ultimately addressing inefficiencies in the cancer clinical trials system. Prior analyses have demonstrated that a large proportion of trials initiated by the National Cancer Institute (NCI) Cooperative Group system are never completed. While NCI Cooperative Group trials are important, they represent only a small proportion of all cancer clinical trials performed. Herein, we explore the problem of cancer clinical trials that fail to complete within the broader cancer clinical trials enterprise. Among 7776 phase II-III adult cancer clinical trials initiated between 2005-2011, we found a seven-year cumulative incidence of failure to complete of approximately 20% (95% confidence interval = 18% to 22%). Nearly 48000 patients were enrolled in trials that failed to complete. These trials likely contribute little to the scientific knowledge base, divert resources and patients from answering other critical questions, and represent a barrier to progress.

  9. Recapitulating maladaptive, multiscale remodeling of failing myocardium on a chip.

    Science.gov (United States)

    McCain, Megan L; Sheehy, Sean P; Grosberg, Anna; Goss, Josue A; Parker, Kevin Kit

    2013-06-11

    The lack of a robust pipeline of medical therapeutic agents for the treatment of heart disease may be partially attributed to the lack of in vitro models that recapitulate the essential structure-function relationships of healthy and diseased myocardium. We designed and built a system to mimic mechanical overload in vitro by applying cyclic stretch to engineered laminar ventricular tissue on a stretchable chip. To test our model, we quantified changes in gene expression, myocyte architecture, calcium handling, and contractile function and compared our results vs. several decades of animal studies and clinical observations. Cyclic stretch activated gene expression profiles characteristic of pathological remodeling, including decreased α- to β-myosin heavy chain ratios, and induced maladaptive changes to myocyte shape and sarcomere alignment. In stretched tissues, calcium transients resembled those reported in failing myocytes and peak systolic stress was significantly reduced. Our results suggest that failing myocardium, as defined genetically, structurally, and functionally, can be replicated in an in vitro microsystem by faithfully recapitulating the structural and mechanical microenvironment of the diseased heart.

  10. KELEMBAGAAN DAN STRATEGI PENINGKATAN DAYA SAING KOMODITAS CABAI KAPUPATEN GARUT

    Directory of Open Access Journals (Sweden)

    Silmi Tsurayya

    2015-03-01

    Full Text Available The objectives of this study were to identify supply chains, analyze the institutions, formulate strategies for competitiveness enhancement, design competitiveness enhancement model, and determine the main strategies in competitiveness enhancement of chili pepper in Garut District. This study used primary data (observations, interviews, and questionnaires and secondary data (literature study. The data were processed and analyzed by Descriptive Analysis, SWOT Analysis, the House Model, and Pairwise Comparison. The results of this study showed that: 1 there were 6 supply chain structures in chili pepper distribution; 2 the major institutional sectors contributed to competitiveness enhancement of chili pepper including public sector, voluntary sector, and private sector; 3 SWOT Analysis obtained 15 alternative strategies; 4 the House Model as competitiveness enhancement model had 3 pillars consisting of products, human resource, and institutional and marketing; 5 the main strategies in competitiveness enhancement of chili pepper included Increase in the number of productions, Market expansion, and Partnership Strengthening and development. The managerial implications of the study suggest: 1 land expansion and plant arrangement pattern to ensure continuity of production quantities; 2 Optimization of the role of Agribusiness Sub-Terminal as the marketing institution; and 3 Maximization in the government’s role in facilitating farmer groups with associations or corporations.Keywords: institutional, the house model, competitiveness, chili, SWOTABSTRAKPenelitian ini bertujuan mengidentifikasi rantai pasok, menganalisis kelembagaan, merumuskan strategi peningkatan daya saing, merancang model peningkatan daya saing, dan menentukan strategi utama dalam peningkatan daya saing  komoditas cabai di Kabupaten Garut. Data yang digunakan terdiri dari data primer (observasi, wawancara, dan kuesioner dan data sekunder (studi literatur. Metode pengolahan dan

  11. WRKY Transcription Factors Involved in Activation of SA Biosynthesis Genes

    Directory of Open Access Journals (Sweden)

    Bol John F

    2011-05-01

    Full Text Available Abstract Background Increased defense against a variety of pathogens in plants is achieved through activation of a mechanism known as systemic acquired resistance (SAR. The broad-spectrum resistance brought about by SAR is mediated through salicylic acid (SA. An important step in SA biosynthesis in Arabidopsis is the conversion of chorismate to isochorismate through the action of isochorismate synthase, encoded by the ICS1 gene. Also AVRPPHB SUSCEPTIBLE 3 (PBS3 plays an important role in SA metabolism, as pbs3 mutants accumulate drastically reduced levels of SA-glucoside, a putative storage form of SA. Bioinformatics analysis previously performed by us identified WRKY28 and WRKY46 as possible regulators of ICS1 and PBS3. Results Expression studies with ICS1 promoter::β-glucuronidase (GUS genes in Arabidopsis thaliana protoplasts cotransfected with 35S::WRKY28 showed that over expression of WRKY28 resulted in a strong increase in GUS expression. Moreover, qRT-PCR analyses indicated that the endogenous ICS1 and PBS3 genes were highly expressed in protoplasts overexpressing WRKY28 or WRKY46, respectively. Electrophoretic mobility shift assays indentified potential WRKY28 binding sites in the ICS1 promoter, positioned -445 and -460 base pairs upstream of the transcription start site. Mutation of these sites in protoplast transactivation assays showed that these binding sites are functionally important for activation of the ICS1 promoter. Chromatin immunoprecipitation assays with haemagglutinin-epitope-tagged WRKY28 showed that the region of the ICS1 promoter containing the binding sites at -445 and -460 was highly enriched in the immunoprecipitated DNA. Conclusions The results obtained here confirm results from our multiple microarray co-expression analyses indicating that WRKY28 and WRKY46 are transcriptional activators of ICS1 and PBS3, respectively, and support this in silico screening as a powerful tool for identifying new components of stress

  12. Promoção da saúde, qualidade de vida e iniquidade em saúde: reflexões para a saúde pública.

    Directory of Open Access Journals (Sweden)

    Aline Rodrigues de ALMEIDA

    2016-01-01

    Full Text Available A ideia de promover saúde tem se tornado uma energia fundamental no movimento de saúde coletiva, no qual saúde é um fenômeno social e marcado por iniquidades. Este trabalho teve como objetivo compreender as relações entre promoção da saúde e iniquidades de acesso e assistência em saúde, identificandoos entraves para uma prática equânime da saúde pública com ênfase à qualidade de vida. Os diferentes perfis de doença e suas mediações sociais ultrapassam os estudos de variação biológica e incorpora o foco na dimensão social das vulnerabilidades. Para promover saúde no Brasil, é indissociável do enfrentamento de uma realidade de iniquidades históricas de grandes proporções que impõem desafios cotidianos não apenas ao setor de saúde, mas a todos aqueles que constroem políticas públicas. A qualidade de vida depende da satisfação das necessidades básicas de todos os cidadãos, propondo uma gestão baseada na solidariedade social, uma visão holística dos problemas e a redução das iniquidades. A promoção da saúde em um país tão desigual como o Brasil propõe um desafio constante aos atores envolvidos no sistema de saúde. A compreensão das iniquidades em saúde para estabelecer uma assistência holística é um processo difícil, mas extremamente relevante para a saúde pública.

  13. Sequence determinants for DNA packaging specificity in the S. aureus pathogenicity island SaPI1.

    Science.gov (United States)

    Bento, Joana C; Lane, Kristin D; Read, Erik K; Cerca, Nuno; Christie, Gail E

    2014-01-01

    The SaPIs and their relatives are a family of genomic islands that exploit helper phages for high frequency horizontal transfer. One of the mechanisms used by SaPIs to accomplish this molecular piracy is the redirection of the helper phage DNA packaging machinery. SaPIs encode a small terminase subunit that can be substituted for that of the phage. In this study we have determined the initial packaging cleavage sites for helper phage 80α, which uses the phage-encoded small terminase subunit, and for SaPI1, which uses the SaPI-encoded small terminase subunit. We have identified a 19nt SaPI1 sequence that is necessary and sufficient to allow high frequency 80α transduction of a plasmid by a terminase carrying the SaPI1-encoded small subunit. We also show that the hybrid enzyme with the SaPI1 small terminase subunit is capable of generalized transduction.

  14. Isolation of Asticcacaulis sp. SA7, a novel agar-degrading alphaproteobacterium.

    Science.gov (United States)

    Hosoda, Akifumi; Sakai, Masao

    2006-03-01

    An agar-degrading bacterium, strain SA7, was isolated from plant roots cultivated in soil. Analysis of the 16S rDNA sequence showed that strain SA7 is affiliated with the genus Asticcacaulis. Strain SA7 produced extracellular agarase, and grew utilizing agar in the culture medium as sole carbon source. Zymogram analysis showed that strain SA7 extracellularly secreted single agarase protein (about 70 kDa).

  15. [Multimodal therapy concepts for failed back surgery syndrome].

    Science.gov (United States)

    Casser, Hans-Raimund

    2016-09-01

    Failed back surgery syndrome (FBSS) is a frequent complication (15-40 %) of lumbar disc surgery and is rarely successfully treated by surgery with the exception of a re-prolapse associated with radicular pain. Multimodal pain treatment, however, is indicated by a lack of pathoanatomical correlates, unclear cause and psychosocial risk factors.This review describes a standardized non-operative treatment starting with broad interdisciplinary clarification by medical, psychological and physiotherapeutic means (assessment).If the conditions for multimodal pain therapy are met, the OPS 8‑918-procedure can be applied to avoid chronic developing pain. In doing so, the already issued quality standards and guidelines for documentation should be respected.

  16. Optimised to Fail: Card Readers for Online Banking

    Science.gov (United States)

    Drimer, Saar; Murdoch, Steven J.; Anderson, Ross

    The Chip Authentication Programme (CAP) has been introduced by banks in Europe to deal with the soaring losses due to online banking fraud. A handheld reader is used together with the customer’s debit card to generate one-time codes for both login and transaction authentication. The CAP protocol is not public, and was rolled out without any public scrutiny. We reverse engineered the UK variant of card readers and smart cards and here provide the first public description of the protocol. We found numerous weaknesses that are due to design errors such as reusing authentication tokens, overloading data semantics, and failing to ensure freshness of responses. The overall strategic error was excessive optimisation. There are also policy implications. The move from signature to PIN for authorising point-of-sale transactions shifted liability from banks to customers; CAP introduces the same problem for online banking. It may also expose customers to physical harm.

  17. Unaware person recognition from the body when face identification fails.

    Science.gov (United States)

    Rice, Allyson; Phillips, P Jonathon; Natu, Vaidehi; An, Xiaobo; O'Toole, Alice J

    2013-11-01

    How does one recognize a person when face identification fails? Here, we show that people rely on the body but are unaware of doing so. State-of-the-art face-recognition algorithms were used to select images of people with almost no useful identity information in the face. Recognition of the face alone in these cases was near chance level, but recognition of the person was accurate. Accuracy in identifying the person without the face was identical to that in identifying the whole person. Paradoxically, people reported relying heavily on facial features over noninternal face and body features in making their identity decisions. Eye movements indicated otherwise, with gaze duration and fixations shifting adaptively toward the body and away from the face when the body was a better indicator of identity than the face. This shift occurred with no cost to accuracy or response time. Human identity processing may be partially inaccessible to conscious awareness.

  18. Intended to Fail? Jatropha Development Project in Indonesia

    Directory of Open Access Journals (Sweden)

    Tristam P. Moeliono

    2016-07-01

    Full Text Available Article offers an analytical description of the legal framework of the Indonesian biofuel energy policy : commercialization of Jatropha. Its purpose is to explain why the legal framework failed. Methodology used to collect data is library research, including shifting through related legal documents. Additional information was collected through interviews with key informants. The purpose is to be able to place the relevant legal framework within a broader economic-political context. The main findings were that government intervention in the economic sector (commercialization of Jatropha, were made more in the spirit of poverty eradication programs and lessening government financial burden in providing cheap fossil fuel. Cautious approach based on economic calculations and other considerations (Jatropha not being sufficiently tested and developed as biofuel crop as advised by researchers (2006 working under the auspices of the Ministry of Agriculture were simply ignored. 

  19. Signaling pathways in failing human heart muscle cells.

    Science.gov (United States)

    Drexler, H; Hasenfuss, G; Holubarsch, C

    1997-07-01

    Experimental studies have delineated important signaling pathways in cardiomyocytes and their alterations in heart failure; however, there is now evidence that these observations are not necessarily applicable to human cardiac muscle cells. For example, angiotensin II (A II) does not exert positive inotropic effects in human ventricular muscle cells, in contrast to observation in rats. Thus, it is important to elucidate cardiac signaling pathways in humans in order to appreciate the functional role of neurohumoral or mechanical stimulation in human myocardium in health and disease. In the present article, we review signal pathways in the failing human heart based on studies in human cardiac tissues and in vivo physiological studies related to A II, nitric oxide, and β-adrenergic stimulation. (Trends Cardiovasc Med 1997; 7:151-160). © 1997, Elsevier Science Inc.

  20. The Nixon years: failed national health reform from both parties.

    Science.gov (United States)

    Goldfield, N

    1992-01-01

    In the November 1991 elections, popular support for national health reform (NHR) enabled Harry Wofford to become a U.S. Senator from Pennsylvania. Since then a bevy of congressional proposals to reform America's health care system have emerged, with even national health insurance, or a single payer system, becoming a prominent contender for the first time in 20 years. National health reform is now a regular feature on the evening news. However, this is not the first time that NHR has attracted national attention. As pointed out in the first article in this series (Physician Executive, March-April 1992, page 23), there have been numerous efforts to enact NHR in the U.S. Each has failed because of strident opposition by interest groups, lack of active presidential interest in the specific legislation, and the absence of strong popular interest.

  1. Behavior of Puerto Rican parrots during failed nesting attempts

    Science.gov (United States)

    Wilson, K.A.; Wilson, M.H.; Field, R.

    1997-01-01

    We compared patterns of nesting behavior of four pairs of Puerto Rican Parrots (Amazona vittata) that experienced failed nesting attempts to behavior of four pairs of parrots that experienced no substantial nest problems and successfully fledged young without management intervention. Only changes in female parrots' behavior were clearly associated with nest failure. During incubation, decreases in nest attendance, increases in duration of recesses, and increases in frequency of nest entries by female parrots were associated with imminent abandonment of nests. During early chick rearing, similar behavior was associated with the loss of broods. Low nest attendance and long recesses by female parrots during incubation were also associated with successful hatching of eggs followed by death of young several days later. The behavior patterns and changes in Puerto Rican Parrot nesting behavior described in this paper may alert biologists to nest problems that might be mitigated by management intervention.

  2. Why did ISO 9001:2008 system fail to deliver?

    Science.gov (United States)

    Langford, Melvyn

    2014-02-01

    This article is based on an actual investigation undertaken, and summarises the subsequent report's findings and observations. It has been anonymised for obvious reasons. In May 2013 an analysis was undertaken by a multidisciplinary team that compared an NHS Trust estates department's managerial systems against the NHS national recommendations. The conclusions stated that: 'There was a systemic failure across a large number of topics generating intolerable/substantial risks to the organisation, its staff, and patients; this despite the department's managerial systems being accredited to the International Standard ISO 9001:2008'. The natural question raised when presented with this demonstrable and auditable evidence was: 'Why did the ISO 9001:2008 system fail?'

  3. Unrecognized failed airway management using a supraglottic airway device.

    Science.gov (United States)

    Vithalani, Veer D; Vlk, Sabrina; Davis, Steven Q; Richmond, Neal J

    2017-10-01

    911 Emergency Medical Services (EMS) systems utilize supraglottic devices for either primary advanced airway management, or for airway rescue following failed attempts at direct laryngoscopy endotracheal intubation. There is, however, limited data on objective confirmation of supraglottic airway placement in the prehospital environment. Furthermore, the ability of EMS field providers to recognize a misplaced airway is unknown. Retrospective review of patients who underwent airway management using the King LTS-D supraglottic airway in a large urban EMS system, between 3/1/15-9/30/2015. Subjective success was defined as documentation of successful airway placement by the EMS provider. Objective success was confirmed by review of waveform capnography, with the presence of a 4-phase waveform greater than 5mmHg. Sensitivity and specificity of the field provider's assessment of success were then calculated. A total of 344 supraglottic airway attempts were reviewed. No patients met obvious death criteria. 269 attempts (85.1%) met criteria for both subjective and objective success. 19 attempts (5.6%) were recognized failures by the EMS provider. 47 (13.8%) airways were misplaced but unrecognized by the EMS provider. 4 attempts (1.2%) were correctly placed but misidentified as failures, leading to the unnecessary removal and replacement of the airway. Sensitivity of the provider's assessment was 98.5%; specificity was 28.7%. The use of supraglottic airway devices results in unrecognized failed placement. Appropriate utilization and review of waveform capnography may remedy a potential blind-spot in patient safety, and systemic monitoring/feedback processes may therefore be used to prevent unrecognized misplaced airways. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Open Latarjet procedure for failed arthroscopic Bankart repair.

    Science.gov (United States)

    Flinkkilä, T; Sirniö, K

    2015-02-01

    This retrospective study assessed the functional results of open Latarjet operation for recurrence of instability after arthroscopic Bankart repair in a consecutive series of patients. Fifty two patients (mean age 28.4 [range 17-62] years, 45 men) were operated on using open Latarjet operation after one (n=46) or two (n=6) failed arthroscopic Bankart repairs. The indication for revision surgery was recurrent dislocation or subluxation. Fifty patients had a Hill-Sachs lesion and 32 patients had glenoid bone lesions on plain radiographs. No attempt was made to grade the severity of bony pathology. Functional outcome and stability of 49 shoulders were assessed after an average follow-up of 38 (range 24-85) months using Western Ontario Shoulder Instability (WOSI) score, Oxford shoulder instability score, and subjective shoulder value (SSV). Forty-two patients had a stable shoulder at follow-up. Seven of 49 (14%) had symptoms of instability; one patient had recurrent dislocation, and six patients had subluxations. Mean WOSI, Oxford, and SSV scores were 83.9, 19.9, and 84.9, respectively. All scores were significantly better in patients who had a stable shoulder compared with those who had an unstable shoulder (WOSI 86.8 vs. 64.3; Oxford 18.2 vs. 30.8; and SSV 88.3 vs. 61.7; PLatarjet operation is a good option for failed arthroscopic Bankart repair. The instability recurrence rate is acceptable and the reoperation rate was low. Level IV, retrospective case series. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  5. Evaluation and Management of Failed Shoulder Instability Surgery

    Science.gov (United States)

    Cartucho, António; Moura, Nuno; Sarmento, Marco

    2017-01-01

    Background: Failed shoulder instability surgery is mostly considered to be the recurrence of shoulder dislocation but subluxation, painful or non-reliable shoulder are also reasons for patient dissatisfaction and should be considered in the notion. Methods: The authors performed a revision of the literature and online contents on evaluation and management of failed shoulder instability surgery. Results: When we look at the reasons for failure of shoulder instability surgery we point the finger at poor patient selection, technical error and an additional traumatic event. More than 80% of surgical failures, for shoulder instability, are associated with bone loss. Quantification of glenoid bone loss and investigation of an engaging Hill-Sachs lesion are determining facts. Adequate imaging studies are determinant to assess labrum and capsular lesions and to rule out associated pathology as rotator cuff tears. CT-scan is the method of choice to diagnose and quantify bone loss. Arthroscopic soft tissue procedures are indicated in patients with minimal bone loss and no contact sports. Open soft tissue procedures should be performed in patients with small bone defects, with hiperlaxity and practicing contact sports. Soft tissue techniques, as postero-inferior capsular plication and remplissage, may be used in patients with less than 25% of glenoid bone loss and Hill-Sachs lesions. Bone block procedures should be used for glenoid larger bone defects in the presence of an engaging Hill-Sachs lesion or in the presence of poor soft tissue quality. A tricortical iliac crest graft may be used as a primary procedure or as a salvage procedure after failure of a Bristow or a Latarjet procedure. Less frequently, the surgeon has to address the Hill-Sachs lesion. When a 30% loss of humeral head circumference is present a filling graft should be used. Conclusion: Reasons for failure are multifactorial. In order to address this entity, surgeons must correctly identify the causes and

  6. Microbial diversity in failed endodontic root-filled teeth

    Institute of Scientific and Technical Information of China (English)

    ZHANG Chen; HOU Ben-xiang; ZHAO Huan-ying; SUN Zheng

    2012-01-01

    Background Persistent/secondary infections of human root canals play an important role in the failure of endodontic treatment.This study used 16S rRNA sequencing to assess microbial diversity in root-filled teeth associated with failed endodontic treatment.Methods DNA was extracted from 15 teeth with persistent intraradicular infections,and the 16S rRNA of all present bacteria were amplified by PCR,followed by cloning and sequencing of the 16S rRNA amplicons.Results All sample extracts were positive for PCR amplification using the universal 16S rRNA gene primers.Negative control reactions yielded no amplicons.Sixty-five phylotypes belonging to seven phyla were identified from 760 clones; a mean of 9.4 phylotypes were detected in each sample (range 3-15).Twenty-eight phylotypes were detected in more than one sample,revealing a high inter-sample variability.Parvimonas micra (60%,9/15),Solobacterium moore (47%,7/15),Dialister invisus (33%,5/15),Enterococcus faecalis (33%,5/15),Filifactor alocis (27%,4/15),and Fusobacterium nucleatum (27%,4/15) were the prevalent species.Nineteen as-yet-uncultivated phylotypes were identified,comprising a substantial proportion of the bacteria in many cases.Conclusions Persistent intraradicular infections were present in all root-filled teeth associated with failed endodontic treatment.The current observations reveal new candidate endodontic pathogens,including as-yet-uncultivated bacteria and phylotypes that may participate in the mixed infections associated with post-treatment apical periodontitis.

  7. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco

    2012-01-01

    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  8. Por um programa preventivo em saúde mental do trabalhador na brigada militar

    Directory of Open Access Journals (Sweden)

    Fernanda Spanier Amador

    Full Text Available O presente artigo argumenta sobre a importância de políticas de Saúde e Segurança Públicas que sustentem programas voltados à saúde do trabalhador na Brigada Militar. Aborda, mais especificamente, a necessidade de ações preventivas e promotoras de saúde mental nesse âmbito.

  9. Zitkala-Sa and the Problem of Regionalism: Nations, Narratives, and Critical Traditions

    Science.gov (United States)

    Totten, Gary

    2005-01-01

    Although Yankton Sioux writer Zitkala-Sa (Gertrude Bonnin, 1876-1938) was, as P. Jane Hafen notes, "virtually unknown for many decades," much critical work has appeared since Dexter Fisher's 1979 article,"Zitkala-Sa: Evolution of a Writer." Some critics desiring to bring Zitkala-Sa into the conversation about turn-of-the-century American women…

  10. 76 FR 7511 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-02-10

    ... Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  11. Política de recursos humanos em saúde: análise de documentos oficiais do ministério da saúde

    OpenAIRE

    Luciana Pavanelli Von Gal de Almeida

    2007-01-01

    A reforma do setor saúde no Brasil levou à criação do Sistema Único de Saúde que contemplou a saúde como um direito social. Dessa forma, na atualidade, a saúde é tratada como um bem universal a ser provido para todos os cidadãos, implicando no princípio da equidade, em que cada cidadão tem direito a ações e serviços requeridos para manutenção e recuperação de sua saúde. Esse ideário tem forte implicação com os recursos humanos em saúde, em termos de definições políticas e técnicas relacionada...

  12. The interdisciplinarity experienced in the PET- Saúde program A interdisciplinaridade vivenciada no PET-Saúde

    Directory of Open Access Journals (Sweden)

    Sueli Moreira Pirolo

    2010-01-01

    Full Text Available Introduction: The incorporation of the oral health team in the Family Health Strategy (ESF, in 2000, enabled the adoption of a more active attitude of Primary Health Care in this field, in as much as oral health consists of an inseparable and integral part of the individual’s health. The interaction of health professionals becomes possible through policies like “PET-Saúde” which promotes the professional formation articulated with the ESF professionals as well as the process of integration of teaching, service and community in the perspective of interdisciplinarity. Objective: To report the experience of students during an interdisciplinary research. Description of the experience: This report was experienced in “PET-Saúde” of the Faculty of Medicine of Marília, at the “Man’s Health” subproject aiming at elaborating and validating a data collection instrument through Delphi Technique in order to help the health care team to detect early dental problems because of the damaged oral health pattern of the age group between 35 and 44 in Brazil. The members of this study are: medical and nursing students, a dentist preceptor and a nursing tutor. For the educational activities, the active methodology of teaching-learning was used. Conclusion: The reflexive actions, the moments for discussions provided the development of scientific investigation. The approximation of the process of validation through Delphi Technique also allowed the expansion of multidisciplinary knowledge on oral health. This experience made it possible to qualify the academic-professional formation on the interdisciplinary approach, and it’s important to strengthen the interaction among professionals and the articulation of health actions.Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste

  13. Quantitation of Staphylococcus aureus in seawater using CHROMagar SA.

    Science.gov (United States)

    Tice, Alan D; Pombo, David; Hui, Jennifer; Kurano, Michelle; Bankowski, Matthew J; Seifried, Steven E

    2010-01-01

    A microbiological algorithm has been developed to analyze beach water samples for the determination of viable colony forming units (CFU) of Staphylococcus aureus (S. aureus). Membrane filtration enumeration of S. aureus from recreational beach waters using the chromogenic media CHROMagar SA alone yields a positive predictive value (PPV) of 70%. Presumptive CHROMagar SA colonies were confirmed as S. aureus by 24-hour tube coagulase test. Combined, these two tests yield a PPV of 100%. This algorithm enables accurate quantitation of S. aureus in seawater in 72 hours and could support risk-prediction processes for recreational waters. A more rapid protocol, utilizing a 4-hour tube coagulase confirmatory test, enables a 48-hour turnaround time with a modest false negative rate of less than 10%.

  14. Andragogia na saúde: estudo bibliométrico

    OpenAIRE

    Draganov, Patrícia Bover [UNIFESP; Friedländer,Maria Romana; Sanna, Maria Cristina [UNIFESP

    2011-01-01

    O sucesso da aprendizagem envolve o uso de estratégias adequadas. Como a clientela de formação profissional e de educação permanente e a população assistida, para quem se dirigem as ações de educação em saúde, são majoritariamente adultas, metodologias como a Andragogia, que é a arte e ciência de conduzir adultos ao aprendizado, são uma alternativa interessante. Com o objetivo de quantificar e descrever a produção científica sobre Andragogia nas Ciências da Saúde no período de 1999 a 2009, re...

  15. Vibration analysis of the SA349/2 helicopter

    Science.gov (United States)

    Heffernan, Ruth; Precetti, Dominique; Johnson, Wayne

    1991-01-01

    Helicopter airframe vibration is examined using calculations and measurements for the SA349/2 research helicopter. The hub loads, which transmit excitations to the fuselage, are predicted using a comprehensive rotorcraft analysis and correlated with measuring hub loads. The predicted and measured hub loads are then coupled with finite element models representing the SA349/2 fuselage. The resulting vertical acceleration at the pilot seat is examined. Adjustments are made to the airframe structural models to examine the sensitivity of predicted vertical acceleration to the model. Changes of a few percent to the damping and frequency of specific models lead to large reductions in predicted vibration, and to major improvements in the correlations with measured pilot-seat vertical acceleration.

  16. Analysis and correlation of SA349/2 helicopter vibration

    Science.gov (United States)

    Heffernan, Ruth; Precetti, Dominique; Johnson, Wayne

    1991-01-01

    Helicopter airframe vibration is examined using calculation and measurements for the SA349/2 research helicopter. The hub loads, which transmit excitation to the fuselage, are predicted using a comprehensive rotorcraft analysis and correlated with measured hub loads. The predicted and measured hub loads are then coupled with finite element models representing the SA349/2 fuselage. The resulting vertical acceleration at the pilot seat is examined. Adjustments are made to the airframe structural models to examine the sensitivity of predicted vertical acceleration to the model. Changes of a few percent to the damping and frequency of specific modes lead to large reductions in predicted vibration and to major improvements in the correlations with measured pilot seat vertical acceleration.

  17. Eventos de massa, desastres e Saúde Pública

    Directory of Open Access Journals (Sweden)

    Camilla Figueiredo de Castro

    2014-09-01

    Full Text Available O Brasil tem sediado eventos de massa (EM e seus participantes estão sujeitos a riscos à saúde. Objetivou-se sistematizar as principais relações, de interesse da Saúde Pública, entre eventos de massa e ocorrência de desastres. Foram realizadas três estratégias metodológicas: revisão da literatura de EM, com busca sistemática, sistematização das principais informações sobre EM e seleção e sistematização das Referências que tratavam do tema desastre em suas palavras-chave, título ou Resumo. Foram selecionadas 28 Referências sobre EM, a maioria artigo científico, revisão de literatura, de 2012 e de natureza esportiva. Os principais assuntos abordados foram sistemas de vigilância e planejamento dos EM. Evidenciou-se a pouca informação analítica sobre os EM, bem como a importância de eventos não transmissíveis para a ocorrência de desastres, com destaque aos relacionados à multidão. O risco de desastres deve ser considerado no planejamento dos EM, para aumentar a capacidade de resposta considerando áreas estratégicas como: emergência médica, vigilância de doenças transmissíveis e vetores, segurança alimentar e dos serviços de saúde, saúde ambiental e laboratório. Ressalta-se a importância de pesquisas analíticas e de registro das experiências relacionadas aos EM, para a redução de risco de desastres.

  18. Genome sequencing and annotation of Morganella sp. SA36

    Directory of Open Access Journals (Sweden)

    Samy Selim

    2015-12-01

    Full Text Available We report draft genome sequence of Morganella sp. Strain SA36, isolated from water spring in Aljouf region, Saudi Arabia. The draft genome size is 2,564,439 bp with a G + C content of 51.1% and contains 6 rRNA sequence (single copies of 5S, 16S & 23S rRNA. The genome sequence can be accessed at DDBJ/EMBL/GenBank under the accession no. LDNQ00000000.

  19. Gripe Suína: Saúde em destaque

    Directory of Open Access Journals (Sweden)

    HELOÍZA FELTRIN BANDEIRA

    2009-05-01

    Full Text Available

    O texto tem por objetivo analisar alguns

    fatos ligados à crise mundial na saúde causada pelo

    virus da Influenza A.

  20. A narrativa nas pesquisas qualitativas em saúde

    Directory of Open Access Journals (Sweden)

    Marcelo Eduardo Pfeiffer Castellanos

    2014-04-01

    Full Text Available O forte interesse das ciências sociais e humanas em saúde nos estudos narrativos levou a várias formas de incorporação das contribuições desses estudos na pesquisa qualitativa em saúde. Torna-se importante refletir sobre os contextos e as características dessa incorporação. Para tanto, destacamos as principais questões teóricas aí envolvidas, assim como situamos essa incorporação no contexto da produção científica mais ampla das ciências sociais e humanas em saúde. Apontamos, também, a contribuição dos estudos narrativos para reflexão sobre as relações entre estrutura e ação social ou entre contextos específicos de interação social e contextos societários mais amplos. Essa contribuição pode ser identificada na análise das relações narrativamente estabelecidas entre interpretação, experiência e ação, ao longo do processo de saúde-doença-cuidado. Argumenta-se que as narrativas não somente organizam interpretações, mas também consistem em uma forma específica de agenciamento social. Nesse sentido, as interpretações narrativas e as performances narrativas podem ser vistas como elementos centrais da construção social de experiências e trajetórias de adoecimento e cuidado.

  1. Using SA508/533 for the HTGR Vessel Material

    Energy Technology Data Exchange (ETDEWEB)

    Larry Demick

    2012-06-01

    This paper examines the influence of High Temperature Gas-cooled Reactor (HTGR) module power rating and normal operating temperatures on the use of SA508/533 material for the HTGR vessel system with emphasis on the calculated times at elevated temperatures approaching or exceeding ASME Code Service Limits (Levels B&C) to which the reactor pressure vessel could be exposed during postulated pressurized and depressurized conduction cooldown events over its design lifetime.

  2. Structural analysis of the JT-60SA cryostat vessel body

    Energy Technology Data Exchange (ETDEWEB)

    Botija, José, E-mail: jose.botija@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Fernández, Pilar; Medrano, Mercedes; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico; Tomarchio, Valerio [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira; Shibama, Yusuke [JAEA – Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► Structural analysis to validate the JT-60SA cryostat vessel body design. ► Design code ASME 2007 “Boiler and Pressure Vessel Code. Section VIII”. ► First buckling mode: load multiplier of 10.644, higher than the minimum factor 4.7. ► Elastic and elastic–plastic stress analysis meets ASME against plastic collapse. ► Bolted fasteners have been analyzed showing small gaps closed by strong welding. -- Abstract: The JT-60SA cryostat is a stainless steel vacuum vessel (14 m diameter, 16 m height) which encloses the Tokamak providing the vacuum environment (10{sup −3} Pa) necessary to limit the transmission of thermal loads to the components at cryogenic temperature. It must withstand both external atmospheric pressure during normal operation and internal overpressure in case of an accident. The paper summarizes the structural analyses performed in order to validate the JT-60SA cryostat vessel body design. It comprises several analyses: a buckling analysis to demonstrate stability under the external pressure; an elastic and an elastic–plastic stress analysis according to ASME VIII rules, to evaluate resistance to plastic collapse including localized stress concentrations; and, finally, a detailed analysis with bolted fasteners in order to evaluate the behavior of the flanges, assuring the integrity of the vacuum sealing welds of the cryostat vessel body.

  3. Performance verification tests of JT-60SA CS model coil

    Energy Technology Data Exchange (ETDEWEB)

    Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Murakami, Haruyuki [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)

    2015-11-15

    Highlights: • The performance of the JT-60SA CS model coil was verified. • The CS model coil comprised a quad-pancake wound with a Nb{sub 3}Sn CIC conductor. • The CS model coil met the design requirements. - Abstract: As a final check of the coil manufacturing method of the JT-60 Super Advanced (JT-60SA) central solenoid (CS), we verified the performance of a CS model coil. The model coil comprised a quad-pancake wound with a Nb{sub 3}Sn cable-in-conduit conductor. Measurements of the critical current, joint resistance, pressure drop, and magnetic field were conducted in the verification tests. In the critical-current measurement, the critical current of the model coil coincided with the estimation derived from a strain of −0.62% for the Nb{sub 3}Sn strands. As a result, critical-current degradation caused by the coil manufacturing process was not observed. The results of the performance verification tests indicate that the model coil met the design requirements. Consequently, the manufacturing process of the JT-60SA CS was established.

  4. Cuidados paliativos: o desafio das equipes de saúde

    Directory of Open Access Journals (Sweden)

    Fernanda de Carvalho Braga

    2013-12-01

    Full Text Available O avanço tecnológico possibilitou tanto a redução da morte quanto o prolongamento da vida. Essa última traz consigo a necessidade de se pensar em como cuidar de pessoas fora de perspectiva de cura, especialmente porque tal cuidado inclui aspectos psicossociais, com implicações tanto para as relações entre os profissionais quanto com o paciente e sua família. Este estudo teve como objetivo buscar na literatura nacional artigos sobre equipes de saúde que oferecem cuidados paliativos. Realizou-se uma revisão de produção em periódicos nacionais com os descritores cuidados paliativos, equipe de saúde e neonatologia. Foram identificados 62 trabalhos, porém somente 11 atenderam ao critério de relacionar pelo menos dois descritores. Nenhum artigo relacionou as três palavras-chaves. O baixo número de publicações evidencia a necessidade de mais pesquisas nessa área, pois proporcionar qualidade de vida desde o diagnóstico da doença até o momento do óbito representa grande estresse para os profissionais de saúde.

  5. Saúde, este obscuro objeto de desejo

    Directory of Open Access Journals (Sweden)

    Fernando Lefèvre

    1997-07-01

    Full Text Available Exploram-se no presente ensaio as relações entre saúde e desejo, envolvendo um dado querer denominado "saúde" e as formas que este querer adquire no contexto do viver contemporâneo. Aponta-se ao final para uma situação radical no que toca à saúde, vítima de um processo irreversível de expansão, que acaba por inviabilizar qualquer tentativa de defini-la, levando a uma perda total de sentido, no contexto de um universo humano tentendo à completa robotização.The present essay explores the relations between health and desire involving a given yearning named "health" and the forms that such feeling acquires in the contemporaneous context of living. It ultimately points to a radical situation in terms of health, victim of a irreversible process of expansion that eventually makes any attempt of definition not viable, leading to a total loss of meaning within a human universe tending to complete robotization.

  6. O impacto da homofobia na saúde do adolescente

    Directory of Open Access Journals (Sweden)

    Taison Regis Penariol Natarelli

    2015-12-01

    Full Text Available Resumo Objetivo: Objetivou-se conhecer os tipos de violência sofrida por adolescentes homossexuais e compreender a influência da homofobia na saúde dessa população. Métodos: Foram realizadas entrevistas, em profundidade, com nove adolescentes residentes em um município do interior de São Paulo que se autodeclararam homossexuais. Resultados: Os tipos de violência sofridos e referidos pelos adolescentes foram: física, verbal, psicológica e sexual. A homofobia provoca percepções negativas sobre si mesmo e a não adoção de hábitos de vida saudáveis relacionados aos cuidados com alimentação, prática de atividades físicas, padrão de sono e ideações suicidas. Foram relatadas situações de homofobia nos serviços de saúde. Conclusão: Adolescentes homossexuais são vulneráveis a diferentes tipos de violência. A dificuldade de acesso aos serviços de saúde é um fator concorrente ao aumento da vulnerabilidade. A contribuição deste estudo reside na problematização de tópicos que podem auxiliar na construção do cuidado integral dos adolescentes homossexuais.

  7. 49 CFR 199.103 - Use of persons who fail or refuse a drug test.

    Science.gov (United States)

    2010-10-01

    ... SAFETY DRUG AND ALCOHOL TESTING Drug Testing § 199.103 Use of persons who fail or refuse a drug test. (a) An operator may not knowingly use as an employee any person who— (1) Fails a drug test required by... 49 Transportation 3 2010-10-01 2010-10-01 false Use of persons who fail or refuse a drug test. 199...

  8. 40 CFR 205.171-8 - Passing or failing under SEA.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Passing or failing under SEA. 205.171... Passing or failing under SEA. (a) A failing exhaust system is one which, when installed on any motorcycle... equal to the number in Column A, the sample passes. (c) Pass or failure of a SEA takes place when...

  9. 40 CFR 205.160-6 - Passing or failing under SEA.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Passing or failing under SEA. 205.160... failing under SEA. (a) A failing vehicle is one whose measured noise level is in excess of the applicable... vehicles is less than or equal to the number in Column A, the sample passes. (c) Pass or failure of an...

  10. FGF23 fails to inhibit uremic parathyroid glands.

    Science.gov (United States)

    Canalejo, Rocío; Canalejo, Antonio; Martinez-Moreno, Julio Manuel; Rodriguez-Ortiz, M Encarnacion; Estepa, Jose C; Mendoza, Francisco Javier; Munoz-Castaneda, Juan Rafael; Shalhoub, Victoria; Almaden, Yolanda; Rodriguez, Mariano

    2010-07-01

    Fibroblast growth factor 23 (FGF23) modulates mineral metabolism by promoting phosphaturia and decreasing the production of 1,25-dihydroxyvitamin D(3). FGF23 decreases parathyroid hormone (PTH) mRNA and secretion, but despite a marked elevation in FGF23 in uremia, PTH production increases. Here, we investigated the effect of FGF23 on parathyroid function in normal and uremic hyperplastic parathyroid glands in rats. In normal parathyroid glands, FGF23 decreased PTH production, increased expression of both the parathyroid calcium-sensing receptor and the vitamin D receptor, and reduced cell proliferation. Furthermore, FGF23 induced phosphorylation of extracellular signal-regulated kinase 1/2, which mediates the action of FGF23. In contrast, in hyperplastic parathyroid glands, FGF23 did not reduce PTH production, did not affect expression of the calcium-sensing receptor or vitamin D receptor, and did not affect cell proliferation. In addition, FGF23 failed to activate the extracellular signal-regulated kinase 1/2-mitogen-activated protein kinase pathway in hyperplastic parathyroid glands. We observed very low expression of the FGF23 receptor 1 and the co-receptor Klotho in uremic hyperplastic parathyroid glands, which may explain the lack of response to FGF23 in this tissue. In conclusion, in hyperparathyroidism secondary to renal failure, the parathyroid cells resist the inhibitory effects of FGF23, perhaps as a result of the low expression of FGF23 receptor 1 and Klotho in this condition.

  11. Experimenting `learn by doing' and `learn by failing'

    Science.gov (United States)

    Pozzi, Rossella; Noè, Carlo; Rossi, Tommaso

    2015-01-01

    According to the literature, in recent years, developing experiential learning has fulfilled the requirement of a deep understanding of lean philosophy by engineering students, demonstrating the advantages and disadvantages of some of the key principles of lean manufacturing. On the other hand, the literature evidences how some kinds of game-based experiential learning overlook daily difficulties, which play a central role in manufacturing systems. To fill the need of a game overcoming such lack of vision, an innovative game direct in-field, named Kart Factory, has been developed. Actual production shifts are simulated, while keeping all the elements peculiar to a real production set (i.e. complexity, effort, safety). The working environment is a real pedal car assembly department, the products to be assembled have relevant size and weight (i.e. up to 35 kg approximately), and the provided tools are real production equipment (e.g. keys, screwdrivers, trans-pallets, etc.). Due to the need to maximise the impact on students, a labour-intensive process characterises the production department. The whole training process is based on three educational principles: Experience Value Principle, Error Value Principle, and Team Value Principle. As the 'learn by doing' and 'learn by failing' are favoured, the theory follows the practice, while crating the willingness to 'do' instead of just designing or planning. The gathered data prove the Kart Factory's effectiveness in reaching a good knowledge of lean concepts, notwithstanding the students' initial knowledge level.

  12. Dam and spillway construction to remediate a failed reservoir rim

    Energy Technology Data Exchange (ETDEWEB)

    Kostaschuk, R.; Grover, P.; Wanner, C. [AMEC Earth and Environmental Ltd., Calgary, AB (Canada); Lockhart, S. [Priddis Greens Golf and Country Club, Priddis, AB (Canada)

    2009-07-01

    Priddis Greens Golf and Country Club (PGGCC) is located in southern Alberta, about 25 kilometres southwest of Calgary. Lake Loon reservoir supplies water for irrigation of the 36-hole golf course and also supplies water to the water treatment plant that provides potable water to the golf course and the housing development. An earthen spillway channel on the reservoir rim failed by erosion at the PGGCC during an extreme flood event in June 2005. The failure resulted in loss of the reservoir for the water supply system servicing the golf course and its housing cooperative. Design and reconstruction of the reservoir rim were undertaken and a new concrete spillway structure was built. This paper provided background information on the June 2005 failure and provided an overview of the design concept for reservoir restoration. The Alberta Environment permitting process was also outlined. Hydrology, flood management and spillway design were explained in detail. A geotechnical design of earthworks was also provided. The paper concluded with a discussion of an emergency preparedness and response plan and operation, maintenance and surveillance manual that were developed for the project. 2 refs., 20 figs.

  13. Requirements: Towards an understanding on why software projects fail

    Science.gov (United States)

    Hussain, Azham; Mkpojiogu, Emmanuel O. C.

    2016-08-01

    Requirement engineering is at the foundation of every successful software project. There are many reasons for software project failures; however, poorly engineered requirements process contributes immensely to the reason why software projects fail. Software project failure is usually costly and risky and could also be life threatening. Projects that undermine requirements engineering suffer or are likely to suffer from failures, challenges and other attending risks. The cost of project failures and overruns when estimated is very huge. Furthermore, software project failures or overruns pose a challenge in today's competitive market environment. It affects the company's image, goodwill, and revenue drive and decreases the perceived satisfaction of customers and clients. In this paper, requirements engineering was discussed. Its role in software projects success was elaborated. The place of software requirements process in relation to software project failure was explored and examined. Also, project success and failure factors were also discussed with emphasis placed on requirements factors as they play a major role in software projects' challenges, successes and failures. The paper relied on secondary data and empirical statistics to explore and examine factors responsible for the successes, challenges and failures of software projects in large, medium and small scaled software companies.

  14. Why does informed consent fail? A discourse analytic approach.

    Science.gov (United States)

    Ness, David E; Kiesling, Scott F; Lidz, Charles W

    2009-01-01

    Informed consent often fails to meet the intended goals that a prospective subject should understand fully and choose autonomously to participate in research. The current study is an attempt to understand such failures by applying linguistic methods of discourse analysis to the transcripts of informed consent interviews. Elements of conversation and of the frame of discourse were analyzed to understand how the participants shaped their spoken interaction during the interview. We looked at the degree to which the subject appeared to be fully informed, at the problem of therapeutic misconception, and at the degree to which the subject was helped to explore concerns relevant to the choice at hand. We found that lapses or miscommunications could be understood specifically in terms of conversational elements and framing. This kind of detailed, language-based analysis is an alternative to approaches that are more abstract and inferential, such as those that are based upon the attitudes or the cognitive performance of speakers. We discuss possible educational and research implications of this approach.

  15. Cluster Development Test 2: An Assessment of a Failed Test

    Science.gov (United States)

    Machin, Ricardo A.; Evans, Carol T.

    2009-01-01

    On 31 July 2008 the National Aeronautics and Space Administration Crew Exploration Vehicle Parachute Assembly System team conducted the final planned cluster test of the first generation parachute recovery system design. The two primary test objectives were to demonstrate the operation of the complete parachute system deployed from a full scale capsule simulator and to demonstrate the test technique of separating the capsule simulator from the Low Velocity Air Drop pallet used to extract the test article from a United States Air Force C-17 aircraft. The capsule simulator was the Parachute Test Vehicle with an accurate heat shield outer mold line and forward bay compartment of the Crew Exploration Vehicle Command Module. The Parachute Test Vehicle separated cleanly from the pallet following extraction, but failed to reach test conditions resulting in the failure of the test and the loss of the test assets. No personnel were injured. This paper will discuss the design of the test and the findings of the team that investigated the test, including a discussion of what were determined to be the root causes of the failure.

  16. CLINICAL EVALUATION OF FAILED ENDONASAL DCR OPERATIONS AND THEIR MANAGEMENT

    Directory of Open Access Journals (Sweden)

    Mohammed Naveed

    2014-09-01

    Full Text Available INTRODUCTION: Endoscopic Intra nasal approach to by-pass the obstruction of lacrimal apparatus is a simple and commonly practiced surgery among the ENT Surgeons. Various modifications in the form of usage of micro drill, application of Mitomycin C and preserving the nasal flap to line the opening in the sac to name a few are being used. Recurrence of epiphora and closure of the neo opening is described and observed are labeled as failed endonasal DCR. This study makes an attempt to review retrospectively and prospectively to evaluate the degree of recurrence and causes of failure. OBJECTIVE OF THE STUDY: This study also attempts to determine the causes of failure of endonasal DCR and its subsequent management. Thus this study precludes the role of revision DCR. Materials and Methods: 50 patients who underwent endonasal DCR surgery at GGH Kurnool and reported with symptoms of returning of epiphora, purulent discharge from the eye were included. A detailed history taking and endoscopic examination done to find the cause of failure. An attempt is made to classify the causes and find suitable remedy.RESULTS:36% of the patients showed tendency to form synaechiae, 18.6% of patients presented with thick lacrimal crest, 9% of them showed formation of a thin veil like membrane over the neo-ostium. All the patients were subjected to revision surgery and subjective improvement in 92% of the patients reported at the time of reporting of the study.

  17. Sparse approximation problem: how rapid simulated annealing succeeds and fails

    Science.gov (United States)

    Obuchi, Tomoyuki; Kabashima, Yoshiyuki

    2016-03-01

    Information processing techniques based on sparseness have been actively studied in several disciplines. Among them, a mathematical framework to approximately express a given dataset by a combination of a small number of basis vectors of an overcomplete basis is termed the sparse approximation. In this paper, we apply simulated annealing, a metaheuristic algorithm for general optimization problems, to sparse approximation in the situation where the given data have a planted sparse representation and noise is present. The result in the noiseless case shows that our simulated annealing works well in a reasonable parameter region: the planted solution is found fairly rapidly. This is true even in the case where a common relaxation of the sparse approximation problem, the G-relaxation, is ineffective. On the other hand, when the dimensionality of the data is close to the number of non-zero components, another metastable state emerges, and our algorithm fails to find the planted solution. This phenomenon is associated with a first-order phase transition. In the case of very strong noise, it is no longer meaningful to search for the planted solution. In this situation, our algorithm determines a solution with close-to-minimum distortion fairly quickly.

  18. Fracture surface analysis of clinically failed fixed partial dentures.

    Science.gov (United States)

    Taskonak, B; Mecholsky, J J; Anusavice, K J

    2006-03-01

    Ceramic systems have limited long-term fracture resistance, especially when they are used in posterior areas or for fixed partial dentures. The objective of this study was to determine the site of crack initiation and the causes of fracture of clinically failed ceramic fixed partial dentures. Six Empress 2 lithia-disilicate (Li(2)O x 2SiO(2))-based veneered bridges and 7 experimental lithia-disilicate-based non-veneered ceramic bridges were retrieved and analyzed. Fractography and fracture mechanics methods were used to estimate the stresses at failure in 6 bridges (50%) whose fracture initiated from the occlusal surface of the connectors. Fracture of 1 non-veneered bridge (8%) initiated within the gingival surface of the connector. Three veneered bridges fractured within the veneer layers. Failure stresses of the all-core fixed partial dentures ranged from 107 to 161 MPa. Failure stresses of the veneered fixed partial dentures ranged from 19 to 68 MPa. We conclude that fracture initiation sites are controlled primarily by contact damage.

  19. Management of failed angioplasty with laser balloon angioplasty

    Science.gov (United States)

    Jenkins, Ronald D.; Spears, J. Richard

    1990-07-01

    Laser balloon angioplasty (LBA) is a technique for improving the post angioplasty result by the radial diffusion of continuous wave Neodymium:YAG laser energy to the arterial wall during the final inflation of percutaneous transluminal coronary angioplasty (PTCA). Potential mechanisms of luminal improvement include sealing of dissections, reduction of arterial recoil, desiccation of thrombus, and reduction of thrombogenicity of tissues at the luminal surface. These effects are helpful in the management of failed PTCA as defined by the presence of a greater than 50% stenosis after conventional PTCA. Preliminary data suggest that LBA may be safe and effective for the treatment of abrupt closure, with a majority of patients successfully avoiding emergency coronary artery bypass surgery. Similarly, a cohort in which the residual post-PTCA luminal diameter was less than 50% of reference diameter (n=13) was subsequently treated with LBA and demonstrated uniform success in improving luminal diameter, with a mean increment of 0.9mm. Data on the long-term clinical outcome of this cohort is encouraging.

  20. Failed back surgery syndrome: review and new hypotheses

    Directory of Open Access Journals (Sweden)

    Bordoni B

    2016-01-01

    Full Text Available Bruno Bordoni,1,2 Fabiola Marelli2 1Department of Cardiology, Foundation Don Carlo Gnocchi, IRCCS, Institute of Hospitalization and Care, S Maria Nascente, Milan, 2School CRESO, Osteopathic Centre for Research and Studies, Falconara Marittima, Ancona, Italy Abstract: Failed back surgery syndrome (FBSS is a term used to define an unsatisfactory outcome of a patient who underwent spinal surgery, irrespective of type or intervention area, with persistent pain in the lumbosacral region with or without it radiating to the leg. The possible reasons and risk factors that would lead to FBSS can be found in distinct phases: in problems already present in the patient before a surgical approach, such as spinal instability, during surgery (for example, from a mistake by the surgeon, or in the postintervention phase in relation to infections or biomechanical alterations. This article reviews the current literature on FBSS and tries to give a new hypothesis to understand the reasons for this clinical problem. The dysfunction of the diaphragm muscle is a component that is not taken into account when trying to understand the reasons for this syndrome, as there is no existing literature on the subject. The diaphragm is involved in chronic lower back and sacroiliac pain and plays an important role in the management of pain perception. Keywords: diaphragm, fascia, chronic pain, pain, spine FBSS

  1. Why Buildings Fail: Are We Learning From Our Mistakes?

    Directory of Open Access Journals (Sweden)

    M. Kevin Parfitt

    2012-09-01

    Full Text Available Most building professionals have investigated or performed remedial designs for at least one architectural or engineering system failure during their careers. Other practitioners, especially those who work for forensic consultants or firms specializing in disaster response and repair, are more familiar with the variety and extent of building failures as they assist their clients in restoring damaged or deficient buildings. The advent of social medial and twenty-four-hour news channels along with the general ease of finding more examples of failures in the Internet have made us realize that building failures in the broad sense are much more common than we may have realized.Relatively recent events leading to building failures such as the Christchurch, New Zealand earthquakes, the roof/parking deck of the Algo Centre mall in the northern Ontario, Canada city of Elliot Lake and the Indiana State Fairground stage collapse in the US are just a few reminders that much more work needs to be done on a variety of fronts to prevent building failures from a life safety standpoint. The need is compounded by economic concerns from what would be considered more mundane or common failures. Inspections by the author after Hurricane Katrina revealed a huge number of failures associated rain water alone as roofs, windows, flashing, mechanical penetrations etc. failed leading to interior water penetration often resulting in more damage from damp conditions and mold propagation than outright structural collapses.

  2. DAYA SAING DAN STRATEGI PENGEMBANGAN MINYAK SAWIT DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Jauhar Samudera Nayantakaningtyas

    2012-11-01

    Full Text Available ABSTRACTThe aims of this study were to analyze the competitiveness of Indonesian Crude palm oil CPO products in the international market and to analyze the strategy to improve the competitiveness of Indonesian CPO. The analysis methods used this research were descriptive qualitative methods. The tools used to analyze the competitiveness of palm oil is Revealed Comparative Advantages and Porter Diamond Theory, while the development of the strategy used to determine the SWOT method. Based on the analysis of Porter's Diamond System and revealed comparative advantages, this study concluded that the competitiveness of Indonesian CPO was pretty strong, but it still needed a strategy to strengthen its competitiveness especially on derivative products. Some of the routine strategies that need to be done every year, are the development of the CPO industry human resources through training and innovation activities, paying attention to national and international issues by improving government policies, downstream industrial development and palm oil value-added increase, enhance cooperation with manufacturers from other countries through promotions.Keywords: crude palm oil, competitiveness, strategy, analysis of porter's diamondABSTRAKTujuan penelitian ini adalah menganalisis daya saing produk Crude Palm Oil (CPO Indonesia di pasar internasional dan menganalisis strategi peningkatan daya saing CPO Indonesia. Metode pengolahan dan analisis data yang digunakan dalam penelitian ini adalah metode deskriptif kualitatif. Alat  yang digunakan untuk menganalisis daya saing minyak sawit  adalah Revealed Comparative Advantages dan Teori Berlian Porter, sedangkan untuk mengetahui strategi pengembangan digunakan metode SWOT. Hasil analisis Sistem Berlian Porter dan revealed comparative advantages disimpulkan bahwa daya saing CPO Indonesia cukup kuat, namun masih diperlukan adanya strategi untuk memperkuat terutama pada produk turunan CPO. Strategi rutin yang harus

  3. O Direito à Saúde no Sistema Prisional

    Directory of Open Access Journals (Sweden)

    Gabrielle Jacobi KOLLING

    2013-04-01

    Full Text Available O direito à saúde é objeto de constante análise e, a cada momento, visualiza-se a necessidade de enfrentar diferentes interfaces desse direito fundamental. A complexidade inerente ao sistema social, e, por conseguinte, ao da saúde também, demanda-nos romper com a classificação de cidadãos de primeira e de segunda classe; isso não é republicano, tampouco democrático. A lógica dos desumanizados e excluídos (esquecidos e negligenciados deve ser cambiada pela lógica da inclusão. A análise enfocará a saúde no sistema prisional. Para isso, é condição de possibilidade analisarmos os condicionantes de saúde e os seus efeitos no panorama prisional-sanitário brasileiro. Observaremos, ainda, as ações governamentais para efetivar o direito à saúde no sistema prisional, em especial a Política Pública de Saúde “Plano Nacional de Saúde no Sistema Penitenciário”, que se apresenta como uma tentativa concreta de romper com a negligência do Estado em relação aos integrantes do sistema prisional, aos esquecidos, aos sem voz. ABSTRACT The right to health is matter of constant analysis and, at each moment the need to challenge the different interfaces of this basic right is visible. The innate complexity of the social system and, by consequence to the health system as well, demands that we break with the concept of first and second class citizens; this is not republican or even democratic. The de-humanized and excluded logic (forgotten and neglected must be traded for the inclusion logic. The analysis will focus the prison system’s health. For this is condition of possibility to analyze the health conditions and its effects in the Brazilian prison-sanitary scope. We will also observe the government’s actions to make the right to heath effective in the prison system, in special the Public Health Policy “Nacional Health Plan in the Prison System”, which is presented as a real attempt to break with the state’s negligence

  4. Saúde auditiva dos recém-nascidos: atuação da fonoaudiologia na Estratégia Saúde da Família Newborn hearing health: speech therapy acting on Family Health Strategy

    Directory of Open Access Journals (Sweden)

    Raquel Martins Maia

    2012-04-01

    Full Text Available OBJETIVO: analisar o acompanhamento dos recém-nascidos quanto à promoção da saúde auditiva após a inserção da fonoaudiologia na Estratégia Saúde da Família. MÉTODO: estudo retrospectivo e documental com abordagem quantitativa com 88 recém-nascidos que realizaram o teste da orelhinha, no período de fevereiro a maio de 2010, a partir dos relatórios mensais de devolutiva do Serviço de Atenção a Saúde Auditiva do município, consolidados mensais e prontuários de um Centro de Saúde da Família em Sobral-Ce. RESULTADOS: dos recém-nascidos avaliados, 35 (39,77% falharam no teste, entre estes, 7 (20% apresentam indicador de risco para deficiência auditiva e 28 (80% não apresentavam nenhum risco. Verificou-se também divergências entre os dados do Serviço de Atenção a Saúde Auditiva e os prontuários do Centro de Saúde da Família quanto a classificação dos indicadores de risco para a perda auditiva. Observou-se ainda que, o número de encaminhamentos para o teste da orelhinha aumentou 8,33%. Em relação ao reteste, 1 (7,69% criança retornou nos meses de março a agosto de 2009 e entre os meses de setembro/2009 a fevereiro/2010 após a atuação da fonoaudiologia no CSF do Sumaré 17 (65,38% crianças realizaram o reteste. CONCLUSÃO: os dados sugerem a importância da presença do fonoaudiólogo na atenção primária, sendo fundamental no acompanhamento e monitoramento do diagnóstico precoce das alterações auditivas.PURPOSE: to analyze the monitoring of the newborn and the promotion of hearing health after insertion of speech therapy at the Family Health Strategy. METHOD: this is a retrospective documentary study with quantitative approach using 88 infants who underwent OAE testing in the period from February to May 2010, we examined the monthly reports’ devolution of the Health Hearing Service of the Municipality, consolidated monthly statements and the handbooks of the Center for Family Health in Sobral

  5. Level of Need for Cognition and Metacognitive Thinking among Undergraduate Kindergarten Female Students at King Sa'ud University in Sa'udi Arabia

    Science.gov (United States)

    Daghistani, Bulquees

    2015-01-01

    This study aims at examining the level of need for cognition and metacognitive thinking among undergraduate kindergarten female students in Education Faculty at King Sa'ud University in Sa'udi Arabia from their own perceptions. Results showed that the need for the cognition level was moderate, but metacognitive thinking level was high. In…

  6. Grupo PET-Saúde/Vigilância em Saúde do Trabalhador Portuário: vivência compartilhada

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Ferreira Queiróz

    2015-12-01

    Full Text Available Trata-se de um relato de vivência compartilhada do Grupo PET-Saúde/ Vigilância em Saúde do Trabalhador Portuário, da Universidade Federal de São Paulo – Unifesp e o Centro de Referência em Saúde do Trabalhador – CEREST, de Santos, SP. O objetivo é descrever a experiência desse grupo tutorial e sua contribuição para o fortalecimento de ações de vigilância em saúde do trabalhador de Santos. O trabalho portuário é a temática do PET-Saúde por sua importância no cenário nacional e por sofrer transformações que geram fatores de agravos à saúde dos trabalhadores. As ações são desenvolvidas englobando o CEREST, os serviços da rede de saúde de Santos e a comunidade portuária santista. Observa-se que os participantes têm compartilhado conhecimento teórico e prático profissional, contribuindo nas ações dos trabalhadores do CEREST e apontando na direção de aproximação com a rede básica de atenção à saúde.

  7. Level of Need for Cognition and Metacognitive Thinking among Undergraduate Kindergarten Female Students at King Sa'ud University in Sa'udi Arabia

    Science.gov (United States)

    Daghistani, Bulquees

    2015-01-01

    This study aims at examining the level of need for cognition and metacognitive thinking among undergraduate kindergarten female students in Education Faculty at King Sa'ud University in Sa'udi Arabia from their own perceptions. Results showed that the need for the cognition level was moderate, but metacognitive thinking level was high. In…

  8. Association Between Difficult Airway Predictors and Failed Prehosptial Endotracheal Intubation.

    Science.gov (United States)

    Gaither, Joshua B; Stolz, Uwe; Ennis, Joshua; Moiser, Jarrod; Sakles, John C

    2015-01-01

    Difficult airway predictors (DAPs) are associated with failure of endotracheal intubation (ETI) in the emergency department (ED). The purpose of this study was to determine if DAPs are associated with failure of prehospital ETI. This retrospective study compared the prevalence of DAPs in cases of failed prehospital ETI successfully intubated in the ED (FPH/SED) with cases with no prehospital attempt that were successfully intubated in the ED on the first attempt by a physician using direct laryngoscopy (NPH/SED). All cases were transported by ground or air to an academic, level-1 trauma center. A total of 1377 ED ETIs were performed; 161 FPH/SED and 530 NPH/SED were identified. The odds ratios with 95% confidence intervals (CIs) of finding DAPs in the FPH/SED group compared with the NPH/SED group was blood = 5.80 (95% CI, 3.89-8.63), vomit = 2.01 (95% CI, 1.25-3.21), short neck = 2.67 (95% CI, 1.39-5.03), neck immobility = 2.52 (95% CI, 1.72-3.67), airway edema = 10.52 (95% CI, 4.15-29.92), facial trauma = 4.64 (95% CI, 2.91-7.39), and large tongue = 3.08 (95% CI, 1.75-5.40). When grouped by the number of DAPs per case (0, 1, 2, 3, or ≥ 4), the odds of multiple DAPs in cases of FPH/SED compared with NPH/SED ranged from 2.89 (95% CI, 1.71-4.90) with 1 DAP to 24.55 (95% CI, 10.60-56.90) with ≥ 4 DAPs. Cases of FPH/SED have more DAPs than NPH/SEDs. Copyright © 2015 Air Medical Journal Associates. Published by Elsevier Inc. All rights reserved.

  9. Machine-learning-assisted materials discovery using failed experiments

    Science.gov (United States)

    Raccuglia, Paul; Elbert, Katherine C.; Adler, Philip D. F.; Falk, Casey; Wenny, Malia B.; Mollo, Aurelio; Zeller, Matthias; Friedler, Sorelle A.; Schrier, Joshua; Norquist, Alexander J.

    2016-05-01

    Inorganic-organic hybrid materials such as organically templated metal oxides, metal-organic frameworks (MOFs) and organohalide perovskites have been studied for decades, and hydrothermal and (non-aqueous) solvothermal syntheses have produced thousands of new materials that collectively contain nearly all the metals in the periodic table. Nevertheless, the formation of these compounds is not fully understood, and development of new compounds relies primarily on exploratory syntheses. Simulation- and data-driven approaches (promoted by efforts such as the Materials Genome Initiative) provide an alternative to experimental trial-and-error. Three major strategies are: simulation-based predictions of physical properties (for example, charge mobility, photovoltaic properties, gas adsorption capacity or lithium-ion intercalation) to identify promising target candidates for synthetic efforts; determination of the structure-property relationship from large bodies of experimental data, enabled by integration with high-throughput synthesis and measurement tools; and clustering on the basis of similar crystallographic structure (for example, zeolite structure classification or gas adsorption properties). Here we demonstrate an alternative approach that uses machine-learning algorithms trained on reaction data to predict reaction outcomes for the crystallization of templated vanadium selenites. We used information on ‘dark’ reactions—failed or unsuccessful hydrothermal syntheses—collected from archived laboratory notebooks from our laboratory, and added physicochemical property descriptions to the raw notebook information using cheminformatics techniques. We used the resulting data to train a machine-learning model to predict reaction success. When carrying out hydrothermal synthesis experiments using previously untested, commercially available organic building blocks, our machine-learning model outperformed traditional human strategies, and successfully predicted

  10. Machine-learning-assisted materials discovery using failed experiments.

    Science.gov (United States)

    Raccuglia, Paul; Elbert, Katherine C; Adler, Philip D F; Falk, Casey; Wenny, Malia B; Mollo, Aurelio; Zeller, Matthias; Friedler, Sorelle A; Schrier, Joshua; Norquist, Alexander J

    2016-05-05

    Inorganic-organic hybrid materials such as organically templated metal oxides, metal-organic frameworks (MOFs) and organohalide perovskites have been studied for decades, and hydrothermal and (non-aqueous) solvothermal syntheses have produced thousands of new materials that collectively contain nearly all the metals in the periodic table. Nevertheless, the formation of these compounds is not fully understood, and development of new compounds relies primarily on exploratory syntheses. Simulation- and data-driven approaches (promoted by efforts such as the Materials Genome Initiative) provide an alternative to experimental trial-and-error. Three major strategies are: simulation-based predictions of physical properties (for example, charge mobility, photovoltaic properties, gas adsorption capacity or lithium-ion intercalation) to identify promising target candidates for synthetic efforts; determination of the structure-property relationship from large bodies of experimental data, enabled by integration with high-throughput synthesis and measurement tools; and clustering on the basis of similar crystallographic structure (for example, zeolite structure classification or gas adsorption properties). Here we demonstrate an alternative approach that uses machine-learning algorithms trained on reaction data to predict reaction outcomes for the crystallization of templated vanadium selenites. We used information on 'dark' reactions--failed or unsuccessful hydrothermal syntheses--collected from archived laboratory notebooks from our laboratory, and added physicochemical property descriptions to the raw notebook information using cheminformatics techniques. We used the resulting data to train a machine-learning model to predict reaction success. When carrying out hydrothermal synthesis experiments using previously untested, commercially available organic building blocks, our machine-learning model outperformed traditional human strategies, and successfully predicted conditions

  11. Metabolomic Profiling in Individuals with a Failing Kidney Allograft

    Science.gov (United States)

    Biancone, Luigi; Bussolino, Stefania; Merugumala, Sai; Tezza, Sara; D’Addio, Francesca; Ben Nasr, Moufida; Valderrama-Vasquez, Alessandro; Usuelli, Vera; De Zan, Valentina; El Essawy, Basset; Venturini, Massimo; Secchi, Antonio; De Cobelli, Francesco; Lin, Alexander; Chandraker, Anil; Fiorina, Paolo

    2017-01-01

    Background Alteration of certain metabolites may play a role in the pathophysiology of renal allograft disease. Methods To explore metabolomic abnormalities in individuals with a failing kidney allograft, we analyzed by liquid chromatography-mass spectrometry (LC-MS/MS; for ex vivo profiling of serum and urine) and two dimensional correlated spectroscopy (2D COSY; for in vivo study of the kidney graft) 40 subjects with varying degrees of chronic allograft dysfunction stratified by tertiles of glomerular filtration rate (GFR; T1, T2, T3). Ten healthy non-allograft individuals were chosen as controls. Results LC-MS/MS analysis revealed a dose-response association between GFR and serum concentration of tryptophan, glutamine, dimethylarginine isomers (asymmetric [A]DMA and symmetric [S]DMA) and short-chain acylcarnitines (C4 and C12), (test for trend: T1-T3 = p<0.05; p = 0.01; p<0.001; p = 0.01; p = 0.01; p<0.05, respectively). The same association was found between GFR and urinary levels of histidine, DOPA, dopamine, carnosine, SDMA and ADMA (test for trend: T1-T3 = p<0.05; p<0.01; p = 0.001; p<0.05; p = 0.001; p<0.001; p<0.01, respectively). In vivo 2D COSY of the kidney allograft revealed significant reduction in the parenchymal content of choline, creatine, taurine and threonine (all: p<0.05) in individuals with lower GFR levels. Conclusions We report an association between renal function and altered metabolomic profile in renal transplant individuals with different degrees of kidney graft function. PMID:28052095

  12. 认识SA8000更要关注ISO26000%Concerned on SA 8000, and Focused on ISO 26000 Further

    Institute of Scientific and Technical Information of China (English)

    张振明

    2006-01-01

    @@ 近年来,在我国形成来势凶猛的SA 8000运动浪潮,特别是2004年初,国内部分媒体的相关报道铺天盖地,各种收费培训班或专题讲座火爆异常,一时间人们谈及社会责任,言必称SA 8000,笔者同年6月参加在深圳举办的SA 8000专题讲座,授课人甚至称SA 8000是国际标准,似乎SA 8000就是社会责任的代名词.

  13. DAYA SAING PRODUK TURUNAN SUSU INDONESIA DI PASAR DUNIA

    Directory of Open Access Journals (Sweden)

    Lina Yanti

    2012-06-01

    Full Text Available ABSTRACTThis research purposes were (1 to measures the competitiveness of Indonesian milk derivative product in international market based on its comparative advantage, (2 to analyze the dynamics of Indonesian milk and also to analyze the commodity’s competitive position in the international market through its dynamic export product performance, (3 to analyze dominant factors that influencing Indonesian dairy export growth based on constant market share analysis. The analysis methods used to measure the competitiveness of Indonesian milk in this research are based on revealed comparative advantage analysis, Export product dynamic analysis (EPD, and constant market share analysis. The result from RCA showed that the Indonesian milk derivative products which are Milk not concentrated nor sweetened 1–6% fat (HS 040120, Milk and cream, concentrated or sweetened (HS 0402 and Buttermilk, curdled milk, cream, kephir, etc (HS 040390 do not have comparative advantage but for Milk and cream powder unsweetened > 1,5%  fat (HS 040221, Milk and cream nes sweetened or concentrated (HS 040299 and Cereal, flour, starch, milk preparations and products (HS19 have comparative advantage. The EPD found that all Indonesian milk derivative products are included in the Rising Star position. The result test using CMS analysis concluded that the most significant factor which affect the export growth for Indonesian HS 040390 and HS 0402 derivative products are the import growth effect, HS 19 is mainly dominated by commodity composition effect, and the export growth for the rest derivative products are dominated with the competitiveness effect. Therefore, it needs to be implemented efforts to enhance the competitiveness of dairy derived products IndonesiaKeywords: milk, competitiveness, revealed comparative advantage (RCA, export product dynamic (EPD, constant market share analysis (CMSAABSTRAKPenelitian ini bertujuan (1 menganalisis daya saing komoditas susu

  14. Eqüidade em saúde: uma análise crítica de conceitos Health equity: a critical analysis of concepts

    Directory of Open Access Journals (Sweden)

    Ligia Maria Vieira-da-Silva

    2009-01-01

    Full Text Available A eqüidade em saúde tem sido estudada principalmente a partir de uma perspectiva epidemiológica e pouca atenção tem sido dada às questões conceituais. Em grande parte dos estudos revisados, a eqüidade tem sido utilizada como sinônimo de igualdade, e seu oposto, a iniqüidade, como sinônimo de desigualdade. As tentativas de melhor precisar seus significados têm sido, em boa parte, descritivas, com lacunas no que diz respeito à discussão das relações entre eqüidade em saúde, justiça e o processo de determinação social da saúde-doença. Neste ensaio, pretendemos analisar criticamente a série significante diversidade, diferença, desigualdade, iniqüidade, distinção no que concerne à produção da saúde-doença-cuidado em grupos sociais e suas possibilidades de articulação a uma teoria social da saúde. Nesse percurso, estaremos apoiados, por um lado, no conceito de Perelman de eqüidade e em alguns dos argumentos de Heller sobre a justiça e, por outro lado, na sociologia das práticas de Bourdieu, com o objetivo de melhor desenvolver esses conceitos, procurando discutir implicações para a formulação de políticas públicas no campo da saúde.Health inequalities have been studied mainly from an epidemiological perspective, with limited attention to conceptual issues. The terms "equity" and "equality" have often been used as synonyms, as have their opposites, "inequity" and "inequality". The few attempts to establish their meanings have been either purely descriptive or have failed to add to an understanding of the underlying dynamics in health-disease-related phenomena. The present essay explores the semantic series that includes difference, diversity, distinction, inequality, and inequity and its relationship to health phenomena in light of Perelman's concept of equity, Bourdieu's sociology, and some arguments in Heller's theory of justice, with the aim of contributing to the development of these concepts, while

  15. Desigualdades socioeconômicas na saúde

    Directory of Open Access Journals (Sweden)

    Diaz Maria Dolores M.

    2003-01-01

    Full Text Available Este artigo analisa as desigualdades socioeconômicas na área da saúde no Brasil, por meio da mensuração de índice de concentração para a variável autoavaliação do estado de saúde. Utilizou-se a base de dados originada pela Pesquisa Domiciliar sobre Padrões de Vida - PPV - realizada pelo IBGE no período de março/1996 a março/1997, em convênio com o Banco Mundial. Entre os principais resultados, deve-se destacar a constatação de que existem diferenças estatisticamente significativas entre índices calculados a partir de distintas variáveis caracterizadoras do nível socioeconômico dos indivíduos. Neste caso, em particular, os indicadores calculados a partir da classificação baseada na variável renda indicou, sistematicamente, a presença de desigualdades na saúde ligeiramente superiores àquelas identificadas a partir da utilização das despesas familiares. Constatou-se, ainda, que os resultados obtidos são bastante robustos em relação às distintas ponderações utilizadas na construção das escalas de equivalência entre os indivíduos. Todas as simulações realizadas revelaram a presença de desigualdades que favorecem os indivíduos pertencentes às camadas mais elevadas das escalas socioeconômicas adotadas.

  16. Indutores de mudança na formação dos profissionais de saúde: pró-saúde e PET-SAÚDE

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Luck Coelho de Holanda

    2012-12-01

    Full Text Available Na última década, a formação de profissionais de saúde tem sido reformulada no intuito de atender às necessidades de saúde das pessoas e não somente suas demandas. Políticas públicas de educação e saúde promovidas em parceria com o Ministério da Educação (MEC e o Ministério da Saúde (MS sinalizaram uma reforma curricular imprescindível nos cursos de graduação da área de saúde(1,2 .A formalização dessa mudança teve seu marco com a instituição das Diretrizes Curriculares Nacionais (DCN para os cursos de graduação no campo da saúde. Todos os instrumentos vigentes orientam a construção do perfil dos egressos por meio de um modelo acadêmico e profissional em que atitudes, habilidades e conteúdos almejem a formação generalista, humanista, crítica e reflexiva, com competência para a atuação em todos os níveis de atenção à saúde, embasando suas condutas nos rigores científico e ético(3-7.Não por acaso, todos os documentos ressaltam os mesmos campos de competência a serem desenvolvidos durante a formação dos diferentes profissionais da área: atenção à saúde, tomada de decisões, comunicação, liderança, educação permanente, administração e gerenciamento(3-7, pois a saúde, como um complexo campo de atuação, não consegue imprimir ações resolutivas através de uma única disciplina ou área do saber.A proposta preconizada pelo MEC e MS de produzir transformação nos processos de formação, trabalho e ampliação da cobertura dos serviços tem sido concretizada mediante programas indutores, como o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para a Saúde (PET–Saúde(1,2.O Pró-Saúde, implementado no país desde 2005 através da divulgação de editais, pretende sintonizar a formação em saúde com as necessidades sociais, considerando as dimensões históricas, culturais e econômicas da população(8

  17. SA8000基本知识解读

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    1SA8000的含义 社会责任国际标准体系(Social Accountability 8000 Intemational standard,简称SAS000)是一种基于国际劳工组织宪章(ILO宪章)、联合国儿童权利公约、世界人权宣言而制定的,以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  18. SA8000基础知识解读

    Institute of Scientific and Technical Information of China (English)

    黎友焕

    2004-01-01

    社会责任国际标准体系(Social Ac-countability 8000 International slandard,简称SA8000)是一种基于国际劳工组织宪章(ILO宪章),联台国儿童权利公约,世界人权宣言而制定的.以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  19. Programa de Monitoreo Ambiental para Cementos Cienfuegos S.A

    OpenAIRE

    Mario A. Curbelo Hernández; José Luis Romero Cabrera; Henrry Ricardo Cabrera

    2012-01-01

    La presente investigación se realizó en las instalaciones de Cementos Cienfuegos S.A. Cuba, con el objetivo de diseñar e implementar un programa de monitoreo de las variables de concentración de polvo en aire, tasa de deposición y concentración de metales pesados, para la valoración de la calidad del aire a partir de índices establecidos en la norma NC ISO 111:2004. Este programa incluye también el monitoreo de los parámetr...

  20. Composition and Value of waste in landfills in SA

    CSIR Research Space (South Africa)

    Oelofse, Suzanna HH

    2015-09-01

    Full Text Available stream_source_info Oelofse1_2015.pdf.txt stream_content_type text/plain stream_size 3221 Content-Encoding UTF-8 stream_name Oelofse1_2015.pdf.txt Content-Type text/plain; charset=UTF-8 1 Composition and Value of waste... in landfills in SA German Chamber of Business From Mining to Urban Mining 16 September 2015 IFAT Environmental Technology Forum Africa 2015 by Prof Suzan Oelofse Research Group Leader: Waste for Development Competency Area: Solutions for a Green...

  1. Caso Molinos Roa S.A.: historia empresarial

    OpenAIRE

    2013-01-01

    Durante su trayectoria empresarial Molinos Roa S.A. ha enfocado sus estrategias gerenciales al logro de objetivos basados en principios y valores corporativos, por lo anterior el documento presenta el estudio de la historia empresarial, donde se da un reflejo de la pujanza y la visión de gestores y administradores. Sin embargo se analiza el impacto que trae en el negocio de la industria arrocera la firma de los tratados de libre comercio, así como el contrabando desmedido de este cereal y el ...

  2. Impacto de ingrediente funcional sobre a saúde intestinal

    OpenAIRE

    Gabriela Santos Souza

    2014-01-01

    O microbioma intestinal influencia de maneira positiva e/ou negativa o bem estar e o equilíbrio da saúde no organismo humano. Carboidratos não disponíveis, tais como frutanos e amido resistente (encontrado na farinha de banana verde), são ingredientes funcionais que resistem à digestão, estimulam o peristaltismo e o trânsito intestinal, e podem aumentar população de bactérias benéficas. O presente estudo teve como objetivo avaliar o impacto do consumo regular e descontinuado (durante 6 semana...

  3. The rebranding of Electrica Soluziona SA - a case study

    Directory of Open Access Journals (Sweden)

    Monica GOMOESCU

    2016-07-01

    Full Text Available This article intends to present the design and implementation stages of a rebranding campaign that took place in the Electrica Soluziona SA company. The rebranding targets a company that provides consultancy services and software solutions and that underwent a change of its main shareholders structure, as it was taken over by Indra Group. After being taken over by Indra, Electrica Soluziona has considerably enlarged its product portfolio and the market segments targeted. Thus, it was mandatory to define a complex rebranding campaign. The rebranding process was not determined only by the broadening of activity, but also by the change of visual identity elements, along with the desire of repositioning.

  4. Genética, saúde e sociedade

    OpenAIRE

    2013-01-01

    O documentário apresenta quatro projetos de pesquisa realizados pelo Instituto de GenéticaMédica Populacional (INAGEMP) em diferentes regiões do país.As atividades mencionadasrepresentam uma amostra do trabalho do INAGEMP, que se estruturou de modo a colocar agenética médica populacional na prática ao associar pesquisa e atenção em saúde parapopulações afetadas por doenças com forte componente genético em sua etiologia.

  5. Significado da massagem com aromaterapia em saúde mental

    OpenAIRE

    Domingos,Thiago da Silva; Braga,Eliana Mara

    2014-01-01

    Objetivo Compreender o significado da intervenção de massagem com aromaterapia em saúde mental para o usuário durante a internação psiquiátrica.Métodos Pesquisa qualitativa que incluiu 22 participantes com diagnóstico de Transtornos de Personalidade internados em unidade psiquiátrica de um hospital geral. Foram realizadas entrevistas semiestruturadas, com uma questão norteadora aos participantes, os quais se submeteram a intervenç...

  6. Prognostic indicators for failed nonsurgical reduction of intussusception

    Directory of Open Access Journals (Sweden)

    Khorana J

    2016-08-01

    Full Text Available Jiraporn Khorana,1 Jesda Singhavejsakul,1 Nuthapong Ukarapol,2 Mongkol Laohapensang,3 Jakraphan Siriwongmongkol,1 Jayanton Patumanond4 1Division of Pediatric Surgery, Department of Surgery, 2Division of Gastroenterology, Department of Pediatrics, Chiang Mai University Hospital, Chiang Mai, 3Division of Pediatric Surgery, Department of Surgery, Siriraj Hospital, Mahidol University, Bangkok, 4Center of Excellence in Applied Epidemiology, Thammasat University Hospital, Pathumthani, Thailand Purpose: To identify the risk factors for failure of nonsurgical reduction of intussusception. Methods: Data from intussusception patients who were treated with nonsurgical reduction in Chiang Mai University Hospital and Siriraj Hospital between January 2006 and December 2012 were collected. Patients aged 0–15 years and without contraindications (peritonitis, abdominal X-ray signs of perforation, and/or hemodynamic instability were included for nonsurgical reduction. The success and failure groups were divided according to the results of the reduction. Prognostic indicators for failed reduction were identified by using generalized linear model for exponential risk regression. The risk ratio (RR was used to report each factor. Results: One hundred and ninety cases of intussusception were enrolled. Twenty cases were excluded due to contraindications. A total of 170 cases of intussusception were included for the final analysis. The significant risk factors for reduction failure clustered by an age of 3 years were weight <12 kg (RR =1.48, P=0.004, symptom duration >3 days (RR =1.26, P<0.001, vomiting (RR =1.63, P<0.001, rectal bleeding (RR =1.50, P<0.001, abdominal distension (RR =1.60, P=0.003, temperature >37.8°C (RR =1.51, P<0.001, palpable abdominal mass (RR =1.26, P<0.001, location of mass (left over right side (RR =1.48, P<0.001, poor prognostic signs on ultrasound scans (RR =1.35, P<0.001, and method of reduction (hydrostatic over pneumatic (RR =1

  7. Percepção do processo saúde-doença: significados e valores da educação em saúde

    Directory of Open Access Journals (Sweden)

    Ana Maria Chagas Sette Câmara

    Full Text Available A relevância sociológica do estudo das representações sociais do processo saúde-doença está no fato de que elas fundamentam práticas e atitudes dos seus atores, assim como as relações que eles estabelecem com o seu contexto social e com aquilo que lhes acontece. O problema dessa pesquisa consiste em conhecer as representações sociais do processo saúde-doença dos profissionais do PSF, considerando que esse conhecimento pode ser fundamental para o desenvolvimento de práticas educativas em saúde. A abordagem metodológica desta pesquisa foi qualitativa, tendo por base as representações sociais dos profissionais de apoio e das equipes de saúde da família do Centro de Saúde Milionários, em Belo Horizonte, Minas Gerais. Para a coleta de dados, foi utilizada entrevista individual semi-estruturada abordando os seguintes aspectos: processo saúde-doença; educação em saúde; e barreiras ou dificuldades para prescrição/adoção de hábitos saudáveis. Os dados foram analisados pela técnica de análise de conteúdo, a partir das categorias: dimensões do processo saúde-doença; barreiras ou dificuldades para adoção de hábitos saudáveis; e significados e valores da educação em saúde. Os dados apontam que há necessidade de modificações conceituais na formação permanente desses profissionais e da inclusão do enfoque coletivo, abordando o conceito ampliado de saúde com seus determinantes sociais e contextuais. Faz-se necessária também a busca de novas metodologias de educação em saúde, para que os profissionais do PSF possam ir além da informação e consigam a ressignificação dos conceitos do processo saúde-doença, podendo de fato estabelecer novas práticas e novos processos de trabalho em saúde.

  8. Psicologia da saúde crítica no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Denis Barros de Carvalho

    Full Text Available O texto apresenta uma discussão sobre a Psicologia da saúde no contexto hospitalar a partir de uma perspectiva histórica e ética, mostrando como o desenvolvimento desse campo foi caracterizado pelo surgimento de duas perspectivas: a Psicologia da saúde tradicional e a Psicologia da saúde crítica. O modelo de quatro abordagens à Psicologia da saúde é apresentado e reformulado com a inclusão do conceito de Psicologia sanitária, e a prática em Psicologia da saúde é discutida à luz do conceito de reflexividade. Por fim, alguns questionamentos derivados da Psicologia da saúde crítica são feitos à prática do psicólogo no contexto hospitalar.

  9. Cuidados em saúde entre portadores de diabetes mellitus autorreferido no Brasil, Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    2015-12-01

    Full Text Available Resumo: Objetivo: Descrever medidas do cuidado assistencial destinadas ao paciente com diabetes mellitus autorreferido no Brasil. Métodos: Foram utilizados dados da Pesquisa Nacional de Saúde(2013, estudo transversal de base populacional, referentes ao cuidado em saúde com o diabetes mellitus autorreferido, quanto ao uso de serviços de saúde e acesso a medicamentos. Resultados: A prevalência de diabetes mellitus autorreferido foi de 6,2%, e 11,5% da população nunca fez uma glicemia na vida. Dos adultos que referiram diabetes mellitus , 80,2% tomaram medicamentos nas duas semanas anteriores à entrevista, 57,4% usaram o Programa Farmácia Popular, 73,2% receberam assistência médica e 47,1% realizaram o atendimento nas Unidades Básicas de Saúde. Em 65,2%, o médico que atendeu na última consulta era o mesmo das consultas anteriores, 95,3% dos pacientes conseguiram realizar os exames complementares solicitados e 83,3% conseguiram fazer as consultas com o médico especialista. A avaliação de pés e olhos foi relatada por 35,6 e 29,1% dos portadores de diabetes mellitus , respectivamente. Relataram internação hospitalar por causa do diabetes ou de alguma complicação 13,4% dos adultos, e outros 7,0% relataram limitações nas atividades diárias. Em geral, mulheres, assim como a população mais idosa, de maior escolaridade, brancos e residentes nas regiões Sul e Sudeste, tiveram maior prevalência da doença e maior acesso aos serviços, medicamentos e consultas. Discussão: Os cuidados aos portadores de diabetes foram recebidos de forma adequada, na maioria dos casos, o que é essencial para manter a qualidade de vida dos pacientes e prevenir desfechos mais graves.

  10. Enredando lutas cotidianas: dispositivos de saúde pela cidade

    Directory of Open Access Journals (Sweden)

    Arielle Rocha de Oliveira Silva

    2009-12-01

    Full Text Available A partir das experiências de intervenções em serviços públicos de saúde e em outros setores da cidade, este trabalho afirma uma prática oficineira descentralizada capaz de compor na construção de redes sociais, servindo de instrumento de análise e possibilitando a invenção de modos de vida e afirmação de singularidades. As intervenções na cidade abrem caminhos para mudanças nos processos em curso e contribuem para a produção de saúde/cidadania por meio da potência conectiva das lutas. O enlace dessas temáticas visa ampliar o campo problemático da atenção psicossocial e fortalecer a luta antimanicomial no Espírito Santo, apostando em novas formas de atuação.

  11. Altera – Technical update, presented by Sascoholz SA

    CERN Multimedia

    FI Department

    2008-01-01

    Thursday 28 August 2008 From 9h00 to 12h00 (welcome at 08h45) in Room B (Main Building 61/1-009) SascoHolz SA cordially invites you to an informative and interesting technical update on the latest Altera FPGA developments. Introducing Altera’s Stratix IV Device Family 40-nm high-performance, high-end FPGAs with 8.5-Gbps transceiver option The Stratix IV FPGA family gives you the highest density, highest system performance, and the lowest power available in an FPGA, enabling innovation without compromise. Speaker Ole Horn, FAE Sascoholz Agenda Altera Stratix IV Device FamilyIntroduction Logic Fabric Architecture DSP Blocks Tri-Matrix Memory PLL and Clock Networks Design Security I/O Connectivity High-Speed Transceiver Low Power Consumption Language: English As a member of the globally active distribution group, Arrow Electronics, SascoHolz SA does more than just following the concepts of classic broadline distributors. In fact, we offer a depth of service throughou...

  12. New Young Star Candidates in CG4 and Sa101

    CERN Document Server

    Rebull, L M; Hoette, V; Kim, J S; Laine, S; Foster, M; Laher, R; Legassie, M; Mallory, C R; McCarron, K; Sherry, W H

    2011-01-01

    The CG4 and Sa101 regions together cover a region of ~0.5 square degree in the vicinity of a "cometary globule" that is part of the Gum Nebula. There are seven previously identified young stars in this region; we have searched for new young stars using mid- and far-infrared data (3.6 to 70 microns) from the Spitzer Space Telescope, combined with ground-based optical data and near-infrared data from the Two-Micron All-Sky Survey (2MASS). We find infrared excesses in all 6 of the previously identified young stars in our maps, and we identify 16 more candidate young stars based on apparent infrared excesses. Most (73%) of the new young stars are Class II objects. There is a tighter grouping of young stars and young star candidates in the Sa101 region, in contrast to the CG4 region, where there are fewer young stars and young star candidates, and they are more dispersed. Few likely young objects are found in the "fingers" of the dust being disturbed by the ionization front from the heart of the Gum Nebula.

  13. Magnetic field measurements of JT-60SA CS model coil

    Energy Technology Data Exchange (ETDEWEB)

    Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Murakami, Haruyuki; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)

    2015-01-15

    Highlights: • Magnetic fields of the JT-60SA CS model coil were measured. • While the coil current was held constant at 20 kA, magnetic fields varied slightly with several different long time constants. • We investigated coils consisting of CIC conductors and having long time constants. - Abstract: In a cold test of the JT-60SA CS model coil, which has a quad-pancake configuration consisting of a Nb{sub 3}Sn cable-in-conduit (CIC) conductor, magnetic fields were measured using Hall sensors. For a holding coil current of 20 kA, measured magnetic fields varied slightly with long time constants in the range 17–571 s, which was much longer than the time constant derived from a measurement using a short straight sample. To validate the measurements, the magnetic fields of the model coil were calculated using a computational model representing the positions of Nb{sub 3}Sn strands inside the CIC conductor. The calculated results were in good agreement with the measurements. Consequently, the validity of the magnetic field measurements was confirmed. Next, we investigated other coils consisting of CIC conductors and having long time constants. The only commonality among the coils was the use of CIC conductors. At present, there is no obvious way to prevent generation of such magnetic-field variations with long time constants.

  14. Finite element analysis of (SA) mechanoreceptors in tactile sensing application

    Science.gov (United States)

    N, Syamimi; Yahud, S.

    2015-05-01

    This paper addresses the structural design of a fingertip model in order to analyse the sensory function of slow adapting (SA) mechanoreceptors by using the finite element analysis (FEA) method. A biologically inspired tactile sensor was designed to mimic a similar response of the human mechanoreceptors in the human glabrous skin. The simulation work was done by using COMSOL Multiphysics. The artificial skin was modelled as a solid square block of silicone elastomer with a semi cylinder protrusion on top. It was modelled as a nearly incompressible and linear hyperelastic material defined by Neo Hookean constitutive law. The sensing element on the other hand was modelled by using constantan alloy mimicking the SA1 receptor. Boundary loads of 1 N/m² to 4 N/m² with the increment of 1 N/m² were applied to the top surface of the protrusion in z and x-direction for normal and shear stress, respectively. The epidermal model base was constrained to maintain the same boundary conditions throughout all simulations. The changes of length experienced by the sensing element were calculated. The simulations result in terms of strain was identified. The simulated result was plotted in terms of sensing element strain against the boundary load and the graph should produce a linear response.

  15. Reflexões sobre o papel das unidades de economia da saúde no âmbito de sistemas nacionais de saúde

    Directory of Open Access Journals (Sweden)

    Fabiola Sulpino Vieira

    Full Text Available Resumo O objetivo deste texto é apresentar algumas reflexões sobre o papel e a relevância das unidades de economia da saúde (UES no âmbito de sistemas nacionais de saúde. Parte-se dos fundamentos deste campo de conhecimento e de sua contribuição à gestão em saúde para tecer considerações sobre o papel e a relevância dessas unidades. São discutidas questões como o conhecimento dos gestores da saúde e lideranças políticas sobre economia da saúde, a necessidade de atuação transversal da UES na organização e de corpo técnico multidisciplinar qualificado, assim como a natureza técnica e política do trabalho, as possibilidades e limites para sua atuação, seus aspectos e a relação com grupos externos de pesquisa. Por fim, ressalta-se que o trabalho de equipe interna especializada em economia da saúde constitui um dos meios para qualificar o processo de tomada de decisão nas organizações públicas de saúde, visando à otimização do uso dos recursos e à equidade em sua alocação.

  16. Contribuições do PET-Saúde/Redes de Atenção Psicossocial à Saúde da Família

    Directory of Open Access Journals (Sweden)

    Larissa de Almeida Rézio

    2015-12-01

    Full Text Available O estudo objetivou analisar as contribuições do Programa de Educação pelo Trabalho para a Saúde – PET-Saúde/Redes de Atenção Psicossocial à Saúde - a uma unidade de Estratégia de Saúde da Família em Cuiabá, Mato Grosso, Brasil. Trata-se de um estudo descritivo, com abordagem qualitativa, utilizando entrevista com cinco profissionais de saúde e dois acadêmicos bolsistas e registros de atividades realizadas no serviço. À luz da análise de conteúdo temática, sistematizamos quatro subtemas: “articulação da rede”; “qualificação da assistência à saúde mental”, “melhora do conhecimento dos profissionais” e “superação de estigmas sobre o paciente em sofrimento psíquico”. Houve sensibilização dos profissionais e bolsistas sobre a importância do acompanhamento das pessoas com sofrimento mental na atenção básica, em articulação com serviços de saúde mental.

  17. Joint Service Aircrew Mask (JSAM) - Strategic Aircraft (SA): Noise Attenuation Performance

    Science.gov (United States)

    2015-08-25

    AFRL-RH-WP-TP-2015-0026 Joint Service Aircrew Mask (JSAM) – Strategic Aircraft (SA): Noise Attenuation Performance...2015 – July 2015 4. TITLE AND SUBTITLE Joint Service Aircrew Mask (JSAM) – Strategic Aircraft (SA): Noise Attenuation Performance 5a. CONTRACT...determine if the Joint Service Aircrew Mask (JSAM) –Strategic Aircraft (SA) performance specification requirements were being met. The requirement stated

  18. ANALISIS DAN MODEL STRATEGI PENINGKATAN DAYA SAING PRODUK EDAMAME BEKU

    Directory of Open Access Journals (Sweden)

    Sandryas Alief Kurniasanti

    2015-03-01

    penelitian ini adalah untuk menganalisis daya saing dan merumuskan prioritas alternatif strategi peningkatan daya saing produk edamame beku di PT MT 27. Metode yang digunakan dalam penelitian ini adalah Revealed Comparative Advantage untuk mengetahui kinerja ekspor dari produk edamame beku di pasar dunia, kemudian menganalisis faktor persaingan dengan menggunakan Diamond Porter’s Theory. Alternatif strategi dihasilkan dari analisis SWOT dan ditentukan prioritasnya dengan menggunakan analytical hierarchy process dari satu narasumber ahli. Hasil penelitian menunjukkan bahwa prioritas alternatif strategi peningkatan daya saing produk edamame beku PT MT 27 secara berurutan meliputi: (1 diversifikasi pasar, (2 diversifikasi produk, (3 meningkatkan kerjasama luar negeri, (4 pengembangan divisi Research and Development, (5 mengembangkan program Corporate Social Responsibility, (6 pengelolaan keuangan secara baik dan benar, serta (7 mengembangkan areal pertanian yang berbasis rumah kaca untuk menghindari cuaca buruk karena beriklim tropis. Implikasi Manajerial dari penelitian ini adalah mengembangkan pasar yang sudah ada, dan mengembangkan jenis produk yang diproduksi untuk memenuhi selera pasar ekspor dan juga penghematan biaya produksi. Kata kunci: daya saing, edamame beku, Mitratani Dua Tujuh, strategi daya saing

  19. The Search for Failed Supernovae with the Large Binocular Telescope: Constraints from 7 Years of Data

    CERN Document Server

    Adams, S M; Gerke, J R; Stanek, K Z

    2016-01-01

    We report updated results for the first 7 years of our program to monitor 27 galaxies within 10 Mpc using the Large Binocular Telescope to search for failed supernovae -- core-collapses of massive stars that form black holes without luminous supernovae. In the new data, we identify no new compelling candidates and confirm the existing candidate. Given the 6 successful core-collapse SNe in the sample and one likely failed SN, the implied fraction of core-collapses that result in failed SNe is $f = 0.14^{+0.33}_{-0.10}$ at 90% confidence. If the current candidate is a failed SN, the fraction of failed SN naturally explains the missing high-mass RSG SN progenitors and the black hole mass function. If the current candidate is ultimately rejected, the data implies a 90% confidence upper limit on the failed SN fraction of $f < 0.35$.

  20. Cobertura de Planos de Saúde na população brasileira, segundo a Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    Full Text Available Resumo O objetivo do estudo é descrever as coberturas de planos de saúde no Brasil, conforme características sociodemográficas, a partir dos dados da Pesquisa Nacional de Saúde, realizada em 2013, e comparar com dados administrativos da Agencia Nacional de Saúde Suplementar para este mesmo ano. Foram utilizados dados da Pesquisa Nacional de Saúde e do Sistema de Informações de Beneficiários da Agência Nacional de Saúde para o ano de 2013. Foi descrita a cobertura dos planos de saúde segundo estratificação para Brasil, urbano/rural, Grandes Regiões, Unidades da Federação e Capitais, sexo, faixa etária, nível de instrução, posição na força de trabalho, cor/raça e estado de saúde. Como resultado, a proporção de pessoas que referiu ter algum plano de saúde no Brasil foi de 27,9% (IC95%: 27,1-28,8. Foi observada diferença significativa com relação a nível de instrução, sendo maior para os que referiram ter educação superior completa (68,8% IC95%: 67,2-70,4 e para aqueles que referiram ter ocupação (32,5% IC95%: 31,5-33,5. O aumento da cobertura de planos de saúde na população brasileira reflete a melhora da oferta de empregos e do crescimento da economia do país na época.

  1. Nas Trilhas (desconhecidas da saúde: a política pública de saúde para os homens no Brasil.

    Directory of Open Access Journals (Sweden)

    Marlene Neves Strey

    2012-11-01

    Full Text Available Neste estudo abordamos as diferentes formas de masculinidades e sua relação com a saúde, contempladas na Política de Atenção Integral à saúde do Homem (PNAISH implementada no Brasil no ano de 2009. Através de uma análise documental dessa política, pretendemos compreender os discursos masculinos que nela estão, bem como analisar a relação entre o discurso da política e as diferentes formas de produção de saúde. Devido a não estarem acostumados a se expor a um profissional de saúde, os homens sentem-se envergonhados, e além disso, atribuem sua baixa procura aos serviços de saúde, à falta de cuidados e escuta adequadas com um olhar de gênero que possa dar conta de suas demandas. Essa nova política de saúde para os homens criada no Brasil pretende atuar de maneira a atingir uma mudança cultural, que possibilite aos homens maior cuidado com sua saúde. Além disso, olhar para os modos de produção de masculinidades nos dias atuais e seus discursos sobre saúde é estar atento aos comportamentos que, devido à herança pautada nas diferenças entre os sexos, contribui para obstaculizar o acesso dos homens aos serviços de saúde.

  2. A política de saúde bucal em pauta no Conselho Municipal de Saúde no Município de Nova Friburgo - RJ

    Directory of Open Access Journals (Sweden)

    Rafael Gomes Ditterich

    Full Text Available Objetivo O presente estudo teve como objetivo analisar, por meio dos documentos técnicos do Conselho Municipal de Saúde (CMS, a organização dos serviços de saúde bucal no Município de Nova Friburgo - RJ, a partir da institucionalização da Política Nacional de Saúde Bucal. Metodologia Para a análise documental, utilizou-se o registro de frequência e categorização por assunto: saúde bucal das atas do CMS de junho/2006 a agosto/2011, do Plano Municipal de Saúde de 2003-2005 e 2010-2013, e os documentos encaminhados entre 2005 e 2011. Resultado Os registros analisados até 2012 indicaram que a população estava desassistida na questão da média complexidade, como também no acesso à água fluoretada. As equipes de saúde bucal ainda não tinham sido qualificadas e ampliadas, como é bem colocado como prioridade no Brasil Sorridente. O Município ainda não desenvolvia programas de prevenção e promoção de saúde bucal de forma contínua e efetiva. Conclusão Concluiu-se que a Política Nacional de Saúde Bucal, até o ano de 2012, não tinha ainda reflexo nas ações de saúde bucal em Nova Friburgo.

  3. Mathematics teachers' beliefs about scientific approach (SA) and implementation in mathematics learning

    Science.gov (United States)

    Mutholib, Ahmad Abdul; Sujadi, Imam; Subanti, Sri

    2017-08-01

    SA is the approach used for the exploration of research and answer questions. Teachers' beliefs have a greater influence than the teacher's knowledge of designing lesson plans in the classroom. The objectives of this study are to explore the teachers' beliefs in SA, to reveal how the beliefs are reflected in classroom practices; and to figure out the factors affecting their beliefs and practices of SA to the teaching of mathematics. This qualitative research applied case study. The data was gained from classroom observation, face-to-face interview, and documentation. Interactive models from Miles and Huberman were used to examine the data. Results of the study: 1) The teachers believe about the conception of SA. They also believe that the SA is important and gives impact to students' progress. They believe that by applying SA, the target of mathematics learning is acquired. As to learning procedure, they believe that SA steps are conducted in sequence by combining some steps for each. 2) Teachers formulate their beliefs of applying the five scientific step of integrating all steps by keeping the sequence. Teachers argue that target of mathematics learning can be attained by some ways, namely presence of theoretical and practical support, teachers' guidance, providing variety of media and motivation to students. 3) There are five factors which influence teachers' beliefs and practices of SA, namely learning and teaching experience, teachers' motivation, sharing with colleagues and facility. This study concludes that teachers believe in the importance of SA, therefore they implement it in the classroom.

  4. The visualization of DHSI based on the relationship model of CL and SA

    Science.gov (United States)

    Wang, Haibo; Guo, Huijuan; Xue, Chengqi

    2013-03-01

    The source and cause of cognitive load (CL) and situation awareness (SA) in digital human-system interface (DHSI) is explained. Based on the analysis of cognitive procedure and the relation of CL and SA, The relationship model of CL and SA in DHSI is put forward. Using the association target and the relationship model of CL and SA, the method and strategy of information visualization of DHSI is presented which is based on the cognitive psychology. Selecting the Boeing 757 autopilot as the case, the comparison of design is shown.

  5. Software reference for SaTool - a Tool for Structural Analysis of Automated Systems

    DEFF Research Database (Denmark)

    Lorentzen, Torsten; Blanke, Mogens

    2004-01-01

    This software reference details the functions of SaTool – a tool for structural analysis of technical systems. SaTool is intended used as part of an industrial systems design cycle. Structural analysis is a graph-based technique where principal relations between variables express the system...... of the graph. SaTool makes analysis of the structure graph to provide knowledge about fundamental properties of the system in normal and faulty conditions. Salient features of SaTool include rapid analysis of possibility to diagnose faults and ability to make autonomous recovery should faults occur....

  6. Improvement of chronic back pain or failed back surgery with vitamin D repletion: a case series.

    Science.gov (United States)

    Schwalfenberg, Gerry

    2009-01-01

    This article reviews 6 selected cases of improvement/resolution of chronic back pain or failed back surgery after vitamin D repletion in a Canadian family practice setting. Pub Med was searched for articles on chronic back pain, failed back surgery, and vitamin D deficiency. Chronic low back pain and failed back surgery may improve with repletion of vitamin D from a state of deficiency/insufficiency to sufficiency. Vitamin D insufficiency is common; repletion of vitamin D to normal levels in patients who have chronic low back pain or have had failed back surgery may improve quality of life or, in some cases, result in complete resolution of symptoms.

  7. CT findings in ten patients with failed renal allografts: comparison with findings in functional grafts

    Energy Technology Data Exchange (ETDEWEB)

    Gayer, Gabriela E-mail: gayer_h@netvsion.net.il; Apter, Sara; Katz, Rama; Ben-David, Aharon; Katzir, Ze' ev; Hertz, Marjorie

    2000-12-01

    Our aim is to report the computed tomography (CT) features of the long-term failed renal allograft. Ten patients with failed renal transplants in whom the graft was left in situ underwent CT for various unrelated indications. The majority of the failed grafts showed marked shrinkage and coarse punctate diffuse parenchymal calcifications. Small cysts were seen in four grafts. A long-term failed renal transplant appeared on CT as a small rounded soft tissue mass. The graft was almost always heavily calcified. Lack of awareness of the nature of such a mass may mislead the radiologist in interpreting it as a space-occupying lesion.

  8. A participação do enfermeiro de saúde pública na saúde familiar

    Directory of Open Access Journals (Sweden)

    Zélia Sena Costa

    1986-09-01

    Full Text Available As autoras partem do pressuposto de que o avanço da epidemiologia tem demonstrado que muitas enfermidades estão associadas a determinadas estruturas sociais. Face a um enfoque científico, humanístico e personalizado, o Enfermeiro tem conquistado um papel de destaque junto à família, uma vez que este grupo social se constitui em uma via estratégica para utilização de parâmetros psicossocias tendo em vista a função básica de ajuda e apoio. Considerando que a contribuição do Enfermeiro de Saúde Pública é de vital importância para a melhoria do nível de saúde familiar, concluem que existe uma necessidade premente da aplicação adequada do Processo de Enfermagem a nível familiar, propondo a inserção da concepção - unidade familiar - como princípio básico da Assistência de Enfermagem.

  9. O conceito de saúde The health's concept

    Directory of Open Access Journals (Sweden)

    Marco Segre

    1997-10-01

    Full Text Available Questiona-se a atual definição de saúde da Organização Mundial da Saúde: "situação de perfeito bem-estar físico, mental e social" da pessoa, considerada ultrapassada, primeiramente, por visar a uma perfeição inatingível, atentando-se as próprias características da personalidade. Menciona-se como principal sustentação dessa idéia, a renúncia necessária a parte da liberdade pulsional do homem, em troca da menor insegurança propiciada pelo convívio social. Discute-se a validade da distincão entre soma, psique e sociedade, esposando o conceito de homem "integrado", e registrando situações em que a interação entre os três aspectos citados é absolutamente cristalina. É revista a noção de qualidade de vida sob um vértice antipositivista. Essa priorização e proposta de resgate do subjetivismo, reverte a um questionamento da atual definição de saúde, toda ela embasada em avaliações externas, "objetivas", dessa situação.Objections to the present WHO (World Health Organization definition of HEALTH, as "the state of perfect physical, mental and social well-being", are expressed. It is considered to be anachronistic, first because it aims at perfection which is unaltainelle because of distict personality characteristics. As the main support for this idea, the necessary renunciation of part of man's drive to liberty in exchange for the lesser insecurity provided by social life (Freud, Castoriadis and Mc Dougall, is groted. The validity of distinguishing between "soma", "psyche" and "society" is questioned and the concept of the "integrated man", alluding to Pierre Marty and to Freud himself is adapted, and situations are recalled in which the interaction of the three aspects mentioned above is actually evident. Finally, the notion of the quality of life, in accordance with an antipositivistic taken from Bion, point of view, is discussed, and the concept that reality is that of each human being, is adapted. This

  10. Left ventricular assist device effects on metabolic substrates in the failing heart.

    Directory of Open Access Journals (Sweden)

    Lindsay B Weitzel

    Full Text Available BACKGROUND: Heart failure patients have inadequate nutritional intake and alterations in metabolism contributing to an overall energy depleted state. Left ventricular assist device (LVAD support is a common and successful intervention in patients with end-stage heart failure. LVAD support leads to alterations in cardiac output, functional status, neurohormonal activity and transcriptional profiles but the effects of LVADs on myocardial metabolism are unknown. This study set out to measure cardiac metabolites in non-failing hearts, failing hearts, and hearts post-LVAD support. METHODS: The study population consisted of 8 non-ischemic failing (at LVAD implant and 8 post-LVAD hearts, plus 8 non-failing hearts obtained from the tissue bank at the University of Colorado. NMR spectroscopy was utilized to evaluate differences in myocardial energy substrates. Paired and non-paired t-tests were used to determine differences between the appropriate groups. RESULTS: Glucose and lactate values both decreased from non-failing to failing hearts and increased again significantly in the (paired post-LVAD hearts. Glutamine, alanine, and aromatic amino acids decreased from non-failing to failing hearts and did not change significantly post-LVAD. Total creatine and succinate decreased from non-failing to failing hearts and did not change significantly post-LVAD. DISCUSSION: Measured metabolites related to glucose metabolism are diminished in failing hearts, but recovered their values post-LVAD. This differed from the amino acid levels, which decreased in heart failure but did not recover following LVAD. Creatine and the citric acid cycle intermediate succinate followed a similar pattern as the amino acid levels.

  11. 美国SA8000标准介绍

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(Social Accoutability 8000的英文简称)是其中最有名的标准之一。企业社会责任是指企业在赚取利润的同时,主动承担对环境、社会和利益相关者的

  12. Impacto da microbiota intestinal na saúde mental

    OpenAIRE

    Landeiro, Joana Almeida Vilão Raposo

    2016-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A microbiota intestinal consiste no conjunto de microrganismos residentes no intestino humano e que é responsável pela execução de diversas funções, sendo essencial para a manutenção da homeostase. Esta encontra-se em comunicação com o sistema nervoso central através do eixo intestino-cérebro, sendo esta comunicação bidirecional. Vários estudos têm revelado que a microbiota intestinal influenc...

  13. Editorial challenges of the Revista de Saúde Pública.

    Science.gov (United States)

    Antunes, José Leopoldo Ferreira; França Júnior, Ivan; de Andrade, Maria Teresinha Dias; Barata, Rita de Cássia Barradas; Monteiro, Carlos Augusto

    2015-07-01

    The editors of the Revista de Saúde Pública describe the journal's editorial profile and discuss the challenges of scientific publication in the area. A historical overview of almost 50 years of the journal is reported, with the temporal projection of their bibliometric indicators. Qualitative and quantitative parameters of its editorial profile and indexes are also reported. Budget constraints and the actions being taken to address them are discussed. The difficulty in allocating reviewers for manuscripts submitted to the editorial process is also discussed; an issue that affects scientific publication in many areas of knowledge. In particular, we sought to reflect on the proposal of measures to boost the editorial process by alleviating the shortage of reviewers and their possible harmful consequences for the editorial process.

  14. STRATEGI PENINGKATAN DAYA SAING RUMAH POTONG AYAM PT XYZ

    Directory of Open Access Journals (Sweden)

    Arli Arli

    2012-07-01

    chicken-based food company in Indonesia.Keywords:  competitiveness, global value chain, poultry slaughterhouse, PT XYZABSTRAKTujuan penelitian ini adalah (1 menganalisis peran aktor-aktor di dalam rantai nilai Rumah Potong Ayam (RPA PT XYZ  yang berpengaruh terhadap daya saingnya, (2 menganalisis para pemain kunci dalam stakeholders RPA PT XYZ , (3 menganalisis faktor-faktor internal dan eksternal (IE yang berpengaruh terhadap daya saing RPA PT XYZ , (4 memformulasikan tujuan dan sasaran jangka panjang strategik untuk meningkatkan daya saing RPA PT XYZ , (5 menganalisis alternatif dan prioritas strategi untuk meningkatkan daya saing RPA PT XYZ . Metode yang digunakan adalah analisis deskriptif. Analisis yang digunakan adalah global value chain, analisis stakeholder, internal factor evaluation, external factor evaluation, matriks IE, SWOT, dan quantitative strategic planning matrix. Hasil dari analisis global value chain, analisis stakeholders, analisis internal dan eksternal, dan visi-misi perusahaan, tujuan jangka panjang adalah (a menyediakan nilai tambah bagi pelanggan, (b memaksimalkan laba dari hasil operasi bisnis, (c meningkatkan kesejahteraan stakeholders, (d melakukan kegiatan sustainable business. Hasil matriks IE dan analisis SWOT, strategi untuk mencapai sasaran dan tujuan jangka panjang strategik adalah (a meningkatkan efektivitas dan efisiensi manajemen rantai pasok; (b mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis; (c memperkuat  citra sebagai perusahaan domestik penghasil makanan olahan berbasis daging ayam berkualitas tinggi di Indonesia; (d meningkatkan kegiatan penelitian dan pengembangan; (e membangun aliansi strategik dengan pemasok ayam hidup eksternal; (f melakukan sosialisasi mengenai pentingnya konsumsi protein hewani kepada masyarakat Indonesia. Tiga strategi prioritas dari analisis QSPM adalah meningkatkan efektivitas dan efisiensi rantai pasok, mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis, dan

  15. Saúde mental: reconstruindo saberes em enfermagem

    Directory of Open Access Journals (Sweden)

    Francisca Bezerra de Oliveira

    2003-02-01

    Full Text Available O manicômio, apesar de criticado, reformado ou mesmo negado, ainda é uma prática preponderante no cuidado às pessoas com transtornos mentais. Tal prática tem como princípio básico o isolamento do doente mental, contrariando todas as possibilidades de assistência centrada num humanismo ético. Este ensaio procura interpretar a institucionalização do asilo, da psiquiatria, da doença mental e o processo da reforma psiquiátrica, buscando contribuir para as reflexões acerca da desinstitucionalização e dos saberes e práticas de enfermagem em saúde mental.

  16. SalSA: A Teraton UHE Neutrino Detector

    Energy Technology Data Exchange (ETDEWEB)

    Reil, Kevin; /SLAC

    2006-04-19

    The observed spectrum of ultra-high energy cosmic rays virtually guarantees the presence of ultra-high energy neutrinos due to their interaction with the cosmic microwave background. Unlike cosmic rays, each of these neutrinos will point back directly to its source and will arrive at the Earth unattenuated, from sources perhaps as distant as z = 20. The neutrino telescopes currently under construction, should discover a handful of these events, probably too few for detailed study. This paper describes how an array of VHF and UHF antennas embedded in a large salt dome, SalSA (Salt dome Shower Array) promises to yield a teraton detector (> 500 km{sup 3 sr}) for contained neutrino events with energies above 10{sup 17} eV. Our simulations show that such a detector may observe several hundreds of these neutrinos over its lifetime with excellent angular resolution providing source locations.

  17. Teaching Computer System-DMT DESIGN(SA.1

    Directory of Open Access Journals (Sweden)

    A. O. Shteynberg

    2012-01-01

    Full Text Available Тhe paper introduces the training computer system of sub- agential type based on a didactic multidimensional technology. The methodology bases incorporate the systematic activity approach, some elements of artificial intelligence theory, and the instrumental didactic theory and technology developed by Scientific Experimental Laboratory at Bashkirsky State Pedagogical University. The above training system – Didactic Multidimensional Technology Design of Sub-Agential Type (DMT_DESIGN (SA.1 – has been developed for raising teachers’ technological competence and creativity regarding both the general and vocational education. Its training structure is specified by invariant socio-cultural and anthropological bases; logically semantic modeling of course materials is provided. The research data can be used by people, engaged in developing educational information technologies; practicing teachers; and post-graduates conducting research and implementing the findings. 

  18. Bien communiquer sur sa thèse, suite.

    Directory of Open Access Journals (Sweden)

    Philippe Heller

    2005-07-01

    Full Text Available Après une brève présentation sur lui-même, Edouard Paulino du Craft (Centre de recherche et d’appui pour la formation et ses technologies, qui travaille à l’ Epfl lance le débat : que signifie communiquer sur sa thèse ? Parmi le petit auditoire de doctorants présents, les questions-réponses fusent : à qui s’adresse-t-on ? Pourquoi ? Comment s’adapter à son auditoire ? Mais en fait qu’est-ce que communiquer ? Doit-on suivre forcément son plan de thèse ou ...

  19. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  20. Comunicação entre usuários e trabalhadores de saúde em colegiados de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Marcelen Palu Longhi

    2013-02-01

    Full Text Available Atualmente, têm sido observados problemas relativos à comunicação nos fóruns de participação social da saúde. O presente estudo tem o objetivo de analisar a comunicação entre usuários e trabalhadores de saúde, em colegiados da Saúde da Família. O referencial teórico utilizado foi a Teoria da Ação Comunicativa de Habermas. Realizou-se uma pesquisa qualitativa. Os dados coletados revelaram duas dimensões que se entrelaçavam: distanciamentos e aproximações entre usuários e trabalhadores de saúde. Quanto aos distanciamentos, destacaram-se a presença de relações assimétricas, de coerção e de manipulação por parte dos trabalhadores de saúde, processos que prejudicam a participação dos usuários. Por outro lado, estiveram presentes momentos de interação e lutas por direitos, abordados nas aproximações entre usuários e trabalhadores de saúde. Por fim, consideramos que a comunicação nos colegiados da Saúde da Família apresenta potencialidades e limites, sendo que estes devem ser problematizados, especialmente, por meio da educação permanente em saúde.

  1. 企业社会责任与SA8000

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    国际市场正逐渐认可的一种新兴的标准体系——SA8000(Social Accoutability 8000,社会责任标准8000),社会责任国际(Social Accountability International,简称SAI)是SA8000标准(即社会责任标准)的制订和执行机构,其前身为1997年成立的美国经济优先认可委员会(CEPAA),总都设在美国纽约,2001年该组织更改为现名。这个全球首个对企业进行道德规范的标准自1997年问世以来,受到了公众极大的关注,如同ISO9000、ISO14000、HACCP等标准体系,已成为国际市场的“通行证”。尽管国内对这个标准还有不同意见,但是通过规范的制度化的约束机制来推动企业社会责任建设,是一个必然的趋势。海尔集团首席执行官张瑞敏说;“责任和利润不是博弈关系。人们对百年老店做过调查,他们都倡导社会责任第一,利益、利润第二。”(以下中译文仅供参考)

  2. Pass/fail patterns of candidates who failed COMLEX-USA level 2-PE because of misrepresentation of clinical findings on postencounter notes.

    Science.gov (United States)

    Langenau, Erik E; Sandella, Jeanne M

    2011-07-01

    In 2007, The National Board of Osteopathic Medical Examiners (NBOME) instituted a policy to address the accuracy and integrity of postencounter written documentation recorded during the Comprehensive Osteopathic Medical Licensing Examination Level 2-Performance Evaluation (COMLEX-USA Level 2-PE). This policy was instituted not only to protect the integrity of the examination, but also to highlight that overdocumentation of clinical findings not obtained during patient encounters may jeopardize patient safety. To investigate overall and domain pass/fail patterns of candidates who misrepresented clinical findings with regard to past and subsequent performance on COMLEX-USA Level 2-PE. Specifically, to investigate what percentage of candidates failed because of misrepresentation on first attempts and how they performed on subsequent administrations, as well as the previous performance patterns of candidates who failed because of misrepresentation on examination retakes. Historical records from NBOME's COMLEX-USA Level 2-PE database (testing cycles 2007-2008, 2008-2009, and 2009-2010) were used to analyze overall and domain pass/fail patterns of candidates who failed at least once because of misrepresentation of clinical findings. Of the 24 candidates who failed because of misrepresentation of postencounter (SOAP) notes, 20 candidates (83%) were first-time examinees. Four candidates (17%) were repeating the examination, 2 of whom were making a third attempt to pass. Among these 20 candidates who failed because of misrepresentation of clinical findings on their first attempt, 19 passed on their next attempt. At the time of study analysis, all but 2 candidates eventually passed the examination in subsequent attempts. Among candidates found to have misrepresented clinical findings on postencounter written documentation on COMLEX-USA Level 2-PE, no pattern existed between their past or subsequent performance with regard to overall or domain pass/fail results. The vast

  3. Fail-Safe Entrepreneurship: Six Reasons You Shouldn't Start a Small Business.

    Science.gov (United States)

    Paradiso, James R.

    Given the statistic that 97 percent of all new businesses fail, it is unwise to enter into a new small business venture. Many aspiring entrepreneurs lack the characteristics and background they need to survive and instead display several common characteristics which predispose them to failure, such as being non-aggressive and casual, failing to…

  4. Failure to Fail in a Final Pre-Service Teaching Practicum

    Science.gov (United States)

    Danyluk, Patricia J.; Luhanga, Florence; Gwekwerere, Yovita N.; MacEwan, Leigh; Larocque, Sylvie

    2015-01-01

    This article presents a Canadian perspective on the issue of failure to fail in Bachelor of Education programs. The issue of failure to fail in Bachelor of Education programs is one that had not been explored in any great detail. What literature does exist focuses on the strain that a teacher experiences when s/he mentors a student teacher…

  5. The Value of Failing in Career Development: A Chaos Theory Perspective

    Science.gov (United States)

    Pryor, Robert G. L.; Bright, James E. H.

    2012-01-01

    Failing is a neglected topic in career development theory and counselling practice. Most theories see failing as simply the opposite of success and something to be avoided. It is contended that the Chaos Theory of Careers with its emphasis on complexity, uncertainty and consequent human imitations, provides a conceptually coherent account of…

  6. Neglected City Narratives And Failed Rebranding: Focusing On Riga And Aarhus

    DEFF Research Database (Denmark)

    Mousten, Birthe; Locmele, Gunta

    2017-01-01

    Rīga, Latvia went through a failed rebranding process as the forerunner of its status as a European Capital of Culture (2014). The same thing happened in Aarhus, Denmark. Aarhus will be a European Capital of Culture (2017) and leading to this, it went through a failed rebranding process. Based on...

  7. The Value of Failing in Career Development: A Chaos Theory Perspective

    Science.gov (United States)

    Pryor, Robert G. L.; Bright, James E. H.

    2012-01-01

    Failing is a neglected topic in career development theory and counselling practice. Most theories see failing as simply the opposite of success and something to be avoided. It is contended that the Chaos Theory of Careers with its emphasis on complexity, uncertainty and consequent human imitations, provides a conceptually coherent account of…

  8. 38 CFR 1.986 - Result if employee fails to meet deadlines.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Result if employee fails to meet deadlines. 1.986 Section 1.986 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS GENERAL PROVISIONS Salary Offset Provisions § 1.986 Result if employee fails to meet deadlines. An...

  9. 49 CFR 1017.6 - Result if employee fails to meet deadlines.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Result if employee fails to meet deadlines. 1017.6... OFFSET FROM INDEBTED GOVERNMENT AND FORMER GOVERNMENT EMPLOYEES § 1017.6 Result if employee fails to meet... this part whichever is applicable, will not result in denial of a hearing or in immediate offset, if...

  10. 7 CFR 3.76 - Result if employee fails to meet deadlines.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Result if employee fails to meet deadlines. 3.76 Section 3.76 Agriculture Office of the Secretary of Agriculture DEBT MANAGEMENT Federal Salary Offset § 3.76 Result if employee fails to meet deadlines. An employee will not be granted a hearing and will...

  11. The Role of Tertiary Education in Fixing Failed States: Globalization and Public Goods

    Science.gov (United States)

    Tierney, William G.

    2011-01-01

    The plight of nations labeled as "failed" is well-documented, as are suggested strategies to fix them. One area that receives a great deal of focus in the extant literature is education. How can education contribute to the rebuilding of a failed State? Most often the responses to this question focus on the importance of reestablishing primary and…

  12. The effect of bosentan in patients with a failing Fontan circulation

    NARCIS (Netherlands)

    Ovaert, Caroline; Thijs, Daisy; Dewolf, Daniel; Ottenkamp, Jaap; Dessy, Hugues; Moons, Philip; Gewillig, Marc; Mertens, Luc

    2009-01-01

    Objectives: To investigate the effect of bosentan in patients with a failing Fontan circulation. Design: A multicentric open label, non-controlled study. Setting: 5 tertiary care centres for congenital cardiology. Patients: We included 10 patients with a failing Fontan circulation. Their median age

  13. Ineffective Staff, Ineffective Supervision, or Ineffective Administration? Why Some Nursing Homes Fail to Provide Adequate Care.

    Science.gov (United States)

    Sheridan, John E.; And Others

    1992-01-01

    This study involved 530 nursing staff working in 25 for-profit and nonprofit nursing homes, 2 of which failed to meet residential care standards. Nursing home climate in failed homes was perceived as being significantly lower in human relations and higher in laissez-faire and status orientation dimensions that the climate in the successful homes.…

  14. Understanding "Failed" Markets: Conflicting Logics and Dissonance in Attempts to Price the Priceless Child

    NARCIS (Netherlands)

    Vermeulen, P.A.M.; Ansari, S.; Lounsbury, M.

    2017-01-01

    While scholars have developed increasingly well-developed accounts of institutional change, little attention has been paid to how change is resisted and, in particular, how efforts to marketize fail. We draw on the institutional logics perspective to guide analysis of an empirical case of the failed

  15. 40 CFR 141.561 - What happens if my system's turbidity monitoring equipment fails?

    Science.gov (United States)

    2010-07-01

    ... happens if my system's turbidity monitoring equipment fails? If there is a failure in the continuous... 40 Protection of Environment 22 2010-07-01 2010-07-01 false What happens if my system's turbidity monitoring equipment fails? 141.561 Section 141.561 Protection of Environment ENVIRONMENTAL PROTECTION...

  16. When Success Makes Me Fail: (De)constructing Failure and Success in a Conventional American Classroom

    Science.gov (United States)

    DePalma, Renee

    2008-01-01

    This article examines the case of Laura, a 9-year-old Mexican immigrant who officially "failed to learn English" in an American school. It may be more accurate to say that schooling failed Laura, and in ways that went beyond language learning. This diagnosis of failure is criticized, along with the individualistic and essentialist assumptions…

  17. Turning the Question Around: Do Colleges Fail to Meet Students' Expectations?

    Science.gov (United States)

    Rosenbaum, James E.; Becker, Kelly Iwanaga; Cepa, Kennan A.; Zapata-Gietl, Claudia E.

    2016-01-01

    Research often focuses on how students fail to meet college expectations, but it rarely asks how colleges fail to meet students' expectations. This study examines students' expectations of college and their institutional confidence--their level of certainty that college will meet their expectations. Drawing on 65 pilot interviews and a survey of…

  18. Saúde mental na Estratégia Saúde da Família: a avaliação de apoio matricial

    Directory of Open Access Journals (Sweden)

    Fernanda Barreto Mielke

    2010-12-01

    Full Text Available O objetivo deste artigo é avaliar o apoio matricial na perspectiva de 14 profissionais de uma unidade de saúde da família em um estudo avaliativo qualitativo realizado a partir da Avaliação de Quarta Geração. Os dados foram coletados por meio de observação e entrevistas e analisados pelo Método Comparativo Constante, enfocando a inclusão de ações de saúde mental na Estratégia Saúde da Família. Os profissionais das equipes estudadas avaliaram a necessidade de retaguarda assistencial e orientações técnicas de equipes especializadas em saúde mental para a realização de ações de saúde mental no território, o que poderia ser implementado por meio do apoio matricial. Avaliamos que este arranjo organizacional é importante na construção de ações de saúde mental no território.

  19. Homossexualidade e o direito à saúde: um desafio para as políticas públicas de saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Grayce Alencar Albuquerque

    Full Text Available Objetivou-se evidenciar a atuação das políticas públicas direcionadas à saúde da população homossexual brasileira. Trata-se de uma revisão integrativa da literatura, realizada na Scientific Eletronic Library Online (SciELO e na Literatura Latino-Americana e do Caribe em Ciências da Saúde (Lilacs, utilizando os Decs: políticas públicas, assistência integral à saúde e homossexualidade. A saúde LGBT é apontada como vulnerável mesmo após a publicação de importantes documentos que garantem o acesso e a inclusão do grupo na saúde. A fragilidade na efetivação das propostas preconizadas vão ao encontro ao atendimento discriminatório e heteronormativo prestado pelos profissionais de saúde.

  20. A música popular brasileira na construção do conhecimento em Saúde Pública: o tema processo de trabalho e saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    2014-01-01

    Full Text Available Este estudo destaca temas relativos ao trabalho e à saúde na música popular brasileira, especialmente no samba. Tem como objetivo apresentar um corpo de conhecimentos sobre o tema processo de trabalho e saúde. Nas canções selecionadas foram identificadas categorias tomadas como ponto de partida para discussão com a literatura. Com o desenvolvimento do texto, percebe-se o manancial da canção popular para proporcionar conteúdos sobre múltiplas dimensões do processo de trabalho e do processo saúde-doença dos trabalhadores, inclusive a dimensão coletiva e histórica da luta pelo direito à saúde. Esta pesquisa resultou na valorização da música popular brasileira como uma forma de se entenderem as relações trabalho-saúde e de se desenvolver conhecimento em Saúde Coletiva.

  1. Percepções e atuação do Agente Comunitário de Saúde em saúde mental

    Directory of Open Access Journals (Sweden)

    Maria Angélica Pagliarini Waidman

    2012-10-01

    Full Text Available Este estudo teve como objetivo identificar as percepções de Agentes Comunitários de Saúde acerca de saúde e transtorno mental, bem como verificar o preparo desses agentes para atuar na área. Trata-se de uma pesquisa qualitativa que utilizou como técnica de coleta de dados a entrevista semiestruturada e, para interpretação dos dados, a técnica de análise de conteúdo. Foram entrevistados 45 Agentes Comunitários de Saúde da Estratégia Saúde da Família, pertencentes às 21 unidades básicas de saúde do município de Maringá, PR. Os resultados obtidos demonstram os preconceitos em relação ao transtorno mental desses profissionais, que reconhecem a importância de se trabalhar tanto com o portador quanto com a família, mas não se sentem capacitados para prestar uma assistência adequada. Por compartilharem o mesmo contexto social e por conhecerem de perto a dinâmica da comunidade, vislumbramos os agentes como importantes facilitadores no cuidado à saúde mental.

  2. The Staphylococcus aureus Membrane Protein SA2056 Interacts with Peptidoglycan Synthesis Enzymes

    Directory of Open Access Journals (Sweden)

    Brigitte Berger-Bächi

    2013-01-01

    Full Text Available The yet uncharacterized membrane protein SA2056 belongs to the ubiquitous RND (Resistance-Nodulation-cell Division family of transmembrane efflux transporters. The sa2056 gene is located downstream of femX, the gene encoding the essential, non-ribosomal peptidyl-transferase adding the first glycine in the staphylococcal cell wall pentaglycine interpeptide. Due to its proximity to and weak co-transcription with femX, we assumed that sa2056 may somehow be involved in peptidoglycan synthesis. Specific antibodies against SA2056 showed that this protein is expressed during growth and present in the membrane fraction of cell preparations. Using a bacterial two hybrid system, SA2056 was shown to interact (i with itself, (ii with FemB, which adds glycines 4 and 5 to the peptidoglycan interpeptide and (iii with the essential penicillin binding proteins, PBP1 and PBP2, required for cell division and incorporation of the peptidoglycan into the cell wall. Unexpectedly, deletion of sa2056 led to no phenotype regarding growth, antibiotic resistances or cell morphology; nor did sa2056 deletion in combination with femB inactivation alter b-lactam and lysostaphin sensitivity and resistance, respectively, pointing to possible redundancy in the cell wall synthesis pathway. These results suggest an accessory role of SA2056 in S. aureus peptidoglycan synthesis, broadening the range of biological functions of RND proteins.

  3. 78 FR 5712 - Airworthiness Directives; CFM International, S.A. Turbofan Engines Modified by Supplemental Type...

    Science.gov (United States)

    2013-01-28

    ..., S.A. Turbofan Engines Modified by Supplemental Type Certificate SE00034EN AGENCY: Federal Aviation... directive (AD) for CFM International, S.A. CFM56-3, CFM56-3B, and CFM56-3C turbofan engines. This AD... of multiple turbine blades, damage to the engine, and damage to the airplane. DATES: This AD...

  4. Intersetorialidade na política de saúde do idoso

    Directory of Open Access Journals (Sweden)

    Grossi, Patricia Krieger

    2006-01-01

    Full Text Available Este artigo versa sobre a intersetorialidade na política de saúde do idoso. Apresenta uma discussão referente à conceituação e à construção da intersetorialidade. Aborda a saúde do idoso nos aspectos conceituais, legais e no enfrentamento de problemas concretos

  5. Draft Genome Sequence of Ochrobactrum intermedium Strain SA148, a Plant Growth-Promoting Desert Rhizobacterium

    KAUST Repository

    Lafi, Feras Fawzi

    2017-03-03

    Ochrobactrum intermedium strain SA148 is a plant growth-promoting bacterium isolated from sandy soil in the Jizan area of Saudi Arabia. Here, we report the 4.9-Mb draft genome sequence of this strain, highlighting different pathways characteristic of plant growth promotion activity and environmental adaptation of SA148.

  6. Educação Popular e Saúde e democracia no Brasil

    Directory of Open Access Journals (Sweden)

    Eduardo Navarro Stotz

    2014-12-01

    Full Text Available O ensaio se propõe a entender os limites, as possibilidades e os desafios do controle social do Sistema Único de Saúde à luz de uma reflexão sobre a democracia no Brasil com base nas referências da Educação Popular e Saúde.

  7. Data of evolutionary structure change: 1C5SA-1QRZD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available dbID> A 1C5SA AHCYK-----SGIQV ...>GGG ----- EEE> ATOM 550 CA ALA A 56 34.816 22.651...QRZD AHCLEKSPRPSSYKV >EGGG EEEe>...DChain>1C5SA SCKSA--YPGQI ure>HHHHH-- ...DChain> VCNRYEFLNGRV >HH > <

  8. Data of evolutionary structure change: 1O2SA-2FOHA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1O2SA SLNSG-----YHFCG >EEE ----- EE...ID>2FOH A 2FOHA SLQYRSGSSWAHTCG ...>EEEEEE EEE EEucture> ATOM 123 CA SER A 32 53....yIDChain>1O2SA PVVCS----GKLQG >EEEE ---- EEEE...LHCLVNGQYAVHG >EEEEEE EEEEEEe>

  9. Best Practices Case Study: S&A Homes, East Liberty, PIttsburgh, PA

    Energy Technology Data Exchange (ETDEWEB)

    None

    2010-12-01

    S&A Homes worked with Building America's IBACOS and architects Pfaffmann & Associates and Moss Associates to design energy-efficient homes for urban in-fill lots. This is a new market for S&A Homes, which builds over 500 homes a year using suburban designs.

  10. 77 FR 25644 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. Airplanes

    Science.gov (United States)

    2012-05-01

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira...) that apply to all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ 190 airplanes... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  11. 75 FR 47190 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135...

    Science.gov (United States)

    2010-08-05

    ...-212-AD; Amendment 39-16378; AD 2010-16-02] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 Airplanes; and Empresa Brasileira de Aeronautica S.A..., 44701. Sec. 39.13 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-16-02...

  12. 75 FR 52263 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... [Amended] 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-18-04 Empresa Brasileira de..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060),...

  13. 77 FR 36224 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-06-18

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 airplanes, and Model EMB-145... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  14. 76 FR 27237 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-05-11

    ...-153-AD; Amendment 39-16684; AD 2011-10-03] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-10-03 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16684... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  15. 78 FR 66258 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2013-11-05

    ...-194-AD; Amendment 39-17650; AD 2013-22-18] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... directive (AD) for certain Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER, - 135KE, -135KL... information identified in this AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER),...

  16. 75 FR 260 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-01-05

    ...; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 STD, -100... Friday, except Federal holidays. For service information identified in this proposed AD, contact Empresa... amends Sec. 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A....

  17. Hydrogen infrastructure within HySA national program in South Africa: road map and specific needs

    CSIR Research Space (South Africa)

    Bessarabov, D

    2012-01-01

    Full Text Available The Department of Science and Technology of South Africa developed the National Hydrogen and Fuel Cells Technologies (HFCT) Research, Development and Innovation Strategy. The National Strategy was branded Hydrogen South Africa (HySA). HySA has been...

  18. Aprendem doença, educam para a saúde : influência da formação, em futuros profissionais de saúde em concepções saúde/doença, educação para a saúde e sua implementação

    OpenAIRE

    Araújo, Isabel Maria Batista de

    2004-01-01

    Dissertação de mestrado em Educação, área de especialização em Educação para a Saúde Sucessivas reuniões internacionais apelam à implementação de actividades de educação para a saúde, apoiando-se na evolução do conceito de saúde, entendido como um recurso, um estado positivo de bem-estar individual e comunitário. Perspectivam a educação para a saúde como processo de capacitar os indivíduos e comunidades a aumentar o controlo sobre os factores que determinam a saúde através de diferentes me...

  19. An efficient hybrid evolutionary optimization algorithm based on PSO and SA for clustering

    Institute of Scientific and Technical Information of China (English)

    Taher NIKNAM; Babak AMIRI; Javad OLAMAEI; Ali AREFI

    2009-01-01

    The K-means algorithm is one of the most popular techniques in clustering. Nevertheless, the performance of the Kmeans algorithm depends highly on initial cluster centers and converges to local minima. This paper proposes a hybrid evolutionary programming based clustering algorithm, called PSO-SA, by combining particle swarm optimization (PSO) and simulated annealing (SA). The basic idea is to search around the global solution by SA and to increase the information exchange among particles using a mutation operator to escape local optima. Three datasets, Iris, Wisconsin Breast Cancer, and Riplcy's Glass, have been considered to show the effectiveness of the proposed clustering algorithm in providing optimal clusters. The simulation results show that the PSO-SA clustering algorithm not only has a better response but also converges more quickly than the K-means, PSO, and SA algorithms.

  20. A eterna busca da verdade em Die Lehrlinge zu Saïs, de Novalis

    Directory of Open Access Journals (Sweden)

    Natália Corrêa Porto Sanches Fadel

    2010-01-01

    Full Text Available The purpose of this essay is to undergo an investigation geared towards identifying the consolidation of the symbolized Upper or Ideal Truth illustrated by the figure of the goddess Saïs in the fragmentary novel Die Lehrlinge zu Saïs, from Novalis, written in 1801. As part of our approach, we traced a parallel between the allegorical use of Saïs myth by Novalis and in Schiller´s poem Das verschleierte Bild zu Saïs, aiming at a better characterization of Novalis' concept of the Ideal Truth. Lastly, we analyzed the fairy tale Hyazinth und Rosenblüte, which is part of the novel Die Lehrlinge zu Saïs, where it is possible to envisage the finding of the Ideal Truth searched by the poets of German Early Romanticism, especially by Novalis.

  1. Qualidade de vida relacionada à saúde de filhos de profissionais da área de saúde

    Directory of Open Access Journals (Sweden)

    Silvia Maria Moussi Gamallo

    2012-12-01

    Full Text Available Neste estudo mensuramos a qualidade de vida relacionada à saúde (QVRS e a fadiga de filhos de profissionais da área da saúde, com idades entre 2 e 11 anos, e avaliamos os hábitos diários e o sono dessas crianças e dos respectivos pais. Foram incluídas no estudo crianças de uma escola pública. Dados demográficos e dados de hábitos diários foram colhidos. A QVRS, o sono e a fadiga foram mensurados por questionários. Participaram 249 pais - 63,5% referiram sono adequado e 47,4% acordavam cansados. A média da idade das crianças foi 5,6 anos - 62,2% assistiam televisão no quarto, 50% usavam computador (> 4 horas/dia e 27,8% faziam atividades físicas extracurriculares. O escore do sono foi de 45,8 ± 12,2. Os escores de QVRS foram mais elevados no aspecto físico e mais baixos no emocional. Detectamos que o sono de pior qualidade dos filhos e dos pais pode estar relacionado à pior QVRS dos filhos. Concluímos que os hábitos inadequados dos pais, bem como das crianças, estão relacionados a uma diminuição da QVRS dos filhos, especialmente no aspecto emocional.

  2. The ChrSA and HrrSA Two-Component Systems Are Required for Transcriptional Regulation of the hemA Promoter in Corynebacterium diphtheriae

    Science.gov (United States)

    Burgos, Jonathan M.

    2016-01-01

    ABSTRACT Corynebacterium diphtheriae utilizes heme and hemoglobin (Hb) as iron sources for growth in low-iron environments. In C. diphtheriae, the two-component signal transduction systems (TCSs) ChrSA and HrrSA are responsive to Hb levels and regulate the transcription of promoters for hmuO, hrtAB, and hemA. ChrSA and HrrSA activate transcription at the hmuO promoter and repress transcription at hemA in an Hb-dependent manner. In this study, we show that HrrSA is the predominant repressor at hemA and that its activity results in transcriptional repression in the presence and absence of Hb, whereas repression of hemA by ChrSA is primarily responsive to Hb. DNA binding studies showed that both ChrA and HrrA bind to the hemA promoter region at virtually identical sequences. ChrA binding was enhanced by phosphorylation, while binding to DNA by HrrA was independent of its phosphorylation state. ChrA and HrrA are phosphorylated in vitro by the sensor kinase ChrS, whereas no kinase activity was observed with HrrS in vitro. Phosphorylated ChrA was not observed in vivo, even in the presence of Hb, which is likely due to the instability of the phosphate moiety on ChrA. However, phosphorylation of HrrA was observed in vivo regardless of the presence of the Hb inducer, and genetic analysis indicates that ChrS is responsible for most of the phosphorylation of HrrA in vivo. Phosphorylation studies strongly suggest that HrrS functions primarily as a phosphatase and has only minimal kinase activity. These findings collectively show a complex mechanism of regulation at the hemA promoter, where both two-component systems act in concert to optimize expression of heme biosynthetic enzymes. IMPORTANCE Understanding the mechanism by which two-component signal transduction systems function to respond to environmental stimuli is critical to the study of bacterial pathogenesis. The current study expands on the previous analyses of the ChrSA and HrrSA TCSs in the human pathogen C

  3. Integration of TB and ART services fails to improve TB treatment ...

    African Journals Online (AJOL)

    [7,8] These delays could negatively influence TB ... [9-11]. In recent years, the SA National Department of Health (NDoH) .... Treatment was received 7 days per ... building. Included in this definition were both partially integrated services that ...

  4. Diretrizes Curriculares na saúde e as mudanças nos modelos de saúde e de educação

    Directory of Open Access Journals (Sweden)

    Carlos Otávio Fiúza Moreira

    2015-12-01

    Full Text Available Artigo produzido a partir de pesquisa bibliográfica e de questões formuladas para uma conferência no módulo “Educação na Saúde II” do Mestrado Profissional da Rede Nordeste de Formação em Saúde da Família. O texto discute questões dos campos da saúde e da educação relacionadas à emergência de novos modelos de saúde e de formação; analisa também as Diretrizes Curriculares Nacionais (DCN de três cursos da área da saúde (Medicina, Enfermagem e Odontologia como expressão desses novos modelos para saúde e para a educação. Uma questão transversal ao artigo são as relações entre os campos da saúde e da educação. Para isto, lança‑se mão do conceito de campo, desenvolvido pelo sociólogo Pierre Bourdieu. Considera‑se, ainda, o desafio de transformar as DCN em currículos e programas, ferramentas ou dispositivos necessários para fazer a passagem do que está prescrito para os cenários de ensino e aprendizagem.

  5. Hortas comunitárias como atividade promotora de saúde: uma experiência em Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Christiane Gasparini Araújo Costa

    2015-10-01

    Full Text Available ResumoA agricultura urbana e periurbana (AUP vem sendo praticada em diferentes espaços, contribuindo para a melhoria da saúde nas comunidades e ambientes mais saudáveis. Objetivando identificar significados e repercussões da prática da AUP em Unidades Básicas de Saúde (UBS, enquanto uma atividade de Promoção da Saúde (PS, e em que medida sua dimensão terapêutica a caracteriza como uma atividade alinhada às práticas integrativas e complementares, foi realizado um estudo transversal com abordagem qualitativa no município de Embu das Artes, SP. Da análise, emergiram as seguintes categorias: concepção de saúde, resultados na saúde, resgate de práticas e hábitos tradicionais e reorientação dos serviços de saúde. Identificou-se a estreita ligação entre a prática das hortas e as diretrizes e campos de ação da PS como: criação de ambientes saudáveis, reforço da ação comunitária, desenvolvimento de habilidades pessoais, estímulo à autonomia e empoderamento e demandas por reorientação dos serviços. As atividades de horta instituídas nas UBS se mostraram uma estratégia de implementação das práticas integrativas e complementares (PIC. Conclui-se que as atividades de cultivo nas hortas comunitárias mostram-se como práticas promotoras da saúde que integram elementos fundamentais das PIC.

  6. Vigilância ambiental em saúde e sua implantação no Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Christovam Barcellos

    2006-02-01

    Full Text Available A incorporação da vigilância ambiental no campo das políticas públicas de saúde é uma demanda relativamente recente no Brasil. Um dos principais desafios da vigilância ambiental em saúde é a definição do seu objeto e a especificidade de suas ações. O conceito ampliado de exposição, tratado não como um atributo da pessoa, mas do conjunto de relações complexas entre a sociedade e o ambiente, é central para a definição de indicadores e para a orientação da prática de vigilância ambiental. Entre as dificuldades encontradas para sua efetivação no Sistema Único de Saúde estão a necessidade de reestruturação das ações de vigilância em saúde e a formação de equipes multidisciplinares, com capacidade de diálogo com outros setores, além da construção de sistemas de informação capazes de auxiliar a análise de situações de saúde e a tomada de decisões. Nesse sentido, foi realizada uma revisão do objeto e conceitos da vigilância ambiental em saúde, bem como identificados os desafios para a sua implantação no Sistema Único de Saúde.

  7. Right ventricular arrhythmogenesis in failing human heart: the role of conduction and repolarization remodeling

    Science.gov (United States)

    Lou, Qing; Janks, Deborah L.; Holzem, Katherine M.; Lang, Di; Onal, Birce; Ambrosi, Christina M.; Fedorov, Vadim V.; Wang, I-Wen

    2012-01-01

    Increased dispersion of repolarization has been suggested to underlie increased arrhythmogenesis in human heart failure (HF). However, no detailed repolarization mapping data were available to support the presence of increased dispersion of repolarization in failing human heart. In the present study, we aimed to determine the existence of enhanced repolarization dispersion in the right ventricular (RV) endocardium from failing human heart and examine its association with arrhythmia inducibility. RV free wall preparations were dissected from five failing and five nonfailing human hearts, cannulated and coronary perfused. RV endocardium was optically mapped from an ∼6.3 × 6.3 cm2 field of view. Action potential duration (APD), dispersion of APD, and conduction velocity (CV) were quantified for basic cycle lengths (BCL) ranging from 2,000 ms to the functional refractory period. We found that RV APD was significantly prolonged within the failing group compared with the nonfailing group (560 ± 44 vs. 448 ± 39 ms, at BCL = 2,000 ms, P < 0.05). Dispersion of APD was increased in three failing hearts (161 ± 5 vs. 86 ± 19 ms, at BCL = 2,000 ms). APD alternans were induced by rapid pacing in these same three failing hearts. CV was significantly reduced in the failing group compared with the nonfailing group (81 ± 11 vs. 98 ± 8 cm/s, at BCL = 2,000 ms). Arrhythmias could be induced in two failing hearts exhibiting an abnormally steep CV restitution and increased dispersion of repolarization due to APD alternans. Dispersion of repolarization is enhanced across the RV endocardium in the failing human heart. This dispersion, together with APD alternans and abnormal CV restitution, could be responsible for the arrhythmia susceptibility in human HF. PMID:23042951

  8. Antropologia no campo da saúde global

    Directory of Open Access Journals (Sweden)

    João Biehl

    2011-06-01

    Full Text Available Neste artigo, eu exploro os limites de abordagens baseadas em balas mágicas para os problemas de saúde global e mostro como as iniciativas centradas nas pessoas desafiam as ortodoxias econômicas e dos direitos humanos e ampliam nossa percepção daquilo que é socialmente possível e desejável. Utilizo o meu estudo etnográfico de longo prazo sobre a resposta terapêutica brasileira ao HIV/AIDS e suas repercussões nos âmbitos de governo, mercados, sistemas de saúde e vida pessoal. Faço também o relato de um novo projeto comparativo sobre as consequências de grandes intervenções farmacêuticas em contextos com recursos limitados. Considerando tanto os processos mais amplos quanto as singularidades humanas, o artigo abre uma janela crítica para os valores e os resultados de intervenções farmacêuticas e humanitárias contemporâneas na vida real. Ao criticar as práticas institucionais de produção de evidência, também reconsidero as noções de responsabilidade e cuidado dentro da antropologia e da medicina.In this article, I explore the limits of magic-bullet approaches to global health problems and show how people-centered initiatives challenge economic and human rights orthodoxies and enlarge our sense of what is socially possible and desirable. I draw from my long-term ethnographic study of the Brazilian therapeutic response to HIV/AIDS and its repercussions through government, markets, health systems and personal lives. I also report on a new comparative project on the aftermath of large-scale pharmaceutical interventions in resource-poor settings. Attending to both larger processes and to human singularities, the article opens a critical window into the values and the real-life outcomes of contemporary pharmaceutical and humanitarian interventions. As I critique institutional evidence-making practices I also reconsider anthropology and medicine's notions of responsibility and care.

  9. Dinamičke simulacije solarnih kombi-sustava sa sezonskim sorpcijskim spremnikom topline: Utjecaj konfiguracije kombi-sustava.

    OpenAIRE

    Hennaut, Samuel; Thomas, Sébastien; Davin, Elisabeth; SKRYLNYK, Alexandre; Frere, Marc; Andre, Philippe

    2012-01-01

    Ovaj članak je fokusiran na dimenzioniranje solarnog kombi-sustava sa sezonskim adsorpcijskim spremnikom topline sa ciljem autonomnog solarnog grijanja prostora. Dvije konfiguracije kombi-sustava su simulirane, uključujući jedan ili dva toplinska spremnika. Utjecaj sezonskog skladištenja energije na dimenzioniranje spremnika je također diskutirano. Analiza je vršena simulacijom u programu TRNSYS. Rezultati analize pokazuju da je performansa sustava sa dva spremnika bolja (2 do 4% sa sezonskim...

  10. Revision total knee arthroplasty using a custom tantalum implant in a patient following multiple failed revisions.

    Science.gov (United States)

    McNamara, Colin A; Gösthe, Raúl G; Patel, Preetesh D; Sanders, Kristopher C; Huaman, Gustavo; Suarez, Juan C

    2017-03-01

    The number of revision total knee arthroplasty procedures performed annually is increasing and, subsequently, so is the number of patients presenting following a failed revision. Rerevising a total knee arthroplasty after one or more failed revision procedures presents many challenges, including diminished bone stock for prosthetic fixation. "Off the shelf" implants may not offer the best alternative for reconstruction. We present the case of a 55-year-old patient who required a rerevision total knee arthroplasty following multiple failed revisions with severe femoral and tibia bone loss. We describe a novel technique we employed to improve component fixation within the compromised bone stock.

  11. Improvement in Mechanical Properties of SA508 Gr.1a Piping Material by Modifying Microstructure

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Weon; Choi, Myung Rak [Chosun Univ., Gwangju (Korea, Republic of); Oh, Young Jin; Park, Heung Bae; Kim, Kyung Su [KEPCO E-C, Yongin (Korea, Republic of)

    2014-10-15

    It is attempted to apply LBB concept to the design of secondary piping systems, such as main-steam line and feed-water line. But, for obtaining sufficient margin in LBB analysis for these piping systems, it is necessary to reduce the applied loads by improving structural design and to employ piping material with higher toughness and strength than existing piping materials such as SA106 Gr.C and SA106 Gr.B carbon steels. SA508 Gr.1a ferritic steel has been used for the reactor coolant system (RCS) piping in KSNP (Korea Nuclear Power Plant) and is known to have good toughness and strength as well as weld ability. Such characteristics provide a sufficient margin in the LBB analysis for RCS piping. Based on SA508 Gr.1a piping material, thus, this study attempts to obtain a further improved piping material by modifying microstructure of SA508 Gr.1a without change of chemical composition. In order to obtain a modified microstructure, thus, this study simply heat-treated again SA508 Gr.1a piping material at the same heat-treatment condition that had been employed in the fabrication of SA508 Gr.1a piping material. The microstructure is composed of the homogeneous mixture of fine-grained ferrite and bainite. This is different from that of as-received SA508 Gr.1a. This difference is associated with different size of object to be heat-treated. This shows that SA508 Gr.1a piping material has a microstructure with fine-grained ferrite and bainite mixture, which provides good toughness and strength, if it is properly heat-treated. Tensile and J-R tests were conducted using specimens machined form modified SA508 Gr.1a piping material given by heat-treated, and the results were compared with those tested from as-received SA508 Gr..1a piping material. At 316 .deg. C, however, both strength and elongation of modified SA508 Gr.1a are higher than those of as-received SA508 Gra.1a. The results of J-R tests showed that J-R curve of modified SA508 Gr.1a is almost the same as that of as

  12. 75 FR 52238 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... new AD: 2010-18-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16414. Docket No... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  13. 76 FR 55781 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2011-09-09

    ...-16786; AD 2011-18-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... the following new AD: 2011-18-04 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16786... to Empresa Brasileira de Aeronautica S.A. (EMBRAER) airplanes as identified in paragraphs (c)(1)...

  14. Práticas de cuidado à saúde de mulheres camponesas

    Directory of Open Access Journals (Sweden)

    Iraí Maria de Campos Teixeira

    2014-12-01

    Full Text Available O presente artigo apresenta resultados de pesquisa acerca de práticas de cuidado à saúde de mulheres camponesas do Assentamento Monte Alegre VI – SP. A metodologia, qualitativa, constou de observação participante, entrevistas individuais e coletivas, tendo ocorrido 15 visitas no período de abril de 2010 a julho de 2011. Participaram doze moradoras, das quais, seis agentes comunitárias de saúde. As práticas de cuidado à saúde referem-se a: companheirismo, diálogo, escuta ativa, mobilizações sociais, assistência multiprofissional dos serviços de saúde, uso de plantas medicinais, crença religiosa como apoio social e dietas. Tais práticas somam-se e articulam-se. As participantes ensinam e aprendem sobre o cuidado à saúde nas relações entre elas, nas intergeracionais e nas com os profissionais de saúde, além de recorrerem a outras fontes de informação e outros processos formativos específicos, como do Programa Saúde da Família.

  15. Sa-Lrp from Sulfolobus acidocaldarius is a versatile, glutamine-responsive, and architectural transcriptional regulator.

    Science.gov (United States)

    Vassart, Amelia; Van Wolferen, Marleen; Orell, Alvaro; Hong, Ye; Peeters, Eveline; Albers, Sonja-Verena; Charlier, Daniel

    2013-02-01

    Sa-Lrp is a member of the leucine-responsive regulatory protein (Lrp)-like family of transcriptional regulators in Sulfolobus acidocaldarius. Previously, we demonstrated the binding of Sa-Lrp to the control region of its own gene in vitro. However, the function and cofactor of Sa-Lrp remained an enigma. In this work, we demonstrate that glutamine is the cofactor of Sa-Lrp by inducing the formation of octamers and increasing the DNA-binding affinity and sequence specificity. In vitro protein-DNA interaction assays indicate that Sa-Lrp binds to promoter regions of genes with a variety of functions including ammonia assimilation, transcriptional control, and UV-induced pili synthesis. DNA binding occurs with a specific affinity for AT-rich binding sites, and the protein induces DNA bending and wrapping upon binding, indicating an architectural role of the regulator. Furthermore, by analyzing an Sa-lrp deletion mutant, we demonstrate that the protein affects transcription of some of the genes of which the promoter region is targeted and that it is an important determinant of the cellular aggregation phenotype. Taking all these results into account, we conclude that Sa-Lrp is a glutamine-responsive global transcriptional regulator with an additional architectural role.

  16. Saúde bucal coletiva: caminhos da odontologia sanitária à bucalidade

    Directory of Open Access Journals (Sweden)

    Narvai Paulo Capel

    2006-01-01

    Full Text Available O ensaio aborda o surgimento das primeiras atividades odontológicas sob responsabilidade do poder público no Brasil e sua evolução no século XX, enfatizando a emergência do marco referencial denominado odontologia sanitária. Caracteriza, sumariamente, a odontologia social e preventiva e a odontologia de mercado, indicando as principais publicações que se ocuparam dessas correntes. As características essenciais da saúde bucal coletiva e da bucalidade são apresentadas, tecendo-se considerações sobre a articulação da saúde bucal coletiva com a saúde coletiva. Discutem-se as implicações do conceito de bucalidade para a organização da prática odontológica e a necessidade de reorientação do trabalho clínico nos serviços de saúde bucal, no âmbito do Sistema Único de Saúde brasileiro. Indicam-se os elementos essenciais de uma agenda para a saúde bucal coletiva, com base nas proposições apresentadas na 3ª Conferência Nacional de Saúde Bucal.

  17. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  18. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    2012-12-01

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  19. Controle social do Sistema Único de Saúde: o que pensam os conselheiros municipais de saúde

    Directory of Open Access Journals (Sweden)

    Vera Dib Zambon

    2013-12-01

    Full Text Available Desafios estão presentes para a consolidação da participação da comunidade e este estudo objetiva analisar o controle social na perspectiva dos conselheiros municipais de saúde. Trata-se de estudo de abordagem qualitativa utilizando entrevistas semiestruturadas. Identificou-se que alguns conselheiros não reconhecem a participação social como diretriz do Sistema Único de Saúde. Apesar do reconhecimento dos conselhos como espaços deliberativos, identificam-se dificuldades como a centralização das decisões na gestão, a valorização do saber técnico e a não realização de conferências de saúde. Há limitações no efetivo exercício do papel de conselheiro, dificuldade de interlocução com as bases de representação e de acesso a informações. Aponta-se a necessidade de articulação dos conselheiros e capacitações. Conclui-se pela necessidade de valorização dos espaços colegiados instituídos no Pacto pela Saúde, para fortalecimento do controle social, com destaque à educação permanente em saúde.

  20. Estratégia saúde da família e saúde do trabalhador: um diálogo possível?

    Directory of Open Access Journals (Sweden)

    Francisco Antonio de Castro Lacaz

    Full Text Available Reflete-se sobre a omissão de práticas voltadas para a saúde dos trabalhadores no âmbito de atuação da Estratégia Saúde da Família (ESF e propõe-se a inclusão dessas práticas. Considera-se que a mudança do modelo de atenção médico-centrado exige uma nova abordagem que incorpore a análise de elementos da produção de bens, da circulação e do consumo. Fundamenta-se na teoria da determinação social do processo saúde-doença e nas categorias trabalho e reprodução social. Propõe-se que a incorporação da temática Saúde do Trabalhador (ST na ESF seja realizada pela operacionalização de: um instrumento que levante e analise variáveis e indicadores de reprodução social; um sistema de apoio matricial que integre os Centros de Referência em ST com as Unidades Básicas de Saúde; educação permanente das equipes da ESF em conteúdos de ST.

  1. Intervenções em saúde pública e seu impacto nas desigualdades sociais em saúde

    Directory of Open Access Journals (Sweden)

    José Leopoldo Ferreira Antunes

    2015-06-01

    Full Text Available Este artigo resume a avaliação de três programas de saúde pública em relação à sua eficácia e impacto sobre as desigualdades sociais na saúde. Foram examinadas a fluoração da água de abastecimento público no contexto brasileiro, a provisão de terapêutica antirretroviral para pacientes com Aids e a vacinação de idosos contra a gripe na cidade de São Paulo. As três intervenções foram consideradas efetivas, na medida em que propiciaram uma redução na carga de doença na população. No entanto, elas tiveram resultados conflitantes quanto ao impacto sobre as desigualdades em saúde. Concluiu-se, por fim, que os programas de saúde pública devem ser implementados com um alcance imediata e efetivamente universal, direcionando recursos adicionais aos grupos com mais necessidades de saúde. Essa estratégia reduziria, ao mesmo tempo, o nível geral de doença na população e as desigualdades na experiência de doenças entre os estratos sociais.

  2. Preliminary treatment of bovine mastitis caused by Staphylococcus aureus, with trx-SA1, recombinant endolysin of S. aureus bacteriophage IME-SA1.

    Science.gov (United States)

    Fan, Jindai; Zeng, Zhiliang; Mai, Kaijie; Yang, Yu; Feng, Jiaqi; Bai, Yang; Sun, Baoli; Xie, Qingmei; Tong, Yigang; Ma, Jingyun

    2016-08-15

    Methicillin-resistant Staphylococcus aureus (MRSA) has become a great threat to human and animal health and there is an urgent need to develop novel antibacterial agents to control this pathogen. The objective of this study was to obtain an active recombinant endolysin from the novel bacteriophage (IME-SA1), and conduct an efficacy trial of its effectiveness against bovine mastitis. We isolated a phage that was virulent and specific for S. aureus with an optimal multiplicity of infection of 0.01. Electron microscopy revealed that IME-SA1 was a member of the family Myoviridae, with an isometric head (98nm) and a long contractile tail (200nm). Experimental lysis experiments indicated the phage had an incubation period of 20min with a burst size of 80. When host bacteria were in early exponential growth stages, a multiplicity of infection of 0.01 resulted in a complete bacterial lysis after 9h. The endolysin gene (804bp) was cloned into the pET-32a bacterial expression vector and recombinant endolysin Trx-SA1 was successfully obtained with molecular size of about 47kDa. Preliminary results of therapeutic trials in cow udders showed that Trx-SA1 could effectively control mild clinical mastitis caused by S. aureus. The endolysin Trx-SA1 might be an alternative treatment strategy for infections caused by S. aureus, including MRSA.

  3. Complexidade em Saúde da Família e formação do futuro profissional de saúde

    Directory of Open Access Journals (Sweden)

    Rodrigo Otávio Moretti-Pires

    2009-09-01

    Full Text Available As características do Sistema Único de Saúde (SUS e da Estratégia de Saúde da Família (ESF os aproximam do pensamento complexo, termo que não se refere à adjetivação de fenômeno de aspectos múltiplos, e sim ao marco teórico e epistemológico. Indícios de inadequação da formação dos profissionais de saúde para a atuação em Saúde da Família levaram a proposta de levantar a formação desses profissionais para a abordagem ampliada de saúde implicada no SUS/ESF. Foram realizados grupos focais com acadêmicos de Enfermagem, Medicina e Odontologia da Universidade Federal do Amazonas, analisado sob a perspectiva hermenêutica dialética. Os dados apontaram para a formação reducionista/biomédica nas três profissões assim como o foco no trabalho individual, e não em equipe multiprofissional, quadro inadequado ao SUS/ESF, que preconiza atuação profissional focada na complexidade do entorno sócioeconômico e antropológico dos usuários do sistema.

  4. Condicionalidades em saúde do programa Bolsa Família – Brasil: uma análise a partir de profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Alice Teles de Carvalho

    2014-12-01

    Full Text Available Este estudo apresenta a percepção de profissionais de equipes de Saúde da Família de municípios do Nordeste do Brasil acerca das mudanças na vida das famílias participantes do programa Bolsa Família, da relação destas com os serviços de saúde e do impacto na dinâmica de trabalho dos profissionais, a partir do acompanhamento das condicionalidades de saúde do programa Bolsa Família. As informações foram obtidas por meio de entrevistas semiestruturadas e encontros de grupo focal. Os profissionais acreditam que o programa ocasionou mudanças favoráveis na vida das famílias participantes, como a redução da pobreza, o aumento da frequência escolar das crianças e mudanças positivas na relação entre as famílias participantes e os serviços de saúde. No entanto, relataram dificuldades de caráter organizacional no acompanhamento das condicionalidades, sobretudo devido ao aumento da demanda de trabalho. É importante que as condicionalidades de saúde proporcionem oportunidades para a realização de ações que visem ao empoderamento e autonomia dos sujeitos quanto ao autocuidado e desenvolvimento da cidadania.

  5. Dinâmica do capital e sistemas locais de saúde: em busca de uma análise integradora do setor saúde

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Siliansky de Andreazzi

    2006-06-01

    Full Text Available Apresenta-se uma proposta metodológica direcionada à análise dos determinantes da oferta de atenção à saúde, com base na dinâmica da acumulação de capital a ser agregada aos elementos de definição das políticas de saúde mais convencionalmente empregados na área da Saúde Coletiva. A análise está baseada nos conceitos e métodos da Economia Industrial, já testados para o setor saúde em trabalhos desenvolvidos no âmbito europeu e por pesquisadores da CEPAL, aos quais se propõem agregar variáveis do contexto geral, que condicionam possibilidades e impõem limites às estratégias dos agentes locais, e análises de corte histórico que permitam identificar rugosidades. Destina-se a apoiar os gestores do SUS, estaduais e municipais, na sua atribuição de comando único do setor saúde sobre um determinado território, o que inclui o conjunto das possibilidades de regulação do setor privado - do planejamento da oferta ao controle de qualidade.

  6. SA BASED SOFTWARE DEPLOYMENT RELIABILITY ESTIMATION CONSIDERING COMPONENT DEPENDENCE

    Institute of Scientific and Technical Information of China (English)

    Su Xihong; Liu Hongwei; Wu Zhibo; Yang Xiaozong; Zuo Decheng

    2011-01-01

    Reliability is one of the most critical properties of software system.System deployment architecture is the allocation of system software components on host nodes.Software Architecture (SA)based software deployment models help to analyze reliability of different deployments.Though many approaches for architecture-based reliability estimation exist,little work has incorporated the influence of system deployment and hardware resources into reliability estimation.There are many factors influencing system deployment.By translating the multi-dimension factors into degree matrix of component dependence,we provide the definition of component dependence and propose a method of calculating system reliability of deployments.Additionally,the parameters that influence the optimal deployment may change during system execution.The existing software deployment architecture may be ill-suited for the given environment,and the system needs to be redeployed to improve reliability.An approximate algorithm,A*_D,to increase system reliability is presented.When the number of components and host nodes is relative large,experimental results show that this algorithm can obtain better deployment than stochastic and greedy algorithms.

  7. em saúde e doença mental

    Directory of Open Access Journals (Sweden)

    Neuza Maria de Fátima Guareschi

    2008-01-01

    Full Text Available This article aims at discussing social vulnerability from an experiment carried out with users of the Day-Hospital Program. This program, proposed by Sistema Único de Saúde, is a strategy directed towards another social agency of madness, distinct from the model of the hospice culture, with health practices that may lead to social exclusion and stigma. This study has been structured from a weekly activity developed in a Day-Hospital of a public general hospital in Rio Grande do Sul, through participative observations’. The group was constituted as a speech space in which users could talk about daily practices, sharing different ways of thinking and feeling the experience of psychic distress. Aiming at debating upon how the condition of social vulnerability has been produced in carriers of psychic distress, we have considered discursive practices of mental health public policies, from the Psychiatric Reform, as well as the notion of performativity in the production of mental health/disease. The forms these subjects think of and recognize both themselves and the world become visible through certain identity marks that constitute them as mentally ill. Even being a program situated in the field of the Psychiatric Reform, the Day-Hospital is still crossed by meanings from both the hospital-centered psychiatric discourse about madness and the medicamentous therapeutic practice, which have inscribed ways of subjects living mental health/disease with strict possibilities of subjectifying themselves out of this logic.

  8. Saúde bucal no Brasil Oral health in Brazil

    Directory of Open Access Journals (Sweden)

    Vitor Gomes Pinto

    1983-08-01

    Full Text Available Apresenta-se um retrato sobre a saúde bucal no Brasil, com ênfase em informações relativas à situação econômica e epidemiológica, prevenção da cárie dental, recursos humanos, montante de gastos financeiros e estrutura de prestação de serviços. O país mostra quadro típico de uma área em desenvolvimento, com elevada incidência de problemas, crescente oferta de cirurgiões-dentistas e difícil acesso aos serviços ofertados mormente face a barreiras de ordem econômica. Visando expandir cuidados odontológicos e reduzir a incidência dos principais problemas, propõe-se um programa de serviços básicos de âmbito nacional.The oral health situation in Brazil is described, with special emphasis on data relating to the economic and epidemiological situation, caries prevention, human resources, health expenditure and dental care structure. The country presents a picture typical of a developing area, with high disease rates, an increase in the offer of dentists and access to dental care hindered principally by economic barriers. A comprehensive program of basic services in odontology is proposed, with the objective of expanding dental care and reducing the incidence of more prevalent problems.

  9. PRODUCTIVITY AND QUALITY: A STRATEGY FOR THE SA DEFENCE FORCE

    Directory of Open Access Journals (Sweden)

    R. Eberlein

    2012-02-01

    Full Text Available In recent times the SA Defence Force (SADF has been bombarded with a variety of methods and approaches to the improvement of productivity, financial savings and, most recently, for quality of work life or quality assurance. Various approaches have included the concepts of Total Quality Management (TQM, Quality Circles (and variants in the guise of Triads and others, Methodology, Unit Management Systems, Cost Control Systems, Deterministic Productivity Accounting and the Iike. There have been many benefits to be found in these various approaches, each of which concentrates on certain aspects of productivity. That there have been great achievements in productivity in the SADF is a matter of record, a record which is reflected in a National Award for Productivity, a smaller more efficient SADF, and a reputation for submitting more recommendations for improvements than other departments in the Public Service. At a more personal level though, the writer has gained the impression that no or very little attempt has been made to integrate selected aspects of these approaches into an overall "productivity” strategy acceptable to the SADF. That there is a need for such an overall strategy is clear from the sentiments expressed recently by the members of the SADF's Productivity Co-ordination Committee when attempting to indicate the way ahead to even greater productivity in the SADF (Meeting, January 1991. In this paper a strategy for the improvement of productivity and the quality of work life which is acceptable to the SADF is proposed.

  10. AUTOMATIZACIÓN DE OFICINAS S.A.

    Directory of Open Access Journals (Sweden)

    Luis Carlos Diaz Osorio

    1998-01-01

    Full Text Available El caso muestra la situación de Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización de muebles y equipos para oficina. A principios de la década pasada, comenzó a comercializar microcomputadoras y elementos de conectividad de redes, manejando grandes márgenes por ser monopolio, aprovechando los beneficios de importación que le otorgaba el ser exportador de muebles. En el momento en que se abren las importaciones, más de doscientas empresas entran a competir en el mercado de los microcomputadores, llegando incluso a manejar márgenes de hasta el 10%. Las ventas de la empresa han bajado a niveles alarmantes, incluso se cree que únicamente compran empresas allegadas a los directivos o personas que no conocen nada del tema de los computadores. La situación puntual es la toma de decisión de las estrategias para ser competitivos o decidir salir del mercado de los PC. La orientación que hemos decidido darle al caso es “fijación de precios”.

  11. High-dose misoprostol as an alternative therapy after failed medical abortion.

    Science.gov (United States)

    Li, Yiu-Tai; Hou, Guang-Qiong; Chen, Tien-Hui; Chu, Yi-Chih; Lin, Ta-Chin; Kuan, Long-Ching; Lin, Mau; Huang, Shu-Feng; Chen, Fu-Min; Kuo, Tsung-Cheng

    2008-12-01

    The aim of this study was to determine the complete abortion rate for the vaginal administration of high-dose misoprostol after a failed medical abortion. When their medical abortions failed after the conventional oral administration of mifepristone and misoprostol, participants then received 1,000 microg of misoprostol vaginally. The efficacy and side effects of this treatment were evaluated. Twenty-seven women who failed to abort after the conventional administration of mifepristone and misoprostol were enrolled in this trial. Fourteen days after the vaginal administration of 1,000 microg misoprostol, the overall complete expulsion rate had reached 88.8% (24/27). Most adverse effects were mild to moderate and did not require treatment. The vaginal administration of 1,000 microg misoprostol as a salvage therapy after a failed medical abortion appears to be a safe and highly effective alternative to surgical intervention.

  12. High-Dose Vitamin D Failed to Curb Heart Disease in Study

    Science.gov (United States)

    ... medlineplus.gov/news/fullstory_164472.html High-Dose Vitamin D Failed to Curb Heart Disease in Study ... 5, 2017 (HealthDay News) -- Taking high doses of vitamin D once a month won't lower your ...

  13. First-Try Antibiotics Now Fail in 1 in 4 Adult Pneumonia Cases

    Science.gov (United States)

    ... medlineplus.gov/news/fullstory_165801.html First-Try Antibiotics Now Fail in 1 in 4 Adult Pneumonia ... 2017 (HealthDay News) -- The first prescription of an antibiotic that the average U.S. adult with pneumonia receives ...

  14. On the fail-safe design of tendon-driven manipulators with redundant tendons

    Energy Technology Data Exchange (ETDEWEB)

    Sheu, Jinn Biau; Liu, Tyng; Lee, Jyh Jone [National Taiwan University, Taipei (China)

    2012-06-15

    A tendon-driven manipulator having redundant tendons may possess more flexibility in operation, such as optimizing the performance of tendons, reducing the burden of each tendon, and providing fail-safe features. The purpose of this paper is to investigate the design of tendon-driven manipulators with a fail-safe feature, that is, to synthesize a system that may still remain controllable as any of the tendons have broken down or malfunctioned. Characteristics of tendon-driven manipulators are briefly discussed. Criteria for tendon-driven manipulators with redundant tendons and fail-safe feature are then established. Subsequently, constraints for such system are derived from the structure of tendon-driven manipulator. Associated with the criteria, manipulators can remain controllable when any of the tendons fails to function. Finally, a geometric method for determining the structure is developed. Examples of two-DOF and three-DOF tendondriven manipulators are demonstrated.

  15. Comment Fail-Stop Blind Signature Scheme Design Based on Pairings

    Institute of Scientific and Technical Information of China (English)

    HU Xiaoming; HUANG Shangteng

    2006-01-01

    Fail-stop signature schemes provide security for a signer against forgeries of an enemy with unlimited computational power by enabling the signer to provide a proof of forgery when a forgery happens. Chang et al proposed a robust fail-stop blind signature scheme based on bilinear pairings. However, in this paper, it will be found that there are several mistakes in Chang et al' fail-stop blind signature scheme. Moreover, it will be pointed out that this scheme doesn' meet the property of a fail-stop signature: unconditionally secure for a signer. In Chang et al' scheme, a forger can forge a valid signature that can' be proved by a signer using the "proof of forgery". The scheme also doesn' possess the unlinkability property of a blind signature.

  16. A revista Saúde em Debate como fonte e objeto de estudo

    OpenAIRE

    Sophia,Daniela Carvalho

    2013-01-01

    A presente nota de pesquisa busca divulgar estudo sobre o Centro Brasileiro de Estudos da Saúde e o movimento de reforma sanitária desenvolvido no âmbito do Programa de História das Ciências e da Saúde Pública da Casa de Oswaldo Cruz. Atém-se à revista Saúde em Debate , periódico do Centro, devido à relevância que teve na área ao longo dos dez anos de publicação. A utilização da revista na pesquisa deu ...

  17. Qualidade em saúde: que trajetos de formação dos enfermeiros?

    OpenAIRE

    Pinho, Carla Amorim

    2012-01-01

    ENQUADRAMENTO: A avaliação da qualidade dos serviços de saúde, a crescente melhoria do desempenho dos profissionais, e a monitorização sistemática das atividades desenvolvidas pelas instituições de saúde, potenciam a qualidade dos cuidados prestados. A intervenção dos enfermeiros e dos restantes profissionais de saúde é imprescindível na promoção desta qualidade conforme defendem os diversos modelos da sua gestão. Para a generalidade destes, considera-se que a supervisão clí...

  18. Oficina de trabalho corporal em um serviço de saúde mental

    OpenAIRE

    Carolina Cristina do Nascimento

    2011-01-01

    Com a reforma psiquiátrica surgiram novos serviços substitutivos na assistência à saúde mental, bem como novas propostas de estratégias de tratamento no processo de reabilitação psicossocial às pessoas em sofrimento psíquico. São possibilidades de assistência que tipificaram os serviços em saúde mental, como Oficinas Terapêuticas, dentre outras designações. As oficinas em saúde mental correspondem a atividades grupais de socialização e expressão, privilegiando a singularidade e subjetividade ...

  19. A autonomia do paciente no processo terapêutico como valor para a saúde

    OpenAIRE

    Jussara Calmon Reis de Souza Soares; Kenneth Rochel de Camargo Jr.

    2007-01-01

    No presente artigo analisam-se as críticas à concepção reducionista de saúde e doença da biomedicina, buscando contribuir para um repensar sobre saúde em uma vertente de proposições positivas. Remetemo-nos, sobretudo, à epistemologia de Canguilhem, para destacar pontos fundamentais na discussão sobre saúde, integrando-a a uma nova leitura do conceito de autonomia do paciente no processo terapêutico. O método de análise seguiu a perspectiva do pensamento complexo. Nesta perspectiva, a autonomi...

  20. Normal-patológico, saúde-doença: revisitando Canguilhem

    OpenAIRE

    Coelho, Maria Thereza Ávila Dantas; Almeida Filho, Naomar de

    1999-01-01

    Este artigo pretende reavaliar a obra de G. Canguilhem sobre a normalidade, a saúde, a doença e a patologia. Discute inicialmente a crítica canguilhemiana da abordagem positivista da dicotomia normal-patológico, avaliando-a como insatisfat6ria porque reafirma a disjunção qualitativo-quantitativo. Analisa ainda a distinção entre normalidade e saúde, juntamente com a proposição da saúde como capacidade normativa. Por fim, apresenta a reflexão ética pioneira de Canguilhem sobre a engenharia gené...

  1. Too many to fail - How bonus taxation prevents gambling for bailouts

    OpenAIRE

    Hilmer, Michael

    2014-01-01

    Using a simple symmetric principal-agent model of two banks, this paper studies the effects of both bailouts and bonus taxes on risk taking and managerial compensation. In contrast to existing literature, we assume financial institutions to be systemic only on a collective basis, implying support only if they collectively fail. This too-many-to-fail assumption generates incentives for herding and collective moral hazard. If banks can anticipate bailouts, they can coordinate on equilibrium whe...

  2. Anatomical Glenoid Reconstruction Using Fresh Osteochondral Distal Tibia Allograft After Failed Latarjet Procedure

    OpenAIRE

    Sanchez, Anthony; Ferrari, Marcio B.; Akamefula, Ramesses A.; Frank, Rachel M.; Sanchez, George; Provencher, Matthew T.

    2017-01-01

    In the treatment of recurrent anterior glenohumeral instability, the Latarjet procedure has been shown to fail. This results in a need for viable revisional procedures for patients who present with this challenging pathology. We report our preferred technique for anatomical glenoid reconstruction using a fresh osteochondral distal tibia allograft after a failed Latarjet procedure. This bony augmentation technique employs a readily available dense, weight-bearing osseous tissue source that has...

  3. Cardiac protein kinases: the cardiomyocyte kinome and differential kinase expression in human failing hearts

    OpenAIRE

    Fuller, Stephen J.; Osborne, Sally A.; Leonard, Sam J.; Hardyman, Michelle A.; Vaniotis, George; Allen, Bruce G.; Sugden, Peter H.; Clerk, Angela

    2015-01-01

    Aims. Protein kinases are potential therapeutic targets for heart failure, but most studies of cardiac protein kinases derive from other systems, an approach that fails to account for specific kinases expressed in the heart and the contractile cardiomyocytes. We aimed to define the cardiomyocyte kinome (i.e. the protein kinases expressed in cardiomyocytes) and identify kinases with altered expression in human failing hearts. Methods and Results. Expression profiling (Affymetrix microarrays) d...

  4. Saúde Masculina: representação e experiência de homens trabalhadores com o corpo, saúde e doença.

    Directory of Open Access Journals (Sweden)

    Marco Antonio Alves SEPARAVICH

    2015-10-01

    Full Text Available Este estudo analisou as experiências e representações de homens trabalhadores com o corpo, saúde, doença e cuidado, e os problemas principais de saúde por eles percebidos, quais sejam, a hipertensão arterial e as lombalgias crônicas. Analisou-se como explicam as suas causas; a forma como enfrentam e buscam a resolução ou mitigação desses problemas de saúde, as terapêuticas utilizadas, a interferência que elas acarretam em suas rotinas de vida e identidades. A revisão da literatura da Saúde Coletiva sobre a saúde do homem e masculinidades mostrou que as demandas masculinas na busca por tratamentos nos serviços públicos de saúde e a percepção de que são portadores de necessidades específicas de saúde são minoritárias. Constatou-se também que as abordagens socioantropológicas de como eles convivem e lidam com as enfermidades que os acometem também são raras. Justifica-se, portanto, o interesse e as razões que motivaram este trabalho. As demandas minoritárias masculinas aos serviços de saúde, concebidas a partir da masculinidade tradicional socialmente vigente, e os dados epidemiológicos das altas taxas de morbimortalidade masculina, embasaram a formulação da Política Nacional de Atenção Integral à Saúde do Homem (PNAISH, cujos objetivos buscam promover a melhora da saúde da população masculina na faixa etária dos 20 aos 59, facilitando o seu acesso aos serviços de atendimento integral à saúde na atenção primária. Campinas abriga projeto piloto de tal política. Analisou-se o processo de implementação da PNAISH em um dos centros de saúde da cidade elegido como piloto, cujos serviços estruturam-se na Estratégia Saúde da Família. Entrevistou-se 9 profissionais que nele atuam, especificamente na saúde do adulto, considerando o conhecimento que têm de tal política, as atividades que realizam para o seu atendimento, e os obstáculos observados que dificultam a sua implementação. Para o

  5. Very Preterm Infants Failing CPAP Show Signs of Fatigue Immediately after Birth.

    Directory of Open Access Journals (Sweden)

    Melissa L Siew

    Full Text Available To investigate the differences in breathing pattern and effort in infants at birth who failed or succeeded on continuous positive airway pressure (CPAP during the first 48 hours after birth.Respiratory function recordings of 32 preterm infants were reviewed of which 15 infants with a gestational age of 28.6 (0.7 weeks failed CPAP and 17 infants with a GA of 30.1 (0.4 weeks did not fail CPAP. Frequency, duration and tidal volumes (VT of expiratory holds (EHs, peak inspiratory flows, CPAP-level and FiO2-levels were analysed.EH incidence increased 9 ml/kg with higher peak inspiratory flows than CPAP-fail infants (71.8 ± 15.8 vs. 15.5 ± 5.2 ml/kg.s, p <0.05. CPAP-fail infants required higher FiO2 (0.31 ± 0.03 vs. 0.21 ± 0.01, higher CPAP pressures (6.62 ± 0.3 vs. 5.67 ± 0.26 cmH2O and more positive pressure-delivered breaths (45 ± 12 vs. 19 ± 9% (p <0.05.At 9-12 minutes after birth, CPAP-fail infants more commonly used lower VTs and required higher peak inspiratory flow rates while receiving greater respiratory support. VT was less variable and larger VT was infrequently used reflecting early signs of fatigue.

  6. FAILED STATE

    African Journals Online (AJOL)

    Dr. Miles R. Cone

    The state as a concept and an everyday reality conjures up vastly different images and ... population tied together by some form of socio-political cohesion and governed by a ... the expectation of the provision of certain political, economic and social goods. In .... In such instances the halt and virtual disappearance of a.

  7. Caracterização das atividades de enfermagem em saúde coletiva desenvolvidas na regional norte de saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    Full Text Available O estudo teve como objetivo identificar e analisar as ações desenvolvidas pela equipe de enfermagem em saúde coletiva na Regional Norte de Saúde do Distrito Federal. Para a coleta de dados aplicou-se um questionário com a descrição das diversas atividades cotidianas da assistência a 29 enfermeiras, 91 auxiliares de enfermagem e 42 agentes de saúde. Para a melhor compreensão de como as atividades são desenvolvidas realizou-se grupos focais com cada uma das categorias profissionais. Os resultados mostram que todos elementos da equipe empregam grandes esforços para organizar, controlar e atender a demanda espontânea e ainda executar as atividades de auxilio às ações médicas, consequentemente priorizam o atendimento individual em detrimento do coletivo.

  8. A saúde mental no contexto da Estratégia Saúde da Família no Brasil

    OpenAIRE

    2015-01-01

    São discutidas as concepções sobre saúde mental e loucura e os modos de funcionamento das equipes de Estratégia Saúde da Família (ESF) associadas a essas concepções em duas unidades da rede básica de saúde das cidades de Natal –capital no nordeste brasileiro- e Porto Alegre –capital do extremo sul do país. O referencial teórico-metodológico da análise institucional foi utilizado para tratamento das informações levantadas através da realização de 40 entrevistas com os profissionais da unidade ...

  9. Concepções de saúde de mulheres cuidadoras-leigas : estratégias à sua promoção da saúde

    OpenAIRE

    2007-01-01

    A situação das mulheres cuidadoras-leigas, acompanhantes de crianças hospitalizadas, representa nesse estudo, a sua visão em relação à saúde, a qualidade da atenção dispensada a elas pelos profissionais e as políticas públicas de saúde instituídas em um ambiente hospitalar. Trata-se de uma pesquisa qualitativa do tipo descritivo-exploratório e intervencionista desenvolvida em um hospital-escola na cidade de Porto Alegre/RS, que objetivou conhecer as concepções de saúde de mulheres cuidadoras-...

  10. Da Saúde Pública às Políticas Saudáveis — Saúde e Cidadania na Pós-modernidade

    Directory of Open Access Journals (Sweden)

    Antônio Ivo de Carvalho

    1996-01-01

    Full Text Available O artigo discute alternativas para o futuro da Saúde Pública, nos marcos do pensamento e das exigências da pós-modernidade. Apresenta os avanços sanitários alcançados na época moderna, e aborda os efeitos mórbidos da tecno-ciência. Com base nos aportes do pensamento pós-moderno, propõe uma agenda de desafios a serem enfrentados pela nova Saúde Pública. Especificamente, propõe novos aportes conceituais para lidar com as relações subjetivo-objetivo e coletivo-individual no campo sanitário. Discute, ainda, as condições e possibilidades de que a proposta de Políticas Saudáveis possa apontar para uma renovação da identidade da saúde pública.

  11. Saúde do homem e masculinidades na Política Nacional de Atenção Integral à Saúde do Homem: uma revisão bibliográfica

    Directory of Open Access Journals (Sweden)

    Marco Antonio Separavich

    2013-06-01

    Full Text Available Este artigo, orientado pela teoria do gênero sobre masculinidades, revisa os textos que trataram do tema nos periódicos de Saúde Coletiva/Saúde Pública no período de 2005-2011. Os eixos temáticos encontrados coincidem com as prioridades conferidas pela Política Nacional de Atenção Integral à Saúde do Homem, criada pelo Ministério da Saúde em 2008. São eles: o acesso dos homens aos serviços de saúde, sexualidade, saúde reprodutiva, violência e os principais agravos à saúde masculina, contextualizados à luz dos determinantes sociais da saúde. Tais determinantes se baseiam em um tipo de masculinidade tradicional concebida como hegemônica, que apesar de comprometer a saúde masculina, não é o tipo único de masculinidade existente na sociedade. As diferentes masculinidades encontram-se imbricadas no processo saúde/doença vivido pelos homens. Elas devem ser consideradas na busca da adesão dos homens aos serviços de saúde.

  12. Does Salicylic Acid (SA) Improve Tolerance to Salt Stress in Plants? A Study of SA Effects On Tomato Plant Growth, Water Dynamics, Photosynthesis, and Biochemical Parameters.

    Science.gov (United States)

    Mimouni, Hajer; Wasti, Salma; Manaa, Arafet; Gharbi, Emna; Chalh, Abdellah; Vandoorne, Bertrand; Lutts, Stanley; Ben Ahmed, Hela

    2016-03-01

    Environmental stresses such as salinity directly impact crop growth, and by extension, world food supply and societal prosperity. It is estimated that over 800 million hectares of land throughout the world are salt-affected. In arid and semi-arid regions, salt concentration can be close to that in the seawater. Hence, there are intensive efforts to improve plant tolerance to salinity and other environmental stressors. Salicylic acid (SA) is an important signal molecule for modulating plant responses to stress. In the present study, we examined, on multiple plant growth related endpoints, whether SA applied through the rooting medium could mitigate the adverse effects of salinity on tomato (Solanum lycopersicum) cv. Marmande. The latter is a hitherto understudied tomato plant from the above perspective; it is a classic variety that produces the large ribbed tomatoes in the Mediterranean and consumed worldwide. We found salt stress negatively affected the growth of cv. Marmande tomato plants. However, the SA-treated plants had greater shoot and root dry mass, leaf area compared to untreated plants when exposed to salt stress. Application of SA restores photosynthetic rates and photosynthetic pigment levels under salt (NaCl) exposure. Leaf water, osmotic potential, stomatal conductance transpiration rate, and biochemical parameters were also ameliorated in SA-treated plants under saline stress conditions. Overall, these data illustrate that SA increases cv. Marmande tomato growth by improving photosynthesis, regulation and balance of osmotic potential, induction of compatible osmolyte metabolism, and alleviating membrane damage. We suggest salicylic acid might be considered as a potential growth regulator to improve tomato plant salinity stress resistance, in the current era of global climate change.

  13. O complexo industrial da saúde e a necessidade de um enfoque dinâmico na economia da saúde

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2003-01-01

    Full Text Available O artigo desenvolve um enfoque analítico voltado para o estudo do complexo industrial da saúde, englobando o conjunto das atividades produtivas e suas relações de interdependência, segundo uma perspectiva de economia política e da inovação. A lógica empresarial capitalista penetra em todos os segmentos produtivos, envolvendo tanto as indústrias que já operavam tradicionalmente nessas bases quanto segmentos que possuíam formas de organização em que era possível verificar a convivência de lógicas empresariais com outras que dela se afastavam, como a produção de vacinas e produtos biológicos, fitoderivados e a prestação de serviços de saúde. O artigo analisa a interação entre o sistema de saúde e o sistema econômico-industrial, mostrando como tem havido uma dicotomia na relação entre ambos, que se exprime na deterioração do potencial de inovação do país e numa crescente e preocupante vulnerabilidade externa da política de saúde. Sugere-se que o enfoque neoclássico tradicional da economia da saúde é insuficiente para tratar do complexo industrial da saúde, dada a intensidade do processo de mudança estrutural, e a necessidade de um enfoque teórico alternativo que incorpore a dinâmica de transformação econômica e institucional, de acumulação e de inovação.

  14. Perfil social do usuário do sistema único de saúde na atenção primária em saúde

    Directory of Open Access Journals (Sweden)

    Aline Braido Pereira

    2012-01-01

    Full Text Available O Sistema Único de Saúde (SUS foi criado como uma política para toda população. Conhecer o perfil de seu usuário é de fundamental importância para sua organização. Sendo assim, o objetivodessa pesquisa foi delinear o perfil social do usuário do SUS na Atenção Básica em Saúde de Santa Maria/RS. Métodos: Pesquisa descritiva, realizada em uma Estratégia de Saúde da Família ( ESF e uma Unidade Básica de Saúde (UBS de Santa Maria/RS no período de março a abril de 2010, onde foram incluídos usuários adultos, de ambos os gêneros. Resultados: Um total d e 1 12 u suários participaram da pesquisa. A grande procura pelo serviço de saúde foi à emergência/urgência, com relação a opinião em relação ao SUS, 60% dos usuários da UBS consideram o SUS ruim e 40,4% dos usuários da ESF consideraram bom. Conclusão: Cabe aos trabalhadores, usuários e apoiadores de uma teoria sobre a produção de saúde, tratar de construir projetos objetivando as necessidades, bem como dos meios necessários para atendê-las.

  15. Pesquisa em saúde, política de saúde e eqüidade na América Latina

    Directory of Open Access Journals (Sweden)

    Alberto Pellegrini Filho

    2004-06-01

    Full Text Available O autor analisa as relações entre pesquisa de saúde, políticas de saúde e eqüidade na América Latina. Descreve novas tendências no modo de produção do conhecimento, que permitem maior integração entre as necessidades sociais e a pesquisa, facilitando o vínculo entre esta e o processo de definição de políticas. Analisa as manifestações das novas tendências na América Latina e finaliza com a descrição de algumas iniciativas promovidas pela OPAS no sentido de aproveitar as oportunidades abertas pelas novas tendências para a melhoria das condições de saúde na região. Busca defender a tese de que a informação e o conhecimento são bens públicos essenciais e que as iniqüidades de acesso a esses bens são importantes determinantes das iniqüidades em saúde. Para que as políticas de saúde e as políticas de pesquisa em saúde se integrem e se consolidem como políticas públicas voltadas a atender ao interesse público e à promoção da eqüidade, é necessário o fortalecimento do processo democrático de definição das mesmas, multiplicando os atores envolvidos, os espaços e oportunidades de interação entre eles e instrumentando sua participação com o acesso eqüitativo a informações e conhecimentos científicos pertinentes que permitam a defesa fundamentada de seus interesses.

  16. BiodanÃa e SaÃde Percebida: um Olhar BiocÃntrico sobre a SaÃde

    OpenAIRE

    Kelen Gomes Ribeiro

    2008-01-01

    Diante da constataÃÃo de uma grande quantidade de abordagens de desenvolvimento humano e de terapias existentes e praticadas no Brasil, atendendo a uma considerÃvel parcela da demanda social relativa aos cuidados com a saÃde dos indivÃduos, consideramos relevante estudar uma abordagem que se coloca como novidade no campo da SaÃde: o Sistema BiodanÃa. A escolha por esse Sistema ocorreu tambÃm devido à nossa afinidade com o mesmo e ao fato de termos realizado pesquisa de iniciaÃÃo cientÃfica so...

  17. Double Band CDMA/AMPS Down Frequeney Converter SA9500%双频段CDMA/AMPS下变频器SA9500

    Institute of Scientific and Technical Information of China (English)

    张颖光; 李斌涛

    2000-01-01

    双频段CDMA/AMPS下变频器集成电路SA9500集成了用于双频段、三模式CDMA/AMPS蜂窝移动通信电话手机所必需的所有前端接收混频器,可工作于高频段1900MHz PCS CDMA和低频段800MHz CDMA蜂窝移动通信系统,或模拟模式的FM AMPS/TACS中.本文介绍了SA9500的原理、特点与典型应用.

  18. Condições de saúde bucal de industriários participantes de Programa de Saúde Bucal na Empresa

    OpenAIRE

    Luísa Silva Lima; Maristela Santos Araújo; Paloma Perez Castro; Maria Cristina Teixeira Cangussu

    2015-01-01

    Resumo Objetivo: verificar as condições de saúde bucal de trabalhadores de cinco indústrias da região metropolitana de Salvador, Bahia, que participavam do Programa de Saúde Bucal na Empresa (PSBE) entre os anos 2003 a 2008. Métodos: estudo transversal retrospectivo, com dados secundários do banco de dados do SESI/DR-BA. Participaram todos os funcionários que realizaram pelo menos dois exames odontológicos no período, totalizando 1.277 trabalhadores. Foram investigados dados sociodemográficos...

  19. GERDAU S.A.: a empresa brasileira mais internacionalizada

    Directory of Open Access Journals (Sweden)

    EVA STAL

    2007-07-01

    Full Text Available Muitas empresas dos países em desenvolvimento não se consideram aptas a explorar outrosmercados devido à distância tecnológica entre as empresas globais e os seus padrões locais. Oartigo mostra que existe espaço para a inovação empresarial oriunda de países emdesenvolvimento, e ela é um dos principais fatores responsáveis pelo sucesso de suasempresas na conquista do mercado mundial. Descreve o processo de expansão internacionalda Gerdau S.A., que começou com exportações e evoluiu para a aquisição de empresassiderúrgicas na América Latina, América do Norte e Europa, num total de 32 usinas em 10países, sendo 21 no exterior, que empregam mais de 32 mil funcionários. Hoje, a empresapossui valor de mercado estimado em 10 bilhões de dólares e 111.000 acionistas. Analisa-sesua estratégia de internacionalização à luz das teorias econômicas, comportamentais eestratégicas e verifica-se que a trajetória internacional pode ser explicada por aspectoscaracterísticos de cada uma dessas teorias. Um traço importante na cultura da empresa é atransferência de seu modelo de negócios, estrutura, valores e tecnologia para as empresasadquiridas, sem deixar de considerar as necessárias adaptações às culturas locais.

  20. SA1 binds directly to DNA through its unique AT-hook to promote sister chromatid cohesion at telomeres.

    Science.gov (United States)

    Bisht, Kamlesh K; Daniloski, Zharko; Smith, Susan

    2013-08-01

    Sister chromatid cohesion relies on cohesin, a complex comprising a tri-partite ring and a peripheral subunit Scc3, which is found as two related isoforms SA1 and SA2 in vertebrates. There is a division of labor between the vertebrate cohesin complexes; SA1-cohesin is required at telomeres and SA2-cohesin at centromeres. Depletion of SA1 has dramatic consequences for telomere function and genome integrity, but the mechanism by which SA1-cohesin mediates cohesion at telomeres is not well understood. Here we dissect the individual contribution of SA1 and the ring subunits to telomere cohesion and show that telomeres rely heavily on SA1 and to a lesser extent on the ring for cohesion. Using chromatin immunoprecipitation we show that SA1 is highly enriched at telomeres, is decreased at mitosis when cohesion is resolved, and is increased when cohesion persists. Overexpression of SA1 alone was sufficient to induce cohesion at telomeres, independent of the cohesin ring and dependent on its unique (not found in SA2) N-terminal domain, which we show binds to telomeric DNA through an AT-hook motif. We suggest that a specialized cohesion mechanism may be required to accommodate the high level of DNA replication-associated repair at telomeres.

  1. Effect of salicylic acid (SA) on delaying fruit senescence of Huang Kum pear

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yuxing; DU Guoqiang; WANG Guoying; ZHANG Jianghong; Hassan Imran

    2007-01-01

    This experiment was undertaken to explore the effect of salicylic acid (SA) at different concentrations on regulating fruit senescence ofHuang Kum pear.Through dipping fruits and fruit discs for a series of hours in SA solution,enzyme activities and physiological characteristics of Huang Kum pear were determined.The results revealed that SA enhanced the activity of superoxide dismutase (SOD) and peroxidase (POD) enzymes at 0.02 mmol/L and at 0.002 mmol/L with the treatment of dipping fruit discs for 4 h and 12 h,respectively.The malondialdehyde (MDA) contents were reduced at 0.002 mmol/L for 12 h,and water loss ratio was decreased at 0.5 mmol/L after 48 h of treatment.It was concluded that SA at lower concentrations could delay the senescence of Huang Kum pear fruit.

  2. Kuu plaat : Lauri Saatpalu ja Katrin Mandel "Sa oled hea". Plaadid kauplusest Lasering

    Index Scriptorium Estoniae

    2005-01-01

    Heliplaatidest: Lauri Saatpalu ja Katrin Mandel "Sa oled hea", Goldfrapp "Supernature", Ultima Thule "Ingel ja suli", Sigur Ros "Takk...", Franz Ferdinand "You Could Have It So Much Better", Ans.Andur "Tuled peale"

  3. Políticas de saúde e blocos econômicos

    OpenAIRE

    André Medici; Bernardo Barros Weaver

    2007-01-01

    O Artigo "Políticas de saúde e blocos econômicos" trata da integração de sistemas de saúde dentro de blocos econômicos. Entretanto, a obra não é restrito aos temas de saúde. Tópicos como proteção ao imigrante intra-regional, e extra-regional também são abordados. Dentro do tópico de proteção ao trabalhador, vêm os temas de pensão: Modelos de aposentadoria para o trabalhador imigrante na Europa e nos EUA. O direito do cidadão de um bloco econômico de ir e vir, garantido não só o acesso à saúde...

  4. BengaSaVex: A new computational genetic sequence extraction tool ...

    African Journals Online (AJOL)

    BengaSaVex : A new computational genetic sequence extraction tool for DNA repeats. ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search ... This research aimed to develop new tools for extracting DNA repeats from the ...

  5. A construção de um modelo de saúde complexo e transdisciplinar

    Directory of Open Access Journals (Sweden)

    Regina Stella Spagnuolo

    2005-02-01

    Full Text Available A saúde como um estado dinâmico coerente e construtivo do ser vivo é o fundamento da proposta deste texto. Nessa ótica, uma visão sistêmica e integrativa do ser humano a ser cuidado na prática diária da saúde está sendo proposta com base nos conceitos de pesquisadores e educadores das últimas décadas. Conceitos de caos, complexidade, transdisciplinaridade e auto-organização são introduzidos e fazem mais sentido como temas orientadores dos procedimentos sugeridos. Maneiras de promover a saúde assim compreendida são discutidas em algumas situações práticas, incluindo o atual programa oficial da Estratégia da Saúde da Família.

  6. SA-MAC:Self-Stabilizing Adaptive MAC Protocol for Wireless Sensor Networks

    Institute of Scientific and Technical Information of China (English)

    波澄; 韩君泽; 李向阳; 王昱; 肖波

    2014-01-01

    A common method of prolonging the lifetime of wireless sensor networks is to use low power duty cycling protocol. Existing protocols consist of two categories: sender-initiated and receiver-initiated. In this paper, we present SA-MAC, a self-stabilizing adaptive MAC protocol for wireless sensor networks. SA-MAC dynamically adjusts the transmission time-slot, waking up time-slot, and packet detection pattern according to current network working condition, such as packet length and wake-up patterns of neighboring nodes. In the long run, every sensor node will find its own transmission phase so that the network will enter a stable stage when the network load and qualities are static. We conduct extensive experiments to evaluate the energy consumption, packet reception rate of SA-MAC in real sensor networking systems. Our results indicate that SA-MAC outperforms other existing protocols.

  7. 马兰士 SA-13S2 SACD/CD播放机

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    SA-13S2内部的规划十分整齐,所使用的激光读取模组是新开发的SACDM-10.有厚达2mm的钢板作为机箱底座.再加上新开发的SACDM-10激光读取机构。光碟的读出精度有很大的提升,同时还减轻噪音辐射。SA-13S2采用了马兰士公司独家开发的HDAM模组,同样配备了马兰士SACD播放机SA-7S1采用的著名的第二代HDAM(High Definition Amplifier Module)SA2放大模组。

  8. O sistema social da saúde: conceito, limites e possibilidades

    Directory of Open Access Journals (Sweden)

    Sandra Regina Martini Vial

    2014-06-01

    Full Text Available Discutem-se as possibilidades de definir o sistema da saúde como um sistema social, diferenciado funcionalmente, a partir da ótica da Teoria dos Sistemas Sociais, utilizando os pressupostos gerais da Teoria e a estrutura apresentada por Niklas Luhmann sobre o sistema médico. Apresentam-se alguns “desassossegos” provocados pela Teoria; as possíveis relações entre o sistema da saúde e o que Luhmann chamou de sistema médico e como esse sistema, atualmente, pode ser considerado sistema da saúde; e, por fim, a nossa concepção do sistema da saúde na atualidade.

  9. Data of evolutionary structure change: 1A4SA-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SA-2ONNF 1A4S 2ONN A F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...HHHHH ------ EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- ... 2ONN F 2ONNF

  10. In Memoriam, Doctor Saúl Rugeles Moreno

    Directory of Open Access Journals (Sweden)

    Carlos Cortés C.

    1994-06-01

    Full Text Available

    Académico Correspondiente

    El pasado cinco de noviembre falleció súbitamente en su tierra natal el Dr. Saúl Rugeles Moreno. Para las nuevas generaciones distantes de la comunidad socorrana, quizá éste nombre no les signifique mucho, pero sí para quienes lo conocimos, lo admiramos y fuimos afortunados de contar con su amistad. Saúl no ejerció en la Capital y pertenecía al grupo de aquellos colegas que por no tener asiento en los centros de docencia, se les ignora, como si sólo existiese la medicina teórica de las universidades, desconociéndose que hay en todo cuerpo médico un grupo silencioso de discípulos de Galeno, que lejos del ruido que brindan los computadores y toda la tecnología moderna, desempeñan una irremplazable labor a otro nivel, ya sea en la periferia de las áreas metropolitanas, de los Institutos municipales de salud y en la provincia, principalmente. Algunos de ellos forman a una generación, cada vez más diezmada pues el tiempo no pasa en vano.

    Ejercen una medicina integral y práctica que a todo encuentra solución, sin traspasar los límites de la temeridad; no dan cátedras magistrales pero ejercen la docencia con el ejemplo; pues también se enseña viviendo honestamente; no han publicado muchos artículos médicos o quizás ninguno, pues con su ejemplo lo han dicho todo. Van a los Congresos Médicos porque les nace estar actualizados; son respetuosos en el trato con sus colegas y no murmuran de ellos pues nunca consideran sus intereses lesionados y como han sido buenos en el sentido evángelico de la palabra, así piensan de los demás.

    Son sencillos en sus comentarios que siempre matizan con su larga experiencia profesional, sin hacer alarde de que en verdad saben. Su afán de servicio los ha llevado a incursionar en otros campos diferentes al médico; actúan también como consejeros y sienten como propia la problemática del medio en el cual actúan, pues para todo tienen tiempo ya

  11. Homens e cuidados de saúde em famílias empobrecidas na Amazônia Men and health care in impoverished families in Amazonia

    Directory of Open Access Journals (Sweden)

    Denise Machado Duran Gutierrez

    2012-12-01

    Full Text Available Investigamos o lugar do homem em relação aos cuidados com saúde, em famílias de baixa renda no contexto amazônico. Utilizamos 11 entrevistas com eles e suas famílias e com 21 profissionais de Saúde sobre eles e observação dos contextos em que vivem e dos processos de utilização e atendimento dos serviços. Os dados empíricos foram analisados em seu conteúdo sob a perspectiva cultural do holismo-individualismo. Verificamos que os homens cuidam predominantemente da saúde de si e da família a partir dos papéis socialmente tradicionais que lhes são atribuídos. O cuidado de si para eles é, em geral, emergencial, superficial e mediado pela mulher. Já o cuidado com os outros está voltado para o cumprimento do papel de provedor. Fogem desse padrão, homens em que predomina a cultura indígena e jovens com visão social e familiar mais moderna. Via de regra, os parentes reforçam as principais tendências culturais do comportamento masculino a respeito dos cuidados com a saúde. Os profissionais, por sua vez, tendem a desqualificar as reivindicações masculinas, buscando equivocadamente combater o machismo, e falham em reconhecer diferenças pautadas em repertórios culturais.We investigated the position of men in relation to health care in low-income families at the Amazon region. We completed 11 interviews with the men and their families and with 21 health care professionals responsible for them. We made observations of the contexts in which they live and of the use and provision of health service process. Data were analyzed from the perspective of cultural holism-individualism. We found that men tend to follow traditional social roles in managing their own and their family's health. Health care for themselves is usually emergency care, superficial and mediated by the woman. The man's care for others is primarily focused on fulfilling the role of provider. However, men dominated by indigenous culture and young men with more modern

  12. The response to gender violence among Brazilian health care professionals Respostas à violência de gênero entre profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Daniela Daltoso

    2013-03-01

    Full Text Available The scope of this paper is to identify the experience, attitudes and impressions of health care professionals (HCPs in addressing the needs of women patients suffering from intimate partner violence (IPV. In-depth interviews were conducted with 14 doctors and 11 nurses in Ribeirão Preto. Results show that there is an 'apparent invisibility' of IPV, the convenience of a tacit compact of silence about such violence on the part of women and HCPs. We studied the reasons given by HCPs for failing to deal with IPV. We also addressed the health service facility context, and the diversity of the professioinals' responses to violence, with indications of the emergence of a more proactive and positive stance. Qualitative data analysis highlights previous survey findings. A positive response from HCPs shows that there is perhaps some change from a narrow, medically-focused model of health care, to a more broadly defined social model.Objetivos: Identificar a experiência, as atitudes e os sentimentos dos profissionais de saúde (PS quando abordam as necessidades de mulheres que sofrem violência do parceiro íntimo (VPI. Método: Foram realizadas entrevistas em profundidade com 14 médicos e 11 enfermeiras em Ribeirão Preto. Resultados: Há uma aparente invisibilidade e a conveniência de um acordo tácito de silêncio por parte da mulher e do PS; exploramos as razões dadas por eles para esta inabilidade em atender VPI. Também abordamos o contexto dos serviços de saúde, a diversidade de respostas dos profissionais e a emergência uma postura mais proativa e positiva. Discussão: A análise qualitativa realça os resultados de um inquérito prévio. Uma resposta positiva mostra que talvez haja algumas mudanças de perspectiva de um modelo medicalizado de cuidado à saúde para um modelo mais abrangente ou integral que define saúde como social.

  13. 出口企业应关注SA8000标准认证

    Institute of Scientific and Technical Information of China (English)

    李志军

    2004-01-01

    @@ 一、SA8000标准的宗旨与主要内容 SA8000标准(Social Accountability 8000)是根据国际劳工组织(ILO)公约、联合国儿童权利公约及世界人权宣言制定的,其宗旨是为了保护劳工基本权益.

  14. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Pinto

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  15. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Pinto Luiz Felipe

    2004-01-01

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  16. Simultaneous Estimation of Geophysical Parameters with Microwave Radiometer Data based on Accelerated Simulated Annealing: SA

    Directory of Open Access Journals (Sweden)

    Kohei Arai

    2012-07-01

    Full Text Available Method for geophysical parameter estimations with microwave radiometer data based on Simulated Annealing: SA is proposed. Geophysical parameters which are estimated with microwave radiometer data are closely related each other. Therefore simultaneous estimation makes constraints in accordance with the relations. On the other hand, SA requires huge computer resources for convergence. In order to accelerate convergence process, oscillated decreasing function is proposed for cool down function. Experimental results show that remarkable improvements are observed for geophysical parameter estimations.

  17. Saúde e qualidade de vida de jornalistas: estudo de revisão

    Directory of Open Access Journals (Sweden)

    Regina Zanella Penteado

    2016-06-01

    Full Text Available Objetivo: Realizar revisão sistemática da literatura voltada para a saúde e a qualidade de vida de jornalistas, relacionadas ao trabalho. Métodos: Foram realizadas buscas nas seguintes bases: LILACS, SciELO, Doaj, MEDLINE, Science Direct, Wiley Online Library, Springer Link e Clase. Foram priorizados artigos publicados em periódicos nacionais e internacionais, nos idiomas em português, inglês e espanhol, no período entre 2005 e 2015. O processo de seleção seguiu etapas e critérios pré-definidos do estudo, bem como a aplicação de Testes de Relevância. Resultados: A seleção resultou em oito publicações para revisão. Os aspectos e/ou questões do processo saúde-doença-cuidado de jornalistas, que têm sido enfatizados nas investigações, integram as categorias: saúde vocal/expressividade (três: 37,5%; saúde mental (quatro: 50% e saúde alimentar/nutricional (um: 12,5%; e eles vêm sendo abordados de maneira isolada. Faltam estudos pautados por uma concepção ampliada e abrangente de saúde e qualidade de vida. Conclusão: O estudo mostra a necessidade de pesquisas e investimentos na formação de uma cultura de promoção da saúde e qualidade de vida dos jornalistas, o que pode ocorrer na interdisciplinaridade das áreas de Saúde, Comunicação e Educação, com apoio das entidades de classe da categoria e da mídia.

  18. Saúde internacional: alguns aspectos conceituais contemporâneos

    Directory of Open Access Journals (Sweden)

    Villa Tereza Cristina Scatena

    2001-01-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca de algumas abordagens contemporâneas de Saúde Internacional, que suscitam o apontamento de questões que merecem ser refletidas e discutidas, permitindo subsidiar a compreensão no campo da Saúde Internacional em seus aspectos conceituais e operacionais, no processo de integração econômico-social das regiões de fronteira.

  19. Análisis factorial confirmatorio del Cuestionario SA-45 en una muestra mexicana

    OpenAIRE

    2012-01-01

    El objetivo de la presente investigación consistió en examinar la estructura factorial, la fiabilidad y los datos normativos del Cuestionario SA-45 (Symptom Assessment-45) en una muestra de estudiantes universi-tarios mexicanos. Como se predijo, los análisis factoriales confirmatorios indicaron que el modelo de nueve factores proporcionaba el mejor ajuste del SA-45. Así mismo, los datos demostraron buenos niveles de fiabilidad (consistencia interna) del cuestionario. Los datos normativos most...

  20. The Sahel-Doukkala Information Network (SaDIN) – A regional online geoinformation system

    OpenAIRE

    2003-01-01

    A critical necessity to achieve international standards in public health and sustainable development is to monitor the quality of the limited groundwater resources. To provide a basis for any sort of environmental investigations, the SaDIN project creates a knowledge pool in the centre of the Chouaïb Doukkali University, El Jadida (Morocco), in collaboration with the Data Centre of the GeoForschungsZentrum Potsdam (Germany). SaDIN comprises tools for data acquisition, sample collection and mu...

  1. Clinical observation of treating 62 patients with severe aplastic anemia failing in immunosuppressive therapy by integrative medicine

    Institute of Scientific and Technical Information of China (English)

    苏尔云

    2013-01-01

    Objective To explore treatment methods for patients with severe aplastic anemia(SAA) failing in immunosuppressive therapy(IST). Methods Totally 62 SAA patients failing in IST were treated by integrative medicine(IM).

  2. Failure to Fail in a Final Pre-service Teaching Practicum

    Directory of Open Access Journals (Sweden)

    Patricia J. Danyluk

    2015-12-01

    Full Text Available This article presents a Canadian perspective on the issue of failure to fail in Bachelor of Education programs. The issue of failure to fail in Bachelor of Education programs is one that had not been explored in any great detail. What literature does exist focuses on the strain that a teacher experiences when s/he mentors a student teacher (Siebert, Clark, Kilbridge, & Peterson, 2006 and the wide variety of situations that can result in failure (Sudzina & Knowles, 1992. This study examines whether the issue of failure to fail in final pre-service practica exist and, if so, why? Twelve interviews were conducted at a mid-sized Canadian university in Ontario with university supervisors and associate teachers on the topic of teacher candidate failure during the final teaching practicum. All participants had experience with teacher candidates struggling during practicum. Faculty commented on their supervision of student teachers in Ontario, other provinces in Canada, and the United States. Results indicate that both university supervisors and associate teachers find the decision to fail a student teacher difficult, taking an emotional toll on both the supervisor and the student. University faculty report the decision to fail results in additional work for the faculty responsible; however, failure to fail an underperforming student teacher could diminish the reputation of professional programs. Associate teachers feel a sense of betrayal when their recommendations to fail an under-performing student are not followed by the university. These findings have implications for improving the quality of field experiences and support for students, associate teachers, and faculty in Bachelor of Education programs.

  3. Functional desensitization to isoproterenol without reducing cAMP production in canine failing cardiocytes.

    Science.gov (United States)

    Laurent, C E; Cardinal, R; Rousseau, G; Vermeulen, M; Bouchard, C; Wilkinson, M; Armour, J A; Bouvier, M

    2001-02-01

    To corroborate alterations in the functional responses to beta-adrenergic receptor (beta-AR) stimulation with changes in beta-AR signaling in failing cardiomyocytes, contractile and L-type Ca(2+) current responses to isoproterenol along with stimulated cAMP generation were compared among cardiomyocytes isolated from canines with tachycardia-induced heart failure or healthy hearts. The magnitude of shortening of failing cardiomyocytes was significantly depressed (by 22 +/- 4.4%) under basal conditions, and the maximal response to isoproterenol was significantly reduced (by 45 +/- 18%). Similar results were obtained when the responses in the rate of contraction and rate of relaxation to isoproterenol were considered. The L-type Ca(2+) current amplitude measured in failing cardiomyocytes under basal conditions was unchanged, but the responses to isoproterenol were significantly reduced compared with healthy cells. Isoproterenol-stimulated cAMP generation was similar in sarcolemmal membranes derived from the homogenates of failing (45 +/- 6.8) and healthy cardiomyocytes (52 +/- 8.5 pmol cAMP. mg protein(-1). min(-1)). However, stimulated cAMP generation was found to be significantly reduced when the membranes were derived from the homogenates of whole tissue (failing: 67 +/- 8.1 vs. healthy: 140 +/- 27.8 pmol cAMP. mg protein(-1). min(-1)). Total beta-AR density was not reduced in membranes derived from either whole tissue or isolated cardiomyocyte homogenates, but the beta(1)/beta(2) ratio was significantly reduced in the former (failing: 45/55 vs. healthy: 72/28) without being altered in the latter (failing: 72/28, healthy: 77/23). We thus conclude that, in tachycardia-induced heart failure, reduction in the functional responses of isolated cardiomyocytes to beta-AR stimulation may be attributed to alterations in the excitation-contraction machinery rather than to limitation of cAMP generation.

  4. A inserção da vigilância em saúde ambiental no sistema único de saúde

    Directory of Open Access Journals (Sweden)

    Edenilo Baltazar Barreira Filho

    2012-03-01

    Full Text Available A inserção das atividades de vigilância ambiental no SUS apresenta algumas características que se diferenciam das práticas de vigilância epidemiológica. Isto ocorre principalmente em decorrência de que muitos dados sobre a exposição aos fatores ambientais são obtidos fora do setor saúde e a adoção de ações que busquem controlar e/ou prevenir exigem, na grande maioria dos casos, uma compreensãoe articulação intra e intersetorial, pois o setor saúde não é capaz de, sozinho, dar respostas as questões de saúde ambiental.Nos últimos anos vem consolidando-se cada vez mais o campo da saúdeambiental, que compreende a área da saúde pública, afeita ao conhecimento científico, à formulação de políticas públicas e às correspondentes intervenções (ações relacionadas à interação entre a saúde humana e os fatores do meio ambiente natural e antrópico que a determinam, condicionam e influenciam, com vistas a melhorar a qualidade de vida do ser humano sob o ponto de vista dasustentabilidade(1.Conforme entendimento acordado no I Seminário da Política Nacional de Saúde Ambiental, realizado em outubro de 2005, e consolidado na primeira Conferência Nacional de Saúde Ambiental, realizada em dezembro de 2009, compreende-se como uma área de práticas intersetoriais e transdisciplinares voltadas aos reflexos, na saúde humana, das relações ecogeossociais do homem com o ambiente(1.Nesse sentido, o Ministério da Saúde vem implementando em todo o território nacional um Sistema de Vigilância em Saúde Ambiental (SINVISA, buscando o aprimoramento deste “modelo” de atuação e estabelecendo competências nas três esferas de gestão, com o objetivo de consolidar a prática da Saúde Ambiental dentro do SUS.A Instrução Normativa nº 1, de 7 de março de 2005, cria o SINVISA, estabelece a área de atuação, as competências para as três esferas de Gestão do SUS e define a Vigilância em Saúde Ambiental como sendo

  5. Da medicina do trabalho à saúde do trabalhador From occupational medicine to workers' health

    Directory of Open Access Journals (Sweden)

    René Mendes

    1991-10-01

    Full Text Available Ensaio de revisão sobre a evolução dos conceitos e práticas da medicina do trabalho à saúde do trabalhador, passando pela saúde ocupacional. Busca-se responder às seguintes questões: quais as características básicas da medicina do trabalho (na sua origem e na sua evolução; como e por que evoluiu a medicina do trabalho para a saúde ocupacional; por que o modelo da saúde ocupacional se mostrou insuficiente; em que contexto surge a saúde do trabalhador; quais as principais características da saúde do trabalhador.The evolution of the concepts and practice of occupational medicine, occupational health and workers' health is tentatively reviewed. An attemp is made to answer the following questions: what were the major characteristics of occupational medicine throughout its evolution? How and why did occupational medicine evolve into occupational health? Why has the "occupational health model" become inadequate? Writhin what context did workers' health arise? What are the principal characteristics of workers' health?

  6. Teatro do oprimido em saúde mental: participação social com arte

    Directory of Open Access Journals (Sweden)

    Érika Sales dos Santos

    2016-09-01

    Full Text Available Relato de experiência de intervenção do projeto Teatro do oprimido na saúde mental em um Centro de Atenção Psicossocial (CAPS de Fortaleza, Ceará, Brasil, no qual descrevemos como esta ferramenta é capaz de contribuir para o fortalecimento da participação social. O projeto foi elaborado por um grupo de residentes e preceptores da Residência Integrada em Saúde, com ênfase em Saúde Mental Coletiva, da Escola de Saúde Pública do Ceará. Utilizamos a pesquisa qualitativa. Em face do difícil contexto de efetivação da política de saúde mental no município, percebemos que a arte pode contribuir para a construção de uma atenção em saúde efetiva, emancipatória e apta a acolher as diversidades. Na nossa ótica, o teatro do oprimido é uma ferramenta importante para fortalecer a participação social e para reinventá-la, problematizando estigmas e impulsionando a garantia de direitos.

  7. A proteomic study of rice cultivar TNG67 and its high aroma mutant SA0420.

    Science.gov (United States)

    Lin, Da-Gin; Chou, Szu-Yi; Wang, Arthur Z; Wang, Yi-Wen; Kuo, Shu-Ming; Lai, Chien-Chen; Chen, Liang-Jwu; Wang, Chang-Sheng

    2014-01-01

    Fragrance is a very important economic trait for rice cultivars. To identify the aroma genes in rice, we performed a proteomics analysis of aroma-related proteins between Tainung 67 (TNG67) and its high aroma mutant SA0420. Seventeen of the differentially identified proteins were close related with the aroma phenotype of SA0420. Among them, 9 were found in leaves and 8 were found in grains. One protein (L3) was identified as the chloroplastic glyceraldehyde-3-phosphate dehydrogenase B (OsGAPDHB) which was less abundant in SA0420 than TNG67. Sequence analysis demonstrated that this protein in SA0420 carries a P425S mutation in the C-terminal extension domain, which might hinder the formation of holoenzyme, thereby changing the profile of aroma compounds. The protein profile of OsGAPDHB showed only a weak correlation to its transcription profile. This result indicated that the reduction of OsGAPDHB in SA0420 is regulated by post-translational processes and can only be analyzed by proteomics approach. Transgenic lines suppressing OsGAPDHB through RNAi harbored more fragrance than TNG67 but less than SA0420. With betaine-aldehyde dehydrogenase as the only fragrance gene identified in rice to date, OsGAPDHB may serve as the second protein known to contribute to the aroma phenotype.

  8. A finitude humana e a saúde pública Human finitude and public health

    Directory of Open Access Journals (Sweden)

    Sergio Rego

    2006-08-01

    Full Text Available A morte é uma questão implícita na prática e na formação dos profissionais da saúde. Há, todavia, uma tendência dos profissionais de saúde de restringir sua discussão aos aspectos meramente técnicos, seja na assistência à saúde, seja nas ações de saúde pública. Este artigo analisa a importância da adoção do cuidado de qualidade no fim de vida como norteador das práticas assistenciais e a necessidade de que o campo da Saúde Pública tome esses cuidados como objeto de reflexão e de pesquisas. Por fim, aponta-se para aspectos relevantes para a formação de profissionais de saúde para que sejam respeitadores das diferenças e comprometidos com o diálogo.Death is an implicit subject in both health practice and health professionals' training. There is a tendency by health professionals to reduce this analysis merely to technical aspects. This paper analyzes the importance of adopting quality care at the end of life as a guide for public health care. We highlight relevant aspects for training health professionals to respect moral differences and to be prepared to discuss their own points of view.

  9. Kakaibang Halimuyak: Iba't Ibang Imahe ng Pangangapital sa Balintawak

    Directory of Open Access Journals (Sweden)

    Mariah Amour C. Miranda

    2015-06-01

    Full Text Available Ginagalugad ng sanaysay na ito ang isang pangunahing lugar na nadaraanan mula Norte patungong Maynila—ang Balintawak. Nagsisilbing manibela ng pagsusuri ang kontemporaneong pananaw sa lunan bilang pugad ng mga anyong may magkakasalungat na kahulugan. Binibigyang-pansin ng sanaysay ang iba't ibang imahe ng pagbebenta na matatagpuan sa Balintawak: ang billboard ng kumpanyang Bench na siyang pinakamalaki, ang mismong palengke, at ang mga lakong paninda sa tabing-kalsada. Sa pamamagitan nito, maipapakita ng sanaysay kung paano madadalumat ang Balintawak bilang isang panlipunang texto na sumasalamin sa mga magkakaibang pangangapital sa naturang lunan. This essay explores the space of Balintawak—a focal point of urban travel from northern Luzon to Manila. Using the contemporary view on space as a site of structures with contradictory meanings, the study seeks to understand how various images of market activities in Balintawak create meaningful representations. These images include the gigantic billboard of Bench, the central market itself, and flea markets in the area. The essay shows how Balintawak as a social text serves as a trading center of different forms of capital.

  10. A autonomia do paciente no processo terapêutico como valor para a saúde

    Directory of Open Access Journals (Sweden)

    Jussara Calmon Reis de Souza Soares

    2007-04-01

    Full Text Available No presente artigo analisam-se as críticas à concepção reducionista de saúde e doença da biomedicina, buscando contribuir para um repensar sobre saúde em uma vertente de proposições positivas. Remetemo-nos, sobretudo, à epistemologia de Canguilhem, para destacar pontos fundamentais na discussão sobre saúde, integrando-a a uma nova leitura do conceito de autonomia do paciente no processo terapêutico. O método de análise seguiu a perspectiva do pensamento complexo. Nesta perspectiva, a autonomia caracteriza-se como relativa e relacional, inseparável da dependência. É também condição necessária para a saúde, compreendida em seu sentido mais amplo, como potência auto-recuperadora do organismo humano. Assim, autonomia passa a ser um valor fundamental a ser resgatado e defendido tanto na clínica, quanto no campo das ciências humanas e sociais em saúde. Discutem-se implicações do resgate da autonomia, ainda que como um vir-a-ser, como precondição para a saúde e a cidadania, para a própria vida.

  11. Produção e citação em Saúde Coletiva: um olhar a partir dos periódicos Cadernos de Saúde Pública e Revista de Saúde Pública Output and citation in Public Health: a perspective based on the journals Cadernos de Saúde Pública and Revista de Saúde Pública

    Directory of Open Access Journals (Sweden)

    Leandro Carvalho

    2007-12-01

    Full Text Available O presente trabalho é um estudo bibliométrico comparativo entre as duas principais revistas científicas da área da Saúde Coletiva publicadas no Brasil: Cadernos de Saúde Pública (CSP e Revista de Saúde Pública (RSP. Foram analisados 24 fascículos de cada periódico, publicados entre 1996 e 2003, construindo uma amostra de 819 artigos (496 de CSP e 323 de RSP. Os seguintes elementos dos artigos foram identificados e analisados: área temática do artigo e padrão de citações de publicações (artigos em periódicos, livros e/ou capítulos de livro, teses/dissertações, documentos de Internet, "literatura cinzenta" e outros tipos de publicações. Os dados encontrados mostram que a maioria dos artigos publicados é da subárea "epidemiologia". O padrão de citação identificado nas revistas foi de citações a artigos em periódico em maior número, seguidas das citações a livros e/ou capítulos de livro. Artigos na subárea "ciências sociais em saúde" publicados em CSP apresentam características distintas, com maior número de citações a livros e capítulos. Os autores argumentam que as informações são relevantes na caracterização da produção da área, com desdobramentos importantes no plano da avaliação acadêmico-científica da Saúde Coletiva no país.This is a comparative bibliometric study of the two main scientific journals in the Public Health field in Brazil: Cadernos de Saúde Pública (CSP and Revista de Saúde Pública (RSP. Twenty-four issues of each periodical were analyzed, published from 1996 to 2003, comprising a sample of 819 articles (496 from CSP and 323 from RSP. The following elements in the articles were identified and analyzed: thematic area of the article and citation pattern of publications (articles in periodicals, books and/or book chapters, theses/dissertations, Internet documents, "gray" literature, and other types of publications. The resulting data showed that the majority of the

  12. The failing human heart is unable to use the Frank-Starling mechanism.

    Science.gov (United States)

    Schwinger, R H; Böhm, M; Koch, A; Schmidt, U; Morano, I; Eissner, H J; Uberfuhr, P; Reichart, B; Erdmann, E

    1994-05-01

    There is evidence that the failing human left ventricle in vivo subjected to additional preload is unable to use the Frank-Starling mechanism. The present study compared the force-tension relation in human nonfailing and terminally failing (heart transplants required because of dilated cardiomyopathy) myocardium. Isometric force of contraction of electrically driven left ventricular papillary muscle strips was studied under various preload conditions (2 to 20 mN). To investigate the influence of inotropic stimulation, the force-tension relation was studied in the presence of the cardiac glycoside ouabain. In skinned-fiber preparations of the left ventricle, developed tension was measured after stretching the preparations to 150% of the resting length. To evaluate the length-dependent activation of cardiac myofibrils by Ca2+ in failing and nonfailing myocardium, the tension-Ca2+ relations were also measured. After an increase of preload, the force of contraction gradually increased in nonfailing myocardium but was unchanged in failing myocardium. There were no differences in resting tension, muscle length, or cross-sectional area of the muscles between both groups. Pretreatment with ouabain (0.02 mumol/L) restored the force-tension relation in failing myocardium and preserved the force-tension relation in nonfailing tissue. In skinned-fiber preparations of the same hearts, developed tension increased significantly after stretching only in preparations from nonfailing but not from failing myocardium. The Ca2+ sensitivity of skinned fibers was significantly higher in failing myocardium (EC50, 1.0; 95% confidence limit, 0.88 to 1.21 mumol/L) compared with nonfailing myocardium (EC50, 1.7; 95% confidence limit, 1.55 to 1.86 mumol/L). After increasing the fiber length by stretching, a significant increase in the sensitivity of the myofibrils to Ca2+ was observed in nonfailing but not in failing myocardium. These experiments provide evidence for an impaired force

  13. 40 CFR 1042.320 - What happens if one of my production-line engines fails to meet emission standards?

    Science.gov (United States)

    2010-07-01

    ...-line engines fails to meet emission standards? 1042.320 Section 1042.320 Protection of Environment... if one of my production-line engines fails to meet emission standards? (a) If you have a production... an initial failed test if all of the following are true: (1) The catalyst was in a green...

  14. Characteristics of successful and failed mentoring relationships: a qualitative study across two academic health centers.

    Science.gov (United States)

    Straus, Sharon E; Johnson, Mallory O; Marquez, Christine; Feldman, Mitchell D

    2013-01-01

    To explore the mentor-mentee relationship with a focus on determining the characteristics of effective mentors and mentees and understanding the factors influencing successful and failed mentoring relationships. The authors completed a qualitative study through the Departments of Medicine at the University of Toronto Faculty of Medicine and the University of California, San Francisco, School of Medicine between March 2010 and January 2011. They conducted individual, semistructured interviews with faculty members from different career streams and ranks and analyzed transcripts of the interviews, drawing on grounded theory. The authors completed interviews with 54 faculty members and identified a number of themes, including the characteristics of effective mentors and mentees, actions of effective mentors, characteristics of successful and failed mentoring relationships, and tactics for successful mentoring relationships. Successful mentoring relationships were characterized by reciprocity, mutual respect, clear expectations, personal connection, and shared values. Failed mentoring relationships were characterized by poor communication, lack of commitment, personality differences, perceived (or real) competition, conflicts of interest, and the mentor's lack of experience. Successful mentorship is vital to career success and satisfaction for both mentors and mentees. Yet challenges continue to inhibit faculty members from receiving effective mentorship. Given the importance of mentorship on faculty members' careers, future studies must address the association between a failed mentoring relationship and a faculty member's career success, how to assess different approaches to mediating failed mentoring relationships, and how to evaluate strategies for effective mentorship throughout a faculty member's career.

  15. The Reputational Consequences of Failed Replications and Wrongness Admission among Scientists.

    Directory of Open Access Journals (Sweden)

    Adam K Fetterman

    Full Text Available Scientists are dedicating more attention to replication efforts. While the scientific utility of replications is unquestionable, the impact of failed replication efforts and the discussions surrounding them deserve more attention. Specifically, the debates about failed replications on social media have led to worry, in some scientists, regarding reputation. In order to gain data-informed insights into these issues, we collected data from 281 published scientists. We assessed whether scientists overestimate the negative reputational effects of a failed replication in a scenario-based study. Second, we assessed the reputational consequences of admitting wrongness (versus not as an original scientist of an effect that has failed to replicate. Our data suggests that scientists overestimate the negative reputational impact of a hypothetical failed replication effort. We also show that admitting wrongness about a non-replicated finding is less harmful to one's reputation than not admitting. Finally, we discovered a hint of evidence that feelings about the replication movement can be affected by whether replication efforts are aimed one's own work versus the work of another. Given these findings, we then present potential ways forward in these discussions.

  16. The dilemma of the failed state thesis in post-9/11 world affairs

    Directory of Open Access Journals (Sweden)

    A. Schoeman

    2008-07-01

    Full Text Available The 9/11 terrorist attacks shifted the emphasis of failed states as just a regional humanitarian problem to one that could present a global security threat. In this regard US policymakers, especially, identified failed states as possible terrorist threats. However, this renewed attention to the study of state failure has exposed a number of theoretical weaknesses in this body of literature. The latter could mainly be ascribed to the way in which US policy makers have often used generalised definitions of failed states and then applied it to states that are perceived as threats. Another problem is the fact that government sponsored research institutes and think tanks are operating independently from university academics. This situation has caused theoretical confusion as conditions in failed states are often interpreted differently resulting in the development of a number of opposing theories, definitions and confusing classification models. The body of literature is further accused of endorsing a “Weberian” definition (ideal type of the state against which degrees of “failure” in non-complying states are measured. This article will investigate the extent of these theoretical weaknesses and expose the dangers of following an approach that seem to misinterpret the political realities of developing states (often regarded as failed – this despite having an extensive popular following. It will further focus on possible alternative approaches – or the formulation of ideas that are better suited and relevant to the often unique internal political, social and economic dynamics of unstable states.

  17. Possibilidades do WHOQOL-bref para a promoção da saúde na estratégia saúde da família

    Directory of Open Access Journals (Sweden)

    Anna Maria Chiesa

    2011-12-01

    Full Text Available A ampliação das ações de promoção da saúde na Estratégia Saúde da Família pode contribuir para a construção da integralidade, mas, ainda persistem lacunas de tecnologias para instrumentalizar os profissionais a analisarem os potenciais de saúde da população. O objetivo deste estudo é sintetizar as contribuições do WHOQOL-bref para instrumentalizar ações de promoção da saúde na Estratégia Saúde da Família. Foi realizada uma metassíntese qualitativa a partir de pesquisas realizadas pelo grupo Modelos tecnoassistenciais e a promoção da saúde com o uso do WHOQOL-bref e sua interface com a promoção da saúde. As sínteses das cinco pesquisas mostraram que existem relações conceituais entre os domínios do WHOQOL-bref e a promoção da saúde, legitimando este como um instrumento para a promoção da saúde. A utilização do WHOQOL-bref pode facilitar o vinculo e o cuidado longitudinal na Estratégia Saúde da Família.

  18. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    2010-03-01

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  19. Challenges of SA 8000 standard implantation: social responsibility at PETROBRAS LUBNOR; Os desafios da implantacao da Norma SA 8000: responsabilidade social na PETROBRAS LUBNOR

    Energy Technology Data Exchange (ETDEWEB)

    Abreu, Monica Cavalcanti Sa de [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Fac. de Economia, Administracao, Atuaria e Contabilidade. Dept. de Administracao de Empresas; Leal Neto, Antenor Gomes de Barros [PETROBRAS S.A., Fortaleza, CE (Brazil). Lubrificantes e Derivados de Petroleo do Nordeste (LUBNOR)

    2004-07-01

    This paper presents the developing steps during the establishment of Social Accountability SA 8000 standards in LUBNOR - a PETROBRAS refining plant at Ceara. The SA 8000 standards have been incorporated to Quality, Environmental, Health and Safety Integrated Management System in accordance with ISO 9001, ISO 14001 and OHSAS 18001. In order to implement the social accountability, the company established a work group task with a mission of communicating, maintaining and promoting some actions with all employees of the Refinery. The biggest challenge of implementing this standard is concerned with the compromise of the supply chain (consisting of suppliers and sub suppliers of products and services), the supervision of the labor task and the adequacy of the management system with the embodying of SA 8000 requisites. New demands were generated, for example: the election of the employee's representative; the celebration of a term of compromise with suppliers; the development of a follow up plan to figure out the supplier's performance; and, the monitoring of extra time worked. The establishment of SA 8000 is a way to stand out the effort at LUBNOR in order to improve the working environment conditions and to consolidate an administration committed with sustainable development and human being improvement. (author)

  20. Tumor imaging with 2 sigma-receptor ligands, F-18-FE-SA5845 and C-11-SA4503 : A feasibility study

    NARCIS (Netherlands)

    van Waarde, A; Buursma, AR; Hospers, GAP; Kawamura, K; Kobayashi, T; Ishii, K; Oda, K; Ishiwata, K; Vaalburg, W; Elsinga, PH

    2004-01-01

    Our objective was to study 2 radioligands for visualization of sigma-receptors with PET. Methods: Two radioligands--sigma(1)-selective C-11-1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine (C-11-SA4503) and nonsubtype-selective 1-(4-2'-F-18-fluoroethoxy-3-methoxyphenethyl)-4-(3-(4-fluoropheny

  1. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  2. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    2011-09-01

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  3. Estresse no trabalho e interrupção de atividades habituais, por problemas de saúde, no Estudo Pró-Saúde

    National Research Council Canada - National Science Library

    Luís Eduardo Teixeira de Macedo; Dóra Chor; Valeska Andreozzi; Eduardo Faerstein; Guilherme L. Werneck; Claudia S. Lopes

    2007-01-01

    .... Esta investigação, do tipo transversal, se insere em um estudo prospectivo de 2.343 funcionários técnico-administrativos de uma universidade no Estado do Rio de Janeiro - Estudo Pró-Saúde...

  4. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  5. Institutos de pesquisa em saúde Health research institutes

    Directory of Open Access Journals (Sweden)

    Erney Plessmann Camargo

    2004-06-01

    Full Text Available Ao fim do século 19, em seguida aos avanços na assepsia cirúrgica e no esclarecimento do papel de microorganismos como causadores de moléstias infecciosas, foram criados em escala mundial "institutos de pesquisa com os objetivos de conduzir pesquisa sobre as causas, prevenção e tratamento de homens e animais e de desenvolver produtos preventivos e curativos como vacinas e antitoxinas". Para atingir esses objetivos os institutos recrutaram os melhores cientistas disponíveis em todos os lugares. Este foi um período fulgurante para a pesquisa sublinhado por inúmeras descobertas sobre as doenças infecciosas. Passada essa fase, os institutos entraram em depressão e até mesmo insolvência. Muitos se recuperaram, alguns não. Muitos ainda sofrem de uma "crise de identidade". Neste ensaio analisamos o destino dos institutos de pesquisa em saúde no Brasil, as causas de seu sucesso e eventuais fracassos e as medidas possíveis de ajudá-los a contornar suas presentes dificuldades.By the end of the 19th century, after the advances in surgical asepsis and the understanding of the role of microorganisms in the etiology of many infectious diseases, research institutes in the public health area were created worldwide with the objectives of undertaking "scientific research into the causes, prevention and treatment of disease in man and animals and to prepare and supply protective and curative materials such as vaccines and antitoxins". To pursue these objectives the institutes hired the best scientists from everywhere. This was an exhilarating period for research in which discoveries proliferated. After that, institutes got into depression and even insolvency. Most recovered, many not. Many are still suffering from an "identity crisis". In this paper we analyze the fate of the health research institutes in Brazil, the causes of their success and eventual failures and the possible ways to get out of their current difficulties.

  6. A agência nacional de saúde suplementar - ANS: onze anos de regulação dos planos de saúde

    Directory of Open Access Journals (Sweden)

    Rachel Torres Salvatori

    2012-09-01

    Full Text Available Trata-se de um trabalho com objetivo de apresentar os principais resultados alcançados pela regulação dos planos de saúde exercida pela Agência Nacional de Saúde Suplementar, autarquia instituída para promover o equilíbrio das relações entre operadoras e consumidores, tornando o mercado de planos de saúde mais efi ciente. Como avanços mais significativos oriundos da regulação do setor podem ser citados: as barreiras à entrada e à saída das operadoras no mercado, a ampliação das coberturas assistenciais contratuais, o monitoramento e o controle dos reajustes, a indução a práticas de promoção da saúde e à qualifi cação do setor, e a possibilidade da portabilidade de carências. Como desafios a serem enfrentados, podem ser apontados: o monitoramento da qualidade da assistência prestada, a renúncia fiscal, a existência dos cartões de desconto, a operação de empresas como operadoras de planos de saúde sem o registro na ANS e a adoção de alguns mecanismos nocivos de regulação assistencial pelas operadoras de planos de saúde. ----- The National Agency of Supplementary Health – ANS: eleven years in regulating health insurance plans ----- ABSTRACT ----- This study aims to present the main results achieved in the regulation of health insurance plans through the National Agency of Supplementary Health, an agency set up to promote a balance in the relationship between health insurance plans and their consumers, making the health insurance market more efficient. As examples of the important progress achieved in regulating the sector, the authors emphasize: greater control of the infl ow and outfl ow of service operators in the market; the widening of contractual coverage; monitoring and control of readjustments; encouragement of health promotion practices and increased training in the sector; grace period flexibility. Examples of regulatory gaps however, include: problems monitoring the quality of the care provided

  7. Homens e saúde na pauta da Saúde Coletiva Men and health as targets of the Public Health

    Directory of Open Access Journals (Sweden)

    Lília Blima Schraiber

    2005-03-01

    Full Text Available Apresenta-se a temática "homens e saúde" como questão contemporânea da Saúde Coletiva e produto da interface entre as ciências humanas e a saúde: o caráter social do adoecimento; a perspectiva de gênero como forma particular da relação saúde-sociedade; e a promoção da saúde como conceituação positiva Elabora-se a temática em torno de três eixos de aproximação, sob a perspectiva dos exercícios das masculinidades: saúde sexual e reprodutiva; violência e gênero e morbi-mortalidade em homens. São apontadas as contribuições que estes eixos produzem como esforço empírico para realizar a categoria gênero, ao tempo em que revelam novas problemáticas para a área de saúde: a paternidade, o exercício interativo da sexualidade, a violência interpessoal no âmbito da vida privada, a hiper-masculinidade na violência entre homens, o cuidado de si e o cuidar em saúde para os homens. Estas contribuições permitirão não apenas inserir as masculinidades como questão de saúde, mas renovar as formas de tratamento de homens e mulheres no campo da saúde.It shows the thematic "men and health" as a contemporary matter of the Public Health and interface product among human sciences and health: the social view of illness; the gender perspective as a particular form of the relation health-society and the health promotion while positive means of health. It elaborates the thematic around three approach axises, conformed in the relation between men and health from the perspective of exercises of the masculinity: sexual and reproductive health; violence and gender, and morbid-mortality in men. The contributions that these axises produce are mentioned as empiric effort to accomplish the category gender, the time in which they reveal health new problems to the health's area: the paternity, the interactive exercise of the sexuality, the interpersonal violence in life closet scope, the hipper-masculinity in the violence among men, the

  8. Bayesian method for system reliability assessment of overlapping pass/fail data

    Institute of Scientific and Technical Information of China (English)

    Zhipeng Hao; Shengkui Zeng; Jianbin Guo

    2015-01-01

    For high reliability and long life systems, system pass/fail data are often rare. Integrating lower-level data, such as data drawn from the subsystem or component pass/fail testing, the Bayesian analysis can improve the precision of the system reli-ability assessment. If the multi-level pass/fail data are overlapping, one chal enging problem for the Bayesian analysis is to develop a likelihood function. Since the computation burden of the existing methods makes them infeasible for multi-component systems, this paper proposes an improved Bayesian approach for the system reliability assessment in light of overlapping data. This approach includes three steps: fristly searching for feasible paths based on the binary decision diagram, then screening feasible points based on space partition and constraint decomposition, and final y sim-plifying the likelihood function. An example of a satel ite rol ing control system demonstrates the feasibility and the efficiency of the proposed approach.

  9. Rotationplasty after failed limb-sparing tumor surgery: a report of two cases.

    Science.gov (United States)

    Brigman, Brian E; Kumagai, Steven G; McGuire, Michael H

    2003-10-01

    Rotationplasty was used in two cases of failed limb salvage in adults after tumor resection and reconstruction. Each patient had distal femoral osteosarcoma, one treated with osteoarticular allograft reconstruction, the other with a custom endoprosthetic reconstruction. Both patients had failure attributable to infection, and after multiple surgeries, elected to have rotationplasty. Both had complications associated with the rotationplasty but went on to have functional limbs with Musculoskeletal Tumor Society functional scores of 67% and 87%. One patient died of metastatic disease 29 months after rotationplasty, the other had no problems 50 months after rotationplasty. Although rotationplasty offers a functional improvement over transfemoral amputation in the salvage of failed tumor reconstructions, only 10 such cases have been reported in adults. Rotationplasty should be considered in selected patients for whom an amputation is being considered after failed limb salvage surgery.

  10. Is the pass/fail system applicable to a medical school in Korea?

    Science.gov (United States)

    Kim, Mee Young

    2007-01-01

    To determine whether a pass/fail system is more appropriate for medical education instead of a grade-based system, a survey of medical students and faculty members of Hallym University, Korea, was taken. A questionnaire was delivered to 54 junior students and 36 faculty members from a medical school in Korea and analyzed. Of these participants, 37.7% of students and 36.1% of faculty agreed to the pass/fail system, while 28.3% of students and 52.8% of faculty objected to it. The most frequent reason for objection was the potential decrease in learning achievement. A pass/fail system should be considered after persuasion of the students and faculty to think positively of this system.

  11. Bicanalicular versus monocanalicular intubation after failed probing in congenital nasolacrimal duct obstruction

    Science.gov (United States)

    Rajabi, Mohammad Taher; Zavarzadeh, Najmeh; Mahmoudi, Alireza; Johari, Mohammad Karim; Hosseini, Seyedeh Simindokht; Abrishami, Yalda; Rajabi, Mohammad Bagher

    2016-01-01

    AIM To investigate the clinical outcomes of different intubation techniques in the cases of failed primary probing. METHODS This retrospective study was performed on 338 patients with the diagnosis of congenital nasolacrimal duct obstruction with age 1-4y that had failed primary probing. Intubation was performed under light sedation in operating room and the stent was left 3mo in place. Clinical outcome was investigated 3mo after tube removal. RESULTS Bicanalicular intubation method had higher complete and relative success rates compared to monocanalicular intubation (P=0.00). In addition, Monoka intubation had better outcomes compared to Masterka technique (P=0.046). No difference was found between genders but the higher the age, the better the outcomes with bicanalicular technique rather than monocanalicular. CONCLUSION Overall success rate of bicanalicular intubation is superior to monocanalicular technique especially in older ages. Also, based upon our clinical outcomes, Masterka intubation is not recommended in cases of failed probing. PMID:27803865

  12. Acute effects of sildenafil and dobutamine in the hypertrophic and failing right heart in vivo

    DEFF Research Database (Denmark)

    Andersen, Asger; Nielsen, Jan M; Rasalingam, Sivagowry

    2013-01-01

    Abstract The purpose of this study was to investigate whether acute intravenous administration of the phosphodiesterase type 5 (PDE-5) inhibitor sildenafil in a single clinically relevant dose improves the in vivo function of the hypertrophic and failing right ventricle (RV). Wistar rats ([Formula...... significant hypertrophy, cardiac fibrosis, and reduction in RV function evaluated by echocardiography (TAPSE) and invasive pressure measurements. Sildenafil did not improve the function of the hypertrophic failing right heart in vivo, measured by TAPSE, RV systolic pressure (RVsP), and dp/dtmax. Dobutamine...... administration of the PDE-5 inhibitor sildenafil in a single clinically relevant dose did not modulate the in vivo function of the hypertrophic failing right heart of the rat measured by echocardiography and invasive hemodynamics. In the same model, dobutamine acutely improved RV function....

  13. Semi-automated Method for Failed Eruptions Search in SDO Data Base: Methodology and First Results

    Science.gov (United States)

    Mrozek, T.; Gronkiewicz, D.; Kołomański, S.; Chmielewska, E.; Chruślińska, M.

    It is well known that not all solar flares are connected with eruptions followed by coronal mass ejection (CME). Even strongest X-class flares may not be accompanied by eruptions or are accompanied by failed eruptions. There are several mechanisms responsible which were proposed. Present observations of SDO/AIA give a chance for deep statistical analysis of properties of an active region that may confine an eruption. Therefore, we developed automated method which can recognize moving structures and confined eruptions in AIA images. We present the algorithm and its performance for 1 April 2012 - 1 July 2012 period. The algorithm found more than 600 dynamic events. More than 30% of them are failed eruptions. Developed algorithm is very effective and gives a chance for huge increase of failed eruption data base.

  14. Suporte social, promoção de saúde e saúde bucal na população idosa no Brasil

    Directory of Open Access Journals (Sweden)

    Silvânia Suely Caribé de Araújo

    2006-06-01

    Full Text Available O crescente envelhecimento da população mundial, inclusive no Brasil, ressalta a importância de medidas para se lidar com esta situação. No Brasil, a maioria dos idosos é do sexo feminino; vive em domicílios multigeracionais; é referência econômica nos mesmos; possui baixo nível socioeconômico; portadora de, pelo menos, uma doença crônica; independente para realização das atividades da vida diária; não possui dentes, e busca atenção em saúde no SUS. Os idosos brasileiros expostos a situações de vulnerabilidade social estão sujeitos à interferência direta dos determinantes sociais no processo saúde-doença. O Suporte Social inclui políticas e redes de apoio social, que atuam como agente de integração do idoso na sociedade, minimizando os riscos de exclusão social e, conseqüentemente, de danos à sua saúde por meio de medidas de Promoção de Saúde. Este artigo aborda o Suporte Social e alguns de seus aspectos, tais como: tipo e local de residência, transporte e suporte financeiro; em idosos brasileiros e sua relação com a Promoção de Saúde.

  15. Saúde Mental na Atenção Básica: Sentidos Atribuídos pelos Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Raul Franklin Sarabando de Moura

    Full Text Available Em consideração a normas recentes do Ministério da Saúde, que regulamentam as relações entre a Saúde Mental e a Atenção Básica, esta pesquisa tem por objetivo estudar os sentidos atribuídos pelo ACS à Saúde Mental e suas implicações na prática cotidiana, além de suas percepções sobre as ações do Programa de Residência Multiprofissional em Atenção à Saúde (PRMAS. Trata-se de um estudo qualitativo, segundo o referencial da Hermenêutica de Profundidade,feito através de observação participante e entrevistas semidirigidas. Os resultados alcançados apontam a centralização dos cuidados em Saúde Mental nos CAPS, especialmente através de medicações. Em relação ao PRMAS, percebe-se o papel de matriciamento exercido pela residência, por meio da escuta e acompanhamento do ACS, que encontra situações de sofrimento psíquico em seu cotidiano mas se sente despreparado para lidar com elas. A residência fortalece a integralidade do cuidado, conforme qualifica a atuação do ACS e o orienta em casos difíceis, bem como pode ser um articulador do trabalho, através das iniciativas de aproximação entre os serviços que tem promovido.

  16. Concepção de enfermeiros de uma rede pública de saúde sobre Educação para a Saúde

    Directory of Open Access Journals (Sweden)

    Gisele Coscrato

    2013-06-01

    Full Text Available Estudo qualitativo que objetivou conhecer as concepções de 12 enfermeiros assistenciais, que compõem a rede pública de saúde de um município do interior paulista, sobre Educação para a Saúde, e propor ação educativa. Utilizou-se da metodologia da pesquisa-ação. A coleta dos dados ocorreu no segundo semestre de 2009, nas unidades públicas de saúde desse município. Foram usadas as técnicas de observação participante e entrevistas individuais. A análise e interpretação dos dados foi feita por categorização, fundamentada na teoria de Paulo Freire. Como resultados, revelou-se o reducionismo da Educação para a Saúde na abordagem pedagógica que envolvia a transmissão de conhecimentos, contemplando uma tendência biologicista da formação acadêmica. Porém, nos círculos de discussão, presumiu-se o despertar de uma consciência política relacionada à temática e à promoção da saúde. Concluindo, apreendeu-se a necessidade de mudanças na formação, e de viabilizar novos modos de produção de ciência, na busca pela transformação social.

  17. New Developments in FPGA Devices: SEUs and Fail-Safe Strategies from the NASA Goddard Perspective

    Science.gov (United States)

    Berg, Melanie; LaBel, Kenneth; Pellish, Jonathan

    2016-01-01

    It has been shown that, when exposed to radiation environments, each Field Programmable Gate Array (FPGA) device has unique error signatures. Subsequently, fail-safe and mitigation strategies will differ per FPGA type. In this session several design approaches for safe systems will be presented. It will also explore the benefits and limitations of several mitigation techniques. The intention of the presentation is to provide information regarding FPGA types, their susceptibilities, and proven fail-safe strategies; so that users can select appropriate mitigation and perform the required trade for system insertion. The presentation will describe three types of FPGA devices and their susceptibilities in radiation environments.

  18. New Developments in FPGA: SEUs and Fail-Safe Strategies from the NASA Goddard Perspective

    Science.gov (United States)

    Berg, Melanie D.; Label, Kenneth A.; Pellish, Jonathan

    2016-01-01

    It has been shown that, when exposed to radiation environments, each Field Programmable Gate Array (FPGA) device has unique error signatures. Subsequently, fail-safe and mitigation strategies will differ per FPGA type. In this session several design approaches for safe systems will be presented. It will also explore the benefits and limitations of several mitigation techniques. The intention of the presentation is to provide information regarding FPGA types, their susceptibilities, and proven fail-safe strategies; so that users can select appropriate mitigation and perform the required trade for system insertion. The presentation will describe three types of FPGA devices and their susceptibilities in radiation environments.

  19. Percutaneous N-Butyl cyanoacrylate embolization of a pancreatic pseudoaneurysm after failed attempts of transcatheter embolization

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ri Hyeon; Yoo, Roh Eul; Kim, Hyo Cheol [Seoul National University Medical Research Center, and Clinical Research Institute, Seoul National University Hospital, Seoul (Korea, Republic of)

    2014-10-15

    One common complication after major pancreatic surgery is bleeding. Herein we describe a case of pancreatic pseudoaneurysm which developed after pylorous preserving pancreaticoduodenectomy for common bile duct cancer. Three attempts of transcatheter embolization failed since feeders to the pseudoaneurysm had unfavorable anatomy. Direct percutaneous N-butyl cyanoacrylate injection was performed under fluoroscopy-guidance and the pseudoaneurysm was successfully treated. Percutaneous fluoroscopy-guided direct N-butyl cyanoacrylate injection may be a useful alternative when selective transcatheter embolization fails or is technically challenging.

  20. Anatomical Glenoid Reconstruction Using Fresh Osteochondral Distal Tibia Allograft After Failed Latarjet Procedure.

    Science.gov (United States)

    Sanchez, Anthony; Ferrari, Marcio B; Akamefula, Ramesses A; Frank, Rachel M; Sanchez, George; Provencher, Matthew T

    2017-04-01

    In the treatment of recurrent anterior glenohumeral instability, the Latarjet procedure has been shown to fail. This results in a need for viable revisional procedures for patients who present with this challenging pathology. We report our preferred technique for anatomical glenoid reconstruction using a fresh osteochondral distal tibia allograft after a failed Latarjet procedure. This bony augmentation technique employs a readily available dense, weight-bearing osseous tissue source that has excellent conformity, as well as the added benefit of a cartilaginous surface to correct chondral deficiencies. Given its effectiveness in the Latarjet revision setting and low complication rate, the distal tibia allograft is a reasonable treatment option.

  1. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Nogueira Vera Maria Ribeiro

    2004-01-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  2. Mulheres encarceradas em São Paulo: saúde mental e religiosidade

    Directory of Open Access Journals (Sweden)

    Paulo Augusto Costivelli de Moraes

    2006-01-01

    Full Text Available OBJETIVO: A religião tem um importante papel na vida de indivíduos encarcerados. A saúde mental e a possibilidade de reabilitação parecem ser favorecidas através da religião. Entretanto poucos estudos no Brasil abordaram a saúde mental em população carcerária feminina e a relacionaram com a religiosidade. O objetivo deste estudo é verificar o perfil de saúde mental e a relação entre religião, religiosidade e saúde mental numa amostra de mulheres encarceradas em São Paulo. MÉTODOS: Foram entrevistadas 358 mulheres, detentas da Penitenciária Feminina da Capital (São Paulo-SP. Foi aplicado um questionário amplo que abrangeu dados sociodemográficos e culturais (incluindo a religiosidade, assim como itens sobre saúde mental e perfil criminal. A avaliação psicopatológica foi feita com o General Health Questionnaire (GHQ-12. Análises estatísticas comparando as variáveis com o GHQ-12 foram realizadas. Foi utilizada também a análise de regressão logística multivariada para respostas dicotômicas para as variáveis que possivelmente interagiram com a saúde mental. RESULTADOS: A idade média da amostra foi 30,7 anos ± 8,5. A prevalência de possível caso psiquiátrico foi 26,6%. CONCLUSÕES: Uma maior religiosidade pessoal associou-se a menor freqüência de possível transtorno mental. Não foram encontradas associações entre tipo de crime e saúde mental.

  3. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Vera Maria Ribeiro Nogueira

    2004-06-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  4. Paism: um marco na abordagem da saúde reprodutiva no Brasil

    Directory of Open Access Journals (Sweden)

    Maria José Martins Duarte Osis

    Full Text Available O Programa de Assistência Integral à Saúde Mulher (PAISM foi lançado pelo Ministério da Saúde em 1983, sendo anunciado como uma nova e diferenciada abordagem da saúde da mulher. Paradoxalmente, o PAISM constitui-se também na primeira vez em que o Estado brasileiro propôs explicitamente, e implantou, embora de modo parcial, um programa que contemplava a regulação da fecundidade. Isso suscitou suspeitas acerca de possíveis intenções ocultas de controle da natalidade. Porém, analisando brevemente a história desse Programa e seu significado social, conclui-se que o PAISM foi pioneiro, inclusive no cenário mundial, ao propor o atendimento à saúde reprodutiva das mulheres, no âmbito da atenção integral à saúde, e não mais a utilização de ações isoladas em planejamento familiar. Por isso mesmo, os movimentos de mulheres, de imediato, passaram a lutar por sua implementação. Seu conteúdo inclui plenamente a definição de saúde reprodutiva adotada pela Organização Mundial da Saúde em 1988, ampliada e consolidada no Cairo em 1994 e em Beijing em 1995. Conseqüentemente, a adoção do PAISM representou, sem dúvida, um passo significativo em direção ao reconhecimento dos direitos reprodutivos das mulheres, mesmo antes que essa expressão ganhasse os diversos foros internacionais de luta.

  5. In my Wish List, an Automated Tool for Fail-Secure Design Analysis: an Alloy-Based Feasibility Draft

    Directory of Open Access Journals (Sweden)

    Gurvan Le Guernic

    2014-05-01

    Full Text Available A system is said to be fail-secure, sometimes confused with fail-safe, if it maintains its security requirements even in the event of some faults. Fail-secure analyses are required by some validation schemes, such as some Common Criteria or NATO certifications. However, it is an aspect of security which as been overlooked by the community. This paper attempts to shed some light on the fail-secure field of study by: giving a definition of fail-secure as used in those certification schemes, and emphasizing the differences with fail-safe; and exhibiting a first feasibility draft of a fail-secure design analysis tool based on the Alloy model checker.

  6. Planejamento, gestão e ações à saúde do homem na estratégia de saúde da família

    Directory of Open Access Journals (Sweden)

    Leonardo Peixoto Pereira

    2014-12-01

    Full Text Available Objetivo: Analisar a situação do planejamento, da gestão e das ações de saúde diante da perspectiva de implantação da Política de Atenção à Saúde do Homem na Estratégia de Saúde da Família no município de Jequié. Métodos: Tratou-se de um estudo qualitativo. Entrevistaram-se gestores municipais dos serviços de saúde, profissionais de saúde da Estratégia de Saúde da Família e homens com 25 a 59 anos residentes nas áreas adscritas das unidades de saúde estudadas; realizou-se análise documental do Plano de Saúde e Relatórios de Gestão na Secretaria Municipal de Saúde e análise de conteúdo, modalidade temática. Resultados: Não há atividades assistenciais; de prevenção e promoção à saúde masculina desenvolvidas e os processos de implantação da atenção à saúde do homem encontram-se incipientes. Conclusão: É preciso ampliar o diálogo e reorganizar as estratégias de planejamento e gestão para compreender as reais necessidades masculina e articular com os atores envolvidos a implantação das ações de atenção à saúde do homem.

  7. Comparison of the live-attenuated Japanese encephalitis vaccine SA14-14-2 strain with its pre-attenuated virulent parent SA14 strain: similarities and differences in vitro and in vivo.

    Science.gov (United States)

    Yun, Sang-Im; Song, Byung-Hak; Polejaeva, Irina A; Davies, Christopher J; White, Kenneth L; Lee, Young-Min

    2016-10-01

    Japanese encephalitis virus (JEV) is the main cause of acute viral encephalitis, primarily affecting children and young adults in the Asia-Pacific region. JEV is a vaccine-preventable pathogen, with four types of JE vaccine licensed in different regions of the world. To date, the most common JEV strain used in vaccine development and production is SA14-14-2, an attenuated strain derived from its wild-type parental strain SA14. In this study, we directly compared the phenotypic and genotypic characteristics of SA14 and SA14-14-2 to determine the biological and genetic properties associated with their differential virulence. In susceptible BHK-21 cells, SA14-14-2 grew slightly more slowly and formed smaller plaques than SA14, but unlike SA14, it showed almost no expression of the viral protein NS1', the product of a conserved predicted RNA pseudoknot-mediated ribosomal frameshift. In weanling ICR mice, SA14-14-2 was highly attenuated in terms of both neuroinvasiveness and neurovirulence, with its median lethal doses invariably over five logs higher than those of SA14 when inoculated intramuscularly and intracerebrally. Interestingly, the neurovirulence of SA14-14-2 was dependent on mouse age, with the 1- to 7-day-old mice being highly susceptible and the 14- to 21-day-old mice becoming resistant to intracerebral inoculation. At the genome level, SA14-14-2 differed from SA14 by 57 nucleotides, including one silent G-to-A substitution at position 3599 within the predicted RNA pseudoknot for NS1' synthesis; of the 57 differences, 25 resulted in amino acid substitutions. Our data pave the way for the development of new genetically modified JE vaccines.

  8. Natural Science and Technology Terminology in the Sesotho sa Leboa Monolingual Dictionary

    Directory of Open Access Journals (Sweden)

    W.M. Mojapelo

    2011-10-01

    Full Text Available

    Abstract: The main purpose of this article is to make a comparative analysis of the structural and the lexical differences between coinage and transliteration, as methods for the acquisition of foreign natural sci-ence and technology lexical items, which are meant for inclusion in the Sesotho sa Leboa comprehensive monolingual dictionary, Pukuntšutlhaloši ya Sesotho sa Leboa. With the exception of the multilingual glossaries ('dictionaries' as they are called, which are compiled by the National Language Service of the Department of Arts and Culture, the Sesotho sa Leboa National Lexicography Unit does not at present have any monolin-gual dictionary specializing in specific subjects like natural science and technology. As a start, the Lexicogra-phy Unit decided to include this specialized terminology in the second edition of its comprehensive monolin-gual dictionary. The main purpose for lemmatizing the natural science and technology terminology is to give these lexical items comprehensive definitions in Sesotho sa Leboa, instead of 'a one word translation defini-tion' as is the case in the bilingual and multilingual dictionaries.

    Keywords: TRANSLITERATION, COINAGE, COINED LEXICAL ITEM, LOAN WORD, ADOPTIVE, FOREIGN WORD, LEXICOGRAPHY, SOTHOIZED WORD, INDIGENOUS WORD, NATURAL SCIENCE, TECHNOLOGY, COMPOUND WORD, AMBIGUITY

    Opsomming: Natuurwetenskaplike en tegnologiese terminologie in die Sesotho sa Leboa eentalige woordeboek. Die hoofdoel van hierdie artikel is om 'n ver-gelykende ontleding te maak van die strukturele en die leksikale verskille tussen nuutskepping en transliterasie as metodes vir die verwerwing van vreemde natuurwetenskaplike en tegnologiese leksikale items wat bedoel is vir insluiting in die Sesotho sa Leboa omvattende eentalige woorde-boek Pukuntšutlhaloši ya Sesotho sa Leboa. Met die uitsondering van die meertalige woordelyste ("woordeboeke" soos hulle genoem word wat deur die Nasionale Taaldiens van die

  9. Quatro tensões na saúde pública

    Directory of Open Access Journals (Sweden)

    Nicolas Lechopier

    2015-04-01

    Full Text Available Este artigo examina a interação da ética, da antropologia social e da epistemologia na saúde pública. Na primeira seção do artigo, introduzimos ao amplo espectro de abordagens existentes que consideram a saúde pública como um campo político, como uma ciência e como um projeto antropológico global que levanta inúmeras questões éticas. Na segunda seção, propomos uma apresentação mais detalhada das principais questões levantadas pela saúde pública através de uma rede de quatro tensões dialéticas fundamentais. A primeira tensão concerne principalmente às dubiedades das definições de saúde e às finalidades propostas para esse campo. A segunda tensão concerne à legitimidade dos meios utilizados para chegar aos objetivos da saúde pública. A terceira tensão diz respeito ao regime de evidência e ao referencial das abordagens empregadas na saúde pública. A quarta tensão se origina nas relações de poder construídas no interior dessas práticas da saúde pública. Sugerimos que essas quatro tensões, nas quais a polarização apresenta uma variedade de formatos, relacionam-se entre si. Isso conduz à conclusão de que na saúde pública, as considerações éticas, antropológicas e epistemológicas precisam andar juntas. Para entender criticamente as questões da saúde pública, precisamos, portanto, levar em conta as íntimas interações entre as ciências, os valores e as práticas.

  10. Toplum Ruh Sağlığı Merkezlerinde Hemşirenin Rolü

    OpenAIRE

    İçel, Sema; Özkan, Birgül; Aydoğan, Arzu

    2016-01-01

     Toplum ruh sağlığı merkezleri, ağır ruhsal bozukluğu olan hastalara, toplum temelli ruh sağlığı modeli çerçevesinde bireysel işlevi iyileştirmeye dönük etkin tedaviler sunulması, psikososyal destek hizmetlerinin verilmesi, takip ve tedavilerinin yaşadıkları ortamda, birinci basamak sağlık hizmetlerine entegre biçimde sunulabilmesi için gerekli hizmetlerin yürütüldüğü merkezlerdir.Bir ülkede ruh sağlığı hizmetlerinin etkinliğini sağlayabilmek için, bu ülke bireylerinin ruh sağlığı yönünden ko...

  11. Percepção de gerentes sobre a assistência à saúde coletiva

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    2002-02-01

    Full Text Available Este estudo tem como objetivo conhecer a percepção de gestores e gerentes dos serviços de saúde sobre a assistência à saúde coletiva no contexto do Sistema Único de Saúde (SUS no Distrito Federal (DF. Trata-se de uma pesquisa qualitativa realizada por meio de entrevistas semi-estruturadas com gestores e gerentes da Regional Norte de Saúde do Distrito Federal. Conclui-se que a implantação dos princípios do SUS ainda é um desafio a ser enfrentado, tanto pela comunidade como pelos profissionais de saúde, que precisam unir esforços para encontrar estratégias que redirecionem a assistência à saúde coletiva.

  12. Prefeitos eleitos, descentralização na saúde e os compromissos com o SUS

    Directory of Open Access Journals (Sweden)

    Lenaura de Vasconcelos Costa Lobato

    Full Text Available O artigo analisa a municipalização na saúde por meio das proposições para a política de saúde de prefeitos eleitos no ano de 2012. Realizou-se análise documental das plataformas de governo dos então candidatos e de documentos oficiais da política e da gestão municipais de saúde - Relatórios das Conferências Municipais de Saúde e Planos Municipais de Saúde - de 24 municípios brasileiros nas cinco regiões do País. Os resultados indicam que os programas das candidaturas, em geral, incorporam a defesa do direito à saúde, embora principalmente através da ampliação da oferta de serviços médicos.

  13. O debate sobre educação em saúde no âmbito do Conselho Municipal de Saúde de Vitória, ES, Brasil

    Directory of Open Access Journals (Sweden)

    Welington Serra Lazarini

    2014-12-01

    Full Text Available Analisou-se a relação entre educação em saúde e a política de participação e controle social em saúde da Secretaria Municipal de Saúde de Vitória-ES, Brasil, entre 2005 e 2012. Realizou-se análise documental nos planos municipais de saúde, relatórios de gestão e em 139 atas do Conselho Municipal de Saúde. Evidenciou-se que a gestão orientou sua política pela participação, mas restringiu-se ao Conselho Municipal de Saúde. A educação em saúde foi tratada pontualmente durante as reuniões. Quando debatida, foi como modelo tradicional, configurando-se em estratégia para vigilância. A Educação Popular em Saúde foi mencionada no segundo governo, mas sem a redefinição das práticas. Sinaliza-se a necessidade de reconhecer as diferentes formas de participação social em Vitória e ampliar o debate acerca do modelo dialógico da educação em saúde.

  14. An??lise das percep????es de professores e profissionais de sa??de sobre pr??ticas educativas em sa??de: subs??dios para a estrat??gia integrada de preven????o da dengue.

    OpenAIRE

    Assis, Sheila Soares de

    2012-01-01

    A dengue integra o conjunto de doen??as negligenciadas, constituindo-se como um grave problema de sa??de p??blica em todo o mundo, inclusive no Brasil. A abordagem dos aspectos relacionados ao processo sa??de-doen??a ?? uma responsabilidade partilhada entre os servi??os de sa??de e os de educa????o. No ensino formal, os temas relacionados ?? sa??de devem ser tratados de forma transversal. Entretanto, historicamente a responsabilidade da abordagem deste tema tem reca??do sobre os componentes c...

  15. Políticas de saúde um contexto de saberes para o cuidado na estratégia de saúde da família

    OpenAIRE

    Eulina Patrícia Oliveira Ramos Pires; Maria Andréa Kertész de Souza

    2011-01-01

    Estudo de relato de experiência, das ações cuidativas vivenciadas por enfermeiras na Estratégia de Saúde da Família, cujo objetivo é contribuir no enlace de conhecimentos para o ser-saber-fazer profissional no cuidado à saúde da família. Embasado nas políticas de saúde e na contextualização do atendimento proximal à população como princípio integrador do Sistema Único de Saúde.

  16. Expression of chondro-osteogenic BMPs in ossified failed tendon healing model of tendinopathy.

    Science.gov (United States)

    Yee Lui, Pauline Po; Wong, Yin Mei; Rui, Yun Feng; Lee, Yuk Wa; Chan, Lai Shan; Chan, Kai Ming

    2011-06-01

    Chondrocytes phenotype/markers were expressed in clinical samples of tendinopathy and calcifying tendinopathy. This study examined the spatial-temporal expression of chondro-osteogenic Bone Morphogenetic Proteins (BMPs), which might contribute to ectopic chondro-osteogenesis and failed healing process in tendinopathy. Collagenase was injected into patellar tendon of rats to induce ossified failed tendon healing. At week 2, 4, 8, 12, and 16, the patella tendon was harvested for immunohistochemical staining and analysis of BMP-2/4/7. BMP-4/7 showed similar expression patterns, which was different from BMP-2. The expression of BMP-2 in the tendon matrix increased at week 2 and was reduced to nearly undetectable level afterwards except at the chondro-ossification sites. However, the expression of BMP-4/7 in the healing tendon fibroblast-like cells and matrix increased at week 2, reduced at week 4 and 8 and increased again at week 12 and 16, consistent with transient healing at week 8 in this animal model. There was increasing strong expression of BMP-4/7 in the chondrocyte-like cells in the un-ossified and ossified areas from week 8-16. BMP-4/7, besides BMP-2, might also contribute to ectopic chondro-osteogenesis and failed healing in tendon injuries. BMP-4/7, but not BMP-2, might be involved in regulating late events in ossified failed tendon healing.

  17. Biomechanics of failed deglutitive upper esophageal sphincter relaxation in neurogenic dysphagia.

    Science.gov (United States)

    Williams, Rohan B H; Wallace, Karen L; Ali, Galib N; Cook, Ian J

    2002-07-01

    Our aims were to examine the etiology and biomechanical properties of the nonrelaxing upper esophageal sphincter (UES) and the relationship between UES opening and failed relaxation. We examined the relationships among swallowed bolus volume, intrabolus pressure, sagittal UES diameter, the pharyngeal swallow response, and geniohyoid shortening in 18 patients with failed UES relaxation, 23 healthy aged controls, and 15 with Zenker's diverticulum. Etiology of failed UES relaxation was 56% medullary disease, 33% Parkinson's or extrapyramidal disease; and 11% idiopathic. Extent of UES opening ranged from absent to normal and correlated with preservation of the pharyngeal swallow response (P = 0.012) and geniohyoid shortening (P = 0.046). Intrabolus pressure was significantly greater compared with aged controls (P < 0.001) or Zenker's diverticulum (P < 0.001). The bolus volume-dependent increase in intrabolus pressure evident in controls was not observed in failed UES relaxation. The nonrelaxing UES therefore displays a constant loss of sphincter compliance throughout the full, and potentially normal, range of expansion during opening. Adequacy of UES opening is influenced by the degree of preservation of the pharyngeal swallow response and hyolaryngeal traction. In contrast, the stenotic UES displays a static loss of compliance, only apparent once the limit of sphincter expansion is reached.

  18. Assisting Driver Sovereignty: A Fail-Safe Design Approach to Driver Distraction

    NARCIS (Netherlands)

    Van Gijssel, A.

    2013-01-01

    This thesis investigates the potential of a fail-safe approach to driver distraction through novel interface concepts for integrated Advanced Driver Assistance Systems (ADAS). Traffic accidents are a negative side effect of the universal and economical desire for mobility. The year 2009 saw the alar

  19. Glucose-6-phosphate dehydrogenase-derived NADPH fuels superoxide production in the failing heart

    Science.gov (United States)

    In the failing heart, NADPH oxidase and uncoupled NO synthase utilize cytosolic NADPH to form superoxide. NADPH is supplied principally by the pentose phosphate pathway, whose rate-limiting enzyme is glucose 6-phosphate dehydrogenase (G6PD). Therefore, we hypothesized that cardiac G6PD activation dr...

  20. Timing of dialysis initiation in transplant-naive and failed transplant patients

    Science.gov (United States)

    Molnar, Miklos Z.; Ojo, Akinlolu O.; Bunnapradist, Suphamai; Kovesdy, Csaba P.; Kalantar-Zadeh, Kamyar

    2017-01-01

    Over the past two decades, most guidelines have advocated early dialysis initiation on the basis of studies showing improved survival in patients starting dialysis early. These recommendations led to an increase in the proportion of patients initiating dialysis with an estimated glomerular filtration rate (eGFR) >10 ml/min/1.73 m2, from 20% in 1996 to 52% in 2008. During this period, patients starting dialysis with an eGFR ≥15 ml/min/1.73 m2 increased from 4% to 17%. However, recent studies have failed to substantiate a benefit of early dialysis initiation and some data have suggested worse outcomes in patients starting dialysis with a higher eGFR. Several reasons for this seemingly paradoxical observation have been suggested, including the fact that patients requiring early dialysis are likely to have more severe symptoms and comorbidities, leading to confounding by indication, as well as biological mechanisms that causally relate early dialysis therapy to adverse outcomes. Dialysis reinitiation in patients with a failing renal allograft encounters similar problems. However, unique factors associated with a failed allograft means that the optimal timing of dialysis initiation in failed transplant patients might differ from that in transplant-naive patients. In this Review, we will discuss studies of dialysis initiation and compare risks and benefits of early versus late dialysis therapy. PMID:22371250

  1. On Global Absences: Reflections on the Failings in the Education and Poverty Relationship in Latin America

    Science.gov (United States)

    Bonal, Xavier

    2007-01-01

    This paper explores some of the aspects of the relationship between education and poverty as it has been constructed by international organisations and national governments in Latin America. The analysis is carried out from two separate angles. On the one hand, the paper highlights the main failings that underlie the positive and hoped-for…

  2. Fit to be unethical: How successful/failed regulatory goal attainment motivates unethical behavior

    NARCIS (Netherlands)

    Vriend, Tim; Jordan, Jennifer; Janssen, Onne

    2013-01-01

    On the basis of regulatory fit theory we argue and show that a regulatory fit induced through successful or failed attainment of goals that specify gains vs. losses (Study 1) or nurturance vs. security (Study 2), will lead individuals to engage in unethical behavior in a subsequent task.

  3. Large Steel Tank Fails and Rockets to Height of 30 meters - Rupture Disc Installed Incorrectly

    DEFF Research Database (Denmark)

    Hedlund, Frank Huess; Selig, Robert Simon; Kragh, Eva K.

    2016-01-01

    At a brewery, the base plate-to-shell weld seam of a 90-m3 vertical cylindrical steel tank failed catastrophically. The 4 ton tank “took off” like a rocket leaving its contents behind, and landed on a van, crushing it. The top of the tank reached a height of 30 m. The internal overpressure...

  4. Measuring too-big-to-fail funding advantages from small banks’ CDS spreads

    NARCIS (Netherlands)

    Bijlsma, M.; Lukkezen, J.H.J.; Marinova, K.

    2014-01-01

    Large banks derive a funding advantage from being too-big-to-fail, while small banks do not. To estimate the funding advantage we explain the CDS spreads of small banks in six major European countries during the crisis by market fundamentals and bank-specific characteristics. Next, we extrapolate an

  5. Persistent postpartum haemorrhage after failed arterial ligation: value of pelvic embolisation

    Energy Technology Data Exchange (ETDEWEB)

    Fargeaudou, Yann; Soyer, Philippe; Sirol, Marc; Boudiaf, Mourad; Dahan, Henri; Dref, Olivier le [Hopital Lariboisiere AP-HP et Universite Diderot-Paris 7, Department of Abdominal and Interventional Imaging, Paris (France); Morel, Olivier; Barranger, Emmanuel [Hopital Lariboisiere AP-HP, Department of Obstetrics and Gynecology, Paris (France); Gayat, Etienne; Mebazaa, Alexandre [Hopital Lariboisiere AP-HP, Department of Anesthesiology and Intensive Care Medicine, Paris (France)

    2010-07-15

    To evaluate the role and efficacy of pelvic embolisation in the treatment of persistent postpartum haemorrhage after failed arterial ligation and to identify the complications of this procedure in this specific population. The clinical files and angiographic examinations of 12 consecutive women (mean age 32 years) who were treated with pelvic embolisation because of persistent, severe postpartum haemorrhage after failed arterial ligation were reviewed. Angiography revealed that persistent bleeding was due to incomplete arterial ligation (n = 4) or the presence of newly developed anastomotic routes (n = 8). In 11 women, pelvic embolisation stopped the bleeding. Hysterectomy was needed in one woman with retained placenta. Two complications due to pelvic embolisation, including leg ischaemia and transient sciatic nerve ischaemia, were identified, both after internal iliac artery ligation. In women with persistent postpartum haemorrhage after failed arterial ligation, pelvic embolisation is an effective treatment in most cases. However, embolisation of the anastomotic routes that contribute to persistent bleeding may result in ischaemic complications. These potential complications reaffirm that arterial ligation should not be the favoured option for postpartum haemorrhage and that special care must be given during pelvic embolisation after failed arterial ligation. (orig.)

  6. Clinically failed eggs as a source of normal human embryo stem cells.

    Science.gov (United States)

    De Sousa, Paul A; Gardner, John; Sneddon, Sharon; Pells, Steve; Tye, Britt Jorgensen; Dand, Pawlina; Collins, Daniel M; Stewart, Karen; Shaw, Lisa; Przyborski, Stefan; Cooke, Michael; McLaughlin, K John; Kimber, Susan J; Lieberman, Brian A; Wilmut, Ian; Brison, Daniel R

    2009-05-01

    The promise of human embryo stem cells (hESCs) for regenerative medicine is offset by the ethical and practical challenges involved in sourcing eggs and embryos for this objective. In this study we sought to isolate an hESC line from clinically failed eggs, the usage of which would not conflict with donor interests to conceive. A total of 8 blastocysts were allocated for hESC derivation from a pool of 579 eggs whose fertilization had been clinically assessed to have occurred abnormally (i.e., three pronuclei) or failed (i.e., no pronuclei) following in vitro insemination or intracytoplasmic sperm injection (ICSI). The latter were subjected to a recovery intervention consisting of either reinsemination by ICSI or parthenogenetic stimulation. One hESC line (RCM1) was obtained from a failed-to-fertilize inseminated egg recovered by parthenogenetic activation. Standard in vitro and in vivo characterization revealed this line to possess all of the properties attributed to a normal euploid hESC line. Whole-genome single-nucleotide polymorphism analysis further revealed that the line was biparental, indicating that sperm penetration had occurred, although parthenogenetic stimulation was required for activation. Our results demonstrate the viability of an alternative strategy to generate normal hESC lines from clinically failed eggs, thereby further minimizing the potential to conflict with donor reproductive interest to conceive.

  7. The Consistency and Uncertainty in Examiners' Definitions of Pass/Fail Performance on OSCE Stations.

    Science.gov (United States)

    Rothman, Arthur I.; And Others

    1996-01-01

    Results of the fall 1993 administration of part two of the Medical Council of Canada's Evaluating Examination for 744 candidates provided evidence of the consistency of the pass/fail and cutting score definitions for the objective- structured clinical examination stations used across examiners. These results support the validity of this…

  8. Comparison of Dental Students' Academic Performance Using Honors/Pass/Fail and Letter Grades.

    Science.gov (United States)

    Leske, Gary S.; Ripa, Louis

    1985-01-01

    Performance in a second-year course in pedodontics/orthodontics for three classes at the State University of New York at Stony Brook School of Dental Medicine who received grades under an honors/pass/fail system was compared to that of three academically comparable classes that received letter grades. (Author/MLW)

  9. Reverse translation of failed treatments can help improving the validity of preclinical animal models

    NARCIS (Netherlands)

    't Hart, Bert A.

    2015-01-01

    A major challenge in translational research is to reduce the currently high proportion of new candidate treatment agents for neuroinflammatory disease, which fail to reproduce promising effects observed in animal models when tested in patients. This disturbing situation has raised criticism against

  10. CO2 laser surface treatment of failed dental implants for re-implantation: an animal study.

    Science.gov (United States)

    Kasraei, Shahin; Torkzaban, Parviz; Shams, Bahar; Hosseinipanah, Seyed Mohammad; Farhadian, Maryam

    2016-07-01

    The aim of the present study was to evaluate the success rate of failed implants re-implanted after surface treatment with CO2 laser. Despite the widespread use of dental implants, there are many incidents of failures. It is believed that lasers can be applied to decontaminate the implant surface without damaging the implant. Ten dental implants that had failed for various reasons other than fracture or surface abrasion were subjected to CO2 laser surface treatment and randomly placed in the maxillae of dogs. Three failed implants were also placed as the negative controls after irrigation with saline solution without laser surface treatment. The stability of the implants was evaluated by the use of the Periotest values (PTVs) on the first day after surgery and at 1, 3, and 6 months post-operatively. The mean PTVs of treated implants increased at the first month interval, indicating a decrease in implant stability due to inflammation followed by healing of the tissue. At 3 and 6 months, the mean PTVs decreased compared to the 1-month interval (P implant stability. The mean PTVs increased in the negative control group compared to baseline (P implants were significantly lower than control group at 3 and 6 months after implant placement (P implantation of failed implants in Jack Russell Terrier dogs after CO2 laser surface debridement is associated with a high success rate in terms of implant stability.

  11. 49 CFR 192.1009 - What must an operator report when compression couplings fail?

    Science.gov (United States)

    2010-10-01

    ...) PIPELINE SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Gas... 49 Transportation 3 2010-10-01 2010-10-01 false What must an operator report when compression couplings fail? 192.1009 Section 192.1009 Transportation Other Regulations Relating to Transportation...

  12. Assisting Driver Sovereignty: A Fail-Safe Design Approach to Driver Distraction

    NARCIS (Netherlands)

    Van Gijssel, A.

    2013-01-01

    This thesis investigates the potential of a fail-safe approach to driver distraction through novel interface concepts for integrated Advanced Driver Assistance Systems (ADAS). Traffic accidents are a negative side effect of the universal and economical desire for mobility. The year 2009 saw the alar

  13. Comparison of Dental Students' Academic Performance Using Honors/Pass/Fail and Letter Grades.

    Science.gov (United States)

    Leske, Gary S.; Ripa, Louis

    1985-01-01

    Performance in a second-year course in pedodontics/orthodontics for three classes at the State University of New York at Stony Brook School of Dental Medicine who received grades under an honors/pass/fail system was compared to that of three academically comparable classes that received letter grades. (Author/MLW)

  14. When social security fails to provide emotional security: single parent households and the contractual welfare state

    NARCIS (Netherlands)

    Tonkens, E.; Verplanke, L.

    2013-01-01

    The provision of services in the contractual welfare state is conditional. If one wants to receive a service, one has to comply with the demands of the provider. If one fails to do so, the organisation threatens to terminate its services, and indeed often does so. There are, however, people who brea

  15. Leadership and the Failed State Status of Nigeria (2010 -2012. An Enquiry

    Directory of Open Access Journals (Sweden)

    Jide Ibietan

    2013-08-01

    Full Text Available The main objective of this paper is to evaluate the impact of leadership in redressing the failed state status of Nigeria with a focus on the present administration (between 2010 and 2012. For the past three years, Nigeria has been keeping the ugly company and ranking consistently as the fourteenth on the list of failed states, but the governing elites have been making spirited campaigns and slow haste in explaining away this situation. Through heavy reliance on secondary sources of data, the utilization of elite theory as framework, backed by the analytical approach to the issues raised/discussed, the paper observed that the ranking of Nigeria on the failed state index ignores some historical facts and current situational realities which make the failed criteria suspect and questionable. There is therefore the need to rethink and tinker with some of these criteria to reflect socio-economic and political performance in realistic terms. Purposeful and people –centered approach to governance capable of redressing the dysfunctions of the Nigerian state is also canvassed.

  16. When goal pursuit fails: The functions of counterfactual thought in intention formation

    NARCIS (Netherlands)

    Epstude, K.; Roese, N.J.

    2011-01-01

    Counterfactual thoughts predominantly occur in response to failed goal pursuit. The primary function of self-related counterfactuals seems to be correction of specific behaviors and preparation for future successful goal attainment. In the present article we describe a model that outlines this view

  17. Cognitive Levels and Approaches Taken by Students Failing Written Examinations in Mathematics

    Science.gov (United States)

    Roegner, Katherine

    2013-01-01

    A study was conducted at the Technical University Berlin involving students who twice failed the written examination in the first semester course Linear Algebra for Engineers in order to better understand the reasons behind their failure. The study considered student understanding in terms of Bloom's taxonomy and the ways in which students…

  18. Why Fish Oil Fails: A Comprehensive 21st Century Lipids-Based Physiologic Analysis

    Directory of Open Access Journals (Sweden)

    B. S. Peskin

    2014-01-01

    Full Text Available The medical community suffered three significant fish oil failures/setbacks in 2013. Claims that fish oil’s EPA/DHA would stop the progression of heart disease were crushed when The Risk and Prevention Study Collaborative Group (Italy released a conclusive negative finding regarding fish oil for those patients with high risk factors but no previous myocardial infarction. Fish oil failed in all measures of CVD prevention—both primary and secondary. Another major 2013 setback occurred when fish oil’s DHA was shown to significantly increase prostate cancer in men, in particular, high-grade prostate cancer, in the Selenium and Vitamin E Cancer Prevention Trial (SELECT analysis by Brasky et al. Another monumental failure occurred in 2013 whereby fish oil’s EPA/DHA failed to improve macular degeneration. In 2010, fish oil’s EPA/DHA failed to help Alzheimer’s victims, even those with low DHA levels. These are by no means isolated failures. The promise of fish oil and its so-called active ingredients EPA / DHA fails time and time again in clinical trials. This lipids-based physiologic review will explain precisely why there should have never been expectation for success. This review will focus on underpublicized lipid science with a focus on physiology.

  19. 30 CFR 77.902-1 - Fail safe ground check circuits; maximum voltage.

    Science.gov (United States)

    2010-07-01

    ... voltage. 77.902-1 Section 77.902-1 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF... OF UNDERGROUND COAL MINES Low- and Medium-Voltage Alternating Current Circuits § 77.902-1 Fail safe ground check circuits; maximum voltage. The maximum voltage used for ground check circuits under §...

  20. 30 CFR 77.803-1 - Fail safe ground check circuits; maximum voltage.

    Science.gov (United States)

    2010-07-01

    ... voltage. 77.803-1 Section 77.803-1 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF... OF UNDERGROUND COAL MINES Surface High-Voltage Distribution § 77.803-1 Fail safe ground check circuits; maximum voltage. The maximum voltage used for ground check circuits under § 77.803 shall...