Cestodes of the family Dilepididae (Cestoda:Cyclophyllidea) from fish-eating birds in Mexico: a survey of species.

Science.gov (United States)

Scholz, Tomás; Kuchta, Roman; Salgado-Madonado, Guillermo

2002-07-01

A survey of adults of dilepidid tapeworms (Cyclophyllidea) from piscivorous birds from Mexico is presented on the basis of the taxonomic evaluation of freshly collected and voucher specimens. The following species are reported (first records from Mexico marked with an asterisk): Cyclustera capito (Rudolphi, 1819); *C. ibisae (Schmidt & Bush, 1972); *Dendrouterina ardeae Rausch, 1955; *D. herodiae Fuhrmann, 1912; *D. papillifera (Fuhrmann, 1908); Glossocercus auritus (Rudolphi, 1819); *Neogryporhynchus cheilancristrotus (Wedl, 1855); Paradilepis caballeroi Rysavy & Macko, 1973; Paradilepis sp.; Parvitaenia cochlearii Coil, 1955; and Valipora mutabilis Linton, 1927. Dendrouteria herodiae is reported from America for the first time. New definitive hosts are Phalacrocorax olivaceus for C. capito, N. cheilancristrotus and P. caballeroi; Casmerodius albus and Egretta thula for G. auritus; and E. thula for D. herodiae. Data on the morphology of the rostellar hooks of all species, their hosts and distribution in Mexico are provided.

Overview of a comprehensive environmental monitoring and surveillance program: The role of fish and wildlife

International Nuclear Information System (INIS)

Gray, R.H.

1988-05-01

Concern about the effects of potential releases from nuclear and non-nuclear activities on the US Department of Energy's Hanford Site in southeastern Washington has evolved over four decades into a comprehensive environmental monitoring and surveillance program. The program includes field sampling, and chemical and physical analyses of air, surface and ground water, fish and wildlife, soil, foodstuffs, and natural vegetation. In addition to monitoring radioactivity in fish and wildlife, population numbers of key species are determined, usually during the breeding season. Data from monitoring efforts are used to assess the environmental impacts of Hanford operations and calculate the overall radiological dose to humans onsite, at the Site perimeter, or residing in nearby communities. Chinook salmon spawning in the Columbia River at Hanford has increased in recent years with a concomitant increase in winter nesting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis) and great blue heron (Ardea herodias), and various other animals, e.g., mule deer (Odocoileus hemionus) and coyotes (Canis latrans) are common. Measured exposure to penetrating radiation and calculated radiation doses to the public are well below applicable regulatory limits

Surface topography of two trematodes parasites infecting grey heron Ardea cinerea Jouyi (Aves, Ciconiiformes) in Qena, Egypt.

Science.gov (United States)

Ammar, Khalaf Nour Abd El-Wahed

2015-04-01

Apharyngostrigea ardeolina and Echinoparyphium recurvatum are two important digenean parasites that were recovered from small intestine of grey heron with an infection rate (16.2%) and (8.8%) respectively. The surface topography of two species was redescribed by both light and scanning electron microscopy. Using SEM studies showed that the body surface of two trematodes were covered by contact receptors, several types of sensory tegumental papillae which may have useful function in orientation and feeding through increasing the surface area of absorption, could also play a role in sensation or in selection of the materials for ingestion by the fluke. The head collar of E. recurvatum is reniform in shape, bearing uninterrupted double row of 41 collar finger-like spines, a total including 4 end group ones on both ventral corners., tegumental spines were tongue-shaped without a terminal tip.

Study on trace element determination in liver samples of great-white-egret Ardea alba Linnaeus, 1758 (Ardeidae, Aves) for environmental contamination biomionitoring

International Nuclear Information System (INIS)

Silva, Rita de Cassia A.; Saiki, Mitiko

2009-01-01

Predatory birds such as herons have been used as bioindicators of pollution since they are at the top of their food webs. The tissues of these animals are analyzed for assessing environmental pollution caused by toxic elements. In the present study, adequate experimental conditions were established for determination of trace elements concentrations in the liver samples of Great-white-egret (Ardea alba Linnaeus, 1758) for further application of this specimens as a bioindicator of environmental contamination. Four liver samples were collected from Greatwhite- egrets found in the metropolitan region of Sao Paulo and were they analyzed by the method of neutron activation analysis (NAA). Concentrations of the elements Br, Co, Cs, Fe, Na, Rb, Se and Zn were measured in these liver tissues. The findings of this present study demonstrated that the established procedure for liver sample treatment was appropriate to obtain a homogeneous sample. The method of neutron activation analysis (NAA) was very promising for liver sample analysis for evaluation of environmental contamination. (author)

Study on trace element determination in liver samples of great-white-egret Ardea alba Linnaeus, 1758 (Ardeidae, Aves) for environmental contamination biomionitoring

Energy Technology Data Exchange (ETDEWEB)

Silva, Rita de Cassia A.; Saiki, Mitiko, E-mail: rcsilva@ipen.b, E-mail: mitiko@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2009-07-01

Predatory birds such as herons have been used as bioindicators of pollution since they are at the top of their food webs. The tissues of these animals are analyzed for assessing environmental pollution caused by toxic elements. In the present study, adequate experimental conditions were established for determination of trace elements concentrations in the liver samples of Great-white-egret (Ardea alba Linnaeus, 1758) for further application of this specimens as a bioindicator of environmental contamination. Four liver samples were collected from Greatwhite- egrets found in the metropolitan region of Sao Paulo and were they analyzed by the method of neutron activation analysis (NAA). Concentrations of the elements Br, Co, Cs, Fe, Na, Rb, Se and Zn were measured in these liver tissues. The findings of this present study demonstrated that the established procedure for liver sample treatment was appropriate to obtain a homogeneous sample. The method of neutron activation analysis (NAA) was very promising for liver sample analysis for evaluation of environmental contamination. (author)

14. The Herons (Ardeidae)

Science.gov (United States)

Kushlan, J.A.; Hancock, J.A.

2005-01-01

Herons and their close relatives, the egrets and bitterns, comprise sixty species in total and are found all over the world except in polar regions, and are a strikingly beautiful part of the wetlands they inhabit. They are particularly abundant and popular in South West USA, especially Florida. Herons are a diverse group, easily recognized by their long legs, necks and bills. Many species are notable for their sociality as they feed, roost, and nest together in single or mixed species assemblages. The authors have extensive experience of research and observation of these birds and this book provides an up to date comprehensive review of the herons of the world. Covering their biology, distribution, description, systematics, breeding, feeding, and conservation, James Hancock and James Kushlan have distilled their lifetimes' research on the heron into one volume. This volume is complemented by beautiful color paintings especially painted for the book, color photographs, and distribution maps.

Hanford, Washington: Monitoring to assess the state of the environment

International Nuclear Information System (INIS)

Gray, R.H.

1992-01-01

Environmental monitoring has been ongoing at the US Department of Energy's Hanford Site for almost 5 years. Concentrations of airborne radionuclides at the Site perimeter, and concentrations of radionuclides and nonradiological water quality in the Columbia River are in compliance with applicable standards. Radionuclide levels in food stuffs irrigated with river water taken downstream of the Site, most onsite wildlife samples, and soils and vegetation from both on- and off-site locations are typical of those attributable to worldwide fallout. The calculated dose potentially received by a maximally exposed individual, using worst-case assumptions for all routes of exposure, was 0.05 mrem/yr in 1989. The average per capita whole-body effective dose to people, based on a population of 340,000 living within 80 km (50 mi) of the Site, was <0.01 to 0.03 mrem annually from 1985 through 1989. Chinook salmon (Oncorhynchus tshawytscha) spawning in Hanford Reach of the Columbia River has increased in recent years with a con-comitant increase in winter roosting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis), great blue heron (Ardea herodias), various plants and other animals, e.g., mule deer (Odocoileus hemionus), and coyotes (Canis latrans) are common

Monitoring fish, wildlife, radionuclides and chemicals at Hanford, Washington

International Nuclear Information System (INIS)

Gray, R.H.

1989-02-01

Concern about the effects of potential releases from nuclear and non-nuclear activities on the US Department of Energy's Hanford Site in southeastern Washington has evolved over four decades into a comprehensive environmental monitoring and surveillance program. The program includes field sampling, and chemical and physical analyses of air, surface and ground water, fish, wildlife, soil, foodstuffs, and natural vegetation. In addition to monitoring radioactivity in fish and wildlife, population numbers of key species are determined, usually during the breeding season. Data from monitoring efforts are used to assess the environmental impacts of Hanford operations and calculate the overall radiological dose to humans onsite, at the Site perimeter, or residing in nearby communities. Chinook salmon (Oncorhynchus tshawytscha) spawning in the Columbia River at Hanford has increased in recent years with a concomitant increase in winter nesting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis) and great blue heron (Ardea herodias), and various other animals, e.g., mule deer (Odocoileus hemionus) and coyotes (Canis latrans) are common. Measured exposure to penetrating radiation and calculated radiation doses to the public are well below applicable regulatory limits. 35 refs., 4 figs

Microhabitat use by three species of egret (Pelecaniformes, Ardeidae in southern Brazil

Directory of Open Access Journals (Sweden)

DP. Pinto

Full Text Available In the present study, we examined the role of different habitat components and their relationship with microhabitat use by three species of egret: Cocoi heron (Ardea cocoi, Great egret (Ardea alba, and Cattle egret (Bubulcus ibis, in wetlands of southern Brazil. Ardea alba and A. cocoi were not habitat-specific (e.g. vegetation cover and flooding level. Conversely, B. ibis was associated with drier microhabitats. Relative air humidity and air temperature were the main variables which correlated with the occurrence of these species and supported the plasticity of B. ibis and its predominance in drier habitats.

Brominated flame retardant trends in aquatic birds from the Salish Sea region of the west coast of North America, including a mini-review of recent trends in marine and estuarine birds

Energy Technology Data Exchange (ETDEWEB)

Miller, Aroha [Department of Applied Biology, University of British Columbia, 2357 Main Mall, Vancouver, BC (Canada); Elliott, John E., E-mail: John.Elliott@ec.gc.ca [Science and Technology, Environment Canada, Delta, BC V4K 3N2 (Canada); Elliott, Kyle H.; Guigueno, Mélanie F. [Department of Biology, University of Western Ontario, 1151 Richmond Street, London, ON N6A 3K7 (Canada); Wilson, Laurie K. [Canadian Wildlife Service, Pacific Wildlife Research Centre, Environment Canada, Delta, BC V4K 3N2 (Canada); Lee, Sandi [Science and Technology, Environment Canada, Delta, BC V4K 3N2 (Canada); Idrissi, Abde [Environment Canada, National Wildlife Research Centre, Ottawa, ON K1A 0H3 (Canada)

2015-01-01

Polybrominated diphenyl ethers (PBDEs) increased in many matrices during the 1990s and early 2000s. Since voluntary restrictions and regulations on PBDEs were implemented in North America circa early 2000s, decreases in PBDEs have occurred in many of these same matrices. To examine temporal trends in the North Pacific, we retrospectively analysed PBDEs and eight non-PBDE flame retardants (FR) in eggs of two aquatic bird species, great blue herons, Ardea herodias, and double-crested cormorants, Phalacrocorax auritus, collected along the British Columbia coast, Canada from 1979 to 2012. Increasing PBDE concentrations were observed in both species followed by significant decreases post-2000 for all dominant congeners and ΣPBDE. Non-PBDE FRs were generally undetected in cormorant eggs, or detected at very low levels in heron eggs, except for hexabromocyclododecane (HBCDD). HBCDD, currently unregulated in North America, was not detected in early sampling years; however low concentrations were observed in both species in recent sampling years (2003–2012). Dietary tracers (δ{sup 13}C and δ{sup 15}N) did not change significantly over time, indicating that temporal changes in PBDEs are likely caused by implemented regulations. A comparison with recently published temporal trends of ΣPBDE in marine birds from North America and Europe is given. - Highlights: • Seabird eggs have been used to monitor POPs on the west coast of Canada since 1979. • Samples of these eggs were analysed retrospectively for PBDEs and HBCDD. • Regulations exist in North America to control PBDEs, but not HBCDD. • PBDEs decreased significantly since regulations were applied. • HBCDD was not detected pre-2003, but is now found in low concentrations.

Analysis of micronucleated erythrocytes in heron nestlings from reference and impacted sites in the Ebro basin (N.E. Spain)

International Nuclear Information System (INIS)

Quiros, Laia; Ruiz, Xavier; Sanpera, Carolina; Jover, Lluis; Pina, Benjamin

2008-01-01

The frequency of micronuclei (MN) in peripheral erythrocytes was tested for 59 heron nestlings (Ardea purpurea, Egretta garzetta and Bubulcus ibis) sampled at two areas (polluted and reference) on the River Ebro (NE Spain) and at its Delta during Spring 2006. Flow-cytometry analysis revealed higher (three- to six-fold) MN counts in samples from the most polluted site relative to samples from the reference area. Samples from the Delta showed intermediate values. Age, morphometric parameters (weight, tarsus size and bill-head length) and maturation status showed no significant differences among the different populations for each species; nor were they correlated with MN levels. The data suggest that elevated levels of MN in chicks in impacted areas reflected the chemical pollution of their nesting sites. The use of nestlings for this assay appears to be a convenient, non-destructive method to assess the impact of pollution in natural bird populations. - Frequency of micronucleated erythrocytes in peripheral blood of waterbird nestlings correlates with chemical pollution loads in their nesting sites

Evaluation of habitat quality for selected wildlife species associated with back channels.

Science.gov (United States)

Anderson, James T.; Zadnik, Andrew K.; Wood, Petra Bohall; Bledsoe, Kerry

2013-01-01

The islands and associated back channels on the Ohio River, USA, are believed to provide critical habitat features for several wildlife species. However, few studies have quantitatively evaluated habitat quality in these areas. Our main objective was to evaluate the habitat quality of back and main channel areas for several species using habitat suitability index (HSI) models. To test the effectiveness of these models, we attempted to relate HSI scores and the variables measured for each model with measures of relative abundance for the model species. The mean belted kingfisher (Ceryle alcyon) HSI was greater on the main than back channel. However, the model failed to predict kingfisher abundance. The mean reproduction component of the great blue heron (Ardea herodias) HSI, total common muskrat (Ondatra zibethicus) HSI, winter cover component of the snapping turtle (Chelydra serpentina) HSI, and brood-rearing component of the wood duck (Aix sponsa) HSI were all greater on the back than main channel, and were positively related with the relative abundance of each species. We found that island back channels provide characteristics not found elsewhere on the Ohio River and warrant conservation as important riparian wildlife habitat. The effectiveness of using HSI models to predict species abundance on the river was mixed. Modifications to several of the models are needed to improve their use on the Ohio River and, likely, other large rivers.

Radiocesium dynamics in herons inhabiting a contaminated reservoir system

International Nuclear Information System (INIS)

Dombey, A.H.; Paine, D.; McFarlane, R.W.

1977-01-01

The little blue heron (Florida caerulea) and the green heron (Butorides virescens) nest at a radionuclide-contaminated reservoir on the Savannah River Plant near Aiken, South Carolina. Green herons distributed their nests singly along the periphery of the reservoir but fed their nestlings exclusively upon amphibians collected from adjacent uncontaminated Carolina bays. Radiocesium burdens in green heron nestlings did not exceed 5 pCi/g wet wt. and 12 regurgitated food pellets averaged 0.2 pCi/g. Twelve pairs of little blue herons established a heronry upon a small island and fed their nestlings fish and amphibians foraged from within the differentially radionuclide-contaminated reservoir system. Nestlings within the same nest did not exhibit significant differences in body burdens, and the maximum radiocesium burden determined was 27.4 pCi/g wet wt. Substantial differences were found between nestlings from different nests however. The radiocesium level of 43 regurgitated food pellets had a high correlation with observed levels in the nestlings, and variation in food contamination is believed to be the major contributor in the observed variation in the nestlings. The variable contamination of primary prey species was correlated with the differentially contaminated foraging sites and indicates that adult little blue herons tended to spatially partition the available foraging areas. (author)

Heron Island, Australia

Science.gov (United States)

2002-01-01

Heron Island is located at the sourthern end of Australia's 2,050 km-long Great Barrier Reef. Surrounded by coral reef and home to over 1000 species of fish, scuba divers and scientists alike are drawn to the island's resort and research station. The true-color image above was taken by Space Imaging's Ikonos satellite with a resolution of 4 meters per pixel-high enough to see individual boats tied up at the small marina. The narrow channel leading from the marina to the ocean was blasted and dredged decades ago, before the island became a national park. Since then the Australian government has implemented conservation measures, such as limiting the number of tourists and removing or recycling, instead of incinerating, all trash. One of the applications of remote sensing data from Ikonos is environmental monitoring, including studies of coral reef health. For more information about the island, read Heron Island. Image by Robert Simmon, based on data copyright Space Imaging

ADAPTIVE CHARACTERISTICS OF HERONS PLUMAGE FOR THEIR WAY OF LIFE

Directory of Open Access Journals (Sweden)

Koshelev V. A.

2011-12-01

Full Text Available Feather cover of each bird species reflects spectra of species, age, sex and environmental attributes defined the phylogeny of taxa, habitat and life patterns. In turn, many ecological phenomena in the birds’ life patterns are directly dependent on the state of plumage (e.g., time of breeding, seasonal migration, roost flights. For the first time the quantitative characterization of six heron species' plumage were done as well as the description of powder down feathers. The adaptive features of feathers and various types of heron’s plumages were discussed.The structure of contour feathers of herons is related to the peculiarities of species life pattern. All the species have a relatively small number of contour feathers, despite their large body size. According to this index the herons are more similar to typical wading birds (gulls, sandpipers than for waterfowl. The total number of heron feathers slightly increase in winter, because they are migratory species. Structure of contour feathers of herons corresponds to that of other waterbirds. The rod is not bent, the feathers are large, and the mounting angle to the surface of the body is little. The cores of abdominal feather fracts reduce heat transfer and can be regarded as an adaptation factor to aquatic environment.Buoyancy is provided by heron’s feathers insignificantly, in contrast to the typical waterfowl species. Significant subcutaneous fat stores are typical for herons in spring, autumn and winter, increased buoyancy and being the energy reserves provide thermoregulation in cold environment. Our data indicate weak adaptation of herons’ plumage to aquatic environments, but also confirm its insulating properties, which is prove the herons semi-aquatic rather than aquatic life patterns.Due to color of plumage some three groups of herons were considered: white, mottled and camouflaged. Coloration of second and third group performs a protective function. We didn’t found a clear

Cloning and restriction enzyme mapping of ribosomal DNA of Giardia duodenalis, Giardia ardeae and Giardia muris.

Science.gov (United States)

van Keulen, H; Campbell, S R; Erlandsen, S L; Jarroll, E L

1991-06-01

In an attempt to study Giardia at the DNA sequence level, the rRNA genes of three species, Giardia duodenalis, Giardia ardeae and Giardia muris were cloned and restriction enzyme maps were constructed. The rDNA repeats of these Giardia show completely different restriction enzyme recognition patterns. The size of the rDNA repeat ranges from approximately 5.6 kb in G. duodenalis to 7.6 kb in both G. muris and G. ardeae. These size differences are mainly attributable to the variation in length of the spacer. Minor differences exist among these Giardia in the sizes of their small subunit rRNA and the internal transcribed spacer between small and large subunit rRNA. The genetic maps were constructed by sequence analysis of the DNA around the 5' and 3' ends of the mature rRNA genes and between the rRNA covering the 5.8S rRNA gene and internal transcribed spacer. Comparison of the 5.8S rDNA and 3' end of large subunit rDNA from these three Giardia species showed considerable sequence variation, but the rDNA sequences of G. duodenalis and G. ardeae appear more closely related to each other than to G. muris.

'HERON' as a dark matter detector?

International Nuclear Information System (INIS)

Adams, J.S.; Bandler, S.R.; Brouer, S.M.; Enss, C.; Lanou, R.E.; Maris, H.J.; More, T.; Seidel, G.M.

1996-01-01

''HERON'', which is the acronym for '' Helium: Roton detection of Neutrinos'', is a project whose principal goal is a next generation detector of solar neutrinos from the p-p and 7 Be branches. It will utilize superfluid helium as the target material and employ event energy transport out of the target by phonon and roton processes unique to helium. Many of the challenges presented for dark matter detection are very similar to those for low energy solar neutrinos. We present new results from our feasibility studies for HERON which indicate an asymmetry in the roton emission distribution from stopping particles and the ability to detect simultaneously the ultraviolet fluorescence photons also emitted. These features are potentially valuable for solar neutrino detection and the question is explored as to whether or not the same helium technique could be valuable for WIMP dark matter detection

The foraging behaviour of herons and egrets on the Magela Creek flood plain, Northern Territory

International Nuclear Information System (INIS)

Recher, H.F.; Holmes, R.T.

1982-03-01

Five species of diurnal herons are common on the Magela Creek flood plain and forage along the edges of natural and artifical waterbodies both inside and outside the Ranger Uranium Project Area. The species of heron differ in the kinds and sizes of prey they take, their foraging location, degree of sociality and foraging behaviour. Because it takes relatively large fish, the Great Egret, E. alba, is most likely to be affected by any contamination of the aquatic environment by heavy metals or radionuclides. The Nankeen Night Heron, Nycticorax caledonicus is also abundant on the flood plain and probably feeds on large fish and frogs. The other herons take smaller or immature prey or hunt mostly in terrestrial habitats and are therefore less likely to be affected by contamination of the aquatic environment

Swimming black-crowned night-herons (Nycticorax nycticorax) Kleptoparasitize American coots (Fulica americana)

DEFF Research Database (Denmark)

Graves, Gary R.

2015-01-01

I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid.......I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid....

The heron that laid the golden egg: metals and metalloids in ibis, darter, cormorant, heron, and egret eggs from the Vaal River catchment, South Africa.

Science.gov (United States)

van der Schyff, V; Pieters, R; Bouwman, H

2016-06-01

Metal pollution issues are afforded the highest priority in developing countries. Only one previous study has addressed metals in African bird eggs. We determined the concentration of metals and metalloids in bird eggs from four sites in the Vaal River catchment (VRC) of South Africa to provide data on the current situation. We analysed 16 pools of 77 heron, ibis, darter, egret, and cormorant eggs for 18 metals and metalloids using ICP-MS. We found high concentrations of gold (Au), uranium (U), thallium (Tl), and platinum (Pt) in Grey Heron eggs from Baberspan. Great white egrets from Bloemhof Dam had high concentrations of mercury (Hg). Multivariate analyses revealed strong associations between Au and U, and between palladium (Pd) and Pt. The toxic reference value (TRV) for Hg was exceeded in seven pools. Selenium exceeded its TRV in one pool; in the same pool, copper (Cu) reached its TRV. Compared with other studies, VRC bird eggs had high concentrations of contaminants. Based on these high concentrations, human health might be at risk as Grey Herons and humans share similar food and are therefore exposed to the same contaminants.

Inscribed polygons and Heron polynomials

International Nuclear Information System (INIS)

Varfolomeev, V V

2003-01-01

Heron's well-known formula expressing the area of a triangle in terms of the lengths of its sides is generalized in the following sense to polygons inscribed in a circle: it is proved that the area is an algebraic function of the lengths of the edges of the polygon. Similar results are proved for the diagonals and the radius of the circumscribed circle. The resulting algebraic equations are studied and elementary geometric applications of the algebraic results obtained are presented

Great Blue Herons in Puget Sound

Science.gov (United States)

2007-06-01

consolidation of the breeding population into relatively few, large reproductive centers. With the breeding population centralized, these colonies become...During nesting and reproduction , heron eggs and young fall prey to forest- associated raptors and other predators, further linking the complexity of...nests up to a meter wide and one-half meter deep. An adequate supply of nest material is also important; both deciduous and conifer twigs are utilized

Heavy metal and selenium levels in feathers of young egrets and herons from Hong Kong and Szechuan, China.

Science.gov (United States)

Burger, J; Gochfeld, M

1993-09-01

Several species of herons and egrets frequently nest in colonies in areas where humans also concentrate. Since the birds feed on intermediate-sized fish that themselves concentrate pollutants, they can be used not only to assess the levels of contaminants in avian tissues but as indicators of contaminants in the environment. The concentration of heavy metals and selenium in the breast feathers of fledgling black-crowned night herons Nycticorax nycticorax and Chinese pond herons Ardeola bacchus from the Tu Jing Yan heronry outside Chengdu, Szechuan Province in China; and from fledgling black-crowned night heron, little egret Egretta garzetta, great egret Egretta alba and cattle egret Bubulcus ibis from the Mai Po heronry in Hong Kong, were determined. Breast feathers were also collected from adult great egrets in Hong Kong. Adult great egrets had significantly higher levels of all heavy metals than did young great egrets. There were no significant interspecific differences in metal levels among the young at Szechuan China, except for chromium (pond herons had higher levels). There were significant differences among the young nesting at Hong Kong for all metals examined. Great egrets had lower, and night herons had higher, levels of lead than the other young. Night herons also had the highest levels of cadmium, manganese, and selenium compared to the other young. Great egret chicks had the lowest mercury levels, while little egret had the highest levels. Lead levels for all the birds in both Hong Kong and Szechuan were among the highest in the world, and this was attributed to the continued use of leaded gasoline.

Metal Concentrations, Foraging Distances, and Fledging Success of Great Blue Herons Nesting Along the Hanford Reach of the Columbia River

Energy Technology Data Exchange (ETDEWEB)

Tiller, Brett L.; Marco, Jeffrey D.; Rickard, William H.

2005-05-01

Excrement sample and livers of juvenile great blue herons were collected at nests at three widely separated colonies along the Hanford Reach of the Columbia River to test the validity of using excrement samples as indicators of metal concentrations in tissues of juvenile herons fed food collected by parent birds within a few kilometers of nests. There was no positive relation noted between metal concentrations in excrement and liver samples taken from the same nests. Statistically significant differences in metal concentrations were noted in excrement samples collected among the different heron colonies. Arsenic, Cd, Cr, and Pb concentrations (dry wt.) were higher in excrement than in liver samples but the opposite was noted for Cu, Hg, and Zn. Mercury concentrations in heron liver samples were biomagnified to a greater extent than Cd and Cr. Fledging success and eggshell thickness measurements were used as indicators of population health. These values were equivalent to or better than those noted for heron colonies elsewhere in the United States.

Short Note Brood parasitism in the Green-backed Heron ( Butorides ...

African Journals Online (AJOL)

Short Note Brood parasitism in the Green-backed Heron (Butorides striatus). R Yosef, P Zduniak. Abstract. Ostrich 2005, 76(1&2): 78–79. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.2989/00306520509485476 · AJOL African Journals Online.

Results of bald eagle, osprey and great blue heron nest site surveys near Fort MacKay, Alberta

International Nuclear Information System (INIS)

Strom, K.; Balagus, P.

1996-01-01

As part of the environmental impact assessment process, a study was conducted to assess the occurrence of bald eagle, osprey and great blue heron on Syncrude's proposed oil sand leases near Fort MacKay. The objective of the study was to determine the relative abundance, habitat preferences and nesting occurrences of these different birds. Aerial count surveys were conducted to include coverage of the shorelines of four rivers and 22 lakes. Breeding activities of the osprey, bald eagle and great blue heron were observed in the regional study area, but not in the local study area. 14 refs., 1 tab., 4 figs

Observations of indirect filial cannibalism in response to nest failure of Black-crowned Night-Herons (Nycticorax nycticorax)

Science.gov (United States)

Brussee, Brianne E.; Coates, Peter S.; Dwight, Ian; Young, Laura G.

2017-01-01

During 2011, four separate instances of indirect filial cannibalism, whereby adults consumed their young that died from unknown causes, were observed using video-monitoring techniques in a nesting colony of Black-crowned Night-Herons (Nycticorax nycticorax) on Alcatraz Island. Though they were not observed actively killing their young, in all four observations adult Black-crowned Night-Herons consumed their young following death (i.e., indirect filial cannibalism). We could not determine cause of chick mortality, but parental neglect was likely a contributing factor in at least two instances. Indirect filial cannibalism is not commonly documented among birds, and understanding how cannibalism contributes to nest failure can help researchers better understand factors that limit nesting populations.

Lead accumulation in feathers of nestling black-crowned night-herons (Nycticorax nycticorax) experimentally treated in the field

Science.gov (United States)

Golden, N.H.; Rattner, B.A.; Cohen, J.B.; Hoffman, D.J.; Russek-Cohen, E.; Ottinger, M.A.

2003-01-01

Although lead can attain high concentrations in feathers, interpretation of the biological significance of this phenomenon is difficult. As part of an effort to develop and validate non-invasive methods to monitor contaminant exposure in free-ranging birds, lead uptake by feathers of nestling black-crowned night-herons (Nycticorax nycticorax) was evaluated in a controlled exposure study. Four to six day-old heron nestlings (one/nest) at Chincoteague Bay, Virginia, received a single intraperitoneal injection of dosing vehicle (control; n=7) or a dose of lead nitrate in water (0.01, 0.05, or 0.25 mg Pb/g body weight of nestling; n=6 or 7/dose) chosen to yield feather lead concentrations found at low to moderately polluted sites. Nestlings were euthanized at 15 days of age. Lead accumulation in feathers was associated with concentrations in bone, kidney, and liver (r = 0.32 - 0.74, p feather lead concentration. Culmen growth rate was depressed in nestlings treated with the highest dose of lead, but not correlated with feather lead concentration. These findings provide evidence that feathers of nestling herons are a sensitive indicator of lead exposure and have potential application for the extrapolation of lead concentrations in other tissues and the estimation of environmental lead exposure in birds.

Lead accumulation in feathers of nestling black-crowned night herons (Nycticorax nycticorax) experimentally treated in the field.

Science.gov (United States)

Golden, Nancy H; Rattner, Barnett A; Cohen, Jonathan B; Hoffman, David J; Russek-Cohen, Estelle; Ottinger, Mary Ann

2003-07-01

Although lead can attain high concentrations in feathers, interpretation of the biological significance of this phenomenon is difficult. As part of an effort to develop and validate noninvasive methods to monitor contaminant exposure in free-ranging birds, lead uptake by feathers of nestling black-crowned night herons (Nycticorax nycticorax) was evaluated in a controlled exposure study. Four- to 6-d-old heron nestlings (one/nest) at Chincoteague Bay, Virginia (USA), received a single intraperitoneal injection of dosing vehicle (control, n = 7) or a dose of lead nitrate in water (0.01, 0.05, or 0.25 mg Pb/g body wt of nestling; n = 6 or 7/dose) chosen to yield feather lead concentrations found at low- to moderately polluted sites. Nestlings were euthanized at 15 d of age. Lead accumulation in feathers was associated with concentrations in bone, kidney, and liver (r = 0.32-0.74, p feather lead concentration. Culmen growth rate was depressed in nestlings treated with the highest dose of lead but not correlated with feather lead concentration. These findings provide evidence that feathers of nestling herons are a sensitive indicator of lead exposure and have potential application for the extrapolation of lead concentrations in other tissues and the estimation of environmental lead exposure in birds.

Unique phylogenetic position of Diplomonadida based on the complete small subunit ribosomal RNA sequence of Giardia ardeae, G. muris, G. duodenalis and Hexamita sp.

Science.gov (United States)

van Keulen, H; Gutell, R R; Gates, M A; Campbell, S R; Erlandsen, S L; Jarroll, E L; Kulda, J; Meyer, E A

1993-01-01

Complete small-subunit rRNA (SSU-rRNA) coding region sequences were determined for two species of the intestinal parasite Giardia: G. ardeae and G. muris, both belonging to the order Diplomonadida, and a free-living member of this order, Hexamita sp. These sequences were compared to published SSU-rDNA sequences from a third member of the genus Giardia, G. duodenalis (often called G. intestinalis or G. lamblia) and various representative organisms from other taxa. Of the three Giardia sequences analyzed, the SSU-rRNA from G. muris is the smallest (1432 bases as compared to 1435 and 1453 for G. ardeae and G. duodenalis, respectively) and has the lowest G+C content (58.9%). The Hexamita SSU-rRNA is the largest in this group, containing 1550 bases. Because the sizes of the SSU-rRNA are prokaryotic rather than typically eukaryotic, the secondary structures of the SSU-rRNAs were constructed. These structures show a number of typically eukaryotic signature sequences. Sequence alignments based on constraints imposed by secondary structure were used for construction of a phylogenetic tree for these four taxa. The results show that of the four diplomonads represented, the Giardia species form a distinct group. The other diplomonad Hexamita and the microsporidium Vairimorpha necatrix appear to be distinct from Giardia.

Influence of the heron colony on heavy metals accumulation in soil of Dniprovsko-Orilsky nature reserve

Directory of Open Access Journals (Sweden)

M. V. Vovk

2005-01-01

Full Text Available The article is devoted to the research of the settlements of heron on the accumulation of heavy metals in the soil. The author considers accumulation of trace elements in different soil horizons. The reasons of the prohibitions has been rate.

Effects of lead in nestling black-crowned night-herons (Nycticorax nycticorax) experimentally dosed in the field

Science.gov (United States)

Golden, N.H.; Rattner, B.A.; Cohen, J.B.; Hoffman, D.J.; Ottinger, M.A.

2000-01-01

Lead is a known environmental toxicant, and poisoning resulting from the ingestion of lead shot has been well-documented in many species of waterfowl. However, much less is known regarding exposure and effects of free environmental lead in species of birds other than waterfowl. In an attempt to evaluate toxicity of lead to herons and to determine the usefulness of feathers as a non-invasive exposure-monitoring tool, black-crowned night-heron nestlings were dosed with lead to determine its distribution among tissues, and its effects on biochemical biomarkers, growth, and survival. Five-day-old heron nestlings (one per nest) at Chincoteague Bay, Virginia were given a single intra-peritoneal injection of dosing vehicle (control; N=7) or one of three lead solutions (as lead nitrate) (10, 50, or 250 mg/kg body weight of nestling; N=7 per dose) chosen to represent levels below, at, and above those found in moderately-polluted environments. All nestlings treated with lead exhibited dose-dependent inhibition of delta-aminolevulinic acid dehydratase (ALAD) activity compared to controls, and nestlings treated with the highest concentration showed a reduced carcass weight compared to controls. Of several measures of oxidative stress that were analyzed, significant differences were found between low- and high-dosed nestlings in hepatic total thiol and protein-bound sulfhydryl concentrations. No differences in survival were detected between dosed nestlings, controls, or uninjected siblings. Lead concentrations in several matrices, including feathers, are being determined to assess distribution among tissues and will also be examined for relationships with measures of effect.

Element patterns in feathers of nestling Black-Crowned Night-Herons, Nycticorax nycticorax L., from four colonies in Delaware, Maryland, and Minnesota

Science.gov (United States)

Custer, Thomas W.; Golden, Nancy H.; Rattner, Barnett A.

2008-01-01

The pattern of elements in nestling black-crowned night-heron feathers from a rural Minnesota colony differed from colonies in industrialized regions of Maryland and Delaware. Except for chromium, however, the differences did not reflect the elements associated with waters and sediments of the Maryland and Delaware colonies. Therefore, elements in water and sediment do not necessarily bioaccumulate in night-heron feathers in relation to potential exposure. Although trace element patterns in feathers indicated differences among geographical locations, they did not separate all locations well and their usefulness as an indicator of natal colony location may be limited.

Waterbirds (other than Laridae nesting in the middle section of Laguna Cuyutlán, Colima, México

Directory of Open Access Journals (Sweden)

Eric Mellink

2008-03-01

Full Text Available Laguna de Cuyutlán, in the state of Colima, Mexico, is the only large coastal wetland in a span of roughly 1150 km. Despite this, the study of its birds has been largely neglected. Between 2003 and 2006 we assessed the waterbirds nesting in the middle portion of Laguna Cuyutlán, a large tropical coastal lagoon, through field visits. We documented the nesting of 15 species of non-Laridae waterbirds: Neotropic Cormorant (Phalacrocorax brasilianus, Tricolored Egret (Egretta tricolor, Snowy Egret (Egretta thula, Little Blue Heron (Egretta caerulea, Great Egret (Ardea alba, Cattle Egret (Bubulcus ibis, Black-crowned Nightheron (Nycticorax nycticorax, Yellow-crowned Night-heron (Nyctanassa violacea, Green Heron (Butorides virescens, Roseate Spoonbill (Platalea ajaja, White Ibis (Eudocimus albus, Black-bellied Whistling-duck (Dendrocygna autumnalis, Clapper Rail (Rallus longirostris, Snowy Plover (Charadrius alexandrinus, and Black-necked Stilt (Himantopus mexicanus. These add to six species of Laridae known to nest in that area: Laughing Gulls (Larus atricilla, Royal Terns (Thalasseus maximus, Gull-billed Terns (Gelochelidon nilotica, Forster’s Terns (S. forsteri, Least Terns (Sternula antillarum, and Black Skimmer (Rynchops niger, and to at least 57 species using it during the non-breeding season. With such bird assemblages, Laguna Cuyutlán is an important site for waterbirds, which should be given conservation status. Rev. Biol. Trop. 56 (1: 391-397. Epub 2008 March 31.Durante la prospección de la parte media de la Laguna Cuyutlán, una gran laguna costera en Colima, México, entre 2003 y 2006, documentamos la anidación de 15 especies de aves acuáticas que no pertenecer a la familia Laridae: Phalacrocorax brasilianus, Egretta tricolor, Egretta thula, Egretta caerulea, Ardea alba, Bubulcus ibis, Nycticorax nycticorax, Nyctanassa violacea, Butorides virescens, Platalea ajaja, Eudocimus albus, Dendrocygna autumnalis, Rallus longirostris

Third Culture Kid's Effect on Character of Cady Heron in Mean Girls

OpenAIRE

Hapsari, Laily

2017-01-01

This thesis focuses on the movie, Mean Girls, specifically one of the character, Cady Heron,as a Third Culture Kid trying to adapt in new society. The purpose of this study is to understand the effect of Third Culture Kid in the movie character in socializing with the new surroundings and explain the way how one of the characters in Mean Girls adapts to the new surroundings.The writer uses library research to collect the data with the novel as the main data, and several relevant books, journa...

Prey diversity for Three Species Herons in Pulau Dua Nature Reserve Serang Distrik, Banten Province

Directory of Open Access Journals (Sweden)

DEWI ELFIDASARI

2006-10-01

Full Text Available The diversity of prey consumed by three species herons (Casmerodius albus, Egretta garzetta and Bubulcus ibis was studied in Pulau Dua Nature Reserve Serang, Banten Province using video tapes by following a focal individual for five minutes. In the laboratory the film was analysed every minutes to select complete sequences of feeding behavior in foraging site. There were differences on diversity and size of prey that consumed by three species herons among the different feeding locations. Casmerodius albus which was feeding on mudflat and fisheries consumed Chanos chanos (15.6%, Oreochromis sp (9.4% and Periophtalmus sp. (7.3%, and 36.5% couldn’t be identified. Egretta garzetta was feeding on mudflat, fisheries and rice-field, consumed Periophtalmus sp (15.4%, Mugil dussumeieri (7.9%, Chanos chanos (4.7%, Oreochromis sp (0.5%, including small frog and crustacean (0.5%. Bubulcus ibis was feeding on rice-field and grassland, consumed many variety of insects (92 % and many variety of snail (1.9% in their diet. The insects that B. ibis consumed including grasshopper (26.8%, caterpillar (0.9% and other invertebrates (worm, crustacean that could not be identified (64.3%.

Model of the PCB and mercury exposure of mink and great blue heron inhabiting the off-site environment downstream from the US Department of Energy Oak Ridge Reservation

International Nuclear Information System (INIS)

MacIntosh, D.L.

1992-09-01

This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models

Model of the PCB and mercury exposure of mink and great blue heron inhabiting the off-site environment downstream from the US Department of Energy Oak Ridge Reservation

Energy Technology Data Exchange (ETDEWEB)

MacIntosh, D.L. (Indiana Univ., Bloomington, IN (United States). School of Public and Environmental Affairs); Suter, G.W. II; Hoffman, F.O. (Oak Ridge National Lab., TN (United States))

1992-09-01

This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models.

POTENTIAL FOR GREAT EGRETS (ARDEA ALBA) TO TRANSMIT A VIRULENT STRAIN OF AEROMONAS HYDROPHILA AMONG CHANNEL CATFISH (ICTALURUS PUNCTATUS) CULTURE PONDS.

Science.gov (United States)

Jubirt, Madison M; Hanson, Larry A; Hanson-Dorr, Katie C; Ford, Lorelei; Lemmons, Scott; Fioranelli, Paul; Cunningham, Fred L

2015-07-01

Aeromonas hydrophila is a gram-negative, rod-shaped, facultative, anaerobic bacterium that is ubiquitous in freshwater and slightly brackish aquatic environments and infects fish, humans, reptiles, and birds. Recent severe outbreaks of disease in commercial channel catfish (Ictalurus punctatus) aquaculture ponds have been associated with a highly virulent A. hydrophila strain (VAH), which is genetically distinct from less-virulent strains. The epidemiology of this disease has not been determined. Given that A. hydrophila infects birds, we hypothesized that fish-eating birds may serve as a reservoir for VAH and spread the pathogen by flying to uninfected ponds. Great Egrets (Ardea alba) were used in this transmission model because these wading birds frequently prey on farmed catfish. Great Egrets that were fed VAH-infected catfish shed VAH in feces demonstrating their potential to spread VAH.

Responses of nestling black-crowned night herons (Nycticorax nycticorax) to aquatic and terrestrial recreational activities: a manipulative study

Science.gov (United States)

Esteban Fernandez-Juricic; Patrick A. Zollner; Cherie LeBlanc Fisher; Lynne M. Westphal

2007-01-01

We assessed the effects of the presence and the frequency of canoe and pedestrian disturbance during two breeding seasons on multiple behavioral responses (scanning, freezing, grooming, sleeping, moving, wing-raising, and standing-up) of Black-crowned Night Heron ( Nycticorax nycticorax ) nestlings in a breeding colony in southeast Chicago. Short-...

Presencia y abundancia de aves que se reproducen en islas de la bahía de Mazatlán, Sinaloa, México

Directory of Open Access Journals (Sweden)

Alberto Piña-Ortiz

2017-04-01

Full Text Available Registramos la presencia y abundancia de aves, así como el hábitat y temporalidad de la reproducción de especies en las islas Pájaros, Venados, Lobos, Hermano Norte y Hermano Sur, ubicadas en la bahía de Mazatlán. Realizamos siete recorridos entre noviembre de 2014 y mayo de 2015; además contábamos con información colectada en mayo de 2004. Observamos un total de 59 especies de aves, de las cuales 15 fueron reproductoras: Dendrocygna autumnalis (pijije ala blanca, Phaethon aethereus (rabijunco pico rojo, Sula leucogaster (bobo café, Pelecanus occidentalis (pelícano café, Ardea herodias (garza morena, Ardea alba (garza blanca, Egretta thula (garza pie dorado, Bubulcus ibis (garza ganadera, Nycticorax nycticorax (pedrete corona negra, Nyctanassa violacea (pedrete corona clara, Eudocimus albus (ibis blanco, Coragyps atratus (zopilote común, Haematopus palliatus (ostrero americano, Larus heermanni (gaviota ploma y Falco peregrinus (halcón peregrino. Para P. aethereus y S. leucogaster no había reportes previos de reproducción en estas islas; además, confirmamos la anidación de L. hermanni. La isla Pájaros fue la que albergó el mayor número de especies reproductoras (10 especies. Pelecanus occidentalis fue la especie más abundante con un total de 1 559 individuos, seguido de Fregata magnificens (fragata magnífica y Sula nebouxii (bobo pata azul con 1 526 y 1 100 individuos, respectivamente; aunque para estas dos últimas especies no hubo registros de reproducción. Las islas se encuentran bajo protección, pero se requiere realizar monitoreos para establecer el estado y tendencias de las poblaciones de aves, así como los efectos de las perturbaciones por actividades humanas y por las especies introducidas.

Mercury and drought along the lower Carson River, Nevada: II. Snowy egret and black-crowned night-heron reproduction on Lahontan Reservoir, 1997-2006

Science.gov (United States)

Hill, Elwood F.; Henry, Charles J.; Grove, Robert A.

2008-01-01

Mercury concentrations in the floodplain of the Carson River Basin in northwestern Nevada are some of the highest ever reported in a natural system. Thus, a portion of the basin including Lahontan Reservoir was placed on the U.S. Environmental Protection Agency’s Natural Priorities List for research and cleanup. Preliminary studies indicated that reproduction in piscivorous birds may be at risk. Therefore, a 10-year study (1997–2006) was conducted to evaluate reproduction of snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax) nesting on Gull Island in Lahontan Reservoir. Special attention was given to the annual flow of the Carson River, the resultant fluctuation of this irrigation reservoir, and the annual exposure of snowy egrets and night-herons to methylmercury (MeHg). The dynamic character of the river due to flooding and drought (drought effect) influenced snowy egret and night-heron reproduction more so than did MeHg contamination of eggs. During an extended drought (2000–2004) in the middle of the study, snowy egret nests containing eggs with concentrations of MeHg (measured as total mercury [THg] ∼ 100% MeHg) ≥0.80 μg THg/g, ww, all failed, but in 1997 and 2006 (wet years with general flooding), substantial numbers of young were produced (but fewer than at nests where eggs contained reproductive threshold of tolerance to MeHg may be associated with habitat quality (food type and abundance). Clearly, drought was the most important factor affecting snowy egret annual productivity. In contrast to snowy egrets, night-herons generally had fewer nests meeting the 0.80 μg THg/g criterion, and those above the criterion were less sensitive to mercury than were snowy egrets. Furthermore, night-herons appeared more tolerant of drought conditions than snowy egrets because they nested earlier, selected more protected nesting sites, and had a more generalist diet that provided additional food options including terrestrial

Model of the PCB and mercury exposure of mink and great blue heron inhabiting the off-site environment downstream from the US Department of Energy Oak Ridge Reservation. Environmental Restoration Program

Energy Technology Data Exchange (ETDEWEB)

MacIntosh, D.L. [Indiana Univ., Bloomington, IN (United States). School of Public and Environmental Affairs; Suter, G.W. II; Hoffman, F.O. [Oak Ridge National Lab., TN (United States)

1992-09-01

This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models.

Chlorinated hydrocarbons and biomarkers of exposure in wading birds and fish of the Lower Rio Grande Valley, Texas

Science.gov (United States)

Wainwright, S.E.; Mora, M.A.; Sericano, J.L.; Thomas, P.

2001-01-01

During 1997 we evaluated reproductive success in colonial water birds nesting in the Lower Rio Grande Valley (LRGV), Texas, and correlated success with concentrations of contaminants in eggs. We also measured steroid hormones and gonadosomatic index (GSI) as biomarkers of endocrine effects in common carp (Cyprinus carpio). Nest and fledging success of green herons (Butorides virescens) and great egrets (Ardea alba) were similar to those found in other parts of North America; however, nesting success of black-crowned night-herons (Nycticorax nycticorax) was lower, very likely due to flooding of the nesting area. Except for DDE and toxaphene, all chlorinated pesticides in bird eggs were low and not of concern for negative effects on any of the three species. DDE was highest in green heron eggs and seemed to increase along a geographic gradient from west to east, with eggs from Falcon Reservoir containing low concentrations, and those at Los Indios containing the highest concentrations (approx. 11,000 ng/g WW), near or above the threshold for reproductive impairment. DDE levels in great egrets and black-crowned night-herons were below those that are associated with reproductive impairment. Mean DDE levels in carp at the JAS Farms site were above the threshold level suggested for predator protection. Toxaphene was detected in about 20% of the samples with high levels observed in green heron eggs from Los Indios (mean = 4,402 ng/g WW). These are the highest toxaphene levels reported in bird eggs in the LRGV. Toxaphene levels in fish ranged between 90 and 312 ng/g WW. In general, PCBs in bird eggs and fish tissue were low and at levels not of concern for reproductive effects. The greatest concentrations of testosterone and 11-ketotestosterone were detected in fish from the JAS Farms site, which also had the greatest concentrations of DDE. Increased androgen production and gonad development in fish at this site, relative to Pharr, could be possibly associated with

Relation among cytochrome P450, AH-active PCB congeners and dioxin equivalents in pipping black-crowned night-heron embryos

Science.gov (United States)

Rattner, B.A.; Hatfield, J.S.; Melancon, M.J.; Custer, T.W.; Tillitt, D.E.

1994-01-01

Pipping black-crowned night-heron (Nycticorax nycticorax) embryos were collected from a relatively uncontaminated site (next to Chincoteague National Wildlife Refuge, VA) and three polluted sites (Cat Island, Green Bay, Lake Michigan, WI; Bair Island, San Francisco Bay, CA; West Marin Island, San Francisco Bay, CA). Hepatic cytochrome P-450-associated monooxygenases and cytochrome P-450 proteins, induced up to 85-fold relative to the reference site, were associated with concentrations of total polychlorinated biphenyls (PCBs) and 11 PCB congeners that are presumed to express toxicity through the arylhydrocarbon (Ah) receptor. Multiple regression revealed that up to 86% of the variation of cytochrome P450 measurements was accounted for by variation in the concentration of these PCB congeners. Toxic equivalents (TEQs) of sample extracts, predicted mathematically (summed product of PCB congener concentrations and toxic equivalency factors), and dioxin equivalents (TCDD-EQs), derived by bioassay (ethoxyresorufin-O-dealkylase activity of treated H4IIE rat hepatoma cells), were greatest in Cat Island samples. Cytochrome P450-associated monooxygenases and cytochrome P450 proteins were related to TEQs and TCDD-EQs; adjusted r-2 often exceeded 0.5 for the relation among mathematically predicted TEQs and cytochrome P450 measurements. These data extend previous observations in heron embryos of an association between P450 and total PCB burdens to include Ah-active PCB congeners, and presumably other compounds, which interact similarly with the Ah receptor. Benzyloxyresorufin O-dealkylase, ethoxyresorufin O-dealkylase, and cytochrome P450 1A appear to be the most reliable measures of exposure to Ah-active PCB congeners in black-crowned night-heron embryos. These findings provide further evidence that cytochrome P450-associated parameters have considerable value as a biomarker for assessing environmental contamination of wetlands.

Habitat Evaluation Procedures (HEP) Report; Iskuulpa Wildlife Mitigation and Watershed Project, Technical Report 1998-2003.

Energy Technology Data Exchange (ETDEWEB)

Quaempts, Eric

2003-01-01

U.S. Fish and Wildlife Service (USFWS) Habitat Evaluation Procedures (HEP) were used to determine the number of habitat units credited to evaluate lands acquired and leased in Eskuulpa Watershed, a Confederated Tribes of the Umatilla Indian Reservation watershed and wildlife mitigation project. The project is designed to partially credit habitat losses incurred by BPA for the construction of the John Day and McNary hydroelectric facilities on the Columbia River. Upland and riparian forest, upland and riparian shrub, and grasslands cover types were included in the evaluation. Indicator species included downy woodpecker (Picuides puhescens), black-capped chickadee (Pams atricopillus), blue grouse (Beadragapus obscurus), great blue heron (Ardea herodias), yellow warbler (Dendroica petschia), mink (Mustela vison), and Western meadowlark (Sturnello neglects). Habitat surveys were conducted in 1998 and 1999 in accordance with published HEP protocols and included 55,500 feet of transects, 678 m2 plots, and 243 one-tenth-acre plots. Between 123.9 and f 0,794.4 acres were evaluated for each indicator species. Derived habitat suitability indices were multiplied by corresponding cover-type acreages to determine the number of habitat units for each species. The total habitat units credited to BPA for the Iskuulpa Watershed Project and its seven indicator species is 4,567.8 habitat units. Factors limiting habitat suitability are related to the direct, indirect, and cumulative effects of past livestock grazing, road construction, and timber harvest, which have simplified the structure, composition, and diversity of native plant communities. Alternatives for protecting and improving habitat suitability include exclusion of livestock grazing or implementation of restoration grazing schemes, road de-commissioning, reforestation, large woody debris additions to floodplains, control of competing and unwanted vegetation, reestablishing displaced or reduced native vegetation species

Rainwater Wildlife Area Habitat Evaluation Procedures Report; A Columbia Basin Wildlife Mitigation Project.

Energy Technology Data Exchange (ETDEWEB)

Childs, Allen B.

2004-01-01

The 8,768 acre Rainwater Wildlife Area was acquired in September 1998 by the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) through an agreement with Bonneville Power Administration (BPA) to partially offset habitat losses associated with construction of the John Day and McNary hydroelectric facilities on the mainstem Columbia River. U.S. Fish and Wildlife Service (USFWS) Habitat Evaluation Procedures (HEP) were used to determine the number of habitat units credited to BPA for acquired lands. Upland and riparian forest, upland and riparian shrub, and grassland cover types are evaluated in this study. Targeted wildlife species include downy woodpecker (Picoides pubescens), black-capped chickadee (Parus atricopillus), blue grouse (Dendragapus obscurus), great blue heron (Ardea herodias), yellow warbler (Dendroica petechia), mink (Mustela vison), and Western meadowlark (Sturnella neglecta). Habitat surveys were conducted in 1998 and 1999 in accordance with published HEP protocols and included 65,300, 594m{sup 2}2 plots, and 112 one-tenth-acre plots. Between 153.3 and 7,187.46 acres were evaluated for each target wildlife mitigation species. Derived habitat suitability indices were multiplied by corresponding cover-type acreages to determine the number of habitat units for each species. The total baseline habitat units credited to BPA for the Rainwater Wildlife Area and its seven target species is 5,185.3 habitat units. Factors limiting habitat suitability are related to the direct, indirect, and cumulative effects of past livestock grazing, road construction, and timber harvest which have simplified the structure, composition, and diversity of native plant communities. Alternatives for protecting and improving habitat suitability include exclusion of livestock grazing, road de-commissioning/obliteration, reforestation and thinning, control of competing and unwanted vegetation (including noxious weeds), reestablishing displaced or reduced native

Molecular characterization of Babesia peircei and Babesia ugwidiensis provides insight into the evolution and host specificity of avian piroplasmids

Directory of Open Access Journals (Sweden)

Michael J. Yabsley

2017-12-01

Full Text Available There are 16 recognized species of avian-infecting Babesia spp. (Piroplasmida: Babesiidae. While the classification of piroplasmids has been historically based on morphological differences, geographic isolation and presumed host and/or vector specificities, recent studies employing gene sequence analysis have provided insight into their phylogenetic relationships and host distribution and specificity. In this study, we analyzed the sequences of the 18S rRNA gene and ITS-1 and ITS-2 regions of two Babesia species from South African seabirds: Babesia peircei from African penguins (Spheniscus demersus and Babesia ugwidiensis from Bank and Cape cormorants (Phalacrocorax neglectus and P. capensis, respectively. Our results show that avian Babesia spp. are not monophyletic, with at least three distinct phylogenetic groups. B. peircei and B. ugwidiensis are closely related, and fall within the same phylogenetic group as B. ardeae (from herons Ardea cinerea, B. poelea (from boobies Sula spp. and B. uriae (from murres Uria aalge. The validity of B. peircei and B. ugwidiensis as separate species is corroborated by both morphological and genetic evidence. On the other hand, our results indicate that B. poelea might be a synonym of B. peircei, which in turn would be a host generalist that infects seabirds from multiple orders. Further studies combining morphological and molecular methods are warranted to clarify the taxonomy, phylogeny and host distribution of avian piroplasmids. Keywords: Africa, Babesia, Piroplasmida, Phalacrocoracidae, Spheniscidae, Tick-borne pathogen

Organochlorine pesticide, polychlorinated biphenyl, trace element and metal residues in bird eggs from Salton Sea, California, 2004

Science.gov (United States)

Henny, Charles J.; Anderson, T.W.; Crayon, J.J.

2008-01-01

The Salton Sea is a highly eutrophic, hypersaline terminal lake that receives inflows primarily from agricultural drainages in the Imperial and Coachella valleys. Impending reductions in water inflow at Salton Sea may concentrate existing contaminants which have been a concern for many years, and result in higher exposure to birds. Thus, waterbird eggs were collected and analyzed in 2004 and compared with residue concentrations from earlier years; these data provide a base for future comparisons. Eggs from four waterbird species (black-crowned night-heron [Nycticorax nycticorax], great egret [Ardea alba], black-necked stilt [Himantopus mexicanus], and American avocet [Recurvirostra Americana]) were collected. Eggs were analyzed for organochlorine pesticides, polychlorinated biphenyls (PCBs), metals, and trace elements, with current results compared to those reported for eggs collected from the same species and others during 1985a??1993. The two contaminants of primary concern were p,pa??-DDE (DDE) and selenium. DDE concentrations in night-heron and great egret eggs collected from the northwest corner of Salton Sea (Whitewater River delta) decreased 91 and 95%, respectively, by 2004, with a concomitant increase in eggshell thickness for both species. Decreases in bird egg DDE levels paralleled those in tissues of tilapia (Oreochromis mossambicus ?? O. urolepis), an important prey species for herons and egrets. Despite most nests of night-herons and great egrets failing in 2004 due to predation, predicted reproductive effects based on DDE concentrations in eggs were low or negligible for these species. The 2004 DDE findings were in dramatic contrast to those in the past decade, and included an 81% decrease in black-necked stilt eggs, although concentrations were lower historically than those reported in night-herons and egrets. Selenium concentrations in black-necked stilt eggs from the southeast corner of Salton Sea (Davis Road) were similar in 1993 and 2004, with 4

Relationships among cytochromes P450 and dioxin equivalents in pipping heron embryos from Virginia, the Great Lakes and San Francisco Bay

Science.gov (United States)

Rattner, B.A.; Hatfield, J.S.; Melancon, M.J.; Custer, T.W.; Tillett, D.E.

1993-01-01

Pipping black-crowned night-heron (Nycticorax nycticorax) embryos were collected from undisturbed (Chincoteague National Wildlife Refuge, VA) and industrialized (Cat Island, Green Bay, WI; San Francisco Bay, CA) locations. Hepatic P450 associated monooxygenases (AHH, EROD, BROD, ECOD) and P450 proteins (CYP1A, CYP2B) were induced up to 85-fold, and were associated with burdens of total PCBs and 11 AHH-active PCB congeners. Dioxin equivalents (TCDD-EQs) of sample extracts, derived by bioassay (H4I1E rat hepatoma cell) and mathematically (product of PCB congener concentration and relative TCDD potency), revealed greatest TCDD-EQs in Cat Island samples. TCDD-EQs were associated with P450s, especially BROD, EROD and CYP1A (r2 = 0.35 to 0.66). TCDD-EQs derived by bioassay were highly correlated with TCDD-EQs derived mathematically (r2 = 0.58 to 0.67) . Multiple regressions were also performed to investigate relationships among P450s and PCB congeners. In summary, these data demonstrate that hepatic P450s of heron embryos are biomarkers of exposure to dioxin-like compounds and provide further evidence that this species has considerable value for assessing wetland and estuarine contamination.

DDT exposure of frogs: A case study from Limpopo Province, South Africa.

Science.gov (United States)

Viljoen, Ignatius M; Bornman, Riana; Bouwman, Hindrik

2016-09-01

Amphibians are globally under pressure with environmental contaminants contributing to this. Despite caution aired more than 80 years ago of threats posed to amphibians by DDT spraying for disease vector control, no data have been published on concentrations or effects of DDT contamination in frogs from areas where DDT is actively sprayed to control the insect vectors of malaria. In this study, we sampled fat bodies of Xenopus laevis and Xenopus muelleri naturally occurring in an area where indoor residual spraying of DDT is employed and from adjacent, non-sprayed, areas. ΣDDT concentrations ranged between DDT in the eggs of the Grey Heron Ardea cinerea. This suggests that the DDT we found in frogs may have contributed to DDT loadings higher in the food web. These findings, combined with other studies from this area, support the need to reduce and eventually move away from DDT in malaria control safely and sustainably. Copyright © 2016 Elsevier Ltd. All rights reserved.

Patrones de crecimiento postnatal en ocho especies de garzas (Ciconiiformes: Ardeidae

Directory of Open Access Journals (Sweden)

Dennis Denis Ávila

2011-06-01

Full Text Available El crecimiento en aves forma parte de las estrategias reproductivas y su implicación ecológica ha sido profundamente debatida. En este trabajo se describe el crecimiento del pico, peso y tarso de ocho garzas (Aves: Ardeidae en la ciénaga de Birama, Cuba. Para ello, entre 1998-2006, se midieron en días alternos un total de 714 pichones de Butorides virescens, Bubulcus ibis, Egretta thula, E. tricolor, E. caerulea, E. rufescens, Ardea alba y Nycticorax nycticorax, durante sus dos primeras semanas de vida. Se hicieron ajustes a las curvas Logística y de Gompertz y se usó regresiones no lineales y valores adultos como asíntotas, además se determinaron las variables que describenel crecimiento. El tamaño de los pichones al eclosionar fue similar al encontrado en otras localidades, con CV entre 10-19% y diferencias relativas al tamaño adulto. Las ecuaciones de Gompertz tuvieron menos residuos en todos los casos. Entonces, se identificaron dos procesos fundamentales de extensión en el crecimiento de cada estructura: uno físico y otro de duración, entre B. virescens y E. alba. Nycticorax, B. ibis y E. rufescens mostraron variaciones que los diferenciaron del resto. Los resultados apoyan la hipótesis de la microevolución de Ardeidae por hipermorfosis, por un retardo en el momento final del crecimiento.Postnatal growth patterns in eight species of herons and egrets (Ciconiiformes: Ardeidae. Avian postnatal growth has received considerable attention and its ecological implications have been deeply analyzed. In this current paper, I describe the patterns of culmen and tarsus growth, as well as of weight gain patterns in eight species of herons and egrets (Aves: Ardeidae found in the Birama Swamp in Eastern Cuba. Between 1998 and 2006, 714 nestlings of the following species were measured every two days: Butorides virescens, Bubulcus ibis, Egretta thula, E. tricolor, E. caerulea, E. rufescens, Ardea alba and Nycticorax nycticorax. Logistic and

Epilithic Cyanobacterial Communities of a Marine Tropical Beach Rock (Heron Island, Great Barrier Reef): Diversity and Diazotrophy▿

Science.gov (United States)

Díez, Beatriz; Bauer, Karolina; Bergman, Birgitta

2007-01-01

The diversity and nitrogenase activity of epilithic marine microbes in a Holocene beach rock (Heron Island, Great Barrier Reef, Australia) with a proposed biological calcification “microbialite” origin were examined. Partial 16S rRNA gene sequences from the dominant mat (a coherent and layered pink-pigmented community spread over the beach rock) and biofilms (nonstratified, differently pigmented microbial communities of small shallow depressions) were retrieved using denaturing gradient gel electrophoresis (DGGE), and a clone library was retrieved from the dominant mat. The 16S rRNA gene sequences and morphological analyses revealed heterogeneity in the cyanobacterial distribution patterns. The nonheterocystous filamentous genus Blennothrix sp., phylogenetically related to Lyngbya, dominated the mat together with unidentified nonheterocystous filaments of members of the Pseudanabaenaceae and the unicellular genus Chroococcidiopsis. The dominance and three-dimensional intertwined distribution of these organisms were confirmed by nonintrusive scanning microscopy. In contrast, the less pronounced biofilms were dominated by the heterocystous cyanobacterial genus Calothrix, two unicellular Entophysalis morphotypes, Lyngbya spp., and members of the Pseudanabaenaceae family. Cytophaga-Flavobacterium-Bacteroides and Alphaproteobacteria phylotypes were also retrieved from the beach rock. The microbial diversity of the dominant mat was accompanied by high nocturnal nitrogenase activities (as determined by in situ acetylene reduction assays). A new DGGE nifH gene optimization approach for cyanobacterial nitrogen fixers showed that the sequences retrieved from the dominant mat were related to nonheterocystous uncultured cyanobacterial phylotypes, only distantly related to sequences of nitrogen-fixing cultured cyanobacteria. These data stress the occurrence and importance of nonheterocystous epilithic cyanobacteria, and it is hypothesized that such epilithic cyanobacteria

Exposure of great egret (Ardea albus) nestlings to mercury through diet in the Everglades ecosystem

Science.gov (United States)

Frederick, Peter C; Spalding, Marilyn G.; Sepalveda, Maria S.; Williams, Gary E.; Nico, Leo G.; Robins, Robert H.

1999-01-01

We estimated exposure of great egret (Ardea albus) nestlings to mercury in food in the Florida Everglades, USA, by collecting regurgitated food samples during the 1993 to 1996 breeding seasons and during 1995 measured concentrations of mercury in individual prey items from those samples. Great egret nestlings had a diet composed predominantly of fish (>95% of biomass), though the species composition of fish in the diet fluctuated considerably among years. Great egrets concentrated on the larger fish available in the marsh, especially members of the Centrarchidae. The importance of all nonnative fish fluctuated from 0 to 32% of the diet by biomass and was dominated by pike killifish (Belonesox belizanus) and cichlids (Cichlidae). Total mercury concentrations in prey fish ranged from 0.04 to 1.40 mg/kg wet weight, and we found a significant relationship between mass of individual fish and mercury concentration. We estimated the concentration of total mercury in the diet as a whole by weighting the mercury concentration in a given fish species by the proportion of that species in the diet. We estimate that total mercury concentrations in the diets ranged among years from 0.37 to 0.47 mg/kg fish (4-year mean = 0.41 mg/kg). We estimated total mercury exposure in great egret nestlings by combining these mercury concentrations with measurements of food intake rate, as measured over the course of the nestling period in both lab and field situations. We estimate that, at the 0.41 mg/kg level, nestlings would ingest 4.32 mg total mercury during an 80-day nestling period. Captive feeding studies reported elsewhere suggest that this level of exposure in the wild could be associated with reduced fledging mass, increased lethargy, decreased appetite, and, possibly, poor health and juvenile survival.

Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from HERON ISLAND, KANGAROO ISLAND and others in the Coral Sea, Great Australian Bight and Tasman Sea from 2009-10-09 to 2012-11-28 (NODC Accession 0100062)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0100062 includes chemical, meteorological, physical and time series data collected from HERON ISLAND, KANGAROO ISLAND, MARIA ISLAND, MOORING_HERON...

Dissolved inorganic carbon, total alkalinity, nitrate, phosphate, temperature and other variables collected from time series observations at Heron Island Reef Flat from 2010-06-01 to 2010-12-13 (NODC Accession 0127256)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This archival package contains carbonate chemistry and environmental parameters data that were collected from a 200-day time series monitoring on the Heron Island...

Effects of mercury on health and first-year survival of free-ranging great egrets (Ardea albus) from southern Florida.

Science.gov (United States)

Sepúlveda, M S; Williams, G E; Frederick, P C; Spalding, M G

1999-10-01

The objectives of this study were to determine whether elevated mercury (Hg) concentrations have a negative impact on the health and survival of nestling and juvenile free-ranging great egrets (Ardea albus) from southern Florida. During 1994, when health and survival was monitored in a cohort of young birds with naturally variable concentrations of Hg, packed cell volume was positively correlated with blood Hg concentrations, and high Hg concentration in blood was not related to the probability of surviving during the first 10.5 months of life. During 1995, 70 first-hatched great egret chicks were included in a Hg field-dosing experiment to compare the effects of elevated Hg on health and survival. Birds were dosed while in the nest orally every 2.5 days for 15 days with 0.5 mg of methyl mercury chloride (MeHgCl) for an estimated intake of 1.54 mg MeHgCl/kg food intake. These birds were compared with controls, which received an estimated 0.41 mg MeHgCl/kg food. No differences were observed in health parameters or in the probability of surviving during the first 8 months of age between egrets that were dosed with Hg and those that were not. A likely explanation for the lack of any effects on health and survival between both groups could be that chicks at this age were eliminating most of the dietary Hg through the production of new feathers.

Brominated flame retardants and organochlorine pollutants in aquatic and terrestrial predatory birds of Belgium: levels, patterns, tissue distribution and condition factors

International Nuclear Information System (INIS)

Jaspers, V.L.B.; Covaci, A.; Voorspoels, S.; Dauwe, T.; Eens, M.; Schepens, P.

2006-01-01

Liver and muscle samples from 7 species of aquatic and terrestrial predatory birds from Flanders (Belgium) were analysed for polychlorinated biphenyls (PCBs), polybrominated diphenylethers (PBDEs) and organochlorine pesticides (OCPs). PCBs were the predominant compounds in our samples, which showed highest concentrations in the liver of barn owl (Tyto alba) and sparrowhawk (Accipiter nisus) (up to 1000 μg/g lipid weight). PBDEs could be determined in most samples at lower concentrations than PCBs (up to 64 μg/g lipid in sparrowhawk liver). Sparrowhawks had the highest levels of hexachlorobenzene, DDTs and PBDEs. In contrast, kestrels (Falco tinnunculus) had relatively low levels of most measured organochlorines. BDE 47 was the most abundant congener in heron (Ardea cinerea) and grebe (Podiceps cristatus), while BDE 47, 99 and 153 were equally important in the terrestrial species. BDE 183 and BDE 209 were only measured in the terrestrial birds. These results indicate that terrestrial birds may be more exposed to higher brominated BDE congeners than aquatic species. - Aquatic and terrestrial predatory birds show different accumulation profiles of PBDEs

Characterization of cholinesterases in plasma of three Portuguese native bird species: application to biomonitoring.

Directory of Open Access Journals (Sweden)

Cátia S A Santos

Full Text Available Over the last decades the inhibition of plasma cholinesterase (ChE activity has been widely used as a biomarker to diagnose organophosphate and carbamate exposure. Plasma ChE activity is a useful and non-invasive method to monitor bird exposure to anticholinesterase compounds; nonetheless several studies had shown that the ChE form(s present in avian plasma may vary greatly among species. In order to support further biomonitoring studies and provide reference data for wildlife risk-assessment, plasma cholinesterase of the northern gannet (Morus bassanus, the white stork (Ciconia ciconia and the grey heron (Ardea cinerea were characterized using three substrates (acetylthiocholine iodide, propionylthiocholine iodide, and S-butyrylthiocholine iodide and three ChE inhibitors (eserine sulphate, BW284C51, and iso-OMPA. Additionally, the range of ChE activity that may be considered as basal levels for non-exposed individuals was determined. The results suggest that in the plasma of the three species studied the main cholinesterase form present is butyrylcholinesterase (BChE. Plasma BChE activity in non-exposed individuals was 0.48±0.11 SD U/ml, 0.39±0.12 SD U/ml, 0.15±0.04 SD U/ml in the northern gannet, white stork and grey heron, respectively. These results are crucial for the further use of plasma BChE activity in these bird species as a contamination bioindicator of anti-cholinesterase agents in both wetland and marine environments. Our findings also underscore the importance of plasma ChE characterization before its use as a biomarker in biomonitoring studies with birds.

Habitat Evaluation Procedures (HEP) Report : Rainwater Wildlife Area, 1998-2001 Technical Report.

Energy Technology Data Exchange (ETDEWEB)

Childs, Allen

2004-01-01

The 8,768 acre Rainwater Wildlife Area was acquired in September 1998 by the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) through an agreement with Bonneville Power Administration (BPA) to partially offset habitat losses associated with construction of the John Day and McNary hydroelectric facilities on the mainstem Columbia River. U.S. Fish and Wildlife Service (USFWS) Habitat Evaluation Procedures (HEP) were used to determine the number of habitat units credited to BPA for acquired lands. Upland and riparian forest, upland and riparian shrub, and grassland rover types are evaluated in this study. Targeted wildlife species include downy woodpecker (Picoides pubescens), black-capped chickadee (Parus atricopillus), blue grouse (Dendragapus obscurus), great blue heron (Ardea herodias), yellow warbler (Dendroica petechia), mink (Mustela vison), and Western meadowlark (Sturnella neglects). Habitat surveys were conducted in 1998 and 1999 in accordance with published HEP protocols and included 65,300, 594m{sup 2} plots, and 112 one-tenth-acre plots. Between 153.3 and 7,187.46 acres were evaluated for each target wildlife mitigation species. Derived habitat suitability indices were multiplied by corresponding cover-type acreages to determine the number of habitat units for each species. The total baseline habitat units credited to BPA for the Rainwater Wildlife Area and its seven target species is 5,185.3 habitat units. Factors limiting habitat suitability are related to the direct, indirect, and cumulative effects of past livestock grazing, road construction, and timber harvest which have simplified the structure, composition, and diversity of native plant communities. Alternatives for protecting and improving habitat suitability include exclusion of livestock grazing, road de-commissioning/obliteration, reforestation and thinning, control of competing and unwanted vegetation (including noxious weeds), reestablishing displaced or reduced native

Diel coral reef acidification driven by porewater advection in permeable sands, Heron Island, Great Barrier Reef

DEFF Research Database (Denmark)

Santos, Isaac R.; Glud, Ronnie N.; Maher, Damien

2011-01-01

Little is known about how biogeochemical processes in permeable sediments affect the pH of coastal waters. We demonstrate that seawater recirculation in permeable sands can play a major role in proton (H+) cycling in a coral reef lagoon. The diel pH range (up to 0.75 units) in the Heron Island...... lagoon was the broadest ever reported for reef waters, and the night‐time pH (7.69) was comparable to worst‐case scenario predictions for seawater pH in 2100. The net contribution of coarse carbonate sands to the whole system H+ fluxes was only 9% during the day, but approached 100% at night when small...... scale (i.e., flow and topography‐induced pressure gradients) and large scale (i.e., tidal pumping as traced by radon) seawater recirculation processes were synergistic. Reef lagoon sands were a net sink for H+, and the sink strength was a function of porewater flushing rate. Our observations suggest...

Combined impacts of Black-crowned Night-Heron predation/disturbance and various management activities on Roseate Tern productivity in 2003, and testing of a video surveillance system for recording the diurnal and nocturnal behavior of terns and night-herons at Falkner Island, Stewart B. McKinney National Wildlife Refuge, Connecticut, in 2004: Report to U.S. Fish and Wildlife Service, Stewart B. McKinney National Wildlife Refuge, Westbrook, Connecticut and U.S. Fish and Wildlife Service, Region 5 Regional Office, Hadley, Massachusetts

Science.gov (United States)

Spendelow, J.A.; Kuter, M.

2004-01-01

Falkner Island (FICT), a unit of the U.S. Fish and Wildlife Service's Stewart B. McKinney National Wildlife Refuge (SBMNWR) since 1985, is located in Long Island Sound 5 km south of Guilford, CT. For more than three decades it has been the site of the only large breeding colony in Connecticut of the federally endangered Northwest Atlantic population of Roseate Terns (Sterna dougallii) and the state's largest colony of Common Terns (S. hirundo). Both species have been studied at this site since 1978 as part of the Falkner Island Tern Project (FITP), and since 1987 also as part of a regional Cooperative Roseate Tern Metapopulation Dynamics and Ecology Project (CRTMP), both coordinated by Dr. Jeffrey A. Spendelow of the U.S. Geological Survey's Patuxent Wildlife Research Center (USGS-PWRC). From 1997-2002 the Roseate Tern breeding population at this site declined by more than 50% from about 150 to about 70 nesting pairs, mostly as a result of the nocturnal predation and disturbance of tern chicks and eggs by Black-crowned Night-Herons (Nycticorax nycticorax). Here we report the results of research done with the goal of improving management of nocturnal predators and developing new practices/structures to reduce losses of tern eggs and chicks so as to prevent the abandonment of this site by Roseate Terns. Notification of release of the USGS 'Quick Response Funds' (QRF) that were to be used to support the part of this study entitled 'Nocturnal behavior/interactions of endangered Roseate Terns and Black-crowned Night-Herons', and final approval of the Study Plan for this research did not occur until after the breeding season in 2003 was well underway. As a result, some work will need to be completed during the 2004 field season. There are two major objectives of this study. The first is to collect basic information (a) on the nocturnal behavior and interactions of Roseate (and Common) Terns with predatory Black-crowned Night-Herons, and (b) on how the behavior of the

Free-Ranging Synanthropic Birds (Ardea alba and Columba livia domestica) as Carriers of Salmonella spp. and Diarrheagenic Escherichia coli in the Vicinity of an Urban Zoo.

Science.gov (United States)

de Oliveira, Mirela C V; Camargo, Beatriz Q; Cunha, Marcos P V; Saidenberg, Andre Becker; Teixeira, Rodrigo H F; Matajira, Carlos E C; Moreno, Luisa Z; Gomes, Vasco T M; Christ, Ana P G; Barbosa, Mikaela R F; Sato, Maria I Z; Moreno, Andrea M; Knöbl, Terezinha

2018-01-01

The presence of free-ranging urban birds is a risk factor for transmitting pathogens to captive animals and humans alike, including Salmonella spp. and diarrheagenic Escherichia coli. Cloacal swabs from 156 synanthropic Great egrets (Ardea alba) and feral pigeons (Columba livia domestica) that inhabit the surroundings of an urban zoo were processed for the identification of Salmonella spp. and diarrheagenic E. coli pathotypes. Bacterial species identification and genotypic characterization employed the matrix-assisted laser desorption ionization-time of flight mass spectrometry and PCR techniques, respectively, comparing their phylogenetic profiles through amplified fragment length polymorphism (AFLP) analysis. A total of 11 birds were positive for Salmonella Typhimurium (7%) and 9 individuals (5.8%) for diarrheagenic E. coli (enteropathogenic E. coli/Shiga-toxin producing E. coli [EPEC/STEC]) strains. S. Typhimurium strains presented highly similar AFLP profiles (85-100%), whereas EPEC/STEC strains showed more polymorphism. The results show free-ranging birds as carriers for both microorganisms in a zoo environment in Brazil for the first time and suggest these species as possible sources of infection to other animals as well as exposing personnel and visitors to potential zoonotic microorganisms. The presence of carriers highlights the importance of a surveillance system and the need for preventive measures to avoid attracting growing number of synanthropic avian species.

Vision and foraging in cormorants: more like herons than hawks?

Directory of Open Access Journals (Sweden)

Craig R White

Full Text Available BACKGROUND: Great cormorants (Phalacrocorax carbo L. show the highest known foraging yield for a marine predator and they are often perceived to be in conflict with human economic interests. They are generally regarded as visually-guided, pursuit-dive foragers, so it would be expected that cormorants have excellent vision much like aerial predators, such as hawks which detect and pursue prey from a distance. Indeed cormorant eyes appear to show some specific adaptations to the amphibious life style. They are reported to have a highly pliable lens and powerful intraocular muscles which are thought to accommodate for the loss of corneal refractive power that accompanies immersion and ensures a well focussed image on the retina. However, nothing is known of the visual performance of these birds and how this might influence their prey capture technique. METHODOLOGY/PRINCIPAL FINDINGS: We measured the aquatic visual acuity of great cormorants under a range of viewing conditions (illuminance, target contrast, viewing distance and found it to be unexpectedly poor. Cormorant visual acuity under a range of viewing conditions is in fact comparable to unaided humans under water, and very inferior to that of aerial predators. We present a prey detectability model based upon the known acuity of cormorants at different illuminances, target contrasts and viewing distances. This shows that cormorants are able to detect individual prey only at close range (less than 1 m. CONCLUSIONS/SIGNIFICANCE: We conclude that cormorants are not the aquatic equivalent of hawks. Their efficient hunting involves the use of specialised foraging techniques which employ brief short-distance pursuit and/or rapid neck extension to capture prey that is visually detected or flushed only at short range. This technique appears to be driven proximately by the cormorant's limited visual capacities, and is analogous to the foraging techniques employed by herons.

Mercury and drought along the Lower Carson River, Nevada: III. effects on blood and organ biochemistry and histopathology of snowy egrets and black-crowned night-herons on Lahontan Reservoir, 2002-2006

Science.gov (United States)

Hoffman, David J.; Henny, Charles J.; Hill, Elwood F.; Grove, Robert A.; Kaiser, James L.; Stebbins, Katherine R.

2009-01-01

A 10-year study (1997-2006) was conducted to evaluate reproduction and health of aquatic birds in the Carson River Basin of northwestern Nevada (on the U.S. Environmental Protection Agency Natural Priorities List) due to high mercury (Hg) concentrations from past mining activities. This part of the study evaluated physiological associations with blood Hg in young snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax), and organ biochemistry and histopathological effects in snowy egrets on Lahontan Reservoir (LR) from the period 2002-2006. LR snowy egret geometric mean total Hg concentrations (μg/g ww) ranged from 1.5 to 4.8 for blood, 2.4 to 3.1 liver, 1.8 to 2.5 kidneys, 1.7 to 2.4 brain, and 20.5 to 36.4 feathers over these years. For night-herons, mean Hg for blood ranged from 1.6 to 7.4. Significant positive correlations were found between total Hg in blood and five plasma enzyme activities of snowy egrets suggesting hepatic stress. Histopathological findings revealed vacuolar changes in hepatocytes in LR snowy egrets as well as correlation of increased liver inflammation with increasing blood and tissue Hg. Hepatic oxidative effects were manifested by decreased hepatic total thiol concentration and glutathione reductase activity and elevated hepatic thiobarbituric acid-reactive substances (TBARS), a measure of lipid peroxidation. However, other hepatic changes indicated compensatory mechanisms in response to oxidative stress, including decreased oxidized glutathione (GSSG) concentration and decreased ratio of GSSG to reduced glutathione. In young black-crowned night-herons, fewer correlations were apparent. In both species, positive correlations between blood total Hg and plasma uric acid and inorganic phosphorus were suggestive of renal stress, which was supported by histopathological findings. Both oxidative effects and adaptive responses to oxidative stress were apparent in kidneys and brain. Vacuolar change and inflammation in

Human exposure to PCDDs and their precursors from heron and tern eggs in the Yangtze River Delta indicate PCP origin.

Science.gov (United States)

Zhou, Yihui; Yin, Ge; Asplund, Lillemor; Stewart, Kathryn; Rantakokko, Panu; Bignert, Anders; Ruokojärvi, Päivi; Kiviranta, Hannu; Qiu, Yanling; Ma, Zhijun; Bergman, Åke

2017-06-01

Polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) are highly toxic to humans and wildlife. In the present study, PCDD/Fs were analyzed in the eggs of whiskered terns (Chlidonias hybrida), and genetically identified eggs from black-crowned night herons (Nycticorax nycticorax) sampled from two lakes in the Yangtze River Delta area, China. The median toxic equivalent (TEQ) of PCDD/Fs were 280 (range: 95-1500) and 400 (range: 220-1100) pg TEQ g -1 lw (WHO, 1998 for birds) in the eggs of black-crowned night heron and whiskered tern, respectively. Compared to known sources, concentrations of PCDDs relative to the sum of PCDD/Fs in bird eggs, demonstrated high abundance of octachlorodibenzo-p-dioxin (OCDD), 1,2,3,4,6,7,8-heptaCDD and 1,2,3,6,7,8-hexaCDD indicating pentachlorophenol (PCP), and/or sodium pentachlorophenolate (Na-PCP) as significant sources of the PCDD/Fs. The presence of polychlorinated diphenyl ethers (PCDEs), hydroxylated and methoxylated polychlorinated diphenyl ethers (OH- and MeO-PCDEs, known impurities in PCP products), corroborates this hypothesis. Further, significant correlations were found between the predominant congener CDE-206, 3'-OH-CDE-207, 2'-MeO-CDE-206 and OCDD, indicating a common origin. Eggs from the two lakes are sometimes used for human consumption. The WHO health-based tolerable intake of PCDD/Fs is exceeded if eggs from the two lakes are consumed regularly on a weekly basis, particularly for children. The TEQs extensively exceed maximum levels for PCDD/Fs in hen eggs and egg products according to EU legislation (2.5 pg TEQ g -1 lw). The results suggest immediate action should be taken to manage the contamination, and further studies evaluating the impacts of egg consumption from wild birds in China. Likewise, studies on dioxins and other POPs in common eggs need to be initiated around China. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

The component helminth community in six sympatric species of Ardeidae.

Science.gov (United States)

Navarro, Pilar; Lluch, Javier; Font, Enrique

2005-08-01

We studied the helminth communities in 6 sympatric species of Ardeidae (Ixobrychus minutus (Linnaeus, 1766), Nycticorax nycticorax (Linnaeus, 1758), Bubulcus ibis (Linnaeus, 1758), Egretta garzetta (Linnaeus, 1766), Ardea cinerea (Linnaeus, 1758), and Ardea purpurea (Linnaeus, 1766)) from "La Albufera de Valencia," Spain. The survey revealed 13 species of helminth parasites: 5 digeneans, 2 cestodes, and 6 nematodes. The component helminth communities of the Ardeidae examined are depauperate and conform to the pattern typically found in isolationist communities, probably because of their high trophic dependence on a few prey species. Evenness was positively correlated with richness and abundance, but host body weight was not correlated with the number of helminth species or with the total number of helminths. Ardea cinerea is more heavily infected than E. garzetta by Apharyngostrigea cornu, and B. ibis is more heavily infected than both Ardea cinerea and E. garzetta by Desportesius spinulatus. Apharyngostrigea cornu was positively associated with Desmidocercella numidica and D. spinulatus in A. cinerea.

Unravelling feeding territoriality in the Little Blue Heron, Egretta caerulea, in Cananéia, Brazil

Directory of Open Access Journals (Sweden)

E Moralez-Silva

Full Text Available Habitat use by the Little Blue Heron (Egretta caerulea and discovery of feeding territoriality are discussed here. The results showed the existence of a territorial individual defending an area (2,564.46 ± 943.56 m² close to the mangrove, and non-territorial individuals (9.17 ± 2.54 in the rest of a demarcated area (mean area for the non-territorial: 893.25 ± 676.72. A weak positive correlation (r = 0.47, df = 46, p < 0.05 was found between the overlapping of territorial and non-territorial individuals (2.85 ± 3.07 m² and the mean overlapped area for territorial individuals (171.41 ± 131.40 m². Higher capture (1.52 ± 1.14 × 1.00 ± 1.37 catches/minutes and success rates (0.45 ± 0.31 × 0.21 ± 0.27 and lower energy expenditure rates (45.21 ± 14.96 × 51.22 ± 14.37 steps/minutes; and 3.65 ± 2.55 × 4.94 ± 3.28 stabs/minutes were observed for individuals foraging in areas close to the mangrove. The results suggest that the observed territorial behaviour is more related to a number of food parameters than to intruder pressure, and also that the observed territoriality might be related to defense of areas with higher prey availability.

Spatiotemporal patterns of coral disease prevalence on Heron Island, Great Barrier Reef, Australia

Science.gov (United States)

Haapkylä, J.; Melbourne-Thomas, J.; Flavell, M.; Willis, B. L.

2010-12-01

Despite increasing research effort on coral diseases, little is known about factors driving disease dynamics on the Great Barrier Reef (GBR). This is the first study to investigate the temporal patterns of coral disease prevalence and potential drivers of disease around Heron Island, in the southern Capricorn Bunker sector of the GBR. Surveys were conducted in two austral summers and three winters between November 2007 and August 2009 on six sites around the island. Six diseases were detected: brown band syndrome (BrB), growth anomalies (GA), ulcerative white spots (UWS), white syndrome (WS), skeletal eroding band disease (SEB) and black band disease (BBD). The lowest overall mean disease prevalence was 1.87 ± 0.75% (mean ± SE) in November 2007 and the highest 4.22 ± 1.72% in August 2008. There was evidence of seasonality for two diseases: BrB and UWS. This is the first study to report a higher prevalence of BrB in the winter. BrB had a prevalence of 3.29 ± 0.58% in August 2008 and 1.53 ± 0.28% in August 2009, while UWS was the most common syndrome in the summer with a prevalence of 1.12 ± 0.31% in November 2007 and 2.67 ± 0.52% prevalence in January 2008. The prevalence of GAs and SEB did not depend on the season, although the prevalence of GAs increased throughout the study period. WS had a slightly higher prevalence in the summer, but its overall prevalence was low (disease prevalence (12% of Acropora and 3.3% of Montipora species were diseased respectively). These results highlight the correlations between coral disease prevalence, seasonally varying environmental parameters and coral community composition. Given that diseases are likely to reduce the resilience of corals, seasonal patterns in disease prevalence deserve further research.

Digenean parasites of Ciconiiform birds from Argentina Digéneos parásitos de aves Ciconiiformes de Argentina

Directory of Open Access Journals (Sweden)

Fabiana B. Drago

2011-03-01

Full Text Available The helminthological survey of 13 specimens of 5 ciconiiform species revealed the presence of 10 species of intestinal digeneans: Sphincterodiplostomum musculosum Dubois, 1936 in Tigrisoma lineatum and Ardea alba; Tylodelphys elongata (Lutz, 1928 in T. lineatum; Apharyngostrigea ardearum (Lutz, 1928 and Dolichorchis lacombeensis Lunaschi and Drago, 2006 in Ardea cocoi and Ardea alba; Posthodiplostomum nanum Dubois, 1937 in A. alba and T. lineatum; Ascocotyle diminuta (Stunkard and Haviland, 1924 in A. alba; Petasiger sp.1 in A. cocoi and Paryphostomum segregatum Dietz, 1909, Strigea vaginata (Brandes, 1888 and Petasiger sp. 2 in Coragyps atratus. Syrigma sibilatrix was free of digeneans. The reports of A. ardearum, T. elongata, S. musculosum and D. lacombeensis represent new host records; the other reports are new geographical records. Moreover, the specimens described as Apharyngostrigea brasiliana Szidat, 1929 by Labriola and Suriano (1998 were analyzed and transferred to A. ardearum.El estudio parasitológico de 13 ejemplares pertenecientes a 5 especies de aves Ciconiiformes reveló la presencia de 10 especies de digéneos intestinales: Sphincterodiplostomum musculosum Dubois, 1936 en Tigrisoma lineatum y Ardea alba; Tylodelphys elongata (Lutz, 1928 en T. lineatum; Apharyngostrigea ardearum (Lutz, 1928 y Dolichorchis lacombeensis Lunaschi y Drago, 2006 en Ardea cocoi y A. alba; Posthodiplostomum nanum Dubois, 1937 en A. alba y T. lineatum; Ascocotyle diminuta (Stunkard y Haviland, 1924 en A. alba; Petasiger sp.1 en A. cocoi y Paryphostomum segregatum Dietz, 1909, Strigea vaginata (Brandes, 1888 y Petasiger sp. 2 en Coragyps atratus. Syrigma sibilatrix no se encontró parasitada por digéneos. El presente estudio aporta nuevos registros de hospedadores para A. ardearum, T. elongata, S. musculosum y D. lacombeensis y nuevos registros geográficos para las restantes especies. Además, los organismos descritos como Apharyngostrigea brasiliana

Breeding success of a colony of Boat-billed Herons Cochlearius cochlearius (Ciconiiformes: Ardeidae in pasturelands of Costa Rica

Directory of Open Access Journals (Sweden)

Jaime Gómez

2006-12-01

Full Text Available The breeding success of a double-brooding colony of Boat-billed Herons Cochlearius cochlearius was studied in pasturelands of Costa Rica. Mean clutch size in the first clutches (2.9 eggs/nest was higher than in second and repeat clutches (2.3 eggs/nest. Breeding success was similar in the first attempt and second attempts(20.7 % and 21.7 %, respectively. In both attempts earlier nests enjoyed a higher breeding success. Starvation of the youngest chicks within the nest and destruction of nests by bad weather conditions were the main factors related to nestling death. No effects of human activity on the reproduction of the breeding colony were observed. Rev. Biol. Trop. 54 (4: 1131-1134. Epub 2006 Dec. 15Estudiamos el éxito reproductivo de una colonia del ave Cochlearius cochlearius en una zona ganadera de Costa Rica. El promedio de huevos por nido fue mayor durante el periodo de primeras puestas (2.9 huevos/nido que durante el periodo de segundas puestas y reposiciones (2.3 huevos/nido. El éxito reproductor de los dos periodos fue similar (20.7 % y 21.7 %, respectivamente. En ambos tuvieron más éxito las parejas que comenzaron la puesta antes. Las principales causas de mortandad fueron inanición de los pollos más jóvenes del nido y la destrucción de los nidos debido a condiciones climáticas adversas. No notamos efectos adversos por la actividad humana

Depredación de aves acuáticas por la nutria neotropical (Lontra longicaudis annectens, en el río Yaqui, Sonora, México Aquatic bird predation by neotropical river otter (Lontra longicaudis annectens, at Rio Yaqui, Sonora, Mexico

Directory of Open Access Journals (Sweden)

Juan Pablo Gallo-Reynoso

2008-06-01

Full Text Available Se registra la depredación de aves acuáticas por la nutria neotropical (L. longicaudis annectens en el río Yaqui, Sonora. Se colectaron e identificaron 25 cráneos, porciones de esqueleto postcraneal y plumas de aves encontrados en los comederos de las nutrias; las especies identificadas fueron el cormorán neotropical (Phalacrocorax brasilianus con 16 individuos, el pato de collar (Anas platyrhynchos diazi, 4 individuos; la garza blanca (Ardea alba, 3 individuos; el huaco de corona amarilla (Nyctanassa violacea y el pelícano café (Pelecanus occidentalis, ambos con 1 individuo. En los peces se encontró la tilapia del género Oreochromis. Probablemente los hábitos alimenticios de esta especie responden a la estacionalidad y al consumo de presas más disponibles en el hábitat. Estos registros confirman que las nutrias de río son depredadores oportunistas cuya dieta tiene una amplio rango de uso de especies de los ambientes riparios, además dichos registros son una razón más para considerar la nutria neotropical como especie sombrilla para la conservación de ecosistemas completos, ya que su presencia es un indicador de alta disponibilidad energética y de alta biodiversidad.We report the predation of aquatic birds by neotropical river otters (L. longicaudis annectens at Río Yaqui, Sonora. As many as 25 skulls, post-cranial skeletons and feathers were found at river otter feeding sites. The neotropical cormorant (Phalacrocorax brasilianus was the most predated bird with 16 individuals, followed by Mexican mallard (Anas platyrhynchos diazi with 4 individuals, great egret (Ardea alba with 3 individuals, yellow-crowned night-heron (Nyctanassa violacea, and brown pelican (Pelecanus occidentalis, both with 1 individual. With respect to fish, the tilapia Oreochromis, was the only species found in scats. Neotropical river otter feeding habits were associated with food availability at different seasons of the year. These records show that

The relative abundance of dimethylsulfoniopropionate (DMSP) among other zwitterions in branching coral at Heron Island, southern Great Barrier Reef.

Science.gov (United States)

Swan, Hilton B; Deschaseaux, Elisabeth S M; Jones, Graham B; Eyre, Bradley D

2017-07-01

Dimethylsulfoniopropionate (DMSP) and eleven other target zwitterions were quantified in the branch tips of six Acropora species and Stylophora pistillata hard coral growing on the reef flat surrounding Heron Island in the southern Great Barrier Reef (GBR), Australia. Hydrophilic interaction liquid chromatography mass spectrometry (HILIC-MS) was used for sample analysis with isotope dilution MS applied to quantify DMSP. The concentration of DMSP was ten times greater in A. aspera than A. valida, with this difference being maintained throughout the spring, summer and winter seasons. In contrast, glycine betaine was present in significantly higher concentrations in these species during the summer than the winter. Exposure of branch tips of A. aspera to air and hypo-saline seawater for up to 1 h did not alter the concentrations of DMSP present in the coral when compared with control samples. DMSP was the most abundant target zwitterion in the six Acropora species examined, ranging from 44-78% of all target zwitterions in A. millepora and A. aspera, respectively. In contrast, DMSP only accounted for 7% in S. pistillata, with glycine betaine and stachydrine collectively accounting for 88% of all target zwitterions in this species. The abundance of DMSP in the six Acropora species examined points to Acropora coral being an important source for the biogeochemical cycling of sulfur throughout the GBR, since this reef-building branching coral dominates the coral cover of the GBR. Graphical Abstract HILIC-MS extracted ion chromatogram showing zwitterionic metabolites from the branching coral Acropora isopora.

Subchronic effects of methylmercury on plasma and organ biochemistries in great egret nestlings

Science.gov (United States)

Hoffman, D.J.; Spalding, M.G.; Frederick, P.C.

2005-01-01

In recent years, high concentrations of mercury have been found in wading birds in Florida, USA. Great egret (Ardea alba) chicks (2 weeks old) were dosed orally daily with the equivalent of 0, 0.5, or 5 ug/g Hg as methylmercury chloride in the diet for up to 12 weeks. Weakness of the legs or paralysis occurred in all high-dosed birds. Geometric mean blood Hg concentrations were 0.17, 10.3, and 78.5 ug/g (wet wt), respectively. Mercury concentrations for organs (ug/g wet wt), including brain (0.22, 3.4, and 35, respectively), liver (0.34, 15.1, 138, respectively), and kidney (0.28, 8.1, and 120, respectively), increased in a dose-dependent manner. Total glutathione (GSH) peroxidase activity was significantly lower in the plasma, brain, liver, and kidney of the high-dosed group. Plasma aspartate aminotransferase activity increased with mercury treatment, whereas lactate dehydrogenase activity decreased. Four other plasma chemistries were decreased significantly in the high-dosed group and included uric acid, total protein, albumin, and inorganic phosphorus. Lipid peroxidation increased in liver (low and high dose) and brain (high dose). Tissue changes in concentrations of reduced thiols included decreased total thiols and protein-bound thiols in liver, decreased protein-bound thiols in kidney, and increased GSH in kidney and brain. Activities of GSH S-transferase and oxidized glutathione reductase increased in liver. In kidney, GSH S-transferase and glucose-6-phosphate dehydrogenase activities increased with mercury dose. These findings, including apparent compensatory changes, are compared to other Hg studies where oxidative stress was reported in egrets, herons, and diving ducks in the field and mallards in the laboratory.

Effects of a railway line project on a colony of grey herons; Auswirkungen eines linienhaften Vorhabens (Eisenbahnstrecke) auf eine Graureiherkolonie (Bayern)

Energy Technology Data Exchange (ETDEWEB)

Krause, P. [Inst. fuer Oekologie, Umweltvertraeglichkeit, Landschaftsplanung und Landesentwicklung, Westheim (Germany). igi Niedermeyer Inst.

1997-12-01

As part of the efforts made to collect ecological evidence in connection with the Nantenbach Bend project to link the Wuerzburg-Aschaffenburg-Frankfurt line with the new Wuerzburg-Hanover line the colony was observed at regular intervals after completion of the construction work with the intention of quantifying any effects on the population of grey herons. The counts that were carried out indicate that the number of breeding pairs halved in the period from 1990 to 1995 (49 pairs in 1995). On completion of the construction work the pairs once again increased in number, to 56 in 1996 and 52 in 1997. The conclusion that can be drawn from this is that the effects of construction work on the environment in the immediate vicinity were the main cause of negative developments in a bird population and that such measures have more extensive effects than has been assumed in the past. (orig.) [Deutsch] Im Rahmen der oekologischen Beweissicherung zum Vorhaben der Nantenbacher Kurve, die die Anbindung der Eisenbahnstrecke Wuerzburg-Aschaffenburg-Frankfurt am Main an die Neubaustrecke Wuerzburg-Hannover ermoeglicht, wurde die Graureiherkolonie in regelmaessigen Zeitabstaenden nach Fertigstellung der Baumassnahme untersucht. Die Bestandsaufnahmen sollen dazu dienen moegliche Auswirkungen auf die Graureiherpopulation zu quantifizieren. Aufgrund der Bestandszaehlungen wurde vom Jahr 1990 bis 1995 eine Halbierung der Brutpaare (49 Bp. in 1995) in der Kolonie festgestellt. Nach Beendigung der Bautaetigkeiten nahmen die Brutpaare von 56 Bp. in 1996 und 52 Bp. in 1997 wieder zu. Dies laesst darauf schliessen, dass baubedingte Auswirkungen im unmittelbaren Umfeld die hauptsaechliche Ursache fuer die negative Entwicklung eines Bestandes darstellen und einen groesseren Wirkungsgrad haben, als dieser bisher immer angenommen wurde. (orig.)

Prokaryotic and eukaryotic features observed on the secondary structures of Giardia SSU rRNAs and its phylogenetic implications.

Science.gov (United States)

Hwang, Ui Wook

2007-04-01

Phylogenetic position of a diplomonad protist Giardia, a principle cause of diarrhea, among eukaryotes has been vigorously debated so far. Through the comparisons of primary and secondary structures of SSU rRNAs of G. intestinalis, G. microti, G. ardeae, and G. muris, I found two major indel regions (a 6-nt indel and a 22-26-nt indel), which correspond to the helix 10 of the V2 region and helices E23-8 to E23-9 of the V4 region, respectively. As generally shown in eukaryotes, G. intestinalis and G. microti have commonly a relatively longer helix 10 (a 7-bp stem and a 4-nt loop), and also the eukaryote-specific helices E23-6 to E23-9. On the other hand, G. muris and G. ardeae have a shorter helix 10: a 2-bp stem and a 6-nt loop in G. ardeae and a 3-bp stem and a 6-nt loop in G. muris. In the V4, they have a single long helix (like the P23-1 helix in prokaryotes) instead of the helices E23-6 to E23-9. Among the four Giardia species, co-appearance of prokaryote- and eukaryote-typical features might be significant evidence to suggest that Giardia (Archezoa) is a living fossil showing an "intermediate stage" during the evolution from prokaryotes to eukaryotes.

Avian species differences in the intestinal absorption of xenobiotics (PCB, dieldrin, Hg2+)

Science.gov (United States)

Serafin, J.A.

1984-01-01

1. Intestinal absorption of a polychlorinated biphenyl, dieldrin, and mercury (from HgCl2) was measured in adult Northern bobwhites, Eastern screech owls, American kestrels, black-crowned night-herons and mallards in vivo by an in situ luminal perfusion technique.2. Bobwhites, screech owls and kestrels absorbed much more of each xenobiotic than black-crowned night-herons and mallards.3. Mallards absorbed less dieldrin and mercury than black-crowned night-herons.4. Mercury absorption by kestrels was more than twice that in screech owls and eight times that observed in mallards.5. Pronounced differences in xenobiotic absorption rates between bobwhites, screech owls and kestrels on the one hand, and black-crowned night-herons and mallards on the other, raise the possibility that absorptive ability may be associated with the phylogenetic classification of birds.

Trends of some wintering waterbirds in Lazio (1993-2006

Directory of Open Access Journals (Sweden)

Massimo Brunelli

2012-09-01

Full Text Available Since the 90s, censuses of wintering waterfowl have been carried out in the main wetlands of Lazio. We analysed the trends of 31 species in the 1993-2006 period (base year 1993 by means of TRIM (Trends and Indices Monitoring data software (Model 3. Among the species regularly recorded in the region, Ardea alba, Ardea cinerea, Bubulcus ibis and Anser anser showed a strong increase; Podiceps cristatus, Nycticorax nycticorax, Egretta garzetta, Phoenicopterus ruber, Anas penelope, Anas strepera, Anas crecca, Anas platyrhynchos, Anas clypeata, Netta rufina, Aythya ferina, Aythya nyroca, Circus aeruginosus, Fulica atra, Pluvialis apricaria and Vanellus vanellus showed a moderate increase; Gavia arctica, Tachybaptus ruficollis, Podiceps nigricollis, Phalacrocorax carbo, Aythya fuligula and Numenius arquata resulted “stable”; Botaurus stellaris, Tadorna tadorna, Anas acuta, Pluvialis squatarola and Calidris alpina showed an uncertain trend. The trends for most species are similar to those recorded at a national level.

Heron Island, Australia

Science.gov (United States)

2002-01-01

The skies over Northern India are filled with a thick soup of aerosol particles all along the southern edge of the Himalayan Mountains, and streaming southward over Bangladesh and the Bay of Bengal. Notice that the air over the Tibetan Plateau to the north of the Himalayas is very clear, whereas the view of the land surface south of the mountains is obstructed by the brownish haze. Most of this air pollution comes from human activities. The aerosol over this region is notoriously rich in sulfates, nitrates, organic and black carbon, and fly ash. These particles not only represent a health hazard to those people living in the region, but scientists have also recently found that they can have a significant impact on the region's hydrological cycle and climate (click to read the relevant NASA press release). This true-color image was acquired on December 4, 2001, by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra satellite. It is interesting to compare the image above with this earlier MODIS image over the region, acquired on October 23, 2001. Notice the difference in the clarity of the air over the region in the earlier image. Under the thick plume of aerosol, the Brahmaputra (upper right) and Ganges Rivers are still visible. The many mouths of the Ganges have turned the northern waters of the Bay of Bengal a murky brown as they empty their sediment-laden waters into the bay. Toward the upper lefthand corner of the image, there appears to be a fresh swath of snow on the ground just south of the Himalayas. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC

A multi-omics based ecological analysis of coastal marine sediments from Gladstone, in Australia's Central Queensland, and Heron Island, a nearby fringing platform reef.

Science.gov (United States)

Beale, D J; Crosswell, J; Karpe, A V; Ahmed, W; Williams, M; Morrison, P D; Metcalfe, S; Staley, C; Sadowsky, M J; Palombo, E A; Steven, A D L

2017-12-31

The impact of anthropogenic factors arising from point and non-point pollution sources at a multi commodity marine port and its surrounding ecosystems were studied using sediment samples collected from a number of onshore (Gladstone Harbour and Facing Island) and offshore (Heron Island and Fitzroy Reefs) sites in Australia's Central Queensland. Sediment samples were analyzed for trace metals, organic carbon, polycyclic aromatic hydrocarbons (PAH), emerging chemicals of concern (ECC) and sterols. Similarly, the biological and biochemical interaction between the reef and its environment was analyzed by the multi-omic tools of next-generation sequencing characterization of the bacterial community and microbial community metabolic profiling. Overall, the trace elements were observed at the lower end of the Australian environmental guideline values at the offshore sites, while higher values were observed for the onshore locations Nickel and copper were observed above the high trigger value threshold at the onshore sites. The levels of PAH were below limits of detection across all sites. However, some of the ECC and sterols were observed at higher concentrations at both onshore and offshore locations, notably, the cholesterol family sterols and 17α-ethynylestradiol. Multi-omic analyses also indicated possible thermal and photo irradiation stressors on the bacterial communities at all the tested sites. The observed populations of γ-proteobacteria were found in combination with an increased pool of fatty acids that indicate fatty acid synthesis and utilisation of the intermediates of the shikimate pathways. This study demonstrates the value of applying a multi-omics approach for ecological assessments, in which a more detailed assessment of physical and chemical contaminants and their impact on the community bacterial biome is obtained. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.

Movements of immature European Honey Buzzards Pernis apivorus in tropical Africa

NARCIS (Netherlands)

Strandberg, Roine; Hake, Mikael; Klaassen, Raymond H. G.; Alerstam, Thomas

2012-01-01

Strandberg R., Hake M., Klaassen R.H.G. & Alerstam T. 2012. Movements of immature European Honey Buzzards Pernis apivorus in tropical Africa. Ardea 100: 157-162. Immature European Honey Buzzards Pernis apivorus are believed to remain in tropical Africa during the first years of their lives. We

Keratin subsidies promote feather decomposition via an increase in keratin-consuming arthropods and microorganisms in bird breeding colonies.

Science.gov (United States)

Sugiura, Shinji; Masuya, Hayato

2015-06-01

Resource subsidies are well known to increase population densities of consumers. The decomposition process of these subsidised resources can be influenced by increasing consumer abundance. However, few studies have assessed whether resource subsidies can promote resource decomposition via a population increase in consumers. Here, we examined the effects of keratin subsidies on feather decomposition in egret and heron breeding colonies. Egrets and herons (Ardeidae) frequently breed in inland forests and provide large amounts of keratin materials to the forest floor in the form of feathers of chicks (that die). We compared the decrease in the weights of egret and heron feathers (experimentally placed on the forest floor) over a 12-month period among egret/heron breeding colonies (five sites) and areas outside of colonies (five sites) in central Japan. Of the feathers placed experimentally on forest floors, 92-97 % and 99-100 % in colonies and 47-50 % and 71-90 % in non-colony areas were decomposed after 4 and 12 months, respectively. Then, decomposition rates of feathers were faster in colonies than in areas outside of colonies, suggesting that keratin subsidies can promote feather decomposition in colonies. Field observations and laboratory experiments indicated that keratin-feeding arthropods and keratinophilic fungi played important roles in feather decomposition. Therefore, scavenging arthropods and keratinophilic fungi, which dramatically increased in egret and heron breeding colonies, could accelerate the decomposition of feathers supplied to the forest floor of colonies.

Nest survival is influenced by parental behaviour and heterospecifics in a mixed-species colony

Science.gov (United States)

Brussee, Brianne E.; Coates, Peter S.; Hothem, Roger L.; Howe, Kristy; Casazza, Michael L.; Eadie, John M.

2016-01-01

Studies of avian nest success often focus on examining influences of variation in environmental and seasonal factors. However, in-depth evaluations can also incorporate variation in individual incubation behaviour to further advance our understanding of avian reproductive ecology. We examined these relationships in colonially nesting Black-crowned Night-Herons Nycticorax nycticorax using intensive video-monitoring methods to quantify incubation behaviours. We modelled nest survival as a function of both extrinsic factors and incubation behaviours over a 3-year period (2010–12) on Alcatraz Island, USA. Model-averaged parameter estimates indicated that nest survival increased as a function of greater incubation constancy (% of time spent incubating eggs within a 24-h period), and average daily precipitation throughout the nesting stage. Common Ravens Corvus corax are the only known nest predator of Night-Herons on Alcatraz Island, as on many other coastal Pacific islands. We also investigated the effects of heterospecific nesting of California Gulls Larus californicus and Western Gulls Larus occidentalis in a mixed-species colony with Night-Herons, based on nesting proximity data collected over a 2-year period (2011–12). This second analysis indicated that, in addition to incubation behaviours, nesting heterospecifics are an important factor for explaining variation in Night-Heron nest survival. However, contrary to our original expectation, we found that Night-Herons experienced increased nest survival with increasing distance from gull colony boundaries. These results may apply to other areas with multiple colonial nesting species and similar predator communities and climatic patterns.

Seropositivity and risk factors associated with Toxoplasma gondii infection in wild birds from Spain.

Directory of Open Access Journals (Sweden)

Oscar Cabezón

Full Text Available Toxoplasma gondii is a zoonotic intracellular protozoan parasite of worldwide distribution that infects many species of warm-blooded animals, including birds. To date, there is scant information about the seropositivity of T. gondii and the risk factors associated with T. gondii infection in wild bird populations. In the present study, T. gondii infection was evaluated on sera obtained from 1079 wild birds belonging to 56 species (including Falconiformes (n=610, Strigiformes (n=260, Ciconiiformes (n=156, Gruiformes (n=21, and other orders (n=32, from different areas of Spain. Antibodies to T. gondii (modified agglutination test, MAT titer ≥1:25 were found in 282 (26.1%, IC(95%:23.5-28.7 of the 1079 birds. This study constitute the first extensive survey in wild birds species in Spain and reports for the first time T. gondii antibodies in the griffon vulture (Gyps fulvus, short-toed snake-eagle (Circaetus gallicus, Bonelli's eagle (Aquila fasciata, golden eagle (Aquila chrysaetos, bearded vulture (Gypaetus barbatus, osprey (Pandion haliaetus, Montagu's harrier (Circus pygargus, Western marsh-harrier (Circus aeruginosus, peregrine falcon (Falco peregrinus, long-eared owl (Asio otus, common scops owl (Otus scops, Eurasian spoonbill (Platalea leucorodia, white stork (Ciconia ciconia, grey heron (Ardea cinerea, common moorhen (Gallinula chloropus; in the International Union for Conservation of Nature (IUCN "vulnerable" Spanish imperial eagle (Aquila adalberti, lesser kestrel (Falco naumanni and great bustard (Otis tarda; and in the IUCN "near threatened" red kite (Milvus milvus. The highest seropositivity by species was observed in the Eurasian eagle owl (Bubo bubo (68.1%, 98 of 144. The main risk factors associated with T. gondii seropositivity in wild birds were age and diet, with the highest exposure in older animals and in carnivorous wild birds. The results showed that T. gondii infection is widespread and can be at a high level in many wild

Persistent organochlorine pollutants in eggs of colonial waterbirds from Galveston Bay and East Texas, USA

Science.gov (United States)

Frank, D.S.; Mora, M.A.; Sericano, J.L.; Blankenship, Alan L.; Kannan, K.; Giesy, J.P.

2001-01-01

Eggs of neotropic cormorants (Phalacrocorax brasilianus), black-crowned night herons (Nycticorax nycticorax), and great egrets (Ardea alba) nesting on several locations in Galveston Bay (TX, USA) and at two control sites outside the bay were collected during April–May 1996 and analyzed for chlorinated pesticides, PCBs, polychlorinated dibenzo-p-dioxins, and polychlor-inated dibenzofurans. Additionally, concentrations of 2,3,7,8-tetrachlorodibenzo-p-dioxin equivalents (TCDD-EQs) were determined by use of relative potency factors (TEQs) or the H4IIE-luc bioassay TCDD-EQs. Concentrations of 1,1,-dichloro-2,2-bis(p-chlo-rophenyl)ethylene (DDE) were greater in eggs of neotropic cormorants from Alexander Island (mean = 1,040 ng/g wet wt) in the Houston Ship Channel (Houston, TX, USA) and in those from Telfair Island (mean = 1,460 ng/g wet wt), a reference location outside the bay, than in most locations inside the bay (mean range = 119–453 ng/g wet wt). Mean PCB concentrations were greater in eggs of neotropic cormorants from Alexander Island (mean = 5,720 ng/g wet wt) than in eggs of cormorants from areas farther away from the ship channel, including two reference sites outside the bay (mean range = 404–3,140 ng/g wet wt). The TCDD was the main dioxin congener detected in eggs from all locations within Galveston Bay. Instrumental TEQs in eggs ranged from 67 pg/g wet weight at control sites to 452 pg/g wet weight at Alexander Island. Concentrations of TCDD-EQs determined in the H4IIE assay were correlated with instrumental TEQs and were greater in eggs of cormorants from islands within the bay, although these were farther away from the ship channel. Overall, concentrations of DDE, PCBs, TCDD, and TCDD-EQs were less than the threshold levels known to affect reproduction. However, some eggs contained concentrations of total PCBs or DDE greater than what would elicit adverse effects on birds. No identifiable deformities or abnormalities were detected in embryos

Temporal trends (1989–2011) in levels of mercury and other heavy metals in feathers of fledgling great egrets nesting in Barnegat Bay, NJ

International Nuclear Information System (INIS)

Burger, Joanna

2013-01-01

There is an abundance of data for levels of metals from a range of species, but relatively few long-term time series from the same location. In this paper I examine the levels of arsenic, cadmium, chromium, lead, manganese, mercury and selenium in feathers from fledgling great egrets (Ardea alba) collected at nesting colonies in Barnegat Bay, New Jersey from 1989 to 2011. The primary objectives were to test the null hypotheses that (1) There were no temporal differences in metal levels in feathers of fledgling great egrets, and (2) Great egrets nesting in different areas of Barnegat Bay (New Jersey) did not differ in metal levels. There were significant yearly variations in levels of all heavy metals in feathers of fledgling great egret, but levels decreased significantly from 1989 to 2011 only for lead (1470 ppb to 54.3 ppb), cadmium (277 ppb to 30.5 ppb), and manganese (only since 1996; 2669 ppb to 329 ppb)). Although mercury levels decreased from 2003–2008 (6430 ppb to 1042 ppb), there was no pattern before 2003, and levels increased after 2008 to 2610 ppb in 2011. Lead, cadmium, chromium, manganese and mercury were higher in feathers from great egrets nesting in the northern part of the bay, and selenium was highest in feathers from mid-bay. The lack of a temporal decline in mercury levels in feathers of great egrets is cause for concern, since the high levels in feathers from some years (means as high as 6430 ppb) are in the range associated with adverse effects (5000 ppb for feathers). -- Highlights: ► Metals were monitored in feathers of great egrets from Barnegat Bay, New Jersey. ► Levels of cadmium and lead decreased significantly from 1989–2011. ► Mercury levels in feathers from great egrets did not decline from 1989–2011. ► Metal levels were generally higher in great egrets and black-crowned night heron feathers than in snowy egrets

Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

NARCIS (Netherlands)

Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

2009-01-01

We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

KSC-04PD-0894

Science.gov (United States)

2004-01-01

KENNEDY SPACE CENTER, FLA. White pelicans swim in a lake north of Kennedy Space Center. In the distance, at right, is a great blue heron. White pelicans winter from Florida and southern California south to Panama. Great blue herons range across the breadth of the United States, as well as north to Alaska and Canada and south to Mexico and the West Indies. The Center shares a boundary north, south and west with the 92,000-acre Merritt Island National Wildlife Refuge, which is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.

Keratin decomposition by trogid beetles: evidence from a feeding experiment and stable isotope analysis

Science.gov (United States)

Sugiura, Shinji; Ikeda, Hiroshi

2014-03-01

The decomposition of vertebrate carcasses is an important ecosystem function. Soft tissues of dead vertebrates are rapidly decomposed by diverse animals. However, decomposition of hard tissues such as hairs and feathers is much slower because only a few animals can digest keratin, a protein that is concentrated in hairs and feathers. Although beetles of the family Trogidae are considered keratin feeders, their ecological function has rarely been explored. Here, we investigated the keratin-decomposition function of trogid beetles in heron-breeding colonies where keratin was frequently supplied as feathers. Three trogid species were collected from the colonies and observed feeding on heron feathers under laboratory conditions. We also measured the nitrogen (δ15N) and carbon (δ13C) stable isotope ratios of two trogid species that were maintained on a constant diet (feathers from one heron individual) during 70 days under laboratory conditions. We compared the isotopic signatures of the trogids with the feathers to investigate isotopic shifts from the feathers to the consumers for δ15N and δ13C. We used mixing models (MixSIR and SIAR) to estimate the main diets of individual field-collected trogid beetles. The analysis indicated that heron feathers were more important as food for trogid beetles than were soft tissues under field conditions. Together, the feeding experiment and stable isotope analysis provided strong evidence of keratin decomposition by trogid beetles.

Spatial and temporal trends of contaminants in eggs of wading birds from San Francisco Bay, California

Science.gov (United States)

Hothem, R.L.; Roster, D.L.; King, K.A.; Keldsen, T.J.; Marois, Katherine C.; Wainwright, S.E.

1995-01-01

Between 1989 and 1991, reproduction by black-crowned night-herons (Nycticorax nycticorax) and snowy egrets (Egretta thula) was studied at sites in San Francisco Bay. Eggs were collected from these and other bay sites and from South Wilbur Flood Area, a reference site in California's San Joaquin Valley. Eggs were analyzed for inorganic trace elements, organochlorine pesticides, and polychlorinated biphenyls (PCBs). Results were compared among sites and years and with results of previous studies. There was some evidence of impaired reproduction, but concentrations of contaminants were generally lower than threshold levels for such effects. Egg hatchability was generally good, with predation being the factor that most limited reproductive success. Mean PCB concentrations were generally higher in eggs from the south end of San Francisco Bay than from the north, but the only temporal change, an increase, was observed at Alcatraz Island. There were spatial differences for p,p'-DDE in night-heron eggs in 1990, but the highest mean concentration of DDE was in night-heron eggs from South Wilbur in 1991. Temporal declines in maximum concentrations of DDE in eggs were observed in the bay, but means did not change significantly over time, At Bair Island in the southern end of the bay, mean concentrations of mercury decreased while selenium increased in night-heron eggs over time, but there were no clear bay-wide spatial or temporal trends for either element.

Absorption and biotransformation of polybrominated diphenyl ethers DE-71 and DE-79 in chicken (Gallus gallus), mallard (Anas platyrhynchos), American kestrel (Falco sparverius) and black-crowned night-heron (Nycticorax nycticorax) eggs

Science.gov (United States)

McKernan, Moira A.; Rattner, Barnett A.; Hatfield, Jeff S.; Hale, Robert C.; Ottinger, Mary Ann

2010-01-01

We recently reported that air cell administration of penta-brominated diphenyl ether (penta-BDE; DE-71) evokes biochemical and immunologic effects in chicken (Gallus gallus) embryos at very low doses, and impairs pipping (i.e., stage immediately prior to hatching) and hatching success at 1.8 ug g-1 egg (actual dose absorbed) in American kestrels (Falco sparverius). I n the present study, absorption of polybrominated diphenyl ether (PBDE) congeners was measured following air cell administration of a penta-BDE mixture (11.1 ug DE-71 g-1 egg) or an octa-brominated diphenyl ether mixture (octa-BDE; DE-79; 15.4 ug DE-79 g-1 egg). Uptake of PBDE congeners was measured at 24 h post-injection, midway through incubation, and at pipping in chicken, mallard (Anas platyrhynchos), and American kestrel egg contents, and at the end of incubation in black-crowned night-heron (Nycticorax nycticorax) egg contents. Absorption of penta-BDE and octa-BDE from the air cell into egg contents occurred throughout incubation; at pipping, up to 29.6% of penta-BDE was absorbed, but only 1.40-6.48% of octa-BDE was absorbed. Higher brominated congeners appeared to be absorbed more slowly than lower brominated congeners, and uptake rate was inversely proportional to the log Kow of predominant BDE congeners. Six congeners or co-eluting pairs of congeners were detected in penta-BDE-treated eggs that were not found in the dosing solution suggesting debromination in the developing embryo, extraembryonic membranes, and possibly even in the air cell membrane. This study demonstrates the importance of determining the fraction of xenobiotic absorbed into the egg following air cell administration for estimation of the lowest-observed-effect level.

Results of the January 2017 waterbird census in Slovenia

Directory of Open Access Journals (Sweden)

Božič Luka

2017-12-01

Full Text Available In 2017, the International Waterbird Census (IWC was carried out in Slovenia on January 14 and 15. Waterbirds were counted on all larger rivers, along the entire Slovenian Coastland and on most of the major standing waters in the country. During the census, in which 235 observers took part, 413 sections of the rivers and coastal sea with a total length of 1,427 km and 200 other localities (164 standing waters and 36 streams were surveyed. The census was characterized by harsh winter conditions and high proportion of frozen water bodies. Altogether, 51,790 waterbirds of 61 species were counted. Thus, the number of waterbirds and the number of species recorded were close to the 21-year average. The highest numbers of waterbirds were counted in the Drava count area, i.e. 20,064 individuals (38.7% of all waterbirds in Slovenia. By far the most numerous species was Mallard Anas platyrhynchos (46.1% of all waterbirds, followed by Coot Fulica atra (6.8% of all waterbirds, Cormorant Phalacrocorax carbo (5.9% of all waterbirds, Black-headed Gull Chroicocephalus ridibundus (5.7% of all waterbirds and Mute Swan Cygnus olor (3.9% of all waterbirds. The number of 1,000 counted individuals was also surpassed by Yellow-legged Gull Larus michahellis, Teal An. crecca, Tufted Duck Aythya fuligula, White-fronted Goose Anser albifrons, Pygmy Cormorant P. pygmeus and Grey Heron Ardea cinerea. Among the rarer recorded species, the Red-breasted Goose Branta ruficollis (registered for the first time during the January Waterbird Censuses and only for the third time ever in Slovenia and Barnacle Goose Branta leucopsis (the first probable A category individual for IWC and Slovenia deserve special mention. Numbers of the following species were the highest so far recorded during the IWC: Mandarin Duck Aix galericulata (together with 2006 and 2012, Pintail An. acuta, Ferruginous Duck Ay. nyroca, Long-tailed Duck Clangula hyemalis (together with 2003, Goosander Mergus

Changes in the abundance and composition of zooplankton from the ports of Mumbai, India

Digital Repository Service at National Institute of Oceanography (India)

Gaonkar, C.; Venkat, K.; Anil, A.C.

in each of the earlier sampling occasions. The reports of 1940’s and 1960’s used ordinary surface tow net made of organdi cloth (Bal and Pradhan, 1952; Pillai, 1968). Data from the 1970’s indicates the use of Heron-Tranter (HT) net having a mouth... area of 0.25 m 2 with a TSK flow meter and a mesh size of 200 µm (Gajbhiye and Desai, 1981). In 1980’s, though the Heron-Tranter (HT) net was used but with a mesh size of 300 µm (Gajbhiye et al., 1984 a and b). In the present investigation we...

Selenium and metal concentrations in waterbird eggs and chicks at Agassiz National Wildlife Refuge, Minnesota

Science.gov (United States)

Custer, T.W.; Custer, Christine M.; Eichhorst, B.A.; Warburton, D.

2007-01-01

Exceptionally high cadmium (Cd) and chromium (Cr) concentrations were reported in eggs, feathers, or livers of selected waterbird species nesting at Agassiz National Wildlife Refuge (Agassiz) in 1994. Ten- to 15-day-old Franklin's gull (Larus pipixcan), black-crowned night-heron (Nycticorax nycticorax), and eared grebe (Podiceps nigricollis) chicks were collected in 1998, 1999, and 2001 at Agassiz and analyzed for selenium (Se) and metals including Cd and Cr. Freshly laid eggs were collected in 2001 from Franklin's gull, black-crowned night-heron, eared grebe, and pied-billed grebe (Podilymbus podiceps) nests at Agassiz. Based on a multivariate analysis, the pattern of Se and metal concentrations differed among species for eggs, chick feathers, and chick livers. Low Cd and Cr concentrations were measured in eggs, chick livers, and chick feathers of all four species. Mercury concentrations in black-crowned night-heron and eared grebe eggs collected from Agassiz in 2001 were lower than concentrations reported in 1994. Se and metal concentrations, including Cd and Cr, in waterbird eggs and chicks collected at Agassiz in 1998, 1999, and 2001 were not at toxic levels. ?? 2007 Springer Science+Business Media, LLC.

Radionuclide concentrations in fish collected from Jemez, Nambe, and San Ildefonso Tribal Lakes

International Nuclear Information System (INIS)

Fresquez, P.R.; Armstrong, D.R.; Salazar, J.G.

1995-02-01

Radionuclide concentrations ( 90 Sr, 137 Cs, 238 Pu, 239 Pu,and total uranium) were determined in fish collected from Jemez, Nambe, and San Ildefonso tribal lakes. With the exception of 137 Cs, all other radionuclides were not significantly different in (stocked) rainbow trout collected from Jemez and Nambe as compared with game fish collected from Abiquiu, Heron, and El Vado Reservoirs. Although 137 Cs levels in trout from Jemez (3.2 x 10 -2 pCi per dry gram) and Nambe (7.5 x 10 -2 pCi per dry gram) were significantly higher than 137 Cs concentrations in fish from Abiquiu, Heron, and El Vado, they were still well below the regional statistical (worldwide fallout) reference level (i.e., -2 pCi per dry gram). Game and nongame fish collected from San Ildefonso contained higher and significantly higher concentrations of uranium, respectively, as compared with fish collected from Abiquiu, Heron, and El Vado. The higher uranium concentrations in fish from San Ildefonso as compared with fish from Abiquiu, Heron, and El Vado were attributed to the higher natural soil uranium contents in the area as compared with the geology of the area upstream of San Ildefonso. The effective (radiation) dose equivalent (EDE) from consuming 46 lb of game fish from Jemez, Nambe, and San Ildefonso lakes, after natural background has been subtracted, was 0.013 (±0.002), 0.019 (±0.012), and 0.017 (±0.028) mrem/yr, respectively. Similarly, the EDE from consuming nongame fish from San Ildefonso was 0.0092 (±0.0084) mrem/yr. The highest calculated dose, based on the mean + 2 standard deviation (95% confidence level), was 0.073 mrem/yr; this was <0.08% of the International Commission on Radiological Protection permissible dose limit for protecting members of the public

Molecular characterisation of an avihepadnavirus isolated from Psittacula krameri (ring-necked parrot).

Science.gov (United States)

Piasecki, Tomasz; Kurenbach, Brigitta; Chrząstek, Klaudia; Bednarek, Karolina; Kraberger, Simona; Martin, Darren P; Varsani, Arvind

2012-03-01

Avihepadnaviruses have been documented previously in ducks, herons, geese, storks and cranes. Here, we describe the full genome of a new avihepadnavirus isolated from Psittacula krameri (ring-necked parrot) in Poland. The parrot hepatitis B virus (PHBV) genome (3042 bp) shares <76% sequence identity with other avihepadnavirus isolates and is phylogenetically most closely related to heron and stork hepatitis B viruses isolates. PHBV has a genome organization similar to that of other hepadnaviruses and contains ORFs for a preC/C, preS/S and polyprotein. Additionally, we identified an X-like ORF in the genome of PHBV. The full-genome data will be useful in developing screening tools for avihepadnaviruses in parrots.

Protein (Cyanobacteria): 553736347 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available WP_023070590.1 NZ_AWNH01000001 1117:18358 ... 1150:46430 1301283:66978 ... 47251:4271 1385935:793 ... dna alkyla...tion repair enzyme Leptolyngbya sp. Heron Island J MTADQISKTLRDLADPAIAEHSQRFFKTGKGE

75 FR 3897 - Mid-Atlantic Fishery Management Council; Public Meetings

Science.gov (United States)

2010-01-25

... the Hyatt Regency Chesapeake Bay Hotel, 100 Heron Blvd, Cambridge, MD 21613; telephone: (410) 901... Council will hear the Scientific and Statistical Committee (SSC) Report. 1 p.m. until 2 p.m. -- The...

Effects of contaminants on reproductive success of aquatic birds nesting at Edwards Air Force Base, California

Science.gov (United States)

Hothem, R.L.; Crayon, J.J.; Law, M.A.

2006-01-01

Contamination by organochlorine pesticides (OCs), polychlorinated biphenyls, metals, and trace elements at Edwards Air Force Base (EAFB), located in the Mojave Desert, could adversely affect nesting aquatic birds, especially at the sewage lagoons that comprise Piute Ponds. Estimates of avian reproduction, in conjunction with analyses of eggs and avian foods for contaminant residues, may indicate the potential for negative effects on avian populations. From 1996 to 1999, we conducted studies at the Piute Ponds area of EAFB to evaluate the impacts of contaminants on nesting birds. Avian reproduction was evaluated in 1999. Eggs were collected for chemical analyses in 1996 and 1999, and African clawed frogs (Xenopus laevis), a likely food source, were collected for chemical analyses in 1998. Avian species occupying the higher trophic levels-black-crowned night-heron (Nycticorax nycticorax), white-faced ibis (Plegadis chihi), and American avocet (Recurvirostra americana)-generally bioaccumulated higher concentrations of contaminants in their eggs. Reproductive success and egg hatchability of night-herons and white-faced ibises in the Piute Ponds were similar to results observed at other western colonies. Deformities were observed in only one embryo in this study, but concentrations of contaminants evaluated in this ibis embryo were considered insufficient to have caused the deformities. Because clawed frogs, a primary prey item for night-herons at Piute Ponds, had no detectable levels of any OCs, it is likely that OCs found in night-heron eggs were acquired from the wintering grounds rather than from EAFB. The presence of isomers of dichlorodiphenyltrichloroethane (DDT) in ibis eggs indicated recent exposure, but invertebrates used for food by ibises were not sampled at Piute Ponds, and conclusions about the source of OCs in ibis eggs could not be made. Concentrations of contaminants in random and failed eggs of individual species were not different, and we concluded

Classroom

Indian Academy of Sciences (India)

IAS Admin

experiences and viewpoints on matters related to teaching and learning science. Pythagorean ... Figure 1. In this article, we give an alternative proof of. Pythagorean theorem from Heron's formula us- ing elementary school-level geometry.

Sensitivity of Coastal Environments and Wildlife to Spilled Oil: Puget Sound and Strait of Juan de Fuca, Washington: NESTS (Nest Points)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for bald eagle, great blue heron, and seabird nesting sites in Puget Sound and Strait of Juan de Fuca,...

78 FR 14301 - Formations of, Acquisitions by, and Mergers of Bank Holding Companies

Science.gov (United States)

2013-03-05

... ownership of, control of, or the power to vote shares of a bank or bank holding company and all of the banks... Risk Management Partners, Inc., Heron Lake, Minnesota, and thereby engage de novo in general insurance...

Deformation and metamorphism of gold-sulphide lodes in the ...

Indian Academy of Sciences (India)

Geological map of the Aravalli–Delhi orogenic belt (modified after Heron 1953 and Deb and Sarkar 1990). ... also a boomerang with one side eroded out. ... granite comprising altered minerals parallel to the margin (near Bhukia–Ghatol road.

Od Fermatových čísel ke geometrii. Věnováno prof. O. Kowalskému k jeho 65. narozeninám

Czech Academy of Sciences Publication Activity Database

Křížek, Michal

2001-01-01

Roč. 46, č. 3 (2001), s. 179-191 ISSN 0032-2423 R&D Projects: GA ČR GA201/01/1200 Keywords : Heron and Pascal triangle%Sierpienski fractal set%regular polygons Subject RIV: BA - General Mathematics

Contaminant exposure of birds nesting in Green Bay, Wisconsin, USA.

Science.gov (United States)

Custer, Thomas W; Dummer, Paul M; Custer, Christine M; Franson, J Christian; Jones, Michael

2014-08-01

In earlier studies, elevated concentrations of polychlorinated biphenyl (PCB) and p,p'-dichlorodiphenyldichloroethylene (DDE) were reported in double-crested cormorant (Phalacrocorax auritus) eggs and tree swallow (Tachycineta bicolor) eggs and nestlings collected from lower Green Bay (WI, USA) in 1994 and 1995 and black-crowned night-heron (Nycticorax nycticorax) eggs collected in 1991. Comparable samples collected in 2010 and 2011 indicated that concentrations of PCBs were 35%, 62%, 70%, and 88% lower than in the early 1990s in tree swallow eggs, tree swallow nestlings, double-crested cormorant eggs, and black-crowned night-heron eggs, respectively; concentrations of DDE were 47%, 43%, 51%, and 80% lower, respectively. These declines are consistent with regional contaminant trends in other species. Concentrations of PCBs were higher in herring gull (Larus argentatus) than in black-crowned night-heron eggs collected from Green Bay in 2010; PCB concentrations in double-crested cormorant and tree swallow eggs were intermediate. The estimated toxicity of the PCB mixture in eggs of the insectivorous tree swallow was the equal to or greater than toxicity in the 3 piscivorous bird species. A multivariate analysis indicated that the composition percentage of lower-numbered PCB congeners was greater in eggs of the insectivorous tree swallow than in eggs of the 3 piscivorous species nesting in Green Bay. Dioxin and furan concentrations and the toxicity of these chemicals were also higher in tree swallows than these other waterbird species nesting in Green Bay. Published 2014 Wiley Periodicals, Inc.

Avifauna of Ishaqbini Community Conservancy in Ijara District, NE ...

African Journals Online (AJOL)

Conservancy include Green-backed Heron Butorides striatus (R-NT), Purple ... example, while the neighbouring Tana River forests IBA has 19 of the 30 ... in logistics, planning of field work and many other ways during the field periods. This.

Great Blue Heron Range - CWHR [ds609

Data.gov (United States)

California Natural Resource Agency — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model for...

Recent results from Barn Swallow Hirundo rustica ringing in Iringa ...

African Journals Online (AJOL)

the lake, we found that capture rates improved when nets were opened just before dawn to ... Obrowiec in Gogolin, Poland, and at Lake Atanasovsko in Burgas, Bulgaria. (Table 1). ... Notes on nesting herons and other birds of interest at Lake.

Influence of porewater advection on denitrification in carbonate sands: Evidence from repacked sediment column experiments

DEFF Research Database (Denmark)

Santos, Isaac R.; Eyre, Bradley D.; Glud, Ronnie N.

2012-01-01

Porewater flow enhances mineralization rates in organic-poor permeable sands. Here, a series of sediment column experiments were undertaken to assess the potential effect of advective porewater transport on denitrification in permeable carbonate sands collected from Heron Island (Great Barrier Re...

Drivers of pCO2 dynamics in two contrasting coral reef lagoons: The influence of submarine groundwater discharge (Invited)

Science.gov (United States)

Cyronak, T.; Santos, I. R.; Erler, D.; Maher, D. T.; Eyre, B.

2013-12-01

The carbon chemistry of coral reef lagoons can be highly variable over short time scales. While much of the diel variability in seawater carbon chemistry is explained by biological processes, external sources such as river and groundwater seepage may deliver large amounts of organic and inorganic carbon to coral reefs and represent a poorly understood feedback to ocean acidification. Here, we assess the impact of submarine groundwater discharge (SGD) on pCO2 variability in two coral reef lagoons with distinct SGD driving mechanisms. Diel variability of pCO2 in the two ecosystems was explained by a combination of biological drivers and SGD inputs. In Rarotonga, a South Pacific volcanic island, SGD was driven primarily by a steep terrestrial hydraulic gradient, and the lagoon was influenced by the high pCO2 (5,501 μatm) of the fresh groundwater. In Heron Island, a Great Barrier Reef coral cay, SGD was dominated by seawater recirculation through sediments (i.e. tidal pumping) and pCO2 was mainly impacted through the stimulation of biological processes. The Rarotonga water column had a relatively higher average pCO2 (549 μatm) than Heron Island (471 μatm). However, pCO2 exhibited a greater diel range in Heron Island (778 μatm) than in Rarotonga (507 μatm). The Rarotonga lagoon received 31.2 mmol CO2 m-2 d-1 from SGD, while the Heron Island lagoon received 12.3 mmol CO2 m-2 d-1. Over the course of this study both systems were sources of CO2 to the atmosphere (3.00 to 9.67 mmol CO2 m-2 d-1), with SGD-derived CO2 contributing a large portion to the air-sea CO2 flux. The relationship between both water column pH and aragonite saturation state (ΩAr) and radon (222Rn) concentrations indicate that SGD may enhance the local acidification of some coral reef lagoons. Studies measuring the carbon chemistry of coral reefs (e.g. community metabolism, calcification rates) may need to consider SGD-derived CO2.

Observations ornithologiques au Sénégal

NARCIS (Netherlands)

Rose, John; Virondeau, Anthony; Magne, Jean-François; Diop, Moussa Séga; Hooijmeijer, J.C.E.W.; Barlow, Clive

2016-01-01

Ornithological observations in Senegal. We present observations made in Senegal in January 2015. Five sightings of rare species are described: a White-crested Tiger Heron Tigriornis leucolopha in the Saloum delta, a Shorteared Owl Asio flammeus in Madeleine Islands National Park, an Egyptian

Total mercury in water, sediments, and animals along the Indian Coast

Digital Repository Service at National Institute of Oceanography (India)

Sanzgiri, S.; Mesquita, A.; Kureishy, T.W.

Total mercury (Hg) in water, sediments and animals along the coast of India is estimated. Water samples were collected on board of R.V. Gaveshani.The zooplankton samples were collected by Indian Ocean Standard Net and Heron Tranter nets of 500 mesh...

From Fermat Numbers to Geometry

Czech Academy of Sciences Publication Activity Database

Křížek, Michal; Luca, F.; Somer, L.

2005-01-01

Roč. 38, č. 2 (2005), s. 56-63 ISSN 0025-5653 R&D Projects: GA AV ČR(CZ) IAA1019201 Institutional research plan: CEZ:AV0Z10190503 Keywords : Pascal triangle * Heron triangle * graph theory Subject RIV: BA - General Mathematics

Sensitivity of coral cays to climatic variations, southern Great Barrier Reef, Australia

Energy Technology Data Exchange (ETDEWEB)

Flood, P G

1986-01-01

Analysis of available wind data for the years 1962-80 from Heron Island which is located within the southern Great Barrier Reef indicates that the annual wind energy vector has oscillated within a 45 degree arc from the SSE in the early 1960's to ESE in the late 1970's. Such changes in wind direction influence the direction of propagation of the waves which mold the shape of coral sand cays in this region. Documentation is provided which shows that the variability of the shoreline positions on Erskine Island, an uninhabited vegetated sand cays reflects this change. The implication is that contemporary shoreline erosion on Heron Island is not caused by the development associated with the tourist resort there. It is a symptom of the change in the propagation direction of the wind-induced waves which is related to long-term climatic change.

The influence of climate variability on numbers of three waterbird species in Western Port, Victoria, 1973 2002

Science.gov (United States)

Chambers, Lynda E.; Loyn, Richard H.

2006-05-01

Seasonal and annual movements of Australian waterbirds are generally more complex than those of their Northern Hemisphere counterparts, and long-term data are needed to understand their relationships with climatic variables. This paper explores a long-term (1973 2002) set of waterbird counts from coastal Victoria and relates them to climatic data at local and continental scales. Three species (Black Swan Cygnus atratus, White-faced Heron Egretta novaehollandiae and Grey Teal Anas gracilis) were chosen for this analysis. Black Swans have large local breeding populations near the study region; White-faced Herons have smaller local breeding populations and Grey Teal breed extensively in ephemeral inland floodplains, such as those in the Murray-Darling Basin. All showed significant relationships with streamflow, regional rainfall and the Southern Oscillation Index (SOI) at appropriate scales and time-lags, with streamflow explaining the most variance. Black Swans showed a strong seasonal cycle in abundance and local climate variables had the greatest influence on the counts. Numbers were positively correlated with streamflow in southern Victoria three to six seasons before each count. Broader-scale climatic patterns were more important for the other two species. Numbers of White-faced Herons were positively correlated with streamflow or rainfall over various parts of Australia seven to nine seasons before each count. Numbers of Grey Teal showed weak seasonal cycles, and were negatively correlated with rainfall in Victoria or the Murray-Darling Basin in the seasons before or during each count, and positively with streamflow in the Murray-Darling Basin 15 18 months before each count.

New species of Paracalanidae along the west coast of India: Paracalanus arabiensis

Digital Repository Service at National Institute of Oceanography (India)

Kesarkar, K.S.; Anil, A.C.

AND METHODS Zooplankton samples were collected by horizontal hauls with Heron-Tranter (HT) plankton net [100µm mesh with a digital flow meter (Hydro-Bios, no.438110)] from Mandovi and Zuari estuaries [including Marmugao Port Trust (MPT) area], (15˚25’N; 73...

Serological response to vaccination against avian influenza in zoo-birds using an inactivated H5N9 vaccine

DEFF Research Database (Denmark)

Bertelsen, Mads F.; Klausen, Joan; Holm, Elisabeth

2007-01-01

seroconverted, and 76% developed a titre >= 32. The geometric mean titre after vaccination was 137. A significant species variation in response was noted; penguins, pelicans, ducks, geese, herons, Guinea fowl, cranes, cockatiels, lovebirds, and barbets showed very poor response to vaccination, while very high...

76 FR 14042 - San Luis Valley National Wildlife Refuge Complex, Alamosa, CO; Comprehensive Conservation Plan...

Science.gov (United States)

2011-03-15

... nesting, migrating, and wintering birds, including grebes, herons, ibis, ducks, geese, hawks, eagles... movement of water, is a complex issue that needs to be addressed. The Service is also proposing to study... sustainability of America's land, water, wildlife and cultural resources. The study would analyze the potential...

Pricing Strategies and Models for the Provision of Digitized Texts in Higher Education.

Science.gov (United States)

Hardy, Rachel; Oppenheim, Charles; Rubbert, Iris

2002-01-01

Describes research into charging mechanisms for the delivery of digitized texts to higher education students in the United Kingdom and discusses the need for a satisfactory pricing model. Explains the HERON (Higher Education Resources On-Demand) and PELICAN (Pricing Experiment Library Information Cooperative Network) projects and considers…

“BOND OF LOVE”: THE ACTION OF THE SPIRIT

African Journals Online (AJOL)

. Prof. David T .... usage of the words commonly translated “spirit” and observes that the. Greek pneuma had ... of ruach (Heron 1983:4), must be essentially relational, as it is physically generated from ..... God's empowering presence: the Holy Spirit in the letters of Paul. Peabody, Mass: ...

Situating the Debate on "Geometrical Algebra" within the Framework of Premodern Algebra.

Science.gov (United States)

Sialaros, Michalis; Christianidis, Jean

2016-06-01

Argument The aim of this paper is to employ the newly contextualized historiographical category of "premodern algebra" in order to revisit the arguably most controversial topic of the last decades in the field of Greek mathematics, namely the debate on "geometrical algebra." Within this framework, we shift focus from the discrepancy among the views expressed in the debate to some of the historiographical assumptions and methodological approaches that the opposing sides shared. Moreover, by using a series of propositions related to Elem. II.5 as a case study, we discuss Euclid's geometrical proofs, the so-called "semi-algebraic" alternative demonstrations attributed to Heron of Alexandria, as well as the solutions given by Diophantus, al-Sulamī, and al-Khwārizmī to the corresponding numerical problem. This comparative analysis offers a new reading of Heron's practice, highlights the significance of contextualizing "premodern algebra," and indicates that the origins of algebraic reasoning should be sought in the problem-solving practice, rather than in the theorem-proving tradition.

Role of communally nesting ardeid birds in the epidemiology of West Nile virus revisited.

Science.gov (United States)

Reisen, William K; Wheeler, Sarah; Armijos, M Veronica; Fang, Ying; Garcia, Sandra; Kelley, Kara; Wright, Stan

2009-06-01

Although herons and egrets in the family Ardeidae frequently have been associated with viruses in the Japanese encephalitis virus serocomplex, communal nesting colonies do not appear to be a focus of early season and rapid amplification of West Nile virus (WNV) in California. Evidence for repeated WNV infection was found by testing living and dead nestlings collected under trees with mixed species ardeid colonies nesting above in an oak grove near the University of California arboretum in Davis and in a Eucalyptus grove at a rural farmstead. However, mosquito infection rates at both nesting sites were low and positive pools did not occur earlier than at comparison sites within the City of Davis or at the Yolo Bypass wetlands managed for rice production and waterfowl habitat. Black-crowned night herons (Nycticorax nycticorax) were the most abundant and frequently infected ardeid species, indicating that WNV may be an important cause of mortality among nestlings of this species.

INDIRECT EFFECT OF EXTREME FLOODING: DISAPPEARANCE OF WADING BIRDS ROOST CAUSED BY VEGETATION TURN

Czech Academy of Sciences Publication Activity Database

Rajchard, J.; Balounová, Z.; Novák, R.; Kindlmann, Pavel

2007-01-01

Roč. 26, č. 1 (2007), s. 64-67 ISSN 1335-342X R&D Projects: GA AV ČR IAA6093105; GA AV ČR(CZ) KSK6005114 Keywords : extreme flooding * night heron * spoonbill * little egret * shrubs Subject RIV: EH - Ecology, Behaviour Impact factor: 0.085, year: 2005

Avian fossils from the Early Miocene Moghra Formation of Egypt ...

African Journals Online (AJOL)

Avian remains from the Early Miocene (~17 Ma) Moghra Formation of Egypt include new records of 'waterbirds' (storks, herons, pelicans and allies) and a ratite. Only a single avian fossil has been previously reported from Wadi Moghra and, thus, additional knowledge of the avifauna complements previously documented ...

Composition and Dynamics of Migratory and Resident Avian Population in Wintering Wetlands from Northern India

Directory of Open Access Journals (Sweden)

Kaushalendra Kumar JHA

2015-03-01

Full Text Available Twelve wetlands occurring in four different ecozones in Uttar Pradesh (UP, India, were selected for studying the winter composition and dynamics of avian populations. Wetland information was collected from office records of the UP Forest department. Bird populations were estimated by transect method and block-in-flock-in-sector method for woodland and aquatic birds, respectively. Across the twelve selected wetlands a total of 486,182 individuals belonging to 161 species of birds on 15,592 ha were recorded during the winter of 2010-11. The data were analyzed to assess the relationship between wetland characteristics and avian populations. Aquatic vegetation, surrounding vegetation, water availability and climate were found as important factors related to avian populations. January was found to be the peak of bird assemblage, while winter times before and after January were the waxing and waning period, respectively. Species richness and species diversity of aquatic birds varied between 18-58 and 1.90-3.20, respectively, and of all bird species between 23-109, and 1.73-3.81, respectively. The density of aquatic birds ranged between 17-384 ha-1. The most common migratory birds in wetlands were Northern Pintail, Common Teal and Greylag Goose. Common resident birds included Asian Openbill, Darter, Little Egret, Common Coot, Little Cormorant, Grey Heron, Purple Heron, Indian Pond Heron, Common Moorhen, Purple Swamphen, Cattle Egret, Indian Sarus Crane and White-throated Kingfisher. For improved conservation of aquatic avian fauna, management prescriptions are suggested for wetlands under current management which could also be extended to other wetlands, whereas conservation of avian fauna to be the emphasis.

Influence of Response Prepotency Strength, General Working Memory Resources, and Specific Working Memory Load on the Ability to Inhibit Predominant Responses: A Comparison of Young and Elderly Participants

Science.gov (United States)

Grandjean, Julien; Collette, Fabienne

2011-01-01

One conception of inhibitory functioning suggests that the ability to successfully inhibit a predominant response depends mainly on the strength of that response, the general functioning of working memory processes, and the working memory demand of the task (Roberts, Hager, & Heron, 1994). The proposal that inhibition and functional working memory…

Molecular systematics of the parasitic protozoan Giardia intestinalis.

Science.gov (United States)

Monis, P T; Andrews, R H; Mayrhofer, G; Ey, P L

1999-09-01

The long-standing controversy regarding whether Giardia intestinalis is a single species prevalent in both human and animal hosts or a species complex consisting of morphologically similar organisms that differ in host range and other biotypic characteristics is an issue with important medical, veterinary, and environmental management implications. In the past decade, highly distinct genotypes (some apparently confined to particular host groups) have been identified by genetic analysis of samples isolated from different host species. The aim of this study was to undertake a phylogenetic analysis of G. intestinalis that were representative of all known major genetic groups and compare them with other Giardia species, viz. G. ardeae, G. muris, and G. microti. Segments from four "housekeeping" genes (specifying glutamate dehydrogenase, triose phosphate isomerase, elongation factor 1 alpha, and 18S ribosomal RNA) were examined by analysis of 0.48-0.69-kb nucleotide sequences determined from DNA amplified in polymerase chain reactions from each locus. In addition, isolates were compared by allozymic analysis of electrophoretic data obtained for 21 enzymes representing 23 gene loci. The results obtained from these independent techniques and different loci were essentially congruous. Analyses using G. ardeae and/or G. muris as outgroups supported the monophyly of G. intestinalis and also showed that this species includes genotypes that represent at least seven deeply rooted lineages, herein designated assemblages A-G. Inclusion of G. microti in the analysis of 18S rRNA sequence data demonstrated the monophyly of Giardia with the same median body morphology but did not support the monophyly of G. intestinalis, instead placing G. microti within G. intestinalis. The findings support the hypothesis that G. intestinalis is a species complex and suggest that G. microti is a member of this complex.

Notas sobre la historia de la garza morena ardea cocoi (aves en Colombia

Directory of Open Access Journals (Sweden)

José Ignacio Borrero H.

1982-01-01

Full Text Available Una revisión de la bibliografía sobre esta especie, demuestra que si bien existe una serie de notas relacionadas con su distribución geográfica, prácticamente nada se ha escrito en relación con sus costumbres, fuera claro está, de comentarios muy generales consignados en manuales sobre faunas regionales.

Host reproductive phenology drives seasonal patterns of host use in mosquitoes.

Directory of Open Access Journals (Sweden)

Nathan D Burkett-Cadena

2011-03-01

Full Text Available Seasonal shifts in host use by mosquitoes from birds to mammals drive the timing and intensity of annual epidemics of mosquito-borne viruses, such as West Nile virus, in North America. The biological mechanism underlying these shifts has been a matter of debate, with hypotheses falling into two camps: (1 the shift is driven by changes in host abundance, or (2 the shift is driven by seasonal changes in the foraging behavior of mosquitoes. Here we explored the idea that seasonal changes in host use by mosquitoes are driven by temporal patterns of host reproduction. We investigated the relationship between seasonal patterns of host use by mosquitoes and host reproductive phenology by examining a seven-year dataset of blood meal identifications from a site in Tuskegee National Forest, Alabama USA and data on reproduction from the most commonly utilized endothermic (white-tailed deer, great blue heron, yellow-crowned night heron and ectothermic (frogs hosts. Our analysis revealed that feeding on each host peaked during periods of reproductive activity. Specifically, mosquitoes utilized herons in the spring and early summer, during periods of peak nest occupancy, whereas deer were fed upon most during the late summer and fall, the period corresponding to the peak in births for deer. For frogs, however, feeding on early- and late-season breeders paralleled peaks in male vocalization. We demonstrate for the first time that seasonal patterns of host use by mosquitoes track the reproductive phenology of the hosts. Peaks in relative mosquito feeding on each host during reproductive phases are likely the result of increased tolerance and decreased vigilance to attacking mosquitoes by nestlings and brooding adults (avian hosts, quiescent young (avian and mammalian hosts, and mate-seeking males (frogs.

Shelley's Greenbul Andropadus masukuensis in Kimboza Forest ...

African Journals Online (AJOL)

New York: Harper & Row. Kushlan, J.A. & Hancock, J. 2005. Herons. Oxford: Oxford University Press. Payne, R.B. 1979. Ardeidae. In Mayr & Cotterell (Eds). Peters Check List of Birds of the World 2nd. Edition. Cambridge, USA: Museum of Comparative Zoology. Safford, R.J. & Hawkins, A.F.A. (Eds). 2013. The Birds of Africa.

A Dutch Perspective on Coastal Louisiana Flood Risk Reduction and Landscape Stabilization

Science.gov (United States)

2007-10-18

moss- draped tupelo are dominating trees. Its waters are rich in crawfish. Nesting birds here are heron, ibis and egrets. If land is even lower, trees...capacity no slip failure problems wide crest, 20m - 60m enough erosion capacity gentle slope waves break into water, not on the slope no armour , grass cover

Red River of the North Reconnaissance Report: Sand Hill River Subbasin.

Science.gov (United States)

1980-12-01

0.j N- 71064 ko~e Co. us ;IEOfte Co. N I 9 0 5 10 mI les Soure : ulf out Resarc Insitued North Basir i Source: Gulf South Research Institute...J.R. Beer reported seeing the plains pocket mouse in Polk County in 1953 (Henderson and Reitter, 1979; Henderson, 1979). The great blue heron was

A Safe Place to Stay Sharp: Action Learning Meets Cooperative Inquiry in the Service of NHS OD Capacity Building

Science.gov (United States)

Traeger, James; Norgate, Carolyn

2015-01-01

This is an account of practice. It explores the meeting point between action learning and action research, as a way of doing capacity building in organisational development (OD) in the NHS in the UK. The authors were part of a short cooperative inquiry (Heron, J. 1996. "Co-operative Inquiry: Research into the Human Condition." London:…

Thermal Treatment Technologies: Lessons Learned

Science.gov (United States)

2011-11-01

With contributions from: Gorm Heron, Ralph Baker, and Gregory Crisp (TerraTherm) Greg Smith (Thermal Remediation Services, Inc.) Phil La Mori...vapor is generated by boiling, and leaves the volume, carrying contaminant vapors H O H O2 2( )1 1c cw w w g w g d M C dM C dt dt   rate of change

Valuing Puget Sound’s Valued Ecosystems Components

Science.gov (United States)

2007-07-01

Seattle District, U.S. Army Corps of Engineers, Seattle, Washington. Eissinger, A.M. 2007. Great Blue Herons in Puget Sound. Puget Sound Nearshore...among disparate elements of the PNCERS’ multidisci- plinary research program. Pacific salmon, Dungeness crab , Pacific oyster and shorelands were...oyster (Crassostrea gigas)—an introduced and possibly invasive species that is extensively cultivated in Washington and Oregon, particu- larly in

The zooplankton of Mgazana, a mangrove estuary in Transkei

African Journals Online (AJOL)

continent. The estuary is in an excellent state of preservation and all three species of mangrove trees which occur south of K.osi Bay (260 54' S) are recorded here (Avicennia marina, Bruguieria gymnorhiza .... of Heron Island a shallow ford or drift occurs where depth may be less than 0,25 m at low tide. Above the island the ...

Species differences in the sensitivity of avian embryos to methylmercury

Science.gov (United States)

Heinz, G.H.; Hoffman, D.J.; Klimstra, J.D.; Stebbins, K.R.; Kondrad, S.L.; Erwin, C.A.

2009-01-01

We injected doses of methylmercury into the air cells of eggs of 26 species of birds and examined the dose-response curves of embryo survival. For 23 species we had adequate data to calculate the median lethal concentration (LC50). Based on the dose-response curves and LC50s, we ranked species according to their sensitivity to injected methylmercury. Although the previously published embryotoxic threshold of mercury in game farm mallards (Anas platyrhynchos) has been used as a default value to protect wild species of birds, we found that, relative to other species, mallard embryos are not very sensitive to injected methylmercury; their LC50 was 1.79 ug/g mercury on a wet-weight basis. Other species we categorized as also exhibiting relatively low sensitivity to injected methylmercury (their LC50s were 1 ug/g mercury or higher) were the hooded merganser (Lophodytes cucullatus), lesser scaup (Aythya affinis), Canada goose (Branta canadensis), double-crested cormorant (Phalacrocorax auritus), and laughing gull (Larus atricilla). Species we categorized as having medium sensitivity (their LC50s were greater than 0.25 ug/g mercury but less than 1 ug/g mercury) were the clapper rail (Rallus longirostris), sandhill crane (Grus canadensis), ring-necked pheasant (Phasianus colchicus), chicken (Gallus gallus), common grackle (Quiscalus quiscula), tree swallow (Tachycineta bicolor), herring gull (Larus argentatus), common tern (S terna hirundo), royal tern (Sterna maxima), Caspian tern (Sterna caspia), great egret (Ardea alba), brown pelican (Pelecanus occidentalis), and anhinga (Anhinga anhinga). Species we categorized as exhibiting high sensitivity (their LC50s were less than 0.25 ug/g mercury) were the American kestrel (Falco sparverius), osprey (Pandion haliaetus), white ibis (Eudocimus albus), snowy egret (Egretta thula), and tri-colored heron (Egretta tricolor). For mallards, chickens, and ring-necked pheasants (all species for which we could compare the toxicity of our

Acropora interbranch skeleton Sr/Ca ratios: Evaluation of a potential new high-resolution paleothermometer

Science.gov (United States)

Sadler, James; Nguyen, Ai D.; Leonard, Nicole D.; Webb, Gregory E.; Nothdurft, Luke D.

2016-04-01

The majority of coral geochemistry-based paleoclimate reconstructions in the Indo-Pacific are conducted on selectively cored colonies of massive Porites. This restriction to a single genus may make it difficult to amass the required paleoclimate data for studies that require deep reef coring techniques. Acropora, however, is a highly abundant coral genus in both modern and fossil reef systems and displays potential as a novel climate archive. Here we present a calibration study for Sr/Ca ratios recovered from interbranch skeleton in corymbose Acropora colonies from Heron Reef, southern Great Barrier Reef. Significant intercolony differences in absolute Sr/Ca ratios were normalized by producing anomaly plots of both coral geochemistry and instrumental water temperature records. Weighted linear regression of these anomalies from the lagoon and fore-reef slope provide a sensitivity of -0.05 mmol/mol °C-1, with a correlation coefficient (r2 = 0.65) comparable to those of genera currently used in paleoclimate reconstructions. Reconstructions of lagoon and reef slope mean seasonality in water temperature accurately identify the greater seasonal amplitude observed in the lagoon of Heron Reef. A longer calibration period is, however, required for reliable reconstructions of annual mean water temperatures.

Radionuclide concentrations in game and nongame fish upstream and downstream of Los Alamos National Laboratory: 1981 to 1993

International Nuclear Information System (INIS)

Fresquez, P.R.; Armstrong, D.R.; Salazar, J.G.

1994-08-01

Radionuclide concentrations were determined in game (surface-feeding) and nongame (bottom-feeding) fish collected from reservoirs upstream (Abiquiu, Heron, and El Vado) and downstream (Cochiti) of Los Alamos National Laboratory from 1981 to 1993. The average levels of 90 Sr, 137 Cs, 238 Pu, and 239 Pu in game and nongame fish collected from Cochiti reservoir were not significantly different in fish collected from reservoirs upstream of the Laboratory. Total uranium was the only radionuclide that was found to be significantly higher n both game and nongame fish from Cochiti as compared to fish from Abiquiu, Heron, and El Vado. Uranium concentrations in fish collected from Cochiti, however, significantly decreased from 1981 to 1993, and no evidence of depleted uranium was found in fish samples collected from Cochiti in 1993. Based on the average concentration of radionuclides over the year the effective (radiation) dose equivalent from consuming 46 lb of game fish and nongame fish from Cochiti reservoir after natural background has been subtracted was 0.005 and 0.009 mrem/yr, respectively. The highest dose was <0.01% of the International Commission on Radiological Protection (ICRP) permissible dose limit for protecting members of the public

Sherborn's foraminiferal studies and their influence on the collections at the Natural History Museum, London.

Science.gov (United States)

Miller, C Giles

2016-01-01

Sherborn's work on the Foraminifera clearly provided the initial spark to compile the major indexes for which he is famous. Contact and help from famous early micropalaeontologists such as T. Rupert Jones and Fortescue William Millett led Sherborn to produce his Bibliography of Foraminifera and subsequently a two-part Index of Foraminiferal Genera and Species. Edward Heron-Allen, whose mentor was Millett, was subsequently inspired by the bibliography to attempt to acquire every publication listed. This remarkable collection of literature was donated to the British Museum (Natural History) in 1926 along with the foraminiferal collections Heron-Allen had mainly purchased from early micropalaeontologists. This donation forms the backbone of the current NHM micropalaeontological collections. The NHM collections contain a relatively small amount of foraminiferal material published by Sherborn from the London Clay, Kimmeridge Clay and Speeton Clay. Another smaller collection reflects his longer-term interest in the British Chalk following regular fieldwork with A. W. Rowe. Other collections relating to Sherborn's early published work, particularly with T. R. Jones, are not present in the collections but these collections may have been sold or deposited elsewhere by his co-workers.

Environmental Assessment Addressing FTFA07-1174, Repair Approach Lighting System at the North End of Runway 01/19 at Eglin AFB, Florida

Science.gov (United States)

2013-05-01

Hyla andersonii Mammals American beaver Castor canadensis Florida black bear2 Ursus americanus floridanus Raccoon Procyon lotor Source: Eglin...water at a frequency and duration to support, and that under normal circumstances do support, a prevalence of vegetation typically adapted to life...virginiana American Beaver Castor canadensis Redbay Persea borbonia Little Blue Heron Egretta caerulea Source: USAF 2006 E-3 E.2 Eglin AFB

Native Shellfish in Nearshore Ecosystems of Puget Sound

Science.gov (United States)

2006-04-01

California Dungeness crabs (Cancer magister). California Fish and Game 63:43-51. Griffin, K. 1997. Commercial oyster cultivation and eelgrass...A.M. 2007. Great Blue Herons in Puget Sound. Puget Sound Nearshore Partnership Report No. 2007-06. Published by Seattle District, U.S. Army Corps of...non-native Pacific oyster, but more than $40 million is from native crabs , clams, and mussels. Recreationally, personal harvest of shellfish is a

Diversity and prevalence of hemoparasites of wading birds in southern Florida, USA

OpenAIRE

Coker, Sarah M.; Hernandez, Sonia M.; Kistler, Whitney M.; Curry, Shannon E.; Welch, Catharine N.; Barron, Heather W.; Harsch, Stefan; Murray, Maureen H.; Yabsley, Michael J.

2017-01-01

Relatively few studies on hemoparasites have been conducted on wading birds in the families Ardeidae and Threskiornithidae (order Pelecaniformes), especially in the United States. In this study, we obtained baseline data on the prevalence and genetic diversity of haemosporidian parasites in wading birds opportunistically sampled from southern Florida, USA. We detected blood parasites in White Ibis (Eudocimus albus), Glossy Ibis (Plegadis falcinellus), Green Heron (Butorides virescens), and Ro...

Live Coral Cover Index Testing and Application with Hyperspectral Airborne Image Data

Directory of Open Access Journals (Sweden)

Karen E. Joyce

2013-11-01

Full Text Available Coral reefs are complex, heterogeneous environments where it is common for the features of interest to be smaller than the spatial dimensions of imaging sensors. While the coverage of live coral at any point in time is a critical environmental management issue, image pixels may represent mixed proportions of coverage. In order to address this, we describe the development, application, and testing of a spectral index for mapping live coral cover using CASI-2 airborne hyperspectral high spatial resolution imagery of Heron Reef, Australia. Field surveys were conducted in areas of varying depth to quantify live coral cover. Image statistics were extracted from co-registered imagery in the form of reflectance, derivatives, and band ratios. Each of the spectral transforms was assessed for their correlation with live coral cover, determining that the second derivative around 564 nm was the most sensitive to live coral cover variations(r2 = 0.63. Extensive field survey was used to transform relative to absolute coral cover, which was then applied to produce a live coral cover map of Heron Reef. We present the live coral cover index as a simple and viable means to estimate the amount of live coral over potentially thousands of km2 and in clear-water reefs.

Lichen Monitoring Delineates Biodiversity on a Great Barrier Reef Coral Cay

OpenAIRE

Rogers, Paul C.; Rogers, Roderick W.; Hedrich, Anne E.; Moss, Patrick T.

2015-01-01

Coral islands around the world are threatened by changing climates. Rising seas, drought, and increased tropical storms are already impacting island ecosystems. We aim to better understand lichen community ecology of coral island forests. We used an epiphytic lichen community survey to gauge Pisonia (Pisonia grandis R.BR.), which dominates forest conditions on Heron Island, Australia. Nine survey plots were sampled for lichen species presence and abundance, all tree diameters and species, GPS...

[1st observations of the pathogenicity of Ichthyophonus in birds. 2 cases of natural infection].

Science.gov (United States)

Chauvier, G; Mortier-Gabet, J

1984-01-01

Two cases of ichthyophoniasis (ichthyosporidiosis) are reported for the first time in fish-eating birds, heron and herring gull. The lesions were mainly in the heart, liver, spleen and kidney. The fungus was isolated from them, cultivated and found identical to a strain previously obtained from a sea-fish. It was able to grow at 40 degrees C. Attention is drawn on the potential hazard for human health resulting from the ingestion of raw fish.

Lichen Monitoring Delineates Biodiversity on a Great Barrier Reef Coral Cay

Directory of Open Access Journals (Sweden)

Paul C. Rogers

2015-05-01

Full Text Available Coral islands around the world are threatened by changing climates. Rising seas, drought, and increased tropical storms are already impacting island ecosystems. We aim to better understand lichen community ecology of coral island forests. We used an epiphytic lichen community survey to gauge Pisonia (Pisonia grandis R.BR., which dominates forest conditions on Heron Island, Australia. Nine survey plots were sampled for lichen species presence and abundance, all tree diameters and species, GPS location, distance to forest-beach edge, and dominant forest type. Results found only six unique lichens and two lichen associates. A Multi-Response Permutation Procedures (MRPP test found statistically distinct lichen communities among forest types. The greatest group differences were between interior Pisonia and perimeter forest types. Ordinations were performed to further understand causes for distinctions in lichen communities. Significant explanatory gradients were distance to forest edge, tree density (shading, and Pisonia basal area. Each of these variables was negatively correlated with lichen diversity and abundance, suggesting that interior, successionally advanced, Pisonia forests support fewer lichens. Island edge and presumably younger forests—often those with greater tree diversity and sunlight penetration—supported the highest lichen diversity. Heron Island’s Pisonia-dominated forests support low lichen diversity which mirrors overall biodiversity patterns. Lichen biomonitoring may provide a valuable indicator for assessing island ecosystems for conservation purposes regionally.

Notes on nesting herons and other birds of interest at Lake ...

African Journals Online (AJOL)

At high water the lake covers some 800 ha along the 520 m elevation contour. Lake Kalemawe is not included in the gazetteer in Britton (1980) and no mention can be traced of it in the bird literature of the 1980s and 1990s although it has been counted by the Tanzania Bird Atlas Project (TBAP) team in the recent past, and ...

Poèmes

Directory of Open Access Journals (Sweden)

Beryl Schlossman

2012-10-01

Full Text Available Video Senegal (From Some Night Traduction par l’auteur Victor’s home movies from Senegalaspire to the stasis of postcardsbut the women turn away and hideunder veils, their long legs stalkacross the screen and run fasterthan birds: migrating herons andindifferent pink flamingosstep toward the edge of the coast. Victor fait des films au Sénégal,ce pays qu’il aimerait figer commeun papillon de nuit ou une cartepostalemais les femmes se détournentse voilent, traversent l’écranrapidement se mette...

Monorchiids (Platyhelminthes: Digenea) of chaetodontid fishes (Perciformes): biogeographical patterns in the tropical Indo-West Pacific.

Science.gov (United States)

McNamara, M K A; Adlard, R D; Bray, R A; Sasal, P; Cribb, T H

2012-06-01

Species richness and biogeography of the monorchiid genus Hurleytrematoides was studied by the examination of 2834 individuals of 45 species of Chaetodontidae at six major sites in the tropical Indo-West Pacific: Heron Island, Lizard Island, Ningaloo (Western Australia), Palau, New Caledonia and Moorea (French Polynesia). In total, 18 species were distributed among six sites; descriptions are provided for eight new species: H. boucheti n. sp., H. combesi n. sp., H. deblocki n. sp., H. dollfusi n. sp., H. euzeti n. sp., H. kulbickii n. sp., H. pasteuri n. sp., and H. planesi n. sp. Overall richness ranged from zero to five Hurleytrematoides species per chaetodontid species. Seven Hurleytrematoides species were found at only one locality and eleven were found at multiple localities. Only one species, H. morandi, was found at all localities. Individual localities had between six (Moorea) and 10 (Heron Island) species; we attribute Moorea's depauperate parasite fauna to its isolation and distance from the Indo-Philippine centre of biological diversity. Using cluster analysis of 18 species of Hurleytrematoides and 45 species of chaetodontids sampled in the Indo-West Pacific, we show that the localities on the Great Barrier Reef (Heron Island and Lizard Island) and New Caledonia have the most similar chaetodontid and parasite fauna of any locality pairs. Cluster analysis results also show that the similarity of the chaetodontid assemblages at five of the six localities is relatively high and that Ningaloo has the most distinct fauna. Similarity values based on sharing of species of Hurleytrematoides are generally lower than those for their hosts; Moorea, Ningaloo and Palau all have low similarity to New Caledonia and Great Barrier Reef sites. We attribute these distinctions to the differential dispersal capability of the fish and their parasites. Chaetodontids have long-lived mobile pelagic larvae, the dispersal of which would be most affected by prominent

Genotyping of Giardia lamblia isolates from humans in China and Korea using ribosomal DNA Sequences.

Science.gov (United States)

Yong, T S; Park, S J; Hwang, U W; Yang, H W; Lee, K W; Min, D Y; Rim, H J; Wang, Y; Zheng, F

2000-08-01

Genetic characterization of a total of 15 Giardia lamblia isolates, 8 from Anhui Province, China (all from purified cysts) and 7 from Seoul, Korea (2 from axenic cultures and 5 from purified cysts), was performed by polymerase chain reaction amplification and sequencing of a 295-bp region near the 5' end of the small subunit ribosomal DNA (eukaryotic 16S rDNA). Phylogenetic analyses were subsequently conducted using sequence data obtained in this study, as well as sequences published from other Giardia isolates. The maximum parsimony method revealed that G. lamblia isolates from humans in China and Korea are divided into 2 major lineages, assemblages A and B. All 7 Korean isolates were grouped into assemblage A, whereas 4 Chinese isolates were grouped into assemblage A and 4 into assemblage B. Two Giardia microti isolates and 2 dog-derived Giardia isolates also grouped into assemblage B, whereas Giardia ardeae and Giardia muris were unique.

Seasonal variation in the photo-physiology of homogeneous and heterogeneous Symbiodinium consortia in two scleractinian corals

DEFF Research Database (Denmark)

Ulstrup, Karin Elizabeth; Hill, R.; Van Oppen, M. J. H.

2008-01-01

Seasonal variation in the composition of the algal endosymbiont community and photo-physiology was determined in the corals Pocillopora damicornis, which show high local fidelity to one symbiont type (Symbiodinium C1), and Acropora valida, with a mixed Symbiodinium symbiont community, comprising...... members of both clades A and C. The relative abundances of Symbiodinium types varied over time. A significant decline in symbiont densities in both coral species during the summer of 2005 coincided with a NOAA ‘hotspot' warning for Heron Island. This also coincided with a relative increase in the presence...

Proyecto de construcción de la línea de Metro Ligero: tramo Monterrozas-Las Rozas

OpenAIRE

Cabañas Pellicer, Darío

2015-01-01

El presente Proyecto Constructivo define las obras necesarias para la construcción de la infraestructura de la línea de Metro Ligero Monterrozas- Las Rozas. La línea comienza discurriendo por el bulevar central de la Calle Camilo José Cela, donde efectúa dos paradas. La primera se encuentra a la altura de la Biblioteca Leon Tolstoi, mientras que la segunda se sitúa entre el Heron City y Las Rozas Village. Se diseña así la línea de transporte guiado urbano tipo metro ligero, y la definición al...

Algebraic methods for solution of polyhedra

Energy Technology Data Exchange (ETDEWEB)

Sabitov, Idzhad Kh [M. V. Lomonosov Moscow State University, Moscow (Russian Federation)

2011-06-30

By analogy with the solution of triangles, the solution of polyhedra means a theory and methods for calculating some geometric parameters of polyhedra in terms of other parameters of them. The main content of this paper is a survey of results on calculating the volumes of polyhedra in terms of their metrics and combinatorial structures. It turns out that a far-reaching generalization of Heron's formula for the area of a triangle to the volumes of polyhedra is possible, and it underlies the proof of the conjecture that the volume of a deformed flexible polyhedron remains constant. Bibliography: 110 titles.

Tapeworms (Cestoda: Gryporhynchidae) of fish-eating birds (Ciconiiformes) from Mexico: new host and geographical records

Czech Academy of Sciences Publication Activity Database

Ortega-Olivares, M. P.; Barrera-Guzmán, A. O.; Haasová, Ivana; Salgado-Maldonado, G.; Guillén-Hernández, S.; Scholz, Tomáš

2008-01-01

Roč. 75, č. 2 (2008), s. 182-195 ISSN 1525-2647 R&D Projects: GA ČR GA524/08/0885; GA MŠk LC522 Grant - others:Consejo Nacional de Ciencia y Tecnología(MX) D44590-Q Conacyt; Consejo Nacional de Ciencia y Tecnología(MX) Conacyt 2004 CO1; Consejo Nacional de Ciencia y Tecnología(MX) Fomix YUC-2003-CO2-036 Institutional research plan: CEZ:AV0Z60220518 Keywords : faunistic survey * herons * Ardeidae * Cyclophyllidea * morphology * zoogeographical distribution Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.477, year: 2008

Myanmar Model Project

International Nuclear Information System (INIS)

Le Heron, John

1998-01-01

The National Radiation Laboratory was approached by the IAEA in 1997 to provide assistance to the government of Myanmar, as part of the Model Project, in setting up an appropriate regulatory framework for radiation protection. To this end John Le Heron spent 3 weeks in late 1997 based at the Atomic Energy Department of the Ministry of Science and Technology, Yangon, assessing the existing legal framework, assisting with the review and design of the legal framework for consistency with the Basic Safety Standards, and assisting in the preparation of a system of notification, authorisation and inspection of radiation practices. (author)

Genetic diversity within the morphological species Giardia intestinalis and its relationship to host origin.

Science.gov (United States)

Monis, Paul T; Andrews, Ross H; Mayrhofer, Graham; Ey, Peter L

2003-05-01

A genetic analysis of Giardia intestinalis, a parasitic protozoan species that is ubiquitous in mammals worldwide, was undertaken using organisms derived from a variety of mammalian hosts in different geographical locations. The test panel of 53 Giardia isolates comprised 48 samples of G. intestinalis, including representatives of all known genetic subgroups, plus an isolate of G. ardeae and four isolates of G. muris. The isolates were compared by allozymic analysis of electrophoretic data obtained for 21 cytosolic enzymes, representing 23 gene loci. Neighbour Joining analysis of the allelic profiles supported the monophyly of G. intestinalis but showed that the species encompasses a rich population substructure. Seven major clusters were evident within G. intestinalis, corresponding to lineages designated previously as genetic assemblages A-G. Some genotypes, e.g. those defining assemblage A, are found in divergent host species and may be zoonotic. However other genotypes, e.g. those defining assemblages C-G, appear to be confined to particular hosts or host groups. The findings reinforce other evidence that G. intestinalis, which was defined on the basis of morphological criteria only, is a species complex.

Physiological condition of juvenile wading birds in relation to multiple landscape stressors in the Florida Everglades: effects of hydrology, prey availability, and mercury bioaccumulation.

Directory of Open Access Journals (Sweden)

Garth Herring

Full Text Available The physiological condition of juvenile birds can be influenced by multiple ecological stressors, and few studies have concurrently considered the effects of environmental contaminants in combination with ecological attributes that can influence foraging conditions and prey availability. Using three temporally distinct indices of physiological condition, we compared the physiological response of nestling great egrets (Ardea alba and white ibises (Eudocimus albus to changing prey availability, hydrology (water depth, recession rate, and mercury exposure in the Florida Everglades. We found that the physiological response of chicks varied between species and among environmental variables. Chick body condition (short-term index and fecal corticosterone levels (medium-term were influenced by wetland water depth, prey availability, region, and age, but not by mercury contamination. However, mercury exposure did influence heat shock protein 70 (HSP70 in egret chicks, indicating a longer-term physiological response to contamination. Our results indicate that the physiological condition of egret and ibis chicks were influenced by several environmental stressors, and the time frame of the effect may depend on the specialized foraging behavior of the adults provisioning the chicks.

Physiological condition of juvenile wading birds in relation to multiple landscape stressors in the Florida Everglades: effects of hydrology, prey availability, and mercury bioaccumulation

Science.gov (United States)

Herring, Garth; Eagles-Smith, Collin A.; Gawlik, Dale E.; Beerens, James M.; Ackerman, Joshua T.

2014-01-01

The physiological condition of juvenile birds can be influenced by multiple ecological stressors, and few studies have concurrently considered the effects of environmental contaminants in combination with ecological attributes that can influence foraging conditions and prey availability. Using three temporally distinct indices of physiological condition, we compared the physiological response of nestling great egrets (Ardea alba) and white ibises (Eudocimus albus) to changing prey availability, hydrology (water depth, recession rate), and mercury exposure in the Florida Everglades. We found that the physiological response of chicks varied between species and among environmental variables. Chick body condition (short-term index) and fecal corticosterone levels (medium-term) were influenced by wetland water depth, prey availability, region, and age, but not by mercury contamination. However, mercury exposure did influence heat shock protein 70 (HSP70) in egret chicks, indicating a longer-term physiological response to contamination. Our results indicate that the physiological condition of egret and ibis chicks were influenced by several environmental stressors, and the time frame of the effect may depend on the specialized foraging behavior of the adults provisioning the chicks.

Waterbirds diversity in Peniti mangrove forest, Pontianak Regency

Directory of Open Access Journals (Sweden)

DEWI ELFIDASARI

2006-01-01

Full Text Available The aim of this research was to know waterbirds diversity in the Peniti mangrove forest, Pontianak Regency. This research was found 19 species (9 families of waterbirds that living in the Peniti mangrove forest, Pontianak Regency, West Kalimantan. This identification showed that four species were member of Sternitidae Family, three species were member of Ardeidae Family, other three species were member of Anatidae Family, two species were member of Laridae Family, two species from Accipritidae Family, and Alcedinidae Family. One species from Ciconidae Family, Scolopacidae Family, and Ploceidae Family. Thirteen species of them were protected in Indonesia; there were Egretta garzetta, E. sacra, Ardea cinerea, Ciconia episcopus, Larus ridibundus, L. brunnicephalus, Sterna sumatrana, S. dougallii, Anous minutus, Gygis alba, Halcyon pileata, Todirhamphus chloris, and Lonchura fuscans. Lochura fuscans was belonging to Indonesian endemic birds, because we only found this bird species in Kalimantan Islands. Two species, Haliaetus leucogaster and Haliastur indus were the International protected species according to Appendix II Convention on International Trade in Endangered Species (CITES.

Physiological condition of juvenile wading birds in relation to multiple landscape stressors in the Florida Everglades: effects of hydrology, prey availability, and mercury bioaccumulation.

Science.gov (United States)

Herring, Garth; Eagles-Smith, Collin A; Gawlik, Dale E; Beerens, James M; Ackerman, Joshua T

2014-01-01

The physiological condition of juvenile birds can be influenced by multiple ecological stressors, and few studies have concurrently considered the effects of environmental contaminants in combination with ecological attributes that can influence foraging conditions and prey availability. Using three temporally distinct indices of physiological condition, we compared the physiological response of nestling great egrets (Ardea alba) and white ibises (Eudocimus albus) to changing prey availability, hydrology (water depth, recession rate), and mercury exposure in the Florida Everglades. We found that the physiological response of chicks varied between species and among environmental variables. Chick body condition (short-term index) and fecal corticosterone levels (medium-term) were influenced by wetland water depth, prey availability, region, and age, but not by mercury contamination. However, mercury exposure did influence heat shock protein 70 (HSP70) in egret chicks, indicating a longer-term physiological response to contamination. Our results indicate that the physiological condition of egret and ibis chicks were influenced by several environmental stressors, and the time frame of the effect may depend on the specialized foraging behavior of the adults provisioning the chicks.

Seasonal distribution of bird populations at the Patuxent Research Refuge

Science.gov (United States)

Hoffman, D.J.; Henny, C.J.; Hill, E.F.; Keith, J.A.; Grove, R.A.

2000-01-01

High concentrations of mercury from past mining activities have accumulated in the food chain of fish-eating birds nesting along the mid to lower Carson River. Activities of nine plasma and tissue enzymes, and concentrations of other plasma and tissue constituents were measured for black-crowned night-heron, Nycticorax nycticorax, (BCNH) and snowy egret, Egretta thula, (SE) nestlings from two high mercury sites and one low mercury site. Geometric mean blood Hg concentrations for BCNHs at the high mercury sites were 2.6 and 2.8 ppm (ww) and 0.6 ppm at the low mercury site. Blood concentrations for SEs were 3.6 and 1.9 ppm at the high mercury sites and 0.7 ppm at the low mercury site. In BCNHs plasma glutathione peroxidase (GSH peroxidase) activity was lower in both high mercury sites relative to the low mercury site. Butyryl cholinesterase (BuChe), ALT, glutathione reductase (GSSG-reductase) and LDH-L activities were lower in one high mercury site. In SEs significant differences were lower BuChe and LDH-L, but elevated GGT activities. Evidence of renal stress in both species at high mercury sites included increased plasma uric acid, blood urea nitrogen, and creatinine concentrations as well as oxidative stress in the kidney tissue itself where oxidized glutathione increased. A number of the mercury site-related effects, including decreased plasma GSH-peroxidase and hepatic G-6-PDH activities, higher GSSG-reductase activity, and lower hepatic concentrations of reduced thiols have been reported in methylmercury feeding studies with great egrets and mallards. These findings suggest the utility of herons and egrets for monitoring mercury sites.

A male hooded merganser swims in the waters of KSC

Science.gov (United States)

1999-01-01

The distinctive fan-shaped, black-bordered crest and striped breast identify this hooded merganser, swimming in the waters of the Merritt Island National Wildlife Refuge at Kennedy Space Center. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.

A merganser swims in the waters of KSC

Science.gov (United States)

1999-01-01

A young female red-breasted merganser swims in the quicksilver water of the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000- acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.

Toxicological benchmarks for wildlife. Environmental Restoration Program

Energy Technology Data Exchange (ETDEWEB)

Opresko, D.M.; Sample, B.E.; Suter, G.W.

1993-09-01

This report presents toxicological benchmarks for assessment of effects of 55 chemicals on six representative mammalian wildlife species (short-tailed shrew, white-footed mouse, cottontail ink, red fox, and whitetail deer) and eight avian wildlife species (American robin, woodcock, wild turkey, belted kingfisher, great blue heron, barred owl, Cooper`s hawk, and redtailed hawk) (scientific names are presented in Appendix C). These species were chosen because they are widely distributed and provide a representative range of body sizes and diets. The chemicals are some of those that occur at United States Department of Energy (DOE) waste sites. The benchmarks presented in this report are values believed to be nonhazardous for the listed wildlife species.

Tracing the becoming of reflective practitioner through the enactment of epistemic practices

DEFF Research Database (Denmark)

Trenca, Mihaela

2016-01-01

Purpose - This paper aims to develop a conceptual framework for tracing the cognitive and affective micro-processes management accountants can draw upon to construct themselves as reflective practitioners within organizational context. Design/methodology/approach - Drawing on pragmatic...... constructivism and Heron's (1992) theory of learning and personhood, the framework provides a methodology for tracing the way management accountants can construct themselves as reflective practitioners by enactig epistemic practices (Cetina, 2001). Furthermore, we enquire into the epistemological requirements...... for creating trustworthy knowledge and the processes through which actors can diminish the proactive-pragmatic truth gap. Findings - The framework shows how the participatory function of the mind, deeply rooted in affective processes, is implicated in creating empathic engagement with epistemic objects...

Identification of Giardia species and Giardia duodenalis assemblages by sequence analysis of the 5.8S rDNA gene and internal transcribed spacers.

Science.gov (United States)

Cacciò, Simone M; Beck, Relja; Almeida, Andre; Bajer, Anna; Pozio, Edoardo

2010-05-01

PCR assays have been developed mainly to assist investigations into the epidemiology of Giardia duodenalis, the only species in the Giardia genus having zoonotic potential. However, a reliable identification of all species is of practical importance, particularly when water samples and samples from wild animals are investigated. The aim of the present work was to genotype Giardia species and G. duodenalis assemblages using as a target the region spanning the 5.8S gene and the 2 flanking internal transcribed spacers (ITS1 and ITS2) of the ribosomal gene. Primers were designed to match strongly conserved regions in the 3' end of the small subunit and in the 5' end of the large subunit ribosomal genes. The corresponding region (about 310 bp) was amplified from 49 isolates of both human and animal origin, representing all G. duodenalis assemblages as well as G. muris and G. microti. Sequence comparison and phylogenetic analysis showed that G. ardeae, G. muris, G. microti as well as the 7 G. duodenalis assemblages can be easily distinguished. Since the major subgroups within the zoonotic assemblages A and B can be identified by sequence analysis, this assay is also informative for molecular epidemiological studies.

KSC-04PD-0045

Science.gov (United States)

2004-01-01

KENNEDY SPACE CENTER, FLA. -- Three male and one female hooded mergansers swim in the quicksilver water of the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.

Hooded mergansers swim in the waters of KSC

Science.gov (United States)

1999-01-01

A male and two female hooded mergansers swim in the waters of the Merritt Island National Wildlife Refuge at Kennedy Space Center. The male displays its distinctive fan-shaped, black-bordered crest. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.

A female hooded merganser swims in the waters of KSC

Science.gov (United States)

1999-01-01

A female hooded merganser swims solo in the waters of the Merritt Island National Wildlife Refuge at Kennedy Space Center. The male is distinguished by a fan-shaped, black-bordered crest and striped breast. Usually found from Alaska and Canada south to Nebraska, Oregon and Tennessee, hooded mergansers winter south to Mexico and the Gulf Coast, including KSC. The open water of the refuge provides wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds. The 92,000-acre refuge is also habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles.

Marine Bioinorganic Chemistry Workshop Held in Heron Island on 28 June - 2nd July 1989

Science.gov (United States)

1990-02-09

Vilter, H. Phytochemistry, 1984, 23, 1387-1390. 2. Vilter, H. Botanica Marina, 1983, 26, 451-455. 3. Wever, R., Plat, H. and De Boer, E., Biochim. Biophys...and DSc (1977) Vf degrees from the University of Melbourne, where he held teaching and research positions. His major research interests involve the

Development of species-specific rDNA probes for Giardia by multiple fluorescent in situ hybridization combined with immunocytochemical identification of cyst wall antigens.

Science.gov (United States)

Erlandsen, Stanley L; Jarroll, Edward; Wallis, Peter; van Keulen, Harry

2005-08-01

In this study, we describe the development of fluorescent oligonucleotide probes to variable regions in the small subunit of 16S rRNA in three distinct Giardia species. Sense and antisense probes (17-22 mer) to variable regions 1, 3, and 8 were labeled with digoxygenin or selected fluorochomes (FluorX, Cy3, or Cy5). Optimal results were obtained with fluorochome-labeled oligonucleotides for detection of rRNA in Giardia cysts. Specificity of fluorescent in situ hybridization (FISH) was shown using RNase digestion and high stringency to diminish the hybridization signal, and oligonucleotide probes for rRNA in Giardia lamblia, Giardia muris, and Giardia ardeae were shown to specifically stain rRNA only within cysts or trophozoites of those species. The fluorescent oligonucleotide specific for rRNA in human isolates of Giardia was positive for ten different strains. A method for simultaneous FISH detection of cysts using fluorescent antibody (genotype marker) and two oligonucleotide probes (species marker) permitted visualization of G. lamblia and G. muris cysts in the same preparation. Testing of an environmental water sample revealed the presence of FISH-positive G. lamblia cysts with a specific rDNA probe for rRNA, while negative cysts were presumed to be of animal or bird origin.

Stable isotope tracing of trout hatchery carbon to sediments and foodwebs of limestone spring creeks

Energy Technology Data Exchange (ETDEWEB)

Hurd, Todd M. [Department of Biology, Shippensburg University, 1871 Old Main Dr., Shippensburg, PA 17257 (United States)], E-mail: tmhurd@ship.edu; Jesic, Slaven; Jerin, Jessica L.; Fuller, Nathan W.; Miller, David [Department of Biology, Shippensburg University, 1871 Old Main Dr., Shippensburg, PA 17257 (United States)

2008-11-01

Limestone springs support productive ecosystems and fisheries, yet aquaculture may modify or impair these ecosystems. We determined trout hatchery organic contribution to spring creek sediments and foodwebs with natural abundance stable isotope methods. Hatchery feed, waste, and trout were significantly enriched in {delta}{sup 13}C relative to autotrophs and wild fish. Spring creek sediments were enriched in {delta}{sup 13}C toward the hatchery endmember relative to reference streams without hatcheries and relative to a larger larger-order, spring-influenced stream. Contribution of hatchery C to spring creek sediments was greatest during March and associated with greatest sediment %C. Contribution of hatchery C to pollution-tolerant isopod diet was 39-51% in a stream receiving limestone spring water via hatchery effluent. Isopods of one spring creek also relied on hatchery-derived C within one month of hatchery closure. Four years later, less pollution pollution-tolerant amphipods dominated and consumed non-vascular over vascular autotrophs (86%). Isopods of a second spring creek with an active hatchery did not appear to be using hatchery matter directly, but were enriched in {delta}{sup 34}S relative to a spring creek tributary with no hatchery influence. Isopods in both of these streams were relatively enriched in {delta}{sup 15}N, indicating general nutrient enrichment from surrounding agricultural land use. The contribution of hatchery vs. wild fish in diet of herons and egrets was traced with {delta}{sup 13}C of guano. These birds were strongly dependent on stocked trout in a spring creek with a recently closed state trout hatchery, and also near another large, state-run hatchery. Heron dependence on hatchery fish in the spring creek decreased with time since hatchery closure. Use of stable isotope natural abundance techniques in karst spring creeks can reveal stream impairment due to aquaculture, specific C sources to bio-indicating consumers, losses of

Stable isotope tracing of trout hatchery carbon to sediments and foodwebs of limestone spring creeks

International Nuclear Information System (INIS)

Hurd, Todd M.; Jesic, Slaven; Jerin, Jessica L.; Fuller, Nathan W.; Miller, David

2008-01-01

Limestone springs support productive ecosystems and fisheries, yet aquaculture may modify or impair these ecosystems. We determined trout hatchery organic contribution to spring creek sediments and foodwebs with natural abundance stable isotope methods. Hatchery feed, waste, and trout were significantly enriched in δ 13 C relative to autotrophs and wild fish. Spring creek sediments were enriched in δ 13 C toward the hatchery endmember relative to reference streams without hatcheries and relative to a larger larger-order, spring-influenced stream. Contribution of hatchery C to spring creek sediments was greatest during March and associated with greatest sediment %C. Contribution of hatchery C to pollution-tolerant isopod diet was 39-51% in a stream receiving limestone spring water via hatchery effluent. Isopods of one spring creek also relied on hatchery-derived C within one month of hatchery closure. Four years later, less pollution pollution-tolerant amphipods dominated and consumed non-vascular over vascular autotrophs (86%). Isopods of a second spring creek with an active hatchery did not appear to be using hatchery matter directly, but were enriched in δ 34 S relative to a spring creek tributary with no hatchery influence. Isopods in both of these streams were relatively enriched in δ 15 N, indicating general nutrient enrichment from surrounding agricultural land use. The contribution of hatchery vs. wild fish in diet of herons and egrets was traced with δ 13 C of guano. These birds were strongly dependent on stocked trout in a spring creek with a recently closed state trout hatchery, and also near another large, state-run hatchery. Heron dependence on hatchery fish in the spring creek decreased with time since hatchery closure. Use of stable isotope natural abundance techniques in karst spring creeks can reveal stream impairment due to aquaculture, specific C sources to bio-indicating consumers, losses of farmed fish to predation, and potential exposure

H5N1 surveillance in migratory birds in Java, Indonesia.

Science.gov (United States)

Stoops, Arthur C; Barbara, Katie A; Indrawan, Mochamad; Ibrahim, Ima N; Petrus, Wicaksana B; Wijaya, Susan; Farzeli, Arik; Antonjaya, Ungke; Sin, Lim W; Hidayatullah, N; Kristanto, Ige; Tampubolon, A M; Purnama, S; Supriatna, Adam; Burgess, Timothy H; Williams, Maya; Putnam, Shannon D; Tobias, Steve; Blair, Patrick J

2009-12-01

We sought to elucidate the role of migratory birds in transmission of H5N1 in an enzoonotic area. Resident, captive, and migratory birds were sampled at five sites in Java, Indonesia. Mist nets were used to trap birds. Birds were identified to species. RNA was extracted from swabs and reverse transcriptase polymerase chain reaction (RT-PCR) conducted for the HA and M genes of H5N1. Antibodies were detected by enzyme-linked immunosorbent assay and hemagglutination inhibition test. Between October 2006 and September 2007, a total of 4,067 captive, resident, and migratory birds comprising 98 species in 23 genera were sampled. The most commonly collected birds were the common sandpiper (6% of total), striated heron (3%), and the domestic chicken (14%). The overall prevalence of H5N1 antibodies was 5.3%. A significantly higher percentage of captive birds (16.1%) showed antibody evidence of H5N1 exposure when compared to migratory or resident birds. The greatest number of seropositive birds in each category were Muschovy duck (captive), striated heron (resident), and the Pacific golden plover (migratory). Seven apparently well captive birds yielded molecular evidence of H5N1 infection. Following amplification, the HA, NA, and M genes were analyzed. Phylogenetic analysis of the HA gene showed that the isolates were 97% similar to EU124153.1 A/chicken/West Java/Garut May 2006, an isolate obtained in a similar region of West Java. While no known markers of neuraminidase inhibitor resistance were found within the NA gene, M segment analysis revealed the V27A mutation known to confer resistance to adamantanes. Our results demonstrate moderate serologic evidence of H5N1 infection in captive birds, sampled in five sites in Java, Indonesia, but only occasional infection in resident and migratory birds. These data imply that in an enzoonotic region of Indonesia the role of migratory birds in transmission of H5N1 is limited.

Six Month In Situ High-Resolution Carbonate Chemistry and Temperature Study on a Coral Reef Flat Reveals Asynchronous pH and Temperature Anomalies.

Directory of Open Access Journals (Sweden)

David I Kline

Full Text Available Understanding the temporal dynamics of present thermal and pH exposure on coral reefs is crucial for elucidating reef response to future global change. Diel ranges in temperature and carbonate chemistry parameters coupled with seasonal changes in the mean conditions define periods during the year when a reef habitat is exposed to anomalous thermal and/or pH exposure. Anomalous conditions are defined as values that exceed an empirically estimated threshold for each variable. We present a 200-day time series from June through December 2010 of carbonate chemistry and environmental parameters measured on the Heron Island reef flat. These data reveal that aragonite saturation state, pH, and pCO2 were primarily modulated by biologically-driven changes in dissolved organic carbon (DIC and total alkalinity (TA, rather than salinity and temperature. The largest diel temperature ranges occurred in austral spring, in October (1.5 - 6.6°C and lowest diel ranges (0.9 - 3.2°C were observed in July, at the peak of winter. We observed large diel total pH variability, with a maximum range of 7.7 - 8.5 total pH units, with minimum diel average pH values occurring during spring and maximum during fall. As with many other reefs, the nighttime pH minima on the reef flat were far lower than pH values predicted for the open ocean by 2100. DIC and TA both increased from June (end of Fall to December (end of Spring. Using this high-resolution dataset, we developed exposure metrics of pH and temperature individually for intensity, duration, and severity of low pH and high temperature events, as well as a combined metric. Periods of anomalous temperature and pH exposure were asynchronous on the Heron Island reef flat, which underlines the importance of understanding the dynamics of co-occurrence of multiple stressors on coastal ecosystems.

Six Month In Situ High-Resolution Carbonate Chemistry and Temperature Study on a Coral Reef Flat Reveals Asynchronous pH and Temperature Anomalies.

Science.gov (United States)

Kline, David I; Teneva, Lida; Hauri, Claudine; Schneider, Kenneth; Miard, Thomas; Chai, Aaron; Marker, Malcolm; Dunbar, Rob; Caldeira, Ken; Lazar, Boaz; Rivlin, Tanya; Mitchell, Brian Gregory; Dove, Sophie; Hoegh-Guldberg, Ove

2015-01-01

Understanding the temporal dynamics of present thermal and pH exposure on coral reefs is crucial for elucidating reef response to future global change. Diel ranges in temperature and carbonate chemistry parameters coupled with seasonal changes in the mean conditions define periods during the year when a reef habitat is exposed to anomalous thermal and/or pH exposure. Anomalous conditions are defined as values that exceed an empirically estimated threshold for each variable. We present a 200-day time series from June through December 2010 of carbonate chemistry and environmental parameters measured on the Heron Island reef flat. These data reveal that aragonite saturation state, pH, and pCO2 were primarily modulated by biologically-driven changes in dissolved organic carbon (DIC) and total alkalinity (TA), rather than salinity and temperature. The largest diel temperature ranges occurred in austral spring, in October (1.5 - 6.6°C) and lowest diel ranges (0.9 - 3.2°C) were observed in July, at the peak of winter. We observed large diel total pH variability, with a maximum range of 7.7 - 8.5 total pH units, with minimum diel average pH values occurring during spring and maximum during fall. As with many other reefs, the nighttime pH minima on the reef flat were far lower than pH values predicted for the open ocean by 2100. DIC and TA both increased from June (end of Fall) to December (end of Spring). Using this high-resolution dataset, we developed exposure metrics of pH and temperature individually for intensity, duration, and severity of low pH and high temperature events, as well as a combined metric. Periods of anomalous temperature and pH exposure were asynchronous on the Heron Island reef flat, which underlines the importance of understanding the dynamics of co-occurrence of multiple stressors on coastal ecosystems.

Trace elements in livers of great egret (Ardea alba) from the Sao Paulo Metropolitan Region: a preliminary assessment of temporal trends

Energy Technology Data Exchange (ETDEWEB)

Silva, Rita de Cassia A.; Saiki, Mitiko; Moreira, Edson G., E-mail: rcsilva@ipen.br, E-mail: mitiko@ipen.br, E-mail: emoreira@ipen.br, E-mail: poliver@usp.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Oliveira, Paulo T.M.S., E-mail: poliver@usp.br [Universidade de Sao Paulo (IME/USP), Sao Paulo, SP (Brazil). Inst. de Matematica e Estatistica

2015-07-01

This study aimed to assess the variation of trace element concentrations present in great egret livers during six years, from 2006 to 2011. The data were obtained in twenty six livers of great egrets from the Sao Paulo Metropolitan Region (SPMR). The elements Br, Co, Cs, Cu, Fe, K, Mg, Mn, Na, Rb, Se and Zn were determined by using Instrumental Neutron Activation Analysis (INAA) and Cd and Hg by Atomic Absorption Spectrometry (AAS). Arithmetic means and standard deviations of element concentrations of the results obtained in each year were calculated for the samples collected in each year. Analysis of variance (ANOVA; α = 0.05) followed by Kruskal Wallis test was applied to examine if there are temporal differences in the element mean concentrations over time. In general, significant differences of element concentrations were not obtained. However, an increase in Cd and Mn concentrations in the recent years was observed which may indicate recent increase to these elements in environment. The preliminary data obtained suggests the continuation of this kind of study to better understand the temporal trends of trace elements in the aquatic environment of SPMR. (author)

Trace elements in livers of great egret (Ardea alba) from the Sao Paulo Metropolitan Region: a preliminary assessment of temporal trends

International Nuclear Information System (INIS)

Silva, Rita de Cassia A.; Saiki, Mitiko; Moreira, Edson G.; Oliveira, Paulo T.M.S.

2015-01-01

This study aimed to assess the variation of trace element concentrations present in great egret livers during six years, from 2006 to 2011. The data were obtained in twenty six livers of great egrets from the Sao Paulo Metropolitan Region (SPMR). The elements Br, Co, Cs, Cu, Fe, K, Mg, Mn, Na, Rb, Se and Zn were determined by using Instrumental Neutron Activation Analysis (INAA) and Cd and Hg by Atomic Absorption Spectrometry (AAS). Arithmetic means and standard deviations of element concentrations of the results obtained in each year were calculated for the samples collected in each year. Analysis of variance (ANOVA; α = 0.05) followed by Kruskal Wallis test was applied to examine if there are temporal differences in the element mean concentrations over time. In general, significant differences of element concentrations were not obtained. However, an increase in Cd and Mn concentrations in the recent years was observed which may indicate recent increase to these elements in environment. The preliminary data obtained suggests the continuation of this kind of study to better understand the temporal trends of trace elements in the aquatic environment of SPMR. (author)

Echinobothrium chisholmae n. sp. (Cestoda, Diphyllidea) from the giant shovel-nose ray Rhinobatos typus from Australia, with observations on the ultrastructure of its scolex musculature and peduncular spines.

Science.gov (United States)

Jones, M K; Beveridge, I

2001-09-01

Echinobothrium chisholmae n. sp. is described from Rhinobatos typus Bennett (Rhinobatidae), collected from Heron Island, Great Barrier Reef, Australia. E. chisholmae differs from all congeners in possessing 11 hooks in each dorsal and ventral group on the rostellum and groups of 3-6 hooklets on either side of the hooks. A single metacestode of E. chisholmae was collected from the decapod crustacean Penaeus longistylus Kubo. Yellow pigmentation of the cephalic peduncle in immature adults is caused by the accumulation of large vesicles in the distal cytoplasm of the tegument. The vesicles probably provide materials for spine formation. Ultrastructural examination of the rostellar musculature revealed that the muscles are stratified (striated-like), consisting of a periodic repetition of sarcomeres separated by perforated Z-like lines that are oblique to the long axes of the myofilaments.

Water chemistry, seepage investigation, streamflow, reservoir storage, and annual availability of water for the San Juan-Chama Project, northern New Mexico, 1942-2010

Science.gov (United States)

McKean, Sarah E.; Anderholm, Scott K.

2014-01-01

The Albuquerque Bernalillo County Water Utility Authority supplements the municipal water supply for the Albuquerque metropolitan area, in central New Mexico, with surface water diverted from the Rio Grande. The U.S. Geological Survey, in cooperation with the Albuquerque Bernalillo County Water Utility Authority, undertook this study in which water-chemistry data and historical streamflow were compiled and new water-chemistry data were collected to characterize the water chemistry and streamflow of the San Juan-Chama Project (SJCP). Characterization of streamflow included analysis of the variability of annual streamflow and comparison of the theoretical amount of water that could have been diverted into the SJCP to the actual amount of water that was diverted for the SJCP. Additionally, a seepage investigation was conducted along the channel between Azotea Tunnel Outlet and the streamflow-gaging station at Willow Creek above Heron Reservoir to estimate the magnitude of the gain or loss in streamflow resulting from groundwater interaction over the approximately 10-mile reach. Generally, surface-water chemistry varied with streamflow throughout the year. Streamflow ranged from high flow to low flow on the basis of the quantity of water diverted from the Rio Blanco, Little Navajo River, and Navajo River for the SJCP. Vertical profiles of the water temperature over the depth of the water column at Heron Reservoir indicated that the reservoir is seasonally stratified. The results from the seepage investigations indicated a small amount of loss of streamflow along the channel. Annual variability in streamflow for the SJCP was an indication of the variation in the climate parameters that interact to contribute to streamflow in the Rio Blanco, Little Navajo River, Navajo River, and Willow Creek watersheds. For most years, streamflow at Azotea Tunnel Outlet started in March and continued for approximately 3 months until the middle of July. The majority of annual streamflow

THE SYMBOLS OF PRIDE AND PRIVILEGE IN OTTOMAN POETRY “WREATH” “OTAGA” “AIGRETTE” / OSMANLI ŞİİRİNDE İFTİHAR VE İMTİYAZ SİMGELERİ “ÇELENK” “OTAGA” ve “SORGUÇ”

Directory of Open Access Journals (Sweden)

Neslihan KOÇ KESKİN (M.A.H.

2007-11-01

Full Text Available Ottoman Poets have studied the Turkish cultural history with a lyrical expression in their poems and tried to adapt this culturel accumulation to the readers through their poems in an aesthetical way. In this paper, wreath, otaga and aigrette which are the symbols of pride/boast and privilege/exclusivity and can be qaulified as a type of medal have been studied. At first putting the feathers of precious animals such as a heron, a peacock and a crane and then valuable jewels to the head, kavuk and turbans have also been thought as the sign of sovereignity. At the same time, these correspond to the medals and badges of the kings in the west . In our paper, how wreath, otaka and aigrette are taken in hand in Ottoman poetry will be presented in a historically supported frame.

Estuarine predation on radiotagged wild and domesticated sea trout ( Salmo trutta L.) smolts

DEFF Research Database (Denmark)

Dieperink, C.; Pedersen, Stig; Pedersen, Michael Ingemann

2001-01-01

days after entering the sea, both wild and domesticated smolts suffered a severe daily predation rate (range 20-34%). The results support the hypothesis of a transient period immediately after exposure to full-strength sea water, where smolts experience an elevated risk of predation. A transient......Avian predation on emigrating wild and domesticated sea trout smolts was investigated in a fjord in the western Baltic Sea. In April 1997, 50 domesticated and 50 wild smolts were intraperitoneally tagged with radio-transmitters and released in a small coastal stream. Predation was recorded...... by signal interception in an estuarine breeding colony of cormorants and herons near the outlet of the stream. Of the 78 emigrating smolts, 51 (65%) were recorded as eaten. Predation rates were significantly higher among small than large smolts and significantly higher among domesticated smolts. The first 2...

OPTION OF USERS IN SURGICAL CONTRACEPTION FAMILY HEALTH UNIT

Directory of Open Access Journals (Sweden)

Vagner Ferreira do Nascimento

2013-09-01

Full Text Available The study is a descriptive and quantitative approach, which aimed to meet customers the option of surgical contraception by a Family Health Unit in the municipality of Barra do Herons - Mato Grosso. Data were collected on 22 forms of reference that would be forwarded to the sector and family planning counseling. Data were collected and grouped by age, marital status, gender, children and quantitative choice of surgical method of contraception. The period of data collection occurred from March to December 2011. The age group with the highest participation was from 18 to 25 years. Predominantly single, female, with two sons and opting for sterilization. The variety of options to be used as contraceptive methods should be widely publicized and encouraged by health professionals, leaving the surgical methods of reversible or irreversible disruption as a last choice.

Soil Nitrogen Availability Is Reflected in the Bacterial Pathway1

Institute of Scientific and Technical Information of China (English)

V.KRIVTSOV; B.S.GRIFFITHS; K.LIDDELL; A.GARSIDE; R.SALMOND; T.BEZGINOVA; J.THOMPSON

2011-01-01

Measurements of concentrations of easily extractable soil nitrogen (N) were carried out on samples collected at the Heron Wood Reserve, Scotland, concurrently with investigations of N associated with total microbial biomass and the abundances of bacteria,fungi, and invertebrates. Soil biota at the studied site appeared to be limited by N. There was a remarkable difference between the ambient (i.e., easily extractable N) and biomass nitrogen. The abundance data of bacteria, protozoa and nematodes significantly negatively correlated with ambient N but showed positive correlations with the total microbial N content. There were, however,remarkable differences between the correlation patterns exhibited by the fungal and the bacterial pathways, as fungi did not show any correlations with chemical variables. These differences should be taken into account whilst interpreting biological interactions both at this important site and elsewhere.

A Modern Sr/Ca-δ18O-Sea Surface Temperature Calibration for Isopora Corals in the Great Barrier Reef

Science.gov (United States)

Brenner, L. D.; Linsley, B. K.; Potts, D. C.

2014-12-01

Most coral-based paleoceanographic studies have used massive colonies of Porites or Faviidae, due to their long, continuously accreted skeletal records and sub-annual resolution, but other sub-massive corals provide an untapped resource. The genus Isopora is a dominant reef builder in some high-energy environments in the tropical western Pacific, and was a major component of cores recovered on IODP Leg 325 off the Great Barrier Reef (GBR). Despite its abundance, Isopora remains largely unexplored and hence underutilized in paleoceanographic studies. We present a modern Sr/Ca-δ18O-Sea Surface Temperature (SST) calibration of modern Isopora corals (n=3) collected from inner and outer reef locations ranging from 1-13m depth by Heron Island in the southern GBR in 2012. Pairing the Isopora Sr/Ca record with monthly SST yielded an average relationship of SST=-11.48×(Sr/Ca)+131.1 (r2 = 0.42-0.78). The Sr/Ca sensitivity of -0.087 mmol/mol/°C is similar to the sensitivity for Porites that was corrected for tissue layer smoothing effects determined by Gagan et al. (2012). The similarity between our Sr/Ca-SST sensitivity and the corrected sensitivity for Porites suggests tissue layer effects are minimal in Isopora. The mean annual SST amplitude recorded by the corals from 2008-2011 (full annual cycles) was 5.3°C and the average δ18O annual cycle of 1.1‰ approximates that expected if salinity had little effect on coral δ18O, assuming a previously established conversion of -0.23‰ (δ18O)/°C for biogenic aragonite. The average annual salinity amplitude of 0.3 in gridded data from around Heron Island supports our conclusion that δ18O variability is forced almost completely by SST. This modern Sr/Ca-SST calibration will expand the paleoceanographic utility of Isopora and, by assisting interpretation of Sr/Ca data from fossil corals collected during IODP 325, will better constrain the timing and magnitude of sea level changes and surface conditions since the Last

Sandhill cranes browse for food near VAB

Science.gov (United States)

2000-01-01

A family of sandhill cranes searches for food on the grounds near the Vehicle Assembly Building. The cranes have been a constant sight in the Launch Complex 39 area during the month of May. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

Sandhill cranes hunting food at KSC

Science.gov (United States)

2000-01-01

A pair of Sandhill Cranes searches for food with their still- fluffy fledgling close by. The trio have been seen wandering the grassy areas in the KSC Launch Complex 39 area. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

Life history types and strategies

DEFF Research Database (Denmark)

Boel, Mikkel

strategies and types in migratory freshwater fish, using brown trout and alewife as study organisms. Firstly, we investigated underlying mechanisms of resident and migratory life history strategies of salmonids, using indicators for nutritional status, stress, tissue damage and smoltification. Secondly...... III the minimum predation from cormorants and herons was estimated over a three year period on the brown trout population of of Lake Hald. The magnitude of the predation pressure from both bird species were very similar and when summed up, the avian predation accounted for an average minimum of 37.......2 % of the annual brown trout mortality in the lake and 10.1 % in the tributaries. This result illustrates that avian predation in the lake can be quite substantial and potentially plays an important role in the population dynamics of brown trout. Cormorants alone were responsible 21.2% in the lake and the arrival...

Burlington Bottoms Wildlife Mitigation Project. Final Environmental Assessment/Management Plan and Finding of No Significant Impact.

Energy Technology Data Exchange (ETDEWEB)

1994-12-01

Bonneville Power Administration (BPA) proposes to fund wildlife management and enhancement activities for the Burlington bottoms wetlands mitigation site. Acquired by BPA in 1991, wildlife habitat at Burlington bottoms would contribute toward the goal of mitigation for wildlife losses and inundation of wildlife habitat due to the construction of Federal dams in the lower Columbia and Willamette River Basins. Target wildlife species identified for mitigation purposes are yellow warbler, great blue heron, black-capped chickadee, red-tailed hawk, valley quail, spotted sandpiper, wood duck, and beaver. The Draft Management Plan/Environmental Assessment (EA) describes alternatives for managing the Burlington Bottoms area, and evaluates the potential environmental impacts of the alternatives. Included in the Draft Management Plan/EA is an implementation schedule, and a monitoring and evaluation program, both of which are subject to further review pending determination of final ownership of the Burlington Bottoms property.

Burlington Bottoms Wildlife Mitigation Project. Final environmental assessment/management plan and finding of no significant impact

International Nuclear Information System (INIS)

1994-12-01

Bonneville Power Administration (BPA) proposes to fund wildlife management and enhancement activities for the Burlington bottoms wetlands mitigation site. Acquired by BPA in 1991, wildlife habitat at Burlington bottoms would contribute toward the goal of mitigation for wildlife losses and inundation of wildlife habitat due to the construction of Federal dams in the lower Columbia and Willamette River Basins. Target wildlife species identified for mitigation purposes are yellow warbler, great blue heron, black-capped chickadee, red-tailed hawk, valley quail, spotted sandpiper, wood duck, and beaver. The Draft Management Plan/Environmental Assessment (EA) describes alternatives for managing the Burlington Bottoms area, and evaluates the potential environmental impacts of the alternatives. Included in the Draft Management Plan/EA is an implementation schedule, and a monitoring and evaluation program, both of which are subject to further review pending determination of final ownership of the Burlington Bottoms property

Diversity and prevalence of hemoparasites of wading birds in southern Florida, USA.

Science.gov (United States)

Coker, Sarah M; Hernandez, Sonia M; Kistler, Whitney M; Curry, Shannon E; Welch, Catharine N; Barron, Heather W; Harsch, Stefan; Murray, Maureen H; Yabsley, Michael J

2017-12-01

Relatively few studies on hemoparasites have been conducted on wading birds in the families Ardeidae and Threskiornithidae (order Pelecaniformes), especially in the United States. In this study, we obtained baseline data on the prevalence and genetic diversity of haemosporidian parasites in wading birds opportunistically sampled from southern Florida, USA. We detected blood parasites in White Ibis ( Eudocimus albus ), Glossy Ibis ( Plegadis falcinellus ), Green Heron ( Butorides virescens ), and Roseate Spoonbill ( Platalea ajaja ) with several novel host-parasite relationships. Infected birds had low parasitemias (average 0.77%, range 0-4%) suggesting that infections were chronic. Despite the low sample sizes for several of our sampled species, these data highlight the diversity of parasites in this understudied group of birds and suggest that additional studies are needed to investigate the potential impacts of these parasites on their health, especially since southern Florida is becoming increasingly urbanized which can alter parasite transmission or host susceptibility.

Reproduction in eastern screech-owls fed selenium

Science.gov (United States)

Wiemeyer, Stanley N.; Hoffman, D.J.

1996-01-01

Raptors are occasionally exposed to excessive selenium from contaminated prey, but the effects of this exposure on reproduction are unknown. Therefore, we fed captive eastern screech-owls (Otus asio) diets containing 0, 4.4, or 13.2 ppm (wet wt) added selenium in the form of seleno-DL-methionine. Adult mass at sacrifice and reproductive success of birds receiving 13.2 ppm selenium were depressed (P biochemistries indicative of oxidative stress were affected (P < 0.05) in 5-day-old nestlings from parents fed 4.4 ppm selenium and included a 19% increase in glutathione peroxidase activity, a 43% increase in the ratio of oxidized glutathione (GSSG) to reduced glutathione (GSH), and a 17% increase in lipid peroxidation. Based on reproductive effects relative to dietary exposure, sensitivity of eastern screech-owls to selenium was similar to that of black-crowned night-herons (Nycticorax nycticorax) but less than that of mallards (Anas platyrhynchos).

A Roseate Spoonbill hunts for food in the water.

Science.gov (United States)

1999-01-01

A Roseate Spoonbill sweeps the water for food in the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. The brilliant pink bird is named for its straight bill with the broad spatulate tip. Preferring a habitat of mangroves, it is usually found on the coasts of southern Florida and Texas, occasionally in Louisiana., in the West Indies, Mexico and Central and South America. Spoonbills feed on shrimps and fish in shallow waters, sweeping their bills from side to side and scooping up whatever they encounter. The 92,000- acre refuge is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.

Spatio-temporal variability of ichthyophagous bird assemblage around western Mediterranean open-sea cage fish farms.

Science.gov (United States)

Aguado-Giménez, Felipe; Eguía-Martínez, Sergio; Cerezo-Valverde, Jesús; García-García, Benjamín

2018-06-14

Ichthyophagous birds aggregate at cage fish farms attracted by caged and associated wild fish. Spatio-temporal variability of such birds was studied for a year through seasonal visual counts at eight farms in the western Mediterranean. Correlation with farm and location descriptors was assessed. Considerable spatio-temporal variability in fish-eating bird density and assemblage structure was observed among farms and seasons. Bird density increased from autumn to winter, with the great cormorant being the most abundant species, also accounting largely for differences among farms. Grey heron and little egret were also numerous at certain farms during the coldest seasons. Cattle egret was only observed at one farm. No shags were observed during winter. During spring and summer, bird density decreased markedly and only shags and little egrets were observed at only a few farms. Season and distance from farms to bird breeding/wintering grounds helped to explain some of the spatio-temporal variability. Copyright © 2018 Elsevier Ltd. All rights reserved.

The ugly face of tourism: Marine debris pollution linked to visitation in the southern Great Barrier Reef, Australia.

Science.gov (United States)

Wilson, Scott P; Verlis, Krista M

2017-04-15

Marine debris is one of the most significant issues facing oceans worldwide. The sources of this debris vary depending on proximity to urban centres and the nature of activities within an area. This paper examines the influence of tourism in the southern Great Barrier Reef (GBR), and its contribution to litter levels in the region. By conducting beach debris surveys on occupied and unoccupied islands, this study found that debris was prevalent throughout the region with significant differences in material types between locations. The greatest source of debris from publically accessible islands was tourist-related, with this source also influencing debris loads on nearby uninhabited islands. A focus on debris at Heron Island, showed that sites close to amenities had greater levels of tourist-sourced items like cigarette butts. These findings indicate the contribution of tourists to this problem and that working with operators and managers is needed to minimise visitor impacts. Copyright © 2017 Elsevier Ltd. All rights reserved.

Mass coral spawning: A natural large-scale nutrien t addition experiment

DEFF Research Database (Denmark)

Eyre, B.D.; Glud, Ronnie Nøhr; Patten, N.

2008-01-01

A mass coral spawning event on the Heron Island reef flat in 2005 provided a unique opportunity to examine the response of a coral reef ecosystem to a large episodic nutrient addition. A post-major spawning phytoplankton bloom resulted in only a small drawdown of dissolved inorganic phosphorus (DIP......), and dissolved organic phosphorus were used in the production of biomass, and mass balance calculations highlighted the importance of organic forms of N and P for benthic and pelagic production in tropical coral reef environments characterized by low inorganic N and P. The input of N and P via the deposition...... potential N limitation of benthic coral reef communities. For example, there was sufficient bioavailable P stored in the top 10 cm of the sediment column to sustain the prespawning rates of benthic production for over 200 d. Most of the change in benthic N cycling occurred via DON and N-2 pathways, driven...

Patrones de crecimiento postnatal en ocho especies de garzas (Ciconiiformes: Ardeidae

Directory of Open Access Journals (Sweden)

Dennis Denis Ávila

2011-06-01

Full Text Available El crecimiento en aves forma parte de las estrategias reproductivas y su implicación ecológica ha sido profundamente debatida. En este trabajo se describe el crecimiento del pico, peso y tarso de ocho garzas (Aves: Ardeidae en la ciénaga de Birama, Cuba. Para ello, entre 1998-2006, se midieron en días alternos un total de 714 pichones de Butorides virescens, Bubulcus ibis, Egretta thula, E. tricolor, E. caerulea, E. rufescens, Ardea alba y Nycticorax nycticorax, durante sus dos primeras semanas de vida. Se hicieron ajustes a las curvas Logística y de Gompertz y se usó regresiones no lineales y valores adultos como asíntotas, además se determinaron las variables que describenel crecimiento. El tamaño de los pichones al eclosionar fue similar al encontrado en otras localidades, con CV entre 10-19% y diferencias relativas al tamaño adulto. Las ecuaciones de Gompertz tuvieron menos residuos en todos los casos. Entonces, se identificaron dos procesos fundamentales de extensión en el crecimiento de cada estructura: uno físico y otro de duración, entre B. virescens y E. alba. Nycticorax, B. ibis y E. rufescens mostraron variaciones que los diferenciaron del resto. Los resultados apoyan la hipótesis de la microevolución de Ardeidae por hipermorfosis, por un retardo en el momento final del crecimiento.

Eddy covariance measurement of the spatial heterogeneity of surface energy exchanges over Heron Reef, Great Barrier Reef, Australia

Science.gov (United States)

MacKellar, M.; McGowan, H. A.; Phinn, S. R.

2011-12-01

Coral reefs cover 2.8 to 6.0 x 105 km2 of the Earth's surface and are warm, shallow regions that are believed to contribute enhanced sensible and latent heat to the atmosphere, relative to the surrounding ocean. To predict the impact of climate variability on coral reefs and their weather and climate including cloud, winds, rainfall patterns and cyclone genesis, accurate parameterisation of air-sea energy exchanges over coral reefs is essential. This is also important for the parameterisation and validation of regional to global scale forecast models to improve prediction of tropical and sub-tropical marine and coastal weather. Eddy covariance measurements of air-sea fluxes over coral reefs are rare due to the complexities of installing instrumentation over shallow, tidal water. Consequently, measurements of radiation and turbulent flux data for coral reefs have been captured remotely (satellite data) or via single measurement sites downwind of coral reefs (e.g. terrestrial or shipboard instrumentation). The resolution of such measurements and those that have been made at single locations on reefs may not capture the spatial heterogeneity of surface-atmosphere energy exchanges due to the different geomorphic and biological zones on coral reefs. Accordingly, the heterogeneity of coral reefs with regard to substrate, benthic communities and hydrodynamic processes are not considered in the characterization of the surface radiation energy flux transfers across the water-atmosphere interface. In this paper we present a unique dataset of concurrent in situ eddy covariance measurements made on instrumented pontoons of the surface energy balance over different geomorphic zones of a coral reef (shallow reef flat, shallow and deep lagoons). Significant differences in radiation transfers and air-sea turbulent flux exchanges over the reef were highlighted, with higher Bowen ratios over the shallow reef flat. Increasing wind speed was shown to increase flux divergence between sites to the extent that under unstable, south-easterly Trade Winds the net flux of heat was positive and negative over different geomorphic zones. The surface drag coefficient ranged from 1 to 2.5 x 10-3, with no significant difference between sites. Results highlight the spatial variation of air-sea energetics across a lagoonal platform reef in response to local meteorology, hydrodynamics and benthic/substrate cover.

Response of roseate tern to a shoreline protection project on Falkner Island, Connecticut

Science.gov (United States)

Rogers, C.J.; Spendelow, J.A.; Guilfoyle, Michael P.; Fischer, Richard A.; Pashley, David N.; Lott, Casey A.

2007-01-01

subterranean channels, especially in the main revetment area, made it difficult to measure chick growth and productivity as had been done for more than 12 years prior to construction. Also, observations of color-banded adults that were unable to locate and feed their young inside the main revetment, and of adults returning to courtship behavior and renesting after having hatched chicks from their initial clutches, indicated that a minimum of 20% of the chicks (mostly first hatched A-chicks, which usually have high rates of survival to fledging) that entered the main revetment died after doing so in 2001. The mortality rate of Roseate Tern chicks that entered the secondary revetment on the southwest shelf, however, was not unusually high in 2001. In an attempt to reduce the likelihood of nesting and chick losses in these sub-colonies, a research team led by the USGS in 2002-2003 did not put nest boxes on the northeast and east shelf areas where previous losses had been high. However, losses of tern eggs and young chicks to predatory Black-crowned Night Herons (Nycticorax nycticorax) were so great in 2002?2003 that few Roseate Tern chicks survived long enough to move into the main revetment area and little comparative survival data were collected. The USFWS continues to remove predatory night herons, to monitor the location and success of nesting Roseate Terns and to fill in some of problem areas near the tern nests in the main revetment. The extensive chick-searching fieldwork and observational procedures used by the USGS-led research team to determine the growth and survival of the Roseate Tern chicks at Falkner Island were not used in 2004?2005. The number of chicks lost in the revetment during these years is not known. Without additional fill, loss of chicks of this endangered species in the main revetment may rise again even though the night heron predation problem has been reduced.

Molecular characterization of Giardia psittaci by multilocus sequence analysis.

Science.gov (United States)

Abe, Niichiro; Makino, Ikuko; Kojima, Atsushi

2012-12-01

Multilocus sequence analyses targeting small subunit ribosomal DNA (SSU rDNA), elongation factor 1 alpha (ef1α), glutamate dehydrogenase (gdh), and beta giardin (β-giardin) were performed on Giardia psittaci isolates from three Budgerigars (Melopsittacus undulates) and four Barred parakeets (Bolborhynchus lineola) kept in individual households or imported from overseas. Nucleotide differences and phylogenetic analyses at four loci indicate the distinction of G. psittaci from the other known Giardia species: Giardia muris, Giardia microti, Giardia ardeae, and Giardia duodenalis assemblages. Furthermore, G. psittaci was related more closely to G. duodenalis than to the other known Giardia species, except for G. microti. Conflicting signals regarded as "double peaks" were found at the same nucleotide positions of the ef1α in all isolates. However, the sequences of the other three loci, including gdh and β-giardin, which are known to be highly variable, from all isolates were also mutually identical at every locus. They showed no double peaks. These results suggest that double peaks found in the ef1α sequences are caused not by mixed infection with genetically different G. psittaci isolates but by allelic sequence heterogeneity (ASH), which is observed in diplomonad lineages including G. duodenalis. No sequence difference was found in any G. psittaci isolates at the gdh and β-giardin, suggesting that G. psittaci is indeed not more diverse genetically than other Giardia species. This report is the first to provide evidence related to the genetic characteristics of G. psittaci obtained using multilocus sequence analysis. Copyright © 2012 Elsevier B.V. All rights reserved.

Situation report: Heavy DDT contamination at Wheeler National Wildlife Refuge

Science.gov (United States)

Fleming, W.J.; Atkeson, T.Z.

1980-01-01

A DDT manufacturing plant that operated on the Redstone Arsenal near Huntsville, Alabama discharged DDT-Iaden effluent from 1947 to 1970 into a creek on Wheeler National Wildlife Refuge. Seven to 9 years after the plant closed, high DDT, DDE, and DDD levels were reported in soils, river sediments, and fish in the area. Eleven of 27 mallards (Anas platyrhynchos) collected on the Refuge during February 1979 had carcass DDE residues that exceeded levels associated with eggshell thinning. DDE residues in a smaller number of mallards exceeded levels associated with egg breakage, poor hatchability, and abnormal hehavior and poor survival of offspring. Several avian species have disappeared from the Refuge since 1950, probably due to both industrial discharges of DDT from the plant and insecticidal use of DDT in the area. The contamination still presents a threat to herons, waterfowl, and raptors including occasional wintering or migrant eagles (Haliaeetus leucocephalus), and probably many other avian species. A maternity colony of endangered gray bats (Myotis grisescens) is also threatened by this contamination.

Diversity and prevalence of hemoparasites of wading birds in southern Florida, USA

Directory of Open Access Journals (Sweden)

Sarah M. Coker

2017-12-01

Full Text Available Relatively few studies on hemoparasites have been conducted on wading birds in the families Ardeidae and Threskiornithidae (order Pelecaniformes, especially in the United States. In this study, we obtained baseline data on the prevalence and genetic diversity of haemosporidian parasites in wading birds opportunistically sampled from southern Florida, USA. We detected blood parasites in White Ibis (Eudocimus albus, Glossy Ibis (Plegadis falcinellus, Green Heron (Butorides virescens, and Roseate Spoonbill (Platalea ajaja with several novel host-parasite relationships. Infected birds had low parasitemias (average 0.77%, range 0–4% suggesting that infections were chronic. Despite the low sample sizes for several of our sampled species, these data highlight the diversity of parasites in this understudied group of birds and suggest that additional studies are needed to investigate the potential impacts of these parasites on their health, especially since southern Florida is becoming increasingly urbanized which can alter parasite transmission or host susceptibility. Keywords: Avian malaria, Florida, Haemoproteus plataleae, haemosporidia, Pelicaniformes, Plasmodium, Wading birds, White Ibis

[Water birds from Agua Dulce lake and El Ermitaño estuary, Jalisco, Mexico].

Science.gov (United States)

Hernández Vázquez, Salvador

2005-01-01

Waterbird abundance, and seasonal and spatial distribution, were studied in two natural water pools at Jalisco, Mexico, from December 1997 through November 1998. Maximum monthly abundance in Agua Dulce lake and El Ermitaño estuary was 86 471 birds (29 686 in Agua Dulce and 56 785 in Ermitaño), with a total cummulative abundance of 179 808 individuals (66 976 in Agua Dulce and 112 832 in Ermitaño). A total of 87 waterbirds species were recorded, 78 in Agua Dulce and 73 in Ermitaño. The higher species richness and abundance was observed during winter, when migratory species arrived. Most species prefered shallow waters, except seabirds which prefered protected areas such as dunes in Agua Dulce. Other groups, like clucks and related species. prefered low salinity areas, for example in the south-east area of Ermitaño. The higher abundance of the shorehirds was found when the water level on the estuary was low. Herons were seen often at areas with high salinity and influenced by tides (e.g. mouth of Ermitaño).

A review of the genus Antorchis Linton, 1911 (Trematoda: Faustulidae) from Indo-Pacific fishes with the description of a new species.

Science.gov (United States)

Cribb, Thomas H; Bray, Rodney A; Hall, Kathryn A; Cutmore, Scott C

2015-09-01

Species of the faustulid genus Antorchis Linton, 1911 of the tropical Indo-West Pacific are reviewed. We recognise five species in the region, including a novel form. Antorchis nasonis n. sp. is described from Naso annulatus (Quoy & Gaimard) and N. tonganus (Valenciennes) on the southern Great Barrier Reef (GBR). We interpret specimens reported from Naso hexacanthus (Bleeker) from Japan as the same species. This species appears to be the only faustulid known from acanthurid fishes and differs from all other species in the genus in having the prominent dorsal genital invagination close to the posterior end of the body. In addition, new host and locality records are reported for two described species of Antorchis, A. pomacanthi (Hafeezullah & Siddiqi, 1970) and A. tsushimaensis (Machida, 1971). The wide distribution of A. pomacanthi was further demonstrated by the generation of identical ITS2 rDNA sequences for specimens from Ningaloo Reef off Western Australia, off Lizard and Heron Islands (GBR) and off New Caledonia, localities separated by up to 5,300 km. The host-specificity of the genus is considered.

An anhinga shows its iridescent plumage

Science.gov (United States)

2000-01-01

The greenish iridescence of a male Anhinga nearly blends into the green vegetation behind it on the grounds of the Kennedy Space Center. The mostly black-bodied bird is also known as a 'snakebird' because, when swimming, only its head and long, slender neck are visible above water. The anhinga inhabits freshwater ponds and swamps with thick vegetation and ranges the Atlantic and Gulf coasts from North Carolina to Texas, the Mississippi Valley north to Arkansas and Tennessee, and south to southern South America. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

Toddlers' categorization of typical and scrambled dolls and cars.

Science.gov (United States)

Heron, Michelle; Slaughter, Virginia

2008-09-01

Previous research has demonstrated discrimination of scrambled from typical human body shapes at 15-18 months of age [Slaughter, V., & Heron, M. (2004). Origins and early development of human body knowledge. Monographs of the Society for Research in Child Development, 69]. In the current study 18-, 24- and 30-month-old infants were presented with four typical and four scrambled dolls in a sequential touching procedure, to assess the development of explicit categorization of human body shapes. Infants were also presented with typical and scrambled cars, allowing comparison of infants' categorization of scrambled and typical exemplars in a different domain. Spontaneous comments regarding category membership were recorded. Girls categorized dolls and cars as typical or scrambled at 30 months, whereas boys only categorized the cars. Earliest categorization was for typical and scrambled cars, at 24 months, but only for boys. Language-based knowledge, coded from infants' comments, followed the same pattern. This suggests that human body knowledge does not have privileged status in infancy. Gender differences in performance are discussed.

A white pelican and egrets in the Merritt Island National Wildlife Refuge

Science.gov (United States)

1999-01-01

A white pelican and several small egrets rest on the bank of a pond in in the waters of the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. White pelicans inhabit marshy lakes and along the Pacific and Texas coasts. They winter from Florida and southern California south to Panama, chiefly in coastal lagoons. They are frequently seen flying in long lines, flapping and sailing in unison, but also ride rising air currents to soar gracefully in circles. The range of the egret includes southern and eastern states, Mexico, Central and South America, and the West Indies. The Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

Black-necked stilts share nesting in the Merritt Island National Wildlife Refuge

Science.gov (United States)

1999-01-01

A black-necked stilt waits near its nesting mate nest in the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. Stilts usually produce three or four brown-spotted buff eggs in a shallow depression lined with grass or shell fragments. In the nesting season they are particularly agressive. Stilts are identified by a distinct head pattern of black and white, very long red legs, and straight, very thin bill. Their habitat is salt marshes and shallow coastal bays from Delaware and northern South America in the East, and freshwater marshes from Oregon and Saskatchewan to the Gulf Coast. The 92,000-acre wildlife refuge is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.

Levels and profiles of persistent organic pollutants in resident and migratory birds from an urbanized coastal region of South Korea.

Science.gov (United States)

Hong, Sang Hee; Shim, Won Joon; Han, Gi Myung; Ha, Sung Yong; Jang, Mi; Rani, Manviri; Hong, Sunwook; Yeo, Gwang Yeong

2014-02-01

Persistent organic pollutants (POPs) levels in resident and migratory birds collected from an urbanized coastal region of South Korea were investigated. As target species, resident birds that reside in different habitats-such as inland and coastal regions-were selected and their POP contamination status and accumulation features evaluated. Additionally, winter and summer migratory species were analysed for comparison with resident birds. Black-tailed gull and domestic pigeon were selected as the coastal and inland resident birds, respectively, and pacific loon and heron/egret were selected as the winter and summer migratory birds, respectively. The overall POP concentrations (unit: ng/g lipid) in resident birds were 14-131,000 (median: 13,400) for PCBs, 40-284,000 (11,200) for DDTs, urban resident bird such as pigeon, an intentional intake of dust or soils during feeding is likely to be an additional route of exposure to POPs. Resident birds generally accumulated higher POPs concentrations than migratory birds, the exceptions being relatively volatile compounds such as HCB, PeCB and HCHs. © 2013.

Mercury Distribution Along the Food Chain of a Wetland Ecosystem at Sanjiang Plain, Northeast China.

Science.gov (United States)

Zhilong, Ma; Qiang, Wang; Zhongsheng, Zhang; Xuehong, Zhou

2017-02-01

Concentrations of total mercury (T-Hg) and methylmercury (MeHg) in a wetland food chain were determined at Majuan Island of the Sanjiang Plain in China. Four tissues (muscle, liver, kidney and brain) of three waterbird species (great cormorant, grey heron and great egret), muscle tissues of fish (grass carp, crucian carp and longnose gudgeon), insects (predacious diving beetle), aquatic plants (ditch reed) and soil were analyzed. The mean concentrations of T-Hg were 0.392 ± 0.237 mg/kg for tissues of all juveniles, 1.999 ± 2.053 mg/kg for great cormorant adults, and 0.029 ± 0.019 mg/kg for fish muscle, respectively. While the relative contents of T-Hg of insects, plants and sediments were 0.012 ± 0.002, 0.006 ± 0.001 and 0.020 ± 0.002 mg/kg, respectively. Bioaccumulation of Hg along the wetland food chain may be able to show the current situation of Hg contamination in remote regions of East Asia.

Tidal salt marshes of the southeast Atlantic Coast: A community profile

Energy Technology Data Exchange (ETDEWEB)

Wiegert, R.G.; Freeman, B.J.

1990-09-01

This report is part of a series of community profiles on the ecology of wetland and marine communities. This particular profile considers tidal marshes of the southeastern Atlantic coast, from North Carolina south to northern Florida. Alone among the earth's ecosystems, coastal communities are subjected to a bidirectional flooding sometimes occurring twice each day; this flooding affects successional development, species composition, stability, and productivity. In the tidally influenced salt marsh, salinity ranges from less than 1 ppt to that of seawater. Dominant plant species include cordgrasses (Spartina alterniflora and S. cynosuroides), black needlerush (Juncus romerianus), and salt marsh bulrush (Scirpus robustus). Both terrestrail and aquatic animals occur in salt marshes and include herons, egrets ospreys (Pandion haliaetus), bald eagles (Haliaeetus leucocephalus), alligators (Alligator Mississippiensis), manatees (Trichecus manatus), oysters, mussels, and fiddler crabs. Currently, the only significant direct commercial use of the tidal salt marshes is by crabbers seeking the blue crab Callinectes sapidus, but the marshes are quite important recreationally, aesthetically, and educationally. 151 refs., 45 figs., 6 tabs.

Morphological and genetic analysis of three new species of Ceratomyxa Thélohan, 1892 (Myxozoa: Myxosporea) from carcharhinid sharks off Australia.

Science.gov (United States)

Gleeson, Ricky; Adlard, Robert

2011-10-01

Three new species of Ceratomyxa Thélohan, 1892 are described from the gall-bladders of two species of carcharhinid sharks collected off Heron and Lizard Islands on the Great Barrier Reef, Australia. Ceratomyxa carcharhini n. sp. and C. melanopteri n. sp. are described from Carcharhinus melanopterus (Quoy & Gaimard), and Ceratomyxa negaprioni n. sp. is described from Negaprion acutidens (Rüppell). These species are the first ceratomyxids reported from Australian elasmobranchs, and this is the first paper to formally characterise a novel Ceratomyxa species from an elasmobranch using both morphology and small subunit ribosomal DNA sequence data. Maximum parsimony and Bayesian inference analyses of the SSU rDNA dataset revealed that ceratomyxids from elasmobranchs form a sister clade to that of species infecting marine teleosts and Palliatus indecorus Schulman, Kovaleva & Dubina, 1979. Furthermore, the only sequenced freshwater ceratomyxid, Ceratomyxa shasta Noble, 1950, fell outside the overall marine ceratomyxid clade. These data show that Ceratomyxa, as currently recognised, is polyphyletic and ignites discussion on whether Ceratomyxa should be split. However, further taxon sampling, particularly in freshwater systems, is required to establish relevant biological divisions within the genus.

The effect of nutrient enrichment on the growth, nucleic acid concentrations, and elemental stoichiometry of coral reef macroalgae.

Science.gov (United States)

Reef, Ruth; Pandolfi, John M; Lovelock, Catherine E

2012-08-01

The growth rate hypothesis (GRH) links growth rates with organism elemental stoichiometry. Support for the GRH was found for many animal species, but less so for plants. This is the first study to test the GRH in macroalgae. Tropical coral reef macroalgae from three lineages, Caulerpa serrulata (Chlorophyta), Laurencia intricata (Rhodophyta), and Sargassum polyphyllum (Phaeophyceae) were grown enriched with nitrogen or phosphorous and under control conditions at Heron Island on the Great Barrier Reef, Australia. Growth rate, photosynthesis, nucleic acid composition, and elemental stoichiometry were measured. Nutrient enrichment had positive effects on photosynthetic rates and on investment in RNA. However, growth rate was not correlated with either photosynthetic rates or RNA content; thus, we did not find support for the GRH in tropical macroalgae. Macroalgae, especially L. intricata, accumulated P to very high levels (>0.6% of dry weight). The growth rate response to tissue P concentrations was unimodal. Above 0.21%, P accumulation had negative effects on growth. Nitrogen was not stored, but evidence of futile cycling was observed. The capacity to store large amounts of P is probably an adaptation to the low and patchy nutrient environment of the tropical oceans.

Prevalence and antimicrobial susceptibility of salmonellae isolates from reptiles in Taiwan.

Science.gov (United States)

Chen, Chun-Yu; Chen, Wan-Ching; Chin, Shih-Chien; Lai, Yen-Hsueh; Tung, Kwong-Chung; Chiou, Chien-Shun; Hsu, Yuan-Man; Chang, Chao-Chin

2010-01-01

Pets, including reptiles, have been shown to be a source of Salmonella infection in humans. Due to increasing popularity and variety of exotic reptiles as pets in recent years, more human clinical cases of reptile-associated Salmonella infection have been identified. However, limited information is available with regard to serotypes in different reptiles (turtles, snakes, and lizards) and antimicrobial resistance of Salmonella in pet reptiles. The current study was thus conducted to determine the prevalence of Salmonella colonization in pet reptiles. Salmonella organisms were isolated from 30.9% of 476 reptiles investigated. The isolation prevalences were 69.7% (23/33), 62.8% (27/43), and 24.3% (97/400) in snakes, lizards, and turtles, respectively. A total of 44 different Salmonella serovars were identified. Compared with S. Heron, Bredeney, Treforest, and 4,[5],12:i:-, S. Typhimurium isolates were resistant to many antimicrobials tested, and notably 61.1% of the isolates were resistant to cephalothin. The results indicated that raising reptiles as pets could be a possible source of Salmonella infection in humans, particularly zoonotic Salmonella serovars such as S. Typhimurium that may be resistant to antimicrobials.

Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia from the Pacific

Directory of Open Access Journals (Sweden)

James Reimer

2012-11-01

Full Text Available The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, N. uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and N. caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, N. tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific.

Potential radiation dose from eating fish exposed to actinide contamination

International Nuclear Information System (INIS)

Emery, R.M.; Klopfer, D.C.; Baker, D.A.; Soldat, J.K.

1981-01-01

The purpose of this work is to establish a maximum potential for transporting actinides to man via fish consumption. The study took place in U-pond, a nuclear waste pond on the Hanford Site. It has concentrations of 238 U, 238 Pu, sup(239,240)Pu and 241 Am that are approx. 3 orders of magnitude greater than background levels. Fish living in the pond contain higher actinide concentrations than those observed in fish from any other location. Experiments were performed in U-Pond to determine maximum quantities of actinides that could accumulate in fillets and whole bodies of two centrarchid fish species. Doses to hypothetical consumers were then estimated. Results indicate that highest concentrations occurring in bluegill or bass muscle after more than a year's exposure to the pond would not be sufficient to produce a significant radiation dose to a human consumer, even if he ate 0.5 kg (of the order of 1 lb) of these fillets every day for 70 yr. Natural predators (heron or coyote), having lifetime diets of whole fish from U-Pond, would receive less radiation dose from the ingested actinides than from natural background sources. (author)

Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia) from the Pacific

Science.gov (United States)

Reimer, James Davis; Irei, Yuka; Fujii, Takuma

2012-01-01

Abstract The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, Neozoanthus uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and Neozoanthus caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, Neozoanthus tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific. PMID:23275752

[Medicine and orientalism in the late nineteenth century Korea].

Science.gov (United States)

Lee, Jong-Chan

2002-06-01

The paper investigates medical missionaries that exerted a significant role in establishing Western medicine in the late nineteenth century Chosun, in relation to orientalism, an academically popularized concept introduced by Edward Said. Historical analysis is focused on several important medical missionaries such as Horace N. Allen, William B. Scranton, John W. Heron, C. C. Vinton, and Oliver R. Avison to explain how their activism as medical missionary contributed to the formation of medical orientalism in which Western medicine was 'taught, studied, administered, and judged' in that period. In addition, I explore into how medical orientalism was in service of Japanese imperialism by showing that medical missionaries had to be under imperial surveillance by Japanese colonizers. The article explores the medical system of the Koryo Dynasty period and its social characteristics. First, the structure of medical system and roles of medical institutions during the Koryo Dynasty period will be summarized. Then the characteristics of the medical system will be identified through exploring the principles of its formation in a view of social recognition of medical care and a view of social recognition of medical care and a view of public policy.

Risks to Ecological Receptors Posed by Contaminants of Potential Concern in the Lower Three Runs Cooling Ponds and Canals

Energy Technology Data Exchange (ETDEWEB)

Paller, M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Blas, S. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

2017-03-21

The upper portion of Lower Three Runs includes several ponds, reservoirs, and canals that were formerly used as a cooling system for nuclear production reactors. This area was divided into nine exposure areas (EAs) for the assessment of environmental contamination resulting from past reactor operations and other industrial processes. A tiered screening process identified several contaminants of potential concern including aluminum, cyanide, lead, manganese, mercury, DDD, DDE, and DDT. Risks posed by these contaminants to ecological receptors (river otter, belted kingfisher, raccoon, and blue heron) were assessed using contaminant exposure models that estimated contaminant intake resulting from ingestion of food, water, and sediment/ soil and compared these intakes with toxicity reference values (TRVs). The contaminant exposure models showed that the TRVs were not exceeded in the otter model, exceeded by aluminum in EA 7 (Pond 2 and associated canals) in the raccoon model, and exceeded by mercury in EAs 2, 3 (Pond B), 6 (Par Pond), and 8 (Ponds 4 and 5 and Canal to Pond C) in both the kingfisher and blue heron models. Hazard quotients (total exposure dose divided by the TRV) were 2.8 for aluminum and 1.7- 3.6 for mercury. The primary route of exposure for aluminum was the ingestion of soil, and the primary route of exposure for mercury was the ingestion of mercury contaminated fish. Elevated levels of mercury in fish were at least partly the result of the aerial deposition of mercury onto Lower Three Runs and its watershed. The atmospheric deposition of mercury creates pervasive contamination in fish throughout the Savannah River basin. Another possible source of mercury was the discharge of mercury contaminated Savannah River water into the Lower Three Runs cooling ponds and canals during previous years of reactor operation. This contamination originated from industries located upstream of the SRS. The aluminum exceedance for the raccoon was likely the result of

Gas geochemistry of natural analogues for the studies of geological CO{sub 2} sequestration

Energy Technology Data Exchange (ETDEWEB)

Voltattorni, N., E-mail: nunzia.voltattorni@ingv.it [Istituto Nazionale di Geofisica e Vulcanologia, Via di Vigna Murata no 605, 00143 Rome (Italy); Sciarra, A. [Istituto Nazionale di Geofisica e Vulcanologia, Via di Vigna Murata no 605, 00143 Rome (Italy); Caramanna, G. [Earth Science Dep., University ' La Sapienza' , Piazzale A. Moro no 5, 00185 Rome (Italy); Cinti, D.; Pizzino, L.; Quattrocchi, F. [Istituto Nazionale di Geofisica e Vulcanologia, Via di Vigna Murata no 605, 00143 Rome (Italy)

2009-07-15

Geological sequestration of anthropogenic CO{sub 2} appears to be a promising method for reducing the amount of greenhouse gases released to the atmosphere. Geochemical modelling of the storage capacity for CO{sub 2} in saline aquifers, sandstones and/or carbonates should be based on natural analogues both in situ and in the laboratory. The main focus of this paper has been to study natural gas emissions representing extremely attractive surrogates for the study and prediction of the possible consequences of leakage from geological sequestration sites of anthropogenic CO{sub 2} (i.e., the return to surface, potentially causing localised environmental problems). These include a comparison among three different Italian case histories: (i) the Solfatara crater (Phlegraean Fields caldera, southern Italy) is an ancient Roman spa. The area is characterised by intense and diffuse hydrothermal activity, testified by hot acidic mud pools, thermal springs and a large fumarolic field. Soil gas flux measurements show that the entire area discharges between 1200 and 1500 tons of CO{sub 2} per day; (ii) the Panarea Island (Aeolian Islands, southern Italy) where a huge submarine volcanic-hydrothermal gas burst occurred in November, 2002. The submarine gas emissions chemically modified seawater causing a strong modification of the marine ecosystem. All of the collected gases are CO{sub 2}-dominant (maximum value: 98.43 vol.%); (iii) the Tor Caldara area (Central Italy), located in a peripheral sector of the quiescent Alban Hills volcano, along the faults of the Ardea Basin transfer structure. The area is characterised by huge CO{sub 2} degassing both from water and soil. Although the above mentioned areas do not represent a storage scenario, these sites do provide many opportunities to study near-surface processes and to test monitoring methodologies.

Gas geochemistry of natural analogues for the studies of geological CO2 sequestration

International Nuclear Information System (INIS)

Voltattorni, N.; Sciarra, A.; Caramanna, G.; Cinti, D.; Pizzino, L.; Quattrocchi, F.

2009-01-01

Geological sequestration of anthropogenic CO 2 appears to be a promising method for reducing the amount of greenhouse gases released to the atmosphere. Geochemical modelling of the storage capacity for CO 2 in saline aquifers, sandstones and/or carbonates should be based on natural analogues both in situ and in the laboratory. The main focus of this paper has been to study natural gas emissions representing extremely attractive surrogates for the study and prediction of the possible consequences of leakage from geological sequestration sites of anthropogenic CO 2 (i.e., the return to surface, potentially causing localised environmental problems). These include a comparison among three different Italian case histories: (i) the Solfatara crater (Phlegraean Fields caldera, southern Italy) is an ancient Roman spa. The area is characterised by intense and diffuse hydrothermal activity, testified by hot acidic mud pools, thermal springs and a large fumarolic field. Soil gas flux measurements show that the entire area discharges between 1200 and 1500 tons of CO 2 per day; (ii) the Panarea Island (Aeolian Islands, southern Italy) where a huge submarine volcanic-hydrothermal gas burst occurred in November, 2002. The submarine gas emissions chemically modified seawater causing a strong modification of the marine ecosystem. All of the collected gases are CO 2 -dominant (maximum value: 98.43 vol.%); (iii) the Tor Caldara area (Central Italy), located in a peripheral sector of the quiescent Alban Hills volcano, along the faults of the Ardea Basin transfer structure. The area is characterised by huge CO 2 degassing both from water and soil. Although the above mentioned areas do not represent a storage scenario, these sites do provide many opportunities to study near-surface processes and to test monitoring methodologies.

Status and distribution of migrating and breeding marine birds in north Lebanon

International Nuclear Information System (INIS)

Jarade, Gh.R.

2017-01-01

The study of marine birds in the northern part of Lebanon recorded 2681 individuals, distributed over 86 species. Among them 35 are foreshore species, 18 coastal, 6 maritime, 9 ducks, 6 herons, 9 various saltwater related species and 3 terrestrial. The highest density is shown by the yellow-legged Gull Larus michahellis and common blackheaded gull Chroicocephalus ridibundus. The globally vulnerable yelkouan shearwater Puffinus yelkouan, an endemic species to the Mediterranean, appears on the 9th rank in the classification of seabird species from the more to the least abundant, highlighting as such, beside other 6 globally near threatened species, the role that Lebanon can play in improving the conservation status of these species. Regarding the phenological status of species, 48 are passage migrant/winter visitors, 31 passage migrants, 5 winter visitors and 2 vagrant species. The surveys revealed that three coastal seabird species (Armenian gull Larus armenicus, slender-billed gull Chroicocephalus genei and sandwich tern Thalasseus sandvicensis) and one ubiquist species (Eurasian Golden Plover Pluvialis apricaria) are not rare as it was believed in previous papers but fairly common winter visitors. The study identified the yellow-legged gull breeding population to be 160 couples, and confirmed the second and third breeding records of the little ringed plover Charadrius dubius.(author)

Does the Sun appear brighter at night in neutrinos?

International Nuclear Information System (INIS)

Bahcall, J.N.; Krastev, P.I.

1997-01-01

We calculate accurately the number of solar neutrino events expected as a function of solar zenith angle, with and without neutrino oscillations, for detectors at the locations of Super-Kamiokande, SNO, and the Gran Sasso National Laboratory. Using different Earth models to estimate geophysical uncertainties, and different solar models to estimate solar uncertainties, we evaluate distortions predicted by the Mikheyev-Smirnov-Wolfenstein (MSW) effect in the zenith angle distributions of solar neutrino events. The distortions are caused by oscillations and by ν-e interactions in the Earth that regenerate ν e from ν μ or ν τ . We show that the first two moments of the zenith-angle distribution are more sensitive to the small mixing angle MSW solution than the conventionally studied day-night asymmetry. We present iso-σ contours that illustrate the potential of Super-Kamiokande, SNO, BOREXINO, ICARUS, and HERON/HELLAZ for detecting the Earth regeneration effect at their actual locations (and at the equator). MSW solutions favored by the four pioneering solar neutrino experiments predict characteristic distortions for Super-Kamiokande, SNO, BOREXINO, and ICARUS that range from being unmeasurably small to >5σ (stat) after only a few years of observations. copyright 1997 The American Physical Society

The Build-Up Course of Visuo-Motor and Audio-Motor Temporal Recalibration

Directory of Open Access Journals (Sweden)

Yoshimori Sugano

2011-10-01

Full Text Available The sensorimotor timing is recalibrated after a brief exposure to a delayed feedback of voluntary actions (temporal recalibration effect: TRE (Heron et al., 2009; Stetson et al., 2006; Sugano et al., 2010. We introduce a new paradigm, namely ‘synchronous tapping’ (ST which allows us to investigate how the TRE builds up during adaptation. In each experimental trial, participants were repeatedly exposed to a constant lag (∼150 ms between their voluntary action (pressing a mouse and a feedback stimulus (a visual flash / an auditory click 10 times. Immediately after that, they performed a ST task with the same stimulus as a pace signal (7 flashes / clicks. A subjective ‘no-delay condition’ (∼50 ms served as control. The TRE manifested itself as a change in the tap-stimulus asynchrony that compensated the exposed lag (eg, after lag adaptation, the tap preceded the stimulus more than in control and built up quickly (∼3–6 trials, ∼23–45 sec in both the visuo- and audio-motor domain. The audio-motor TRE was bigger and built-up faster than the visuo-motor one. To conclude, the TRE is comparable between visuo- and audio-motor domain, though they are slightly different in size and build-up rate.

Using DNA Barcoding and Standardized Sampling to Compare Geographic and Habitat Differentiation of Crustaceans: A Hawaiian Islands Example

Directory of Open Access Journals (Sweden)

M. Julian Caley

2011-09-01

Full Text Available Recently, the Census of Marine Life has explored methods to assess coral reef diversity by combining standardized sampling (to permit comparison across sites with molecular techniques (to make rapid counts of species possible. To date, this approach has been applied across geographically broad scales (seven sites spanning the Indian, Pacific and Atlantic Oceans, focusing on similar habitats at all sites (10–12 m forereef. Here we examine crustacean spatial diversity patterns for a single atoll, comparing results for four sites (comprising forereef, backreef, and lagoon habitats at French Frigate Shoals (FFS, Northwestern Hawaiian Islands, Hawaii, USA, within the Papahanaumokuakea Marine National Monument. The Bray-Curtis index of similarity across these habitats at FFS was the same or greater than the similarity between similar habitats on Heron Island and Lizard Island in the Great Barrier Reef and much greater than similarity between more widely separated localities in the Indo-Pacific Ocean (e.g., Ningaloo, Moorea, French Polynesia or the Line Islands. These results imply that, at least for shallow reefs, sampling multiple locations versus sampling multiple habitats within a site maximizes the rate at which we can converge on the best global estimate of coral reef biodiversity.

The Relationships between Morphological Characteristics and Foraging Behavior in Four Selected Species of Shorebirds and Water Birds Utilizing Tropical Mudflats

Directory of Open Access Journals (Sweden)

Nor Atiqah Norazlimi

2015-01-01

Full Text Available A study was conducted to investigate the relationship between the physical morphology of shorebirds and water birds (i.e., Lesser adjutant (Leptoptilos javanicus, Common redshank (Tringa totanus, Whimbrel (Numenius phaeopus, and Little heron (Butorides striata and their foraging behavior in the mudflats area of Selangor, Peninsular Malaysia, from August 2013 to July 2014 by using direct observation techniques (using binoculars and a video recorder. The actively foraging bird species were watched, and their foraging activities were recorded for at least 30 seconds for up to a maximum of five minutes. A Spearman Rank Correlation highlighted a significant relationship between bill size and foraging time (R=0.443, p<0.05, bill size and prey size (R=-0.052, p<0.05, bill size and probing depth (R=0.42, p=0.003, and leg length and water/mud depth (R=0.706, p<0.005. A Kruskal-Wallis Analysis showed a significant difference between average estimates of real probing depth of the birds (mm and species (H=15.96, p=0.0012. Three foraging techniques were recorded: pause-travel, visual-feeding, and tactile-hunting. Thus, morphological characteristics of bird do influence their foraging behavior and strategies used when foraging.

Microbiology, Redox and Contaminat Fate in the Grindsted Landfill Leachate Plume - A Summary of 25 Years of work

Science.gov (United States)

Christensen, T. H.

2001-05-01

experiments. Ground Water, 37, 113-121. Bjerg, P.L., Rugge, K., Pedersen, J.K. & Christensen, T.H. (1995): Distribution of redox sensitive groundwater quality parameters downgradient of a landfill (Grindsted, Denmark). Environmental Science and Technology, 29, 1387-1394. Heron, G., Bjerg, P.L., Gravesen, P., Ludvigsen, L. & Christensen, T.H. (1998): Geology and sediment geochemistry of a landfill leachate contaminated aquifer (Grindsted, Denmark). Journal of Contaminant Hydrology, 29, 301-317. Jakobsen, R., Albrechtsen, H.-J., Rasmussen, M., Bay, H., Bjerg, P.L. & Christensen, T.H. (1998): H2 concentrations in a landfill leachate plume (Grindsted, Denmark): In situ energetics of terminal electron acceptor processes. Environmental Science and Technology, 32, 2142-2148. Ludvigsen, L., Albrechtsen, H.-J., Heron, G., Bjerg, P.L. & Christensen, T.H. (1998): Anaerobic microbial redox processes in a landfill leachate contaminated aquifer (Grindsted, Denmark). Journal of Contaminant Hydrology, 33, 273-291. Ludvigsen, L., Albrechtsen, H.-J., Ringelberg, D., Ekelund, F. & Christensen, T.H. (1999): Distribution and composition of microbial populations in a landfill leachate contaminated aquifer (Grindsted, Denmark). Microbial Ecology, 37, (3), 197-207. Rugge, K., Bjerg, P.L. & Christensen, T.H. (1995): Distribution of organic compounds from municipal solid waste in the groundwater downgradient of a landfill (Grindsted, Denmark). Environmental Science and Technology, 29, 1395-1400.

Patient and fetal dose in diagnostic x-rays and radiotherapy in Bangkok, Thailand

International Nuclear Information System (INIS)

Pataramontree, J.; Wangsuphachart, S.; Apaiphonlacharn, J.; Chaichan, P.; Sompradit, S.; Suteerakul, K.; Thamwerawong, W.

2001-01-01

In 1999 the multicenter study of the patient surface dose was conducted at Department of Radiology of Chulalongkorn Hospital, another two university hospitals and a hospital in the suburb. Adult female patients were selected to measure the entrance skin dose and accumulated dose by using the thermoluminescent dosimeters and the kerma area product meter, respectively. The fetal doses were calculated by Monte Carlo method using the computer program written by Le Heron J.C. The average fetal doses were studied for each diagnostic radiographic procedure. The fetus got 0.29, 0.35, 2.63 mGy when its mother had radiography of pelvis, lumbosacral spine, excretory urography respectively. The estimated fetal doses for barium meal, barium enema and renal angiography were 1.47, 33.5 and 3.68 mGy, respectively. The fetal dose varies so much about 2-3 times of the average fetal dose due to equipment and techniques. The study of lower abdomen by computed tomography gave 48.4 mGy on average to a fetus. The scattered dose level outside radiotherapeutic x-rays at fetal position in Random Phantom depends on the primary beam area rather than the energy of radiation. If the threshold dose for fetal malformation is 0.1 Gy, the minimum safety distance for him is 22 cm from beam edges for the tumor dose of 60 Gy. (author)

Defeating diplostomoid dangers in USA catfish aquaculture.

Science.gov (United States)

Overstreet, Robin M; Curran, Stephen S

2004-06-01

Diplostomoid digenean metacercariae have caused widescale mortalities of channel catfish, Ictalurus punctatus (Rafinesque), at aquaculture farms in Louisiana, Mississippi and Arkansas, USA. Originally, based on a tentative diagnosis, the industry considered the primary harmful agent to be an introduced species from Europe, Bolbophorus confusus (Krause, 1914), frequently reported from the American white pelican, Pelecanus erythrorhynchos Gmelin. Our group has now shown, using ITS 1-2 plus three more-conservative gene fragments, that two sympatric species of Bolbophorus exist in the American white pelican. One, B. damnificus Overstreet et Curran, 2002, infects the musculature of catfish, and the other, probably not B. confusus, does not infect catfish. However, at least four other pathogenic diplostomoids and a clinostomoid infect the catfish, and they use at least four different snail hosts, including the planorbids Planorbella trivolvis (Say) and Gyraulus parvus (Say), the physid Physella gyrina (Say) and a lymnaeid. Two metacercariae, B. damnificus and Bursacetabulus pelecanus Dronen, Tehrany et Wardle, 1999, infect the catfish and mature in the pelican; two others, Austrodiplostomum compactum (Lutz, 1928) and Hysteromorpha cf. triloba (Rudolphi, 1819), mature in cormorants; one, Diplostomum sp., matures in seagulls and at least one, Clinostomum marginatum (Rudolphi, 1819), matures in herons, egrets and other wading birds. Consequently, management of catfish ponds relative to digenean infections requires considerable biological information on the fish, bird, and snail hosts as well as the parasites.

Baseline report - tall upland shrubland at the Rocky Flats Environmental Technology Site

International Nuclear Information System (INIS)

1997-03-01

Rocky Flats Environmental Technology Site (Site) is located on the Colorado Piedmont east of the Front Range between Boulder and Golden. At an elevation of approximately 6,000 feet, the Site contains a unique ecotonal mixture of mountain and prairie plant species, resulting from the topography and close proximity to the mountain front. The Buffer Zone surrounding the Industrial Area is one of the largest remaining undeveloped areas of its kind along the Colorado Piedmont. A number of plant communities at the Site have been identified as increasingly rare and unique by Site ecologists and the Colorado Natural Heritage Program (CNHP). These include the xeric tallgrass prairie, tall upland shrubland, wetlands, and Great Plains riparian woodland communities. Many of these communities support populations of increasingly rare animals as well, including the Preble's meadow jumping mouse, grasshopper sparrow, loggerhead shrike, Merriam's shrew, black crowned night heron, and Hops blue and Argos skipper butterflies. One of the more interesting and important plant communities at the Site is the tall upland shrubland community. It has been generally overlooked by previous Site ecological studies, probably due to its relatively small size; only 34 acres total. Although mentioned in a plant community ordination study conducted by Clark et al. and also in the Site baseline ecological study, few data were available on this plant community before the present study

Diversity "down under": monogeneans in the Antipodes (Australia) with a prediction of monogenean biodiversity worldwide.

Science.gov (United States)

Whittington, I D

1998-10-01

There are approximately 25,000 species of fishes known in the world. The Monogenea are believed to be among the most host-specific of parasites and if each species of fish is host to a different species of monogenean, there could be almost 25,000 monogenean species on Earth. Currently, I estimate that between 3000 and 4000 of these are described. Australia has a rich marine fish fauna with approximately 3500 species of teleosts. If the same formula of one monogenean species per host fish species is applied, Australia marine fishes could host potentially 3500 species of monogeneans. The first monogenean species described from Australia was Encotyllabe pagrosomi MacCallum, 1917 and approximately 300 more species have since been described from the continent. Even in a region of Australia such as Heron Island on the Great Barrier Reef that has been a focus of sustained research on these parasites, only about 85 species are described from 40 of the most common, easily-caught species of fish. Reasons are discussed for the relatively small numbers of monogenean species described so far from Australia. Endemicity is difficult to judge, but only one is certain: Concinnocotyla australensis (Polystomatidae) from Neoceratodus forsteri (Dipnoi). Despite reductions in research funding, the value of parasite taxonomy must not be underestimated, particularly in regions of the world that have a rich diversity of potential hosts.

Waterfowl community from a protected artificial wetland in Mexico State, Mexico

Directory of Open Access Journals (Sweden)

Arturo Hernández-Colina

2017-11-01

Full Text Available Wetlands are one of the most important ecosystems worldwide due to the great biologic diversity that they harbor and the re­sources and ecosystem services that they provide; however, their conservation is seriously threatened. Waterfowl are one of the most representative components of wetland biodiversity and the study of their communities is necessary to establish protection priorities appropriately. In this study, we describe the species richness and relative abundance of the waterfowl community of an artificial wetland in Mexico State which we visited from August 2010 to August 2011. We found 23 species, most of which belong to the Anatidae (ducks and Ardeidae (herons families and we recorded an accumulated abundance of 25,220 individuals. We performed an accumulation curve and we used Clench’s model which estimated 24 species; thus, we observed 95% of the predicted species. The arrival of migratory species contributed substantially to the increase of the species richness and the abundance of individuals, especially from October to March. We consider that the species richness and the abundance that we recorded, including observations of rare species, species reproducing, and species under a conservation category, are indicative of the great ecological value of this wetland despite its limited size. Therefore, it is relevant to assess ecological features of natural and artificial wetlands, including waterfowl communities, in order to improve the conservation actions in this region.

Potential radiation dose from eating fish exposed to actinide contamination

International Nuclear Information System (INIS)

Emery, R.M.; Klopfer, D.C.; Baker, D.A.; Soldat, J.K.

1980-01-01

The purpose of this work is to establish a maximum potential for transporting actinides to man via fish consumption. The study took place in U-Pond, a nuclear waste pond on the Hanford Site. It has concentrations of 238 U, 238 Pu, /sup 239,240/Pu and 241 Am that are approximately three orders of magnitude greater than background levels. Fish living in the pond contain higher actinide concentrations than those observed in fish from any other location. Experiments were performed in U-pond to determine maximum quantities of actinides that could accumulate in fillets and whole bodies of two centrarchid fish species. Doses to hypothetical consumers were then estimated by assuming that actinide behavior in their bodies was similar to that defined for Standard Man by the International Commission on Radiological Protection. Results indicate that highest concentrations occurring in bluegill or bass muscle after more than a year's exposure to the pond would not be sufficient to produce a significant radiation dose to a human consumer, even if he ate 0.5 kg (∼1 lb) of these fillets every day for 70 years. Natural predators (heron or coyote), having lifetime diets of whole fish from U-Pond, would receive less radiation dose from the ingested actinides than from natural background sources. 34 refs., 5 figs., 4 tabs

Multivariate analysis of the influences of oceanic and meteorological processes on suspended particulate matter distributions in Mississippi coastal waters

Science.gov (United States)

O'Brien, S. J.; Fitzpatrick, P. J.; Dzwonkowski, B.; Dykstra, S. L.; Wallace, D. J.; Church, I.; Wiggert, J. D.

2016-02-01

The Mississippi Sound is influenced by a high volume of sediment discharge from the Biloxi River, Mobile Bay via Pas aux Herons, Pascagoula River, Pearl River, Wolf River, and Lake Pontchartrain through the Rigolets. The river discharge, variable wind speed, wind direction and tides have a significant impact on the turbidity and transport of sediments in the Sound. Level 1 Moderate Resolution Imaging Spectroradiometer (MODIS) data is processed to extract the remote sensing reflectance at the wavelength of 645 nm and binned into an 8-day composite at a resolution of 500 m. The study uses a regional ocean color algorithm to compute suspended particulate matter (SPM) concentration based on these 8-day composite images. Multivariate analysis is applied between the SPM and time series of tides, wind, turbidity and river discharge measured at federal and academic institutions' stations and moorings. The multivariate analysis also includes in situ measurements of suspended sediment concentration and advective exchanges through the Mississippi Sound's tidal inlets between the coastal shelf and the nearshore estuarine waters. Mechanisms underlying the observed spatiotemporal distribution of SPM, including material exchange between the Sound and adjacent shelf waters, will be explored. The results of this study will contribute to current understanding of exchange mechanisms and pathways with the Mississippi Bight via the Mississippi Sound's tidal inlets.

The cost of pressure ulcers in the United Kingdom.

Science.gov (United States)

Dealey, C; Posnett, J; Walker, A

2012-06-01

To provide an estimate of the costs of treating pressure ulcers in the UK at August 2011 prices, as a means of highlighting the importance of pressure ulcer prevention. Resource use was derived from a bottom-up methodology, based on the daily resources required to deliver protocols of care reflecting good clinical practice, with prices reflecting costs to the health and social care system in the UK. This approach was used to estimate treatment costs per episode of care and per patient for ulcers of different severity and level of complications. The cost of treating a pressure ulcer varies from £1,214 (category 1) to £14,108 (category IV). Costs increase with ulcer severity because the time to heal is longer and the incidence of complications is higher in more severe cases. Pressure ulcers represent a significant cost burden in the UK, both to patients and to health-care providers. Without concerted effort, this cost is likely to increase in the future as the population ages. The estimates reported here provide a basis for assessment of the cost-effectiveness of measures to reduce the incidence of hospital-acquired ulcers. Heron Evidence Development Ltd. was funded for this work by Mölnlycke Health Care (UK). The authors have no other conflicts of interest to declare.

Baseline report - tall upland shrubland at the Rocky Flats Environmental Technology Site

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

Rocky Flats Environmental Technology Site (Site) is located on the Colorado Piedmont east of the Front Range between Boulder and Golden. At an elevation of approximately 6,000 feet, the Site contains a unique ecotonal mixture of mountain and prairie plant species, resulting from the topography and close proximity to the mountain front. The Buffer Zone surrounding the Industrial Area is one of the largest remaining undeveloped areas of its kind along the Colorado Piedmont. A number of plant communities at the Site have been identified as increasingly rare and unique by Site ecologists and the Colorado Natural Heritage Program (CNHP). These include the xeric tallgrass prairie, tall upland shrubland, wetlands, and Great Plains riparian woodland communities. Many of these communities support populations of increasingly rare animals as well, including the Preble`s meadow jumping mouse, grasshopper sparrow, loggerhead shrike, Merriam`s shrew, black crowned night heron, and Hops blue and Argos skipper butterflies. One of the more interesting and important plant communities at the Site is the tall upland shrubland community. It has been generally overlooked by previous Site ecological studies, probably due to its relatively small size; only 34 acres total. Although mentioned in a plant community ordination study conducted by Clark et al. and also in the Site baseline ecological study, few data were available on this plant community before the present study.

Ecological specialization to fluctuating resources prevents long-distance migratory raptors from becoming sedentary on islands.

Science.gov (United States)

Gangoso, Laura; López-López, Pascual; Grande, Juan Manuel; Mellone, Ugo; Limiñana, Rubén; Urios, Vicente; Ferrer, Miguel

2013-01-01

The adaptive transition between behavioral strategies, such as the shift from migratoriness to sedentariness, remains an outstanding question in evolutionary ecology. Density-dependent variation in the age of first breeding has been proposed as a feasible mechanism through which long-lived migratory birds with deferred sexual maturity should become sedentary to persist on islands. Although this pattern seems to hold for most raptors and herons, a few exceptions have been identified. One of these exceptions is the Eleonora's falcon, a long-distance migratory bird, which shows one of the most peculiar adaptations in the timing of reproduction and food requirements among raptors. Here, we compiled data concerning demography, banding recoveries and satellite tracking of Eleonora's falcons to discuss likely explanations for the exceptional behavior of this insular long-distance migratory species. New data reveal that Eleonora's falcons do return to the natal colonies in their first year and young birds are able to breed. However, in contrast to previous hypothesis, the highly specialized strategy of this and other ecologically similar species, as well as the virtual lack of food during winter at breeding areas prevent them from becoming sedentary on islands. Although the ultimate mechanisms underlying the process of sedentarization remain poorly understood, the evidence provided reveal the existence of important trade-offs associated with ecological specialization that may become particularly relevant in the present context of global change.

High natural gene expression variation in the reef-building coral Acropora millepora: potential for acclimative and adaptive plasticity.

Science.gov (United States)

Granados-Cifuentes, Camila; Bellantuono, Anthony J; Ridgway, Tyrone; Hoegh-Guldberg, Ove; Rodriguez-Lanetty, Mauricio

2013-04-08

Ecosystems worldwide are suffering the consequences of anthropogenic impact. The diverse ecosystem of coral reefs, for example, are globally threatened by increases in sea surface temperatures due to global warming. Studies to date have focused on determining genetic diversity, the sequence variability of genes in a species, as a proxy to estimate and predict the potential adaptive response of coral populations to environmental changes linked to climate changes. However, the examination of natural gene expression variation has received less attention. This variation has been implicated as an important factor in evolutionary processes, upon which natural selection can act. We acclimatized coral nubbins from six colonies of the reef-building coral Acropora millepora to a common garden in Heron Island (Great Barrier Reef, GBR) for a period of four weeks to remove any site-specific environmental effects on the physiology of the coral nubbins. By using a cDNA microarray platform, we detected a high level of gene expression variation, with 17% (488) of the unigenes differentially expressed across coral nubbins of the six colonies (jsFDR-corrected, p natural variation between reef corals when assessing experimental gene expression differences. The high transcriptional variation detected in this study is interpreted and discussed within the context of adaptive potential and phenotypic plasticity of reef corals. Whether this variation will allow coral reefs to survive to current challenges remains unknown.

Metals in riparian wildlife of the lead mining district of southeastern Missouri. [Rana catesbeiana, Ondatra zibethicus; Butorides striatus; Nerodia sipedon; Stelgidopteryx serripennis, Riparia riparia

Energy Technology Data Exchange (ETDEWEB)

Niethammer, K.R.; Atkinson, R.D.; Baskett, T.S.; Samson, F.B.

1985-03-01

Five species of riparian vertebrates (425 individuals) primarily representing upper trophic levels were collected from the Big River and Black River drainages in two lead mining districts of southeastern Missouri, 1981-82. Big River is subject to metal pollution via erosion and seepage from large tailings piles from inactive lead mines. Black River drains part of a currently mined area. Bull-frogs (Rana catesbeiana), muskrats (Ondatra zibethicus), and green-backed herons (Butorides striatus) collected downstream from the source of metal contamination to Big River had significantly higher lead and cadmium levels than specimens collected at either an uncontaminated upstream site or on Black River. Northern water snakes (Nerodia sipedon) had elevated lead levels below the tailings source, but did not seem to accumulate cadmium. Levels of lead, cadmium, or zinc in northern rough-winged swallows (Stelgidopteryx serripennis) were not related to collecting locality. Carcasses of ten bank swallows (Riparia riparia) collected from a colony nesting in a tailings pile along the Big River had lead concentrations of 2.0-39 ppm wet weight. Differences between zinc concentrations in vertebrates collected from contaminated and uncontaminated sites were less apparent than differences in lead and cadmium. There was little relationship between metal concentrations in the animals studied and their trophic levels. Bull-frogs are the most promising species examined for monitoring environmental levels of lead, cadmium, and zinc.

Physiological, morphological and allocational plasticity in understory deciduous trees: importance of plant size and light availability.

Science.gov (United States)

Delagrange, Sylvain; Messier, Christian; Lechowicz, Martin J; Dizengremel, Pierre

2004-07-01

In a 4-year study, we investigated changes in leaf physiology, crown morphology and whole-tree biomass allocation in seedlings and saplings of shade-tolerant sugar maple (Acer saccharum Marsh.) and intermediate shade-tolerant yellow birch (Betula alleghaniensis Britt.) growing in natural understory light (0.5 to 35% of full sunlight) or in understory light reduced by 50% with shade nets to simulate the effect of gap closure. Leaf physiological parameters were mainly influenced by the light gradient, whereas crown morphological and whole-tree allocational parameters were mainly influenced by tree size. No single physiological, morphological or allocational trait was identified that could explain the difference in shade tolerance between the species. Yellow birch had higher growth rates, biomass allocation to branches and leaf physiological plasticity and lower crown morphological plasticity in unmodified understory light than sugar maple. Sugar maple did not display significant physiological plasticity, but showed variation with tree size in both crown morphology and whole-tree biomass allocation. When sugar maple was small, a greater proportion of whole-tree biomass was allocated to roots. However, physiological differences between the species decreased with decreasing light and most morphological and allocational differences tended to disappear with increasing tree size, suggesting that many species differences in shade-tolerance are expressed mainly during the seedling stage. Understory trees of both species survived for 4 years under shade nets, possibly because of higher plasticity when small and the use of stored reserves when taller. Copyright 2004 Heron Publishing

Clypeotheca, a new skeletal structure in scleractinian corals: a potential stress indicator

Science.gov (United States)

Nothdurft, L. D.; Webb, G. E.

2009-03-01

Physiological responses to environmental stress are increasingly well studied in scleractinian corals. This work reports a new stress-related skeletal structure we term clypeotheca. Clypeotheca was observed in several live-collected common reef-building coral genera and a two to three kya subfossil specimen from Heron Reef, Great Barrier Reef and consists of an epitheca-like skeletal wall that seals over the surface of parts of the corallum in areas of stress or damage. It appears to form from a coordinated process wherein neighboring polyps and adjoining coenosarc seal themselves off from the surrounding environment as they contract and die. Clypeotheca forms from inward skeletal centripetal growth at the edges of corallites and by the merging of flange-like outgrowths that surround individual spines over the surface of the coenosteum. Microstructurally, the merged flanges are similar to upside-down dissepiments and true epitheca. Clypeotheca is interpreted primarily as a response to stress that may help protect the colony from invasion of unhealthy tissues by parasites or disease by retracting tissues in areas that have become unhealthy for the polyps. Identification of skeletal responses of corals to environmental stress may enable the frequency of certain types of environmental stress to be documented in past environments. Such data may be important for understanding the nature of reef dynamics through intervals of climate change and for monitoring the effects of possible anthropogenic stress in modern coral reef habitats.

Changes in whole-tree water relations during ontogeny of Pinus flexilis and Pinus ponderosa in a high-elevation meadow.

Science.gov (United States)

Fischer, Dylan G; Kolb, Thomas E; DeWald, Laura E

2002-07-01

We measured sap flux in Pinus ponderosa Laws. and Pinus flexilis James trees in a high-elevation meadow in northern Arizona that has been invaded by conifers over the last 150 years. Sap flux and environmental data were collected from July 1 to September 1, 2000, and used to estimate leaf specific transpiration rate (El), canopy conductance (Gc) and whole-plant hydraulic conductance (Kh). Leaf area to sapwood area ratio (LA/SA) increased with increasing tree size in P. flexilis, but decreased with increasing tree size in P. ponderosa. Both Gc and Kh decreased with increasing tree size in P. flexilis, and showed no clear trends with tree size in P. ponderosa. For both species, Gc was lower in the summer dry season than in the summer rainy season, but El did not change between wet and dry summer seasons. Midday water potential (Psi(mid)) did not change across seasons for either species, whereas predawn water potential (Psi(pre)) tracked variation in soil water content across seasons. Pinus flexilis showed greater stomatal response to vapor pressure deficit (VPD) and maintained higher Psi(mid) than P. ponderosa. Both species showed greater sensitivity to VPD at high photosynthetically active radiation (PAR; > 2500 micromol m-2 s-1) than at low PAR (Pinus species, and was influenced by changes in LA/SA. Whole-tree water use and El were similar between wet and dry summer seasons, possibly because of tight stomatal control over water loss. 2002 Heron Publishing--Victoria, Canada

Using heronry birds to monitor urbanization impacts: a case study of painted stork Mycteria leucocephala nesting in the Delhi Zoo, India.

Science.gov (United States)

Urfi, Abdul Jamil

2010-03-01

Although urbanization is a frequently cited cause of biodiversity loss (Czech and Krausman 1997) our understanding about urban ecology is severely limited (Marzluff et al. 2001). Birds are popular bio-indicators of environmental change because they are ecologically versatile, their populations as well as select fitness parameters can be conveniently monitored, often with the voluntary involvement of local nature enthusiasts across large geographical scales, and their presence/absence in a particular area is consequential (Bibby et al. 1992; Urfi 2004). In India, while several studies have focused on changes in bird populations and distributions in natural habitats (Urfi et al. 2005), very few have actually attempted to study either the impacts of urbanization on birds or how different species have adjusted to environmental change. However, many Indian cities offer foraging and nesting habitat for birds, especially colonial waterbirds such as stork, ibis, spoonbill, heron, egret, cormorant, and spoonbill. Some notable examples in this regard are Piele Gardens in Bhavnagar city (Parasharya and Naik 1990), Karanji Tank in Mysore (Jamgaonkar et al. 1994) and the National Zoological Park (hence forth Delhi Zoo) in India's capital city New Delhi (Urfi 1997). In this article, I focus on the opportunities for meaningful ecological research offered by the wild waterbirds nesting in the Delhi Zoo premises and discuss the significance for initiating novel, long term conservation monitoring programs, involving volunteers and bird watchers, to create data bases that will be useful for understanding urbanization and climate change impacts on biodiversity.

Molecular Approach to Microbiological Examination of Water Quality in the Grand Bay National Estuarine Research Reserve (NERR) in Mississippi, USA.

Science.gov (United States)

Kishinhi, Stephen S; Tchounwou, Paul B; Farah, Ibrahim O

2013-01-01

Grand Bay National Estuarine Research Reserve (NERR) is an important ecosystem in the Mississippi Gulf Coast. It serves as important nursery areas for juveniles of many species of fish. The bay is also used for fishing, crabbing, oyster togging, boating as well as recreation. Like in other aquatic environments, this bay may be contaminated by microorganisms including pathogenic bacteria. The objective of this study was to evaluate the microbiological quality of water in the Grand Bay NERR and determine the levels and potential source(s) of human fecal pollution. To achieve this goal, water samples were collected aseptically every month in Bayou Heron, Bayou Cumbest, Point Aux Chenes Bay and Bangs Lake. Enterococci were concentrated from water samples by membrane filtration according to the methodology outlined in USEPA Method 1600. After incubation, DNA was extracted from bacteria colonies on the membrane filters by using QIAamp DNA extraction kit. Water samples were also tested for the presence of traditional indicator bacteria including: heterotrophic plate count, total coliforms, fecal coliforms, and Enterococcus bacteria. The marker esp gene was detected in one site of Bayou Cumbest, an area where human populations reside. Data from this study indicates higher concentrations of indicator bacteria compared to the recommended acceptable levels. Presence of esp marker and high numbers of indicator bacteria suggest a public health concern for shellfish and water contact activities. Hence, control strategies should be developed and implemented to prevent further contamination of the Grand bay NERR waters.

Ecological specialization to fluctuating resources prevents long-distance migratory raptors from becoming sedentary on islands.

Directory of Open Access Journals (Sweden)

Laura Gangoso

Full Text Available BACKGROUND: The adaptive transition between behavioral strategies, such as the shift from migratoriness to sedentariness, remains an outstanding question in evolutionary ecology. Density-dependent variation in the age of first breeding has been proposed as a feasible mechanism through which long-lived migratory birds with deferred sexual maturity should become sedentary to persist on islands. Although this pattern seems to hold for most raptors and herons, a few exceptions have been identified. One of these exceptions is the Eleonora's falcon, a long-distance migratory bird, which shows one of the most peculiar adaptations in the timing of reproduction and food requirements among raptors. METHODOLOGY/PRINCIPAL FINDINGS: Here, we compiled data concerning demography, banding recoveries and satellite tracking of Eleonora's falcons to discuss likely explanations for the exceptional behavior of this insular long-distance migratory species. CONCLUSIONS/SIGNIFICANCE: New data reveal that Eleonora's falcons do return to the natal colonies in their first year and young birds are able to breed. However, in contrast to previous hypothesis, the highly specialized strategy of this and other ecologically similar species, as well as the virtual lack of food during winter at breeding areas prevent them from becoming sedentary on islands. Although the ultimate mechanisms underlying the process of sedentarization remain poorly understood, the evidence provided reveal the existence of important trade-offs associated with ecological specialization that may become particularly relevant in the present context of global change.

Trends in Surface-Water Quality at Selected Ambient-Monitoring Network Stations in Kentucky, 1979-2004

Science.gov (United States)

Crain, Angela S.; Martin, Gary R.

2009-01-01

stations. Flow-adjustment procedures were used with these techniques at all stations to remove the effects of streamflow on water-quality variability. Flow adjustments were used for all constituents, except temperature. A decreasing trend indicates a decrease in concentration of a particular constituent; whereas, an increasing trend indicates an increase in concentration and potential degradation in water quality. Trend results varied statewide by station and by physical property and water-quality constituent. The results for all stations and all physical properties and water-quality constituents examined had at least one statistically significant (p-value <0.05) increasing or decreasing trend during the specified period of record. Water temperature and concentrations of dissolved oxygen had no significant decreasing trends at any station. Water temperature had one significant increasing trend at the South Fork Cumberland River near Blue Heron station. Specific conductance and concentrations of hardness had one significant decreasing trend at the South Fork Cumberland River near Blue Heron station. pH also had a significant decreasing trend at the Mud River near Gus station. Concentrations of total suspended solids had 1 increasing trend at the Kentucky River at High Bridge station and 10 decreasing trends with 5 of those stations located in the Cumberland River Basin. Major ions analyzed for trends included chloride and sulfate. Concentrations of chloride at the 37 stations had increasing trends at 15 stations, decreasing trends at 3 stations, and no significant trend in concentration over time at 19 stations. Most of the increasing trends in concentrations of chloride are located in the northern part of Kentucky, possibly indicating an increase in the use of road salts for road deicing and (or) the result of resource extraction (oil, gas, and coal). Increasing trends of sulfate concentrations were detected at seven stations, all located in the Appalachian

Coastal Changes in Temperature and Salinity Observed during Hurricane Isaac Recorded and Downloaded by NASA DRIFTERs Moored in Heron Bay and at Half Moon Island, Louisiana

Science.gov (United States)

Kalcic, Maria; Iturriaga, Rodolfo H.; Kuper, Philip D.; O'Neal, Stanford Duane; Underwood, Lauren; Fletcher, Rose

2012-01-01

Major changes in salinity (approx.14 ppt.) and temperature (approx.40C) were continuously registered by two prototype NASA DRIFTERs, surface moored floaters, that NASA's Applied Science and Technology Project Office (ASTPO) has developed. The DRIFTER floating sensor module is equipped with an Arduino open-source electronics prototyping platform and programming language (http://www.arduino.cc), a GPS (Global Positioning System) module with antenna, a cell phone SIM (Subscriber Identity Module) card and a cellular antenna which is used to transmit data, and a probe to measure temperature and conductivity (from which salinity can be derived). The DRIFTER is powered by a solar cell panel and all the electronic components are mounted and sealed in [ waterproof encasement. Position and measurement data are transmitted via short message service (SMS) messaging to a Twitter site (DRIFTER 002@NASADRIFTER_002 and DRIFTER 004@NASADRIFTER_004), which provides a live feed. These data are the imported into a Google spreadsheet where conductivity is converted to salinity, and graphed in real-time. The spreadsheet data will be imported into a webpage maintained by ASTPO, where it will be displayed available for dO\\\\1lload.

The fish fauna of Anambra river basin, Nigeria: species abundance and morphometry

Directory of Open Access Journals (Sweden)

Gregory Ejikeme Odo

2009-06-01

Full Text Available The fish yields of most Nigeria inland waters are generally on the decline for causes that may range from inadequate management of the fisheries to degradation of the water bodies. Sustainable exploitation requires knowledge of the ichthyofaunal composition in the water bodies. We did a survey of fish species in Anambra river basin for 22 months. Fish samples were collected using four different gears -hook and line of size 13, caste nets, gill nets, and cages of mesh sizes of 50mm, 75mm, and 100mm each. We recorded 52 fish species belonging to 17 families: 171, 236, and 169 individuals at Ogurugu, Otuocha, and Nsugbe stations respectively. Two families, Characidae, 19.5 %, and Mochokidae, 11.8%, constituted the dominant fish families in the river. The dominant fish species were Citherinus citherius, 9.02%, and Alestes nurse, 7.1%. Other fish species with significant abundance were Synodontis clarias 6.9%, Macrolepidotus curvier 5.7%, Labeo coubie 5.4%, Distichodus rostrtus 4.9%, and Schilbe mystus 4.5%. The meristic features of the two most abundant fish species caught are as follows: Citharinus citharius dorsal fins 20, anal fins 30, caudal fins 21, pectoral fins, 9 and 8 ventral fins, and Alestes nurse 10 dorsal fins, 14 anal fins, 31 caudal fins, 7 pectoral fins and 6 ventral fins. The morphometric features of the two most abundant fish species are Citharinus citharius total length 300mm, standard length 231mm, head length 69mm, body length 101mm, body girth 176 mm, body weight 900mg. Alestes nurse total length 200, standard length 140mm, head length 60mm, body length 80mm, body girth120mm, body weight 400mg. The most abundant animal utilizing the basin was Ardea cinerea(D3 with 22.2% occurrence (D4 and this was followed by Caprini with 13.51%, and Varanus niloticus, 10.04%. The least abundant animals utilizing basin were Chephalophus rufilatus, and Erythrocebus patas, with 0.58% each of occurrence. Rev. Biol. Trop. 57 (1-2: 177-186. Epub

Automated UAV-based video exploitation using service oriented architecture framework

Science.gov (United States)

Se, Stephen; Nadeau, Christian; Wood, Scott

2011-05-01

Airborne surveillance and reconnaissance are essential for successful military missions. Such capabilities are critical for troop protection, situational awareness, mission planning, damage assessment, and others. Unmanned Aerial Vehicles (UAVs) gather huge amounts of video data but it is extremely labour-intensive for operators to analyze hours and hours of received data. At MDA, we have developed a suite of tools that can process the UAV video data automatically, including mosaicking, change detection and 3D reconstruction, which have been integrated within a standard GIS framework. In addition, the mosaicking and 3D reconstruction tools have also been integrated in a Service Oriented Architecture (SOA) framework. The Visualization and Exploitation Workstation (VIEW) integrates 2D and 3D visualization, processing, and analysis capabilities developed for UAV video exploitation. Visualization capabilities are supported through a thick-client Graphical User Interface (GUI), which allows visualization of 2D imagery, video, and 3D models. The GUI interacts with the VIEW server, which provides video mosaicking and 3D reconstruction exploitation services through the SOA framework. The SOA framework allows multiple users to perform video exploitation by running a GUI client on the operator's computer and invoking the video exploitation functionalities residing on the server. This allows the exploitation services to be upgraded easily and allows the intensive video processing to run on powerful workstations. MDA provides UAV services to the Canadian and Australian forces in Afghanistan with the Heron, a Medium Altitude Long Endurance (MALE) UAV system. On-going flight operations service provides important intelligence, surveillance, and reconnaissance information to commanders and front-line soldiers.

Chlorophyll f distribution and dynamics in cyanobacterial beachrock biofilms.

Science.gov (United States)

Trampe, Erik; Kühl, Michael

2016-12-01

Chlorophyll (Chl) f, the most far-red (720-740 nm) absorbing Chl species, was discovered in cyanobacterial isolates from stromatolites and subsequently in other habitats as well. However, the spatial distribution and temporal dynamics of Chl f in a natural habitat have so far not been documented. Here, we report the presence of Chl f in cyanobacterial beachrock biofilms. Hyperspectral imaging on cross-sections of beachrock from Heron Island (Great Barrier Reef, Australia), showed a strong and widely distributed signature of Chl f absorption in an endolithic layer below the dense cyanobacterial surface biofilm that could be localized to aggregates of Chroococcidiopsis-like unicellular cyanobacteria packed within a thick common sheath. High-pressure liquid chromatography-based pigment analyses showed in situ ratios of Chl f to Chl a of 5% in brown-pigmented zones of the beachrock, with lower ratios of ~0.5% in the black- and pink-pigmented biofilm zones. Enrichment experiments with black beachrock biofilm showed stimulated synthesis of Chl f and Chl d when grown under near-infrared radiation (NIR; 740 nm), with a Chl f to Chl a ratio increasing 4-fold to 2%, whereas the Chl d to Chl a ratio went from 0% to 0.8%. Enrichments grown under white light (400-700 nm) produced no detectable amounts of either Chl d or Chl f. Beachrock cyanobacteria thus exhibited characteristics of far-red light photoacclimation, enabling Chl f -containing cyanobacteria to thrive in optical niches deprived of visible light when sufficient NIR is prevalent. © 2016 Phycological Society of America.

Multi-decadal analysis reveals contrasting patterns of resilience and decline in coral assemblages

Science.gov (United States)

Tanner, Jason E.

2017-12-01

A 50-yr study of coral dynamics at Heron Island, on Australia's Great Barrier Reef, shows that community change on a single reef is highly variable and that while some areas of the reef are in decline, others are recovering well 40 yr after a major cyclonic disturbance that eliminated all corals in the study plot. At one site, the genus-level composition in 2012 was identical to that before the cyclone, although it took around 30 yr to recover, and there were still differences at the species level. The colony size structure of some species at this site, notably the dominant Acropora digitifera, which had over 40% cover in 2012, also recovered after 30 yr, although sub-dominant species still lacked large colonies even after 40 yr. Given the small scale of the individual study plots (1 m2), this shows an unexpected degree of determinism in assemblage structure. At a second site, however, both composition and size structure changed dramatically over the last 40 yr of the study as both external and internal factors altered local environmental conditions. At both sites, major changes in composition appear to be related to drying out of the reef crest due to changes in flow regimes and/or natural accretion. At the site that has recovered, erosion has reversed this drying out, whereas no such erosion has occurred at the second site. If such erosion occurs, or sea levels increase due to global warming, then the second site may also prove to be resilient over decadal time scales.

Transboundary pollution: Persistent organochlorine pesticides in migrant birds of the Southwestern United States and Mexico

Science.gov (United States)

Mora, Miguel A.

1997-01-01

The hypothesis that migratory birds accumulate persistent organochlorine pesticides (POPs) during the winter in Latin America has been prevalent for many years, particularly since 1,1,1-trichloro-2,2–bis(p-chlorophenyl)ethane (DDT) was banned in the United States in 1972. It has been suggested that peregrine falcons (Falco peregrinus), black-crowned night herons (Nycticorax nycticorax), white-faced ibises (Plegadis chihi), various migratory waterfowl and shorebirds, and other avian species accumulate higher concentrations of POPs while on migration or on their wintering grounds in Latin America. Nonetheless, the data obtained thus far are limited, and there is no clear pattern to suggest that such accumulation occurs on a widespread basis. In this review wildlife contaminant studies conducted along the U.S.-Mexico border and throughout Mexico are discussed. The results for the most part seem to indicate that no major accumulation of 2,2-bis(p-chlorophenyl)-1,1-dichloroethylene) (DDE), the most persistent organochlorine compound, has occurred or been reported for most parts of Mexico. The majority of the DDE values in birds from Mexico were similar to those reported in birds from the southwestern United States during the same years. More work needs to be done, particularly in those cotton-producing areas of Mexico where DDT was applied heavily in the past (e.g., Chiapas and Michoacan). Because DDT is still used for malaria control and may still be used in agriculture in Chiapas, this state is probably the one where most migrant species would still be at a significant risk of increased accumulation of DDE and DDT.

Characteristic trend of persistent organochlorine contamination in wildlife from a tropical agricultural watershed, south India.

Science.gov (United States)

Ramesh, A; Tanabe, S; Kannan, K; Subramanian, A N; Kumaran, P; Tatsukawa, R

1992-07-01

The residue levels of persistent organochlorines, such as HCH (BHC: 1,2,3,4,5,6-hexachlorocyclohexane) isomers, DDT [1,1,1-trichloro-2,2-bis (p-chlorophenyl) ethane] compounds, PCBs (polychlorobiphenyls) and HCB (hexachlorobenzene), were measured in wildlife. The wildlife were sampled from terrestrial and aquatic habitats in and around the agricultural watershed of Parangipettai, South India. On the basis of overall concentrations sigma HCH ranked first followed by sigma DDT, sigma PCB and HCB, reflecting the increasing usage of HCH in recent years in India. The residue levels of organochlorines in birds varied according to their feeding habits and showed the following pattern: inland piscivores and scavengers greater than coastal piscivores greater than insectivores greater than omnivores greater than granivores. High levels of HCH and DDT residues were recorded in Pond heron and Cattle egret which feed in the agricultural fields. Comparison of HCH concentrations in fish and birds in the study area to other locations was made to further understand the dynamics of contaminant accumulation in tropical wildlife. Regarding birds, a wide variation in residue levels could be seen among various countries, with tropical regions registering high levels. In contrast, the variation is not prominent in the case of fish. The residue levels in fish measured in the present study were generally comparable to values reported from other locations. This suggests that the bioavailability of contaminants to the aquatic fauna is less due to the smaller flux and shorter residence time of these chemicals in the tropics.

Circulating fat-soluble vitamin concentrations and nutrient composition of aquatic prey eaten by American oystercatchers (Haematopus palliatus) in the southeastern United States

Science.gov (United States)

Carlson-Bremer, Daphne; Norton, Terry M.; Sanders, Felicia J.; Winn, Brad; Spinks, Mark D.; Glatt, Batsheva A.; Mazzaro, Lisa; Jodice, Patrick G.R.; Chen, Tai C.; Dierenfeld, Ellen S.

2014-01-01

The American oystercatcher (Haematopus palliatus palliatus) is currently listed as a species of high concern by the United States Shorebird Conservation Plan. Because nutritional status directly impacts overall health and reproduction of individuals and populations, adequate management of a wildlife population requires intimate knowledge of a species' diet and nutrient requirements. Fat-soluble vitamin concentrations in blood plasma obtained from American oystercatchers and proximate, vitamin, and mineral composition of various oystercatcher prey species were determined as baseline data to assess nutritional status and nutrient supply. Bird and prey species samples were collected from the Cape Romain region, South Carolina, USA, and the Altamaha River delta islands, Georgia, USA, where breeding populations appear relatively stable in recent years. Vitamin A levels in blood samples were higher than ranges reported as normal for domestic avian species, and vitamin D concentrations were lower than anticipated based on values observed in poultry. Vitamin E levels were within ranges previously reported for avian groups with broadly similar feeding niches such as herons, gulls, and terns (eg, aquatic/estuarine/marine). Prey species (oysters, mussels, clams, blood arks [Anadara ovalis], whelks [Busycon carica], false angel wings [Petricola pholadiformis]) were similar in water content to vertebrate prey, moderate to high in protein, and moderate to low in crude fat. Ash and macronutrient concentrations in prey species were high compared with requirements of carnivores or avian species. Prey items analyzed appear to meet nutritional requirements for oystercatchers, as estimated by extrapolation from domestic carnivores and poultry species; excesses, imbalances, and toxicities—particularly of minerals and fat-soluble vitamins—may warrant further investigation.

Benthic meiofaunal community response to the cascading effects of herbivory within an algal halo system of the Great Barrier Reef.

Science.gov (United States)

Ollivier, Quinn R; Hammill, Edward; Booth, David J; Madin, Elizabeth M P; Hinchliffe, Charles; Harborne, Alastair R; Lovelock, Catherine E; Macreadie, Peter I; Atwood, Trisha B

2018-01-01

Benthic fauna play a crucial role in organic matter decomposition and nutrient cycling at the sediment-water boundary in aquatic ecosystems. In terrestrial systems, grazing herbivores have been shown to influence below-ground communities through alterations to plant distribution and composition, however whether similar cascading effects occur in aquatic systems is unknown. Here, we assess the relationship between benthic invertebrates and above-ground fish grazing across the 'grazing halos' of Heron Island lagoon, Australia. Grazing halos, which occur around patch reefs globally, are caused by removal of seagrass or benthic macroalgae by herbivorous fish that results in distinct bands of unvegetated sediments surrounding patch reefs. We found that benthic algal canopy height significantly increased with distance from patch reef, and that algal canopy height was positively correlated with the abundances of only one invertebrate taxon (Nematoda). Both sediment carbon to nitrogen ratios (C:N) and mean sediment particle size (μm) demonstrated a positive correlation with Nematoda and Arthropoda (predominantly copepod) abundances, respectively. These positive correlations indicate that environmental conditions are a major contributor to benthic invertebrate community distribution, acting on benthic communities in conjunction with the cascading effects of above-ground algal grazing. These results suggest that benthic communities, and the ecosystem functions they perform in this system, may be less responsive to changes in above-ground herbivorous processes than those previously studied in terrestrial systems. Understanding how above-ground organisms, and processes, affect their benthic invertebrate counterparts can shed light on how changes in aquatic communities may affect ecosystem function in previously unknown ways.

Fossilization of nanobes studied by transmission electron microscopy and constraints related to their population - Recent and Late Quaternary reefbanks (San Salvador Island, The Bahamas; Heron Island, Australia

Czech Academy of Sciences Publication Activity Database

Hladil, Jindřich; Gemperle, Antonín; Carew, J. L.; Bosák, Pavel; Slavík, Ladislav; Pruner, Petr; Charvatova, K.; Mylroie, J. E.; Jell, J. S.

2003-01-01

Roč. 5, Abstracts of the Contributions of the EGS-AGU-EUG Joint Assembly Nice. (2003), s. Abstract Number 05312 ISSN 1029-7006. [EGS-AGU-EUG Joint Assembly. 06.04.2003-11.04.2003, EGS-AGU-EUG Joint Assembly] R&D Projects: GA AV ČR IAA3013209 Institutional research plan: CEZ:AV0Z3013912 Keywords : microbial diagenesis * carbonate platforms * Quaternary Subject RIV: DB - Geology ; Mineralogy http://www.cosis.net/abstracts/EAE03/05312/EAE03-J-05312-1.pdf

Dissolved inorganic carbon, total alkalinity, dissolved oxygen, and pH monitored from benthic Free Ocean Carbon Enrichment (FOCE) -type study in Heron Island reef flat (NODC Accession 0113856)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Ocean acidification poses multiple challenges for coral reefs on molecular to ecological scales, yet previous experimental studies of the impact of projected CO2...

Electrical Resistivity Tomography using a finite element based BFGS algorithm with algebraic multigrid preconditioning

Science.gov (United States)

Codd, A. L.; Gross, L.

2018-03-01

We present a new inversion method for Electrical Resistivity Tomography which, in contrast to established approaches, minimizes the cost function prior to finite element discretization for the unknown electric conductivity and electric potential. Minimization is performed with the Broyden-Fletcher-Goldfarb-Shanno method (BFGS) in an appropriate function space. BFGS is self-preconditioning and avoids construction of the dense Hessian which is the major obstacle to solving large 3-D problems using parallel computers. In addition to the forward problem predicting the measurement from the injected current, the so-called adjoint problem also needs to be solved. For this problem a virtual current is injected through the measurement electrodes and an adjoint electric potential is obtained. The magnitude of the injected virtual current is equal to the misfit at the measurement electrodes. This new approach has the advantage that the solution process of the optimization problem remains independent to the meshes used for discretization and allows for mesh adaptation during inversion. Computation time is reduced by using superposition of pole loads for the forward and adjoint problems. A smoothed aggregation algebraic multigrid (AMG) preconditioned conjugate gradient is applied to construct the potentials for a given electric conductivity estimate and for constructing a first level BFGS preconditioner. Through the additional reuse of AMG operators and coarse grid solvers inversion time for large 3-D problems can be reduced further. We apply our new inversion method to synthetic survey data created by the resistivity profile representing the characteristics of subsurface fluid injection. We further test it on data obtained from a 2-D surface electrode survey on Heron Island, a small tropical island off the east coast of central Queensland, Australia.

'There's the record, closed and final': Rough for Theatre II as Psychiatric Encounter.

Science.gov (United States)

Heron, Jonathan; Broome, Matthew

2016-06-01

A co-authored collaboration between a theatre practitioner and a clinical psychiatrist, this paper will examine Rough for Theatre II (RFTII) and Beckett's demonstration of the way records are used to understand the human subject. Using Beckett's play to explore interdisciplinary issues of embodiment and diagnosis, the authors will present a dialogue that makes use of the 'best sources' in precisely the same manner as the play's protagonists. One of those sources will be Beckett himself, as Heron will locate the play in its theatrical context through reflections upon his own practice (with Fail Better Productions, UK) as well as recent studies such as Beckett, Technology and the Body (Maude 2009) and Performing Embodiment in Samuel Beckett's Drama (McMullan 2010); another source will be the philosopher Wilhelm Windleband, whose 1901 History of Philosophy was read and noted upon by Beckett in the 1930s, as Broome will introduce a philosophical and psychiatric context to the exchange. Windelband is now a neglected figure in philosophy; but as one of the key figures of Neo-Kantianism in the late 19(th) century, his work was an important impetus to that of Rickert, Weber and Heidegger. Specifically, Windelband gives us the distinction between idiographic and nomothetic understanding of individuals, an approach that is of relevance to the psychiatric encounter. This academic dialogue will consider tensions between subjectivity and objectivity in clinical and performance practice, while examining Beckett's analysis of the use of case notes and relating them back to Windelband's ideas on the understanding of others. The dialogue took place in 2011 at the University of Warwick, and has since been edited by the authors.

Seven new species of Paleanotus (Annelida: Chrysopetalidae) described from Lizard Island, Great Barrier Reef, and coral reefs of northern Australia and the Indo-Pacific: two cryptic species pairs revealed between western Pacific Ocean and the eastern Indian Ocean.

Science.gov (United States)

Watson, Charlotte

2015-09-18

Morphological investigation into the paleate genus Paleanotus Schmarda 1861 of the family Chrysopetalidae from northern Australian coral reefs, primarily Lizard Island and outlying reefs, included a complex of very small, slender individuals (length < 5 mm). This complex resolved into 7 new species, described herein: Paleanotus inornatus n. sp., P. adornatus n. sp., P. chrysos n. sp., P. aquifolia n. sp., P. latifolia n. sp., P. silus n. sp., and P. silopsis n. sp. A key is provided to the new species and Paleanotus distinguished from Treptopale and Hyalopale, two closely related genera. Diagnostic features of the apical structure and shape of the notochaetal main paleae plus median paleae shape and raised rib pattern, differentiates each species from the other. Gametous states are described. Two cryptic species pairs (Paleanotus silopsis n. sp. and P. silus n. sp.; Paleanotus aquifolia n. sp. and P. latifolia n. sp.) were identified. In each case one species is restricted to either the NE or NW Australian coast. In each pair the most eastern point for the NW Australian species range occurs at Darwin, western Arnhemland, Northern Territory. Additional material for each species pair extends their respective ranges northwards: NW Australia to Thailand, Andaman Sea, eastern Indian Ocean or NE Australia, Great Barrier Reef to the Philippines, western Pacific Ocean. Cryptic morphology and potential genetic diversity is discussed in Paleanotus inornatus n. sp. and P. adornatus n. sp. that possess overlapping widespread distribution patterns across northern Australia and Indo-Pacific reefs. The smallest bodied taxon, Paleanotus chrysos n. sp. is the only species with a Coral Sea range encompassing Lizard Island, Heron Island and New Caledonia.

Highly Pathogenic Avian Influenza H5N8 Clade 2.3.4.4b in Germany in 2016/2017

Directory of Open Access Journals (Sweden)

Anja Globig

2018-01-01

Full Text Available Here, we report on the occurrence of highly pathogenic avian influenza (HPAI H5Nx clade 2.3.4.4b in Germany. Between November 8, 2016, and September 30, 2017, more than 1,150 cases of HPAI H5Nx clade 2.3.4.4b in wild birds and 107 outbreaks in birds kept in captivity (92 poultry holdings and 15 zoos/animal parks were reported in Germany. This HPAI epidemic is the most severe recorded in Germany so far. The viruses were apparently introduced by migratory birds, sparking an epidemic among wild birds across Germany with occasional incursions into poultry holdings, zoos and animal parks, which were usually rapidly detected and controlled by stamping out. HPAI viruses (mainly subtype H5N8, in a few cases also H5N5 were found in dead wild birds of at least 53 species. The affected wild birds were water birds (including gulls, storks, herons, and cormorants and scavenging birds (birds of prey, owls, and crows. In a number of cases, substantial gaps in farm biosecurity may have eased virus entry into the holdings. In a second wave of the epidemic starting from February 2017, there was epidemiological and molecular evidence for virus transmission of the infections between commercial turkey holdings in an area of high poultry density, which caused approximately 25% of the total number of outbreaks in poultry. Biosecurity measures in poultry holdings should be adapted. This includes, inter alia, wearing of stable-specific protective clothing and footwear, cleaning, and disinfection of equipment that has been in contact with birds and prevention of contacts between poultry and wild water birds.

Prevalence of virus-like particles within a staghorn scleractinian coral ( Acropora muricata) from the Great Barrier Reef

Science.gov (United States)

Patten, N. L.; Harrison, P. L.; Mitchell, J. G.

2008-09-01

Transmission electron microscopy (TEM) was used to determine whether Acropora muricata coral colonies from the Great Barrier Reef (GBR), Australia, harboured virus-like particles (VLPs). VLPs were present in all coral colonies sampled at Heron Island (southern GBR) and in tagged coral colonies sampled in at least two of the three sampling periods at Lizard Island (northern GBR). VLPs were observed within gastrodermal and epidermal tissues, and on rarer occasions, within the mesoglea. These VLPs had similar morphologies to known prokaryotic and eukaryotic viruses in other systems. Icosahedral VLPs were observed most frequently, however, filamentous VLPs (FVLPs) and phage were also noted. There were no clear differences in VLP size, morphology or location within the tissues with respect to sample date, coral health status or site. The most common VLP morphotype exhibited icosahedral symmetry, 120-150 nm in diameter, with an electron-dense core and an electronlucent membrane. Larger VLPs of similar morphology were also common. VLPs occurred as single entities, in groups, or in dense clusters, either as free particles within coral tissues, or within membrane-bound vacuoles. VLPs were commonly observed within the perinuclear region, with mitochondria, golgi apparatus and crescent-shaped particles frequently observed within close proximity. The host(s) of these observed VLPs was not clear; however, the different sizes and morphologies of VLPs observed within A. muricata tissues suggest that viruses are infecting either the coral animal, zooxanthellae, intracellular bacteria and/or other coral-associated microbiota, or that the one host is susceptible to infection from more than one type of virus. These results add to the limited but emerging body of evidence that viruses represent another potentially important component of the coral holobiont.

Discovery of seven novel Mammalian and avian coronaviruses in the genus deltacoronavirus supports bat coronaviruses as the gene source of alphacoronavirus and betacoronavirus and avian coronaviruses as the gene source of gammacoronavirus and deltacoronavirus.

Science.gov (United States)

Woo, Patrick C Y; Lau, Susanna K P; Lam, Carol S F; Lau, Candy C Y; Tsang, Alan K L; Lau, John H N; Bai, Ru; Teng, Jade L L; Tsang, Chris C C; Wang, Ming; Zheng, Bo-Jian; Chan, Kwok-Hung; Yuen, Kwok-Yung

2012-04-01

Recently, we reported the discovery of three novel coronaviruses, bulbul coronavirus HKU11, thrush coronavirus HKU12, and munia coronavirus HKU13, which were identified as representatives of a novel genus, Deltacoronavirus, in the subfamily Coronavirinae. In this territory-wide molecular epidemiology study involving 3,137 mammals and 3,298 birds, we discovered seven additional novel deltacoronaviruses in pigs and birds, which we named porcine coronavirus HKU15, white-eye coronavirus HKU16, sparrow coronavirus HKU17, magpie robin coronavirus HKU18, night heron coronavirus HKU19, wigeon coronavirus HKU20, and common moorhen coronavirus HKU21. Complete genome sequencing and comparative genome analysis showed that the avian and mammalian deltacoronaviruses have similar genome characteristics and structures. They all have relatively small genomes (25.421 to 26.674 kb), the smallest among all coronaviruses. They all have a single papain-like protease domain in the nsp3 gene; an accessory gene, NS6 open reading frame (ORF), located between the M and N genes; and a variable number of accessory genes (up to four) downstream of the N gene. Moreover, they all have the same putative transcription regulatory sequence of ACACCA. Molecular clock analysis showed that the most recent common ancestor of all coronaviruses was estimated at approximately 8100 BC, and those of Alphacoronavirus, Betacoronavirus, Gammacoronavirus, and Deltacoronavirus were at approximately 2400 BC, 3300 BC, 2800 BC, and 3000 BC, respectively. From our studies, it appears that bats and birds, the warm blooded flying vertebrates, are ideal hosts for the coronavirus gene source, bats for Alphacoronavirus and Betacoronavirus and birds for Gammacoronavirus and Deltacoronavirus, to fuel coronavirus evolution and dissemination.

Habitat Evaluation Procedures (HEP) Report; Big Island - The McKenzie River, Technical Report 1998-2001.

Energy Technology Data Exchange (ETDEWEB)

Sieglitz, Greg

2001-03-01

The Big Island site is located in the McKenzie River flood plain, containing remnant habitats of what was once more common in this area. A diverse array of flora and fauna, representing significant wildlife habitats, is present on the site. Stands of undisturbed forested wetlands, along with riparian shrub habitats and numerous streams and ponds, support a diversity of wildlife species, including neotropical migratory songbirds, raptors, mammals, reptiles, and amphibians (including two State-listed Sensitive Critical species). The project is located in eastern Springfield, Oregon (Figure 1). The project area encompasses 187 acres under several ownerships in Section 27 of Township 17S, Range 2W. Despite some invasion of non-native species, the site contains large areas of relatively undisturbed wildlife habitat. Over several site visits, a variety of wildlife and signs of wildlife were observed, including an active great blue heron rookery, red-Legged frog egg masses, signs of beaver, and a bald eagle, Wildlife habitat values resulting from the purchase of this site will contribute toward the goal of mitigating for habitat lost as outlined in the Bonneville Power Administration's (BPA) Mitigation and Enhancement Plan for the Willamette River Basin. Under this Plan, mitigation goals and objectives were developed as a result of the loss of wildlife habitat due to the construction of Federal hydroelectric facilities in the Willamette River Basin. Results of the Habitat Evaluation Procedures (HEP) will be used to: (1) determine the current habitat status of the study area and habitat enhancement potential of the site consistent with wildlife mitigation goals and objectives; and (2) develop a management plan for the area.

From Leonardo to da Vinci: the history of robot-assisted surgery in urology.

Science.gov (United States)

Yates, David R; Vaessen, Christophe; Roupret, Morgan

2011-12-01

What's known on the subject? and What does the study add? Numerous urological procedures can now be performed with robotic assistance. Though not definitely proven to be superior to conventional laparoscopy or traditional open surgery in the setting of a randomised trial, in experienced centres robot-assisted surgery allows for excellent surgical outcomes and is a valuable tool to augment modern surgical practice. Our review highlights the depth of history that underpins the robotic surgical platform we utilise today, whilst also detailing the current place of robot-assisted surgery in urology in 2011. The evolution of robots in general and as platforms to augment surgical practice is an intriguing story that spans cultures, continents and centuries. A timeline from Yan Shi (1023-957 bc), Archytas of Tarentum (400 bc), Aristotle (322 bc), Heron of Alexandria (10-70 ad), Leonardo da Vinci (1495), the Industrial Revolution (1790), 'telepresence' (1950) and to the da Vinci(®) Surgical System (1999), shows the incredible depth of history and development that underpins the modern surgical robot we use to treat our patients. Robot-assisted surgery is now well-established in Urology and although not currently regarded as a 'gold standard' approach for any urological procedure, it is being increasingly used for index operations of the prostate, kidney and bladder. We perceive that robotic evolution will continue infinitely, securing the place of robots in the history of Urological surgery. Herein, we detail the history of robots in general, in surgery and in Urology, highlighting the current place of robot-assisted surgery in radical prostatectomy, partial nephrectomy, pyeloplasty and radical cystectomy. © 2011 THE AUTHORS. BJU INTERNATIONAL © 2011 BJU INTERNATIONAL.

Environmental Conditions and Threatened and Endangered Species Populations near the Titain, Atlas, and Delta Launch Complexes, Cape Canaveral Air Station

Science.gov (United States)

Oddy, Donna M.; Stolen, Eric D.; Schmalzer, Paul A.; Hensley, Melissa A.; Hall, Patrice; Larson, Vickie L.; Turek, Shannon R.

1999-01-01

located at Titan, Atlas, and Delta launch complexes between 1995 and 1997. No direct impacts to scrub-jays were observed as a result of normal launches. The explosion of the Delta rocket in January 1997 caused direct impacts to the habitat of several scrub-jays families, from fire and debris; however, no scrub-jay mortality was observed. Mortality exceeded reproductive output at all areas over the course of the study. Populations of the southeastern beach mouse (Peromyscus polionotus niveiventris) populations, a Federally listed, threatened species, reside near all the launch complexes. Hurricane Erin and several other tropical storms impacted several areas at the inception of the study in 1995 causing coastal habitat alterations as a result of salt-water intrusion. Both the habitat and the beach mice populations recovered during the course of the study. No direct impacts to southeastern beach mice were observed as a result of normal launch operations. Direct impacts were observed to the habitat as a result of the explosion of the Delta rocket in January 1997. This alteration of the habitant resulted in a shift in use with the mice moving on to the newly burned part of the site. Waterbirds use wetlands and aquatic systems near the launch complexes. Species include the Federally-listed, endangered Wood Stork (Mycteria americana) and several state-listed species of special concern including the Snowy Egret (Egretta thula thula), Reddish Egret (Egretta rufescens rufescens), White Ibis (Eudocimus albus), Roseate Spoonbill (Ajaia ajaja), Tricolored Heron (Egretta tricolor ruficolis), and Little Blue Heron (Egretta caerulea). No impacts to these populations resulting from any launch operations were observed. Gopher tortoises (Gopherus polyphemus) also occur around the launch complexes. Most of those observed appeared to be in good condition; however, upper respiratory tract disease is known to occur in the population. Cape Canaveral Air Station, including areas near active

Environmental Conditions and Threatened and Endangered Species Populations near the Titan, Atlas, and Delta Launch Complexes, Cape Canaveral Air Station

Science.gov (United States)

Oddy, Donna M.; Stolen, Eric D.; Schmalzer, Paul A.; Hensley, Melissa A.; Hall, Patrice; Larson, Vickie L.; Turek, Shannon R.

1999-01-01

Titan, Atlas, and Delta launch complexes between 1995 and 1997. No direct impacts to scrub-jays were observed as a result of normal launches. The explosion of the Delta rocket in January 1997 caused direct impacts to the habitat of several scrub-jays families, from fire and debris; however, no scrub-jay mortality was observed. Mortality exceeded reproductive output at all areas over the course of the study. Populations of the southeastern beach mouse (Peromyscus polionotus niveiventris) populations, a Federally listed, threatened species, reside near all the launch complexes. Hurricane Erin and several other tropical storms impacted several areas at the inception of the study in 1995 causing coastal habitat alterations as a result of salt-water intrusion. Both the habitat and the beach mice populations recovered during the course of the study. No direct impacts to southeastern beach mice were observed as a result of normal launch operations. Direct impacts were observed to the habitat as a result of the explosion of the Delta rocket in January 1997. This alteration of the habitat resulted in a shift in use with the mice moving on to the newly burned part of the site. Waterbirds use wetlands and aquatic systems near the launch complexes. Species include the Federally-listed, endangered Wood Stork (Mycferia americana) and several state-listed species of special concern including the Snowy Egret (Egretfa thula fhula), Reddish Egret (Egreffa rufescens rufescens), White Ibis (Eudocimus albus), Roseate Spoonbill (Ajaia ajaja), Tricolored Heron (Egreffa tricolor ruficolis), and Little Blue Heron (Egreffa caerulea). No impacts to these populations resulting from any launch operations were observed. Gopher tortoises (Gopherus polyphemus) also occur around the launch complexes. Most of those observed appeared to be in good condition; however, upper respiratory tract disease is known to occur in the population. Cape Canaveral Air Station, including areas near active launch colexes

Pharmacokinetics, pharmacodynamics, and tolerability of verinurad, a selective uric acid reabsorption inhibitor, in healthy adult male subjects

Directory of Open Access Journals (Sweden)

Shen Z

2017-07-01

Full Text Available Zancong Shen,1 Michael Gillen,2 Jeffrey N Miner,1 Gail Bucci,1 David M Wilson,1 Jesse W Hall1 1Ardea Biosciences, Inc., San Diego, CA, 2AstraZeneca, Gaithersburg, MD, USA Purpose: Verinurad (RDEA3170 is a selective uric acid reabsorption inhibitor in clinical development for the treatment of gout and asymptomatic hyperuricemia. The aim of this study was to evaluate the pharmacokinetics, pharmacodynamics, and tolerability of verinurad in healthy adult males.Subjects and methods: This was a Phase I, randomized, double-blind, placebo-controlled, single and multiple ascending dose study. Panels of eight male subjects received a single oral dose of verinurad or placebo in either a fasted or fed state; panels of 10–12 male subjects received ascending doses of once-daily verinurad or placebo in a fasted state for 10 days. Serial blood and urine samples were assayed for verinurad and uric acid. Safety was assessed by adverse event (AE reports, laboratory tests, vital signs, and electrocardiograms (ECGs.Results: A total of 81 adult males completed the study. Following single doses of verinurad, maximum observed plasma concentration (Cmax and area under the plasma concentration–time curve (AUC increased in a dose-proportional manner; Cmax occurred at 0.5–0.75 hours and 1.25 hours in the fasted and fed states, respectively. Food decreased AUC by 23% and Cmax by 37%-53%. There was a modest accumulation of verinurad following multiple daily doses. Verinurad reduced serum urate levels by up to 62% (40 mg, single dose and 61% (10 mg, multiple dose. The increase in urinary excretion of uric acid was greatest in the first 6 hours after dosing and was still evident ≥24 hours for verinurad doses ≥2 mg. Verinurad was well tolerated at all doses. No serious AEs, severe AEs, discontinuations due to AEs, or clinically significant laboratory or ECG abnormalities were reported.Conclusion: Single and multiple doses of verinurad were well tolerated

A modern Sr/Ca-δ18O-sea surface temperature calibration for Isopora corals on the Great Barrier Reef

Science.gov (United States)

Brenner, Logan D.; Linsley, Braddock K.; Potts, Donald C.

2017-02-01

Isopora (Acroporidae) is a genus of often encrusting, branching to submassive corals that are common in many shallow habitats on modern and fossil Indo-West Pacific reefs. Although abundant, Isopora is largely absent from paleoceanographic literature. The scarcity of large Porites and the abundance of Isopora retrieved from the Great Barrier Reef (GBR) on Integrated Ocean Drilling Program Expedition 325 focused paleoceanographic attention on Isopora. Here we provide the first independent high-resolution calibration of both Sr/Ca and δ18O for temperature analyses based on Isopora and demonstrate its consistency with Porites records. We developed modern skeletal Sr/Ca- and δ18O-sea surface temperature (SST) calibrations based on five modern Isopora colonies from Heron Island in the southern GBR. Pairing the coral Sr/Ca record with monthly SST data yielded Sr/Ca-SST sensitivities from -0.061 ± 0.004 (centered) to -0.083 ± 0.007 (raw) mmol/mol °C-1 based on reduced major axis regressions. These sensitivities are in the middle of the range of published Porites values and overlap most published values for Isopora, -0.075 ± 0.011 to -0.065 ± 0.011 mmol/mol °C-1. The δ18O-SST sensitivities range from -0.184 ± 0.014 (centered) to -0.185 ± 0.014 (raw) ‰ °C-1, assuming that all seasonal variation in δ18O was due to SST. These δ18O-SST sensitivities are smaller than the widely accepted value of -0.23‰ °C-1 for biogenic aragonite but are at the upper end of high-resolution Porites-defined sensitivities that are consistently less than the aforementioned established value. Our results validate the use of Isopora as an alternative source of paleoceanographic records in habitats where large massive Porites are scarce or absent.

The ecology of 'Acroporid white syndrome', a coral disease from the southern Great Barrier Reef.

Directory of Open Access Journals (Sweden)

George Roff

Full Text Available Outbreaks of coral disease have increased worldwide over the last few decades. Despite this, remarkably little is known about the ecology of disease in the Indo-Pacific Region. Here we report the spatiotemporal dynamics of a coral disease termed 'Acroporid white syndrome' observed to affect tabular corals of the genus Acropora on the southern Great Barrier Reef. The syndrome is characterised by rapid tissue loss initiating in the basal margins of colonies, and manifests as a distinct lesion boundary between apparently healthy tissue and exposed white skeleton. Surveys of eight sites around Heron Reef in 2004 revealed a mean prevalence of 8.1±0.9%, affecting the three common species (Acropora cytherea, A. hyacinthus, A. clathrata and nine other tabular Acropora spp. While all sizes of colonies were affected, white syndrome disproportionately affected larger colonies of tabular Acroporids (>80 cm. The prevalence of white syndrome was strongly related to the abundance of tabular Acroporids within transects, yet the incidence of the syndrome appears unaffected by proximity to other colonies, suggesting that while white syndrome is density dependant, it does not exhibit a strongly aggregated spatial pattern consistent with previous coral disease outbreaks. Acroporid white syndrome was not transmitted by either direct contact in the field or by mucus in aquaria experiments. Monitoring of affected colonies revealed highly variable rates of tissue loss ranging from 0 to 1146 cm(-2 week(-1, amongst the highest documented for a coral disease. Contrary to previous links between temperature and coral disease, rates of tissue loss in affected colonies increased threefold during the winter months. Given the lack of spatial pattern and non-infectious nature of Acroporid white syndrome, further studies are needed to determine causal factors and longer-term implications of disease outbreaks on the Great Barrier Reef.

The long term response of birds to climate change: new results from a cold stage avifauna in northern England.

Directory of Open Access Journals (Sweden)

John R Stewart

Full Text Available The early MIS 3 (55-40 Kyr BP associated with Middle Palaeolithic archaeology bird remains from Pin Hole, Creswell Crags, Derbyshire, England are analysed in the context of the new dating of the site's stratigraphy. The analysis is restricted to the material from the early MIS 3 level of the cave because the upper fauna is now known to include Holocene material as well as that from the Late Glacial. The results of the analysis confirm the presence of the taxa, possibly unexpected for a Late Pleistocene glacial deposit including records such as Alpine swift, demoiselle crane and long-legged buzzard with southern and/or eastern distributions today. These taxa are accompanied by more expected ones such as willow ptarmigan /red grouse and rock ptarmigan living today in northern and montane areas. Finally, there are temperate taxa normally requiring trees for nesting such as wood pigeon and grey heron. Therefore, the result of the analysis is that the avifauna of early MIS 3 in England included taxa whose ranges today do not overlap making it a non-analogue community similar to the many steppe-tundra mammalian faunas of the time. The inclusion of more temperate and woodland taxa is discussed in the light that parts of northern Europe may have acted as cryptic northern refugia for some such taxa during the last glacial. These records showing former ranges of taxa are considered in the light of modern phylogeographic studies as these often assume former ranges without considering the fossil record of those taxa. In addition to the anomalous combination of taxa during MIS 3 living in Derbyshire, the individuals of a number of the taxa are different in size and shape to members of the species today probably due to the high carrying capacity of the steppe-tundra.

Biodiversity assessment at Department of Atomic Energy (DAE) campus, Kalpakkam

International Nuclear Information System (INIS)

Jahir Hussain, K.; Satpathy, K.K.; Prasad, M.V.R.; Ramesh, T.; Selvanayagam, M.

2008-01-01

A rapid assessment of biodiversity in the DAE campus, Kalpakkam was carried out. The entire DAE campus of 3000 acres, at Kalpakkam was divided into four representative plots comprising of different landscapes namely (1) undisturbed area with dense vegetation, (2) building area, (3) water bodies with riparian cover and (4) sandy area with meager vegetation for inventorying of charismatic terrestrial/semi-aquatic fauna viz., Mammals, Birds, Reptiles, Amphibians and Butterflies. For birds, early morning surveys were made whereas for mammals evening and night surveys were followed. Midday sampling was followed for butterflies and other animals. Each plot was surveyed twice in a week over a period of one year (April 07' to March 08'). Totally 128 species of animals were identified during the survey and it has highlighted the potential of biodiversity in the campus. The diversity of butterflies is remarkable. Twenty-two butterfly species were encountered. Frogs, toads, lizards and snakes are also diverse. Five species of frogs and one species of toad were recorded. Lizards are more diverse than snakes. Nine species of lizards were encountered. Calotus versicolor is abundant followed by common skink. Totally five species of snakes were recorded. Among them Common bronzedback and Green Vine Snake were predominant. Seventy species of birds were recorded during the survey period. Black crowned night heron, Common house crow, Great cormorant, Oriental white ibis, Painted stork, Cattle egret, Common mynah are more common. Sixteen species of mammals were encountered during the survey. Wild cattle, Jackal, Jungle cat, Toddy cat, Crested porcupine and Indian civet are the major wildlife found. Indian civet and Crested porcupine are elusive animals that are diminishing from wild and their presence at this campus is an indication of less human intervention. (author)

The Long Term Response of Birds to Climate Change: New Results from a Cold Stage Avifauna in Northern England

Science.gov (United States)

Stewart, John R.

2015-01-01

The early MIS 3 (55–40 Kyr BP associated with Middle Palaeolithic archaeology) bird remains from Pin Hole, Creswell Crags, Derbyshire, England are analysed in the context of the new dating of the site’s stratigraphy. The analysis is restricted to the material from the early MIS 3 level of the cave because the upper fauna is now known to include Holocene material as well as that from the Late Glacial. The results of the analysis confirm the presence of the taxa, possibly unexpected for a Late Pleistocene glacial deposit including records such as Alpine swift, demoiselle crane and long-legged buzzard with southern and/or eastern distributions today. These taxa are accompanied by more expected ones such as willow ptarmigan /red grouse and rock ptarmigan living today in northern and montane areas. Finally, there are temperate taxa normally requiring trees for nesting such as wood pigeon and grey heron. Therefore, the result of the analysis is that the avifauna of early MIS 3 in England included taxa whose ranges today do not overlap making it a non-analogue community similar to the many steppe-tundra mammalian faunas of the time. The inclusion of more temperate and woodland taxa is discussed in the light that parts of northern Europe may have acted as cryptic northern refugia for some such taxa during the last glacial. These records showing former ranges of taxa are considered in the light of modern phylogeographic studies as these often assume former ranges without considering the fossil record of those taxa. In addition to the anomalous combination of taxa during MIS 3 living in Derbyshire, the individuals of a number of the taxa are different in size and shape to members of the species today probably due to the high carrying capacity of the steppe-tundra. PMID:25992609

Functional implications of species differences in the size and morphology of the isthmo optic nucleus (ION in birds.

Directory of Open Access Journals (Sweden)

Cristián Gutiérrez-Ibáñez

Full Text Available In birds, there is a retinofugal projection from the brain to the retina originating from the isthmo optic nucleus (ION in the midbrain. Despite a large number of anatomical, physiological and histochemical studies, the function of this retinofugal system remains unclear. Several functions have been proposed including: gaze stabilization, pecking behavior, dark adaptation, shifting attention, and detection of aerial predators. This nucleus varies in size and organization among some species, but the relative size and morphology of the ION has not been systematically studied. Here, we present a comparison of the relative size and morphology of the ION in 81 species of birds, representing 17 different orders. Our results show that several orders of birds, besides those previously reported, have a large, well-organized ION, including: hummingbirds, woodpeckers, coots and allies, and kingfishers. At the other end of the spectrum, parrots, herons, waterfowl, owls and diurnal raptors have relatively small ION volumes. ION also appears to be absent or unrecognizable is several taxa, including one of the basal avian groups, the tinamous, which suggests that the ION may have evolved only in the more modern group of birds, Neognathae. Finally, we demonstrate that evolutionary changes in the relative size and the cytoarchitectonic organization of ION have occurred largely independent of phylogeny. The large relative size of the ION in orders with very different lifestyles and feeding behaviors suggest there is no clear association with pecking behavior or predator detection. Instead, our results suggest that the ION is more complex and enlarged in birds that have eyes that are emmetropic in some parts of the visual field and myopic in others. We therefore posit that the ION is involved in switching attention between two parts of the retina i.e. from an emmetropic to a myopic part of the retina.

Threatened and Endangered Species Survey for Patrick Air Force Base, Florida

Science.gov (United States)

Oddy, Donna M.; Stolen, Eric D.; Schmalzer, Paul A.; Larson, Vickie L.; Hall, Patrice; Hensley, Melissa A.

1997-01-01

characteristic of species that occur in the Indian River Lagoon system. Twenty-five species of waterbirds were observed during quarterly surveys on PAFB, including five species listed as species of special concern by the state of Florida: Snowy Egret (Egretta thula), Little Blue Heron (Egretta caerulea), Tricolored Heron (Egretta tricolo4, White Ibis (Eudocimus albus), and Brown Pelican (Pelecanus occidentalis). The Golf Course was used extensively by almost all species of waterbirds on PAFB. Twenty-two species of shorebirds were observed on PAFB. Although no listed species were observed, the potential exists for several protected species of shorebirds to use the beach at PAFB during some parts of the year. The Airfield runways and associated grass areas were important sites at PAFB for loafing and feeding for some shorebirds. Surveys of rooftop nesting by Least Terns (Stema antillarum) on PAFB found a large colony on a rooftop in the PAFB Industrial Area. This colony produced some independent young. Two rooftop Least Tern colonies reported from previous years were inactive during 1996. A small number of Black Skimmers (Rhynchops nigee attempted to nest at the Least Ten colony but were unsuccessful. Surveys for the gopher tortoise (Gopherus polyphemus) revealed burrows and tortoises only at the Waste Study Site; five burrows and three tortoises were observed. No Florida scrub lizards (Sceloporus woodi), eastern indigo snakes (Drymarchon corais couperl), or diamondback terrapins (Malademys terrapin terrapin) were observed. American alligators (Alligator mississippiensis) were observed on the Golf Course and using ditches, ponds, and areas along the Banana River. The amount of dune habitat could be expanded by not mowing areas adjacent to the dunes to allow dune species to colonize and expand. Planting dune species as part of the beach renourishment project will also increase this habitat. Exotic plants dominate several areas on the base and are used by threatened, endangered, and

Ecology of mangroves in the Jewfish Chain, Exuma, Bahamas

Science.gov (United States)

Wilcox, L. V.; Yocom, Thomas G.; Forbes, A. M.

1976-01-01

The structure and function of mangrove communities in the Jewfish Chain, Exumas, Bahamas, were investigated for 3-1/2 years. Mangrove vegetation in the Jewfish Chain is similar to that in all the Caribbean-Florida area; Rhizophora mangle L. dominates and is interspersed with Avicennia germinans (L.) Lamk. and Laguncularia racemosa (L.) Gaertn. There is no apparent zonation of these three species. The mangrove communities in the Jewfish Chain occur only where they are protected from prevailing winds, storms, and tides, although all are periodically devastated by hurricanes. We found little or no evidence of coast building within these protected locations. The importance of the mangroves appears to be in providing protection and food for other flora and fauna within this unique ecosystem. Twenty-four species of algae were found in the mangroves, 9 of which had not previously been reported from the Bahamas. Distribution of these algae appears to be correlated to incident solar radiation, desiccation, and tide level. A total of 56 species of fish were found in the mangroves, 2 of which were not previously known from the Bahamas. Many fish taken were juveniles, suggesting that mangroves are a nursery ground for numerous species. Nine species of molluscs were found. Each species had a distinct distribution pattern relative to distance from the seaward edge of the mangroves, as well as a distinct vertical distribution pattern. Seventeen species of decapod crustaceans were recorded. Though several species of birds were noted in the mangroves, three species were most abundant: the white-crowned pigeon (Columba leucocephala) uses the mangrove for nesting but feeds in nearby shrub-thorn communities; the gray kingbird (Tyrannus dominicensis) and green heron (Butorides virescens) nest and feed in the mangroves. Our data do not completely describe a stereotyped mangrove community in the Bahamas, but they do give an indication of community structure and suggest several

A geometric approach to aortic root surgical anatomy.

Science.gov (United States)

Contino, Monica; Mangini, Andrea; Lemma, Massimo Giovanni; Romagnoni, Claudia; Zerbi, Pietro; Gelpi, Guido; Antona, Carlo

2016-01-01

The aim of this study was the analysis of the geometrical relationships between the different structures constituting the aortic root, with particular attention to interleaflet triangles, haemodynamic ventriculo-arterial junction and functional aortic annulus in normal subjects. Sixteen formol-fixed human hearts with normal aortic roots were studied. The aortic root was isolated, sectioned at the midpoint of the non-coronary sinus, spread apart and photographed by a high-resolution digital camera. After calibration and picture resizing, the software AutoCAD 2004 was used to identify and measure all the elements of the interleaflets triangles and of the aortic root that were objects of our analysis. Multiple comparisons were performed with one-way analysis of variance for continuous data and with Kruskal-Wallis analysis for non-continuous data. Linear regression and Pearson's product correlation were used to correlate root element dimensions when appropriate. Student's t-test was used to compare means for unpaired data. Heron's formula was applied to estimate the functional aortic annular diameters. The non coronary-left coronary interleaflets triangles were larger, followed by inter-coronary and right-non-coronary ones. The apical angle is <60° and its standard deviation can be considered an asymmetry index. The sinu-tubular junction was shown to be 10% larger than the virtual basal ring (VBR). The mathematical relationship between the haemodynamic ventriculo-arterial junction and the VBR calculated by linear regression and expressed in terms of the diameter was: haemodynamic ventriculo-arterial junction = 2.29 VBR (diameter) + 47. Conservative aortic surgery is based on a better understanding of aortic root anatomy and physiology. The relationships among its elements are of paramount importance during aortic valve repair/sparing procedures and they can be useful also in echocardiographic analysis and in computed tomography reconstruction. © The Author 2015

Water: from the source to the treatment plan

Science.gov (United States)

Baude, I.; Marquet, V.

2012-04-01

Isabelle BAUDE isa.baude@free.fr Lycee français de Vienne Liechtensteinstrasse 37AVienna As a physics and chemistry teacher, I have worked on water from the source to the treatment plant with 27 pupils between 14 and 15 years old enrolled in the option "Science and laboratory". The objectives of this option are to interest students in science, to introduce them to practical methods of laboratory analyses, and let them use computer technology. Teaching takes place every two weeks and lasts 1.5 hours. The theme of water is a common project with the biology and geology teacher, Mrs. Virginie Marquet. Lesson 1: Introduction: The water in Vienna The pupils have to consider why the water is so important in Vienna (history, economy etc.) and where tap water comes from. Activities: Brainstorming about where and why we use water every day and why the water is different in Vienna. Lesson 2: Objectives of the session: What are the differences between mineral waters? Activities: Compare water from different origins (France: Evian, Vittel, Contrex. Austria: Vöslauer, Juvina, Gasteiner and tap water from Vienna) by tasting and finding the main ions they contain. Testing ions: Calcium, magnesium, sulphate, chloride, sodium, and potassium Lesson 3: Objectives of the session: Build a hydrometer Activities: Producing a range of calibration solutions, build and calibrate the hydrometer with different salt-water solutions. Measure the density of the Dead Sea's water and other mineral waters. Lesson 4: Objectives of the session: How does a fountain work? Activities: Construction of a fountain as Heron of Alexandria with simple equipment and try to understand the hydrostatic principles. Lesson 5: Objectives of the session: Study of the physical processes of water treatment (decantation, filtration, screening) Activities: Build a natural filter with sand, stone, carbon, and cotton wool. Retrieve the filtered water to test it during lesson 7. Lesson 6: Visit of the biggest treatment

The Salient Map Analysis for Research and Teaching (SMART) method: Powerful potential as a formative assessment in the biomedical sciences

Science.gov (United States)

Cathcart, Laura Anne

This dissertation consists of two studies: 1) development and characterization of the Salient Map Analysis for Research and Teaching (SMART) method as a formative assessment tool and 2) a case study exploring how a paramedic instructor's beliefs about learners affect her utilization of the SMART method and vice versa. The first study explored: How can a novel concept map analysis method be designed as an effective formative assessment tool? The SMART method improves upon existing concept map analysis methods because it does not require hierarchically structured concept maps and it preserves the rich content of the maps instead of reducing each map down to a numerical score. The SMART method is performed by comparing a set of students' maps to each other and to an instructor's map. The resulting composite map depicts, in percentages and highlighted colors, the similarities and differences between all of the maps. Some advantages of the SMART method as a formative assessment tool include its ability to highlight changes across time, problematic or alternative conceptions, and patterns of student responses at a glance. Study two explored: How do a paramedic instructor's beliefs about students and learning affect---and become affected by---her use of the SMART method as a formative assessment tool? This case study of Angel, an expert paramedic instructor, begins to address a gap in the emergency medical services (EMS) education literature, which contains almost no research on teachers or pedagogy. Angel and I worked together as participant co-researchers (Heron & Reason, 1997) exploring the affordances of the SMART method. This study, based on those interactions with Angel, involved using open coding to identify themes (Strauss & Corbin, 1998) from Angel's views of students and use of the SMART method. Angel views learning as a sense-making process. She has a multi-faceted view of her students as novices and invests substantial time trying to understand their concept

Decline of a common reptile: case study of the viperine snake Natrix maura in a Mediterranean wetland

Directory of Open Access Journals (Sweden)

Xavier Santos

2009-12-01

Full Text Available The Ebro Delta is a wetland area in which natural ecosystems have been partially replaced by rice fields. This mixed and productive landscape has allowed the establishment of a rich community of organisms. The viperine snake Natrix maura has traditionally been a common and abundant predator because the habitat is favorable and prey availability is high. In June 1995, we conducted a demographic study to evaluate relative densities of snakes in the rice fields. Thirteen years later, we repeated the same study in the same area and season. The field work consisted of 29 censuses of one hectare each, and snakes and their potential prey (green frogs and fish were counted. In 1995, we found 27 snakes (0.93 animals/ha, these occupying 48% of the sites. Frogs and fish were observed in 23 of the 29 censuses (79%. In 2008, no snakes were found and frogs and fish appeared in only 11 of the samples (38%. In 2008, we also prospected 20 sites in rice fields located next to the natural lagoons. At these sites, we detected a greater number of snakes (25% of the stations. Several factors can explain the clear decline of the N. maura population in the Ebro Delta rice fields: 1 the transformation and degradation of the habitat; 2 the increase in population densities of natural predators such as herons; 3 the decrease in prey availability; 4 the massive use of pollutants in the rice fields; and 5 snake death on local roads and directly by human persecution. We propose that a combined effect of these factors has caused the alarming decline of this predator. The observation of water snakes in rice fields near natural lagoons indicates that protected natural areas act as natural refuges for fauna with reduced mobility, such as viperine snakes. The recovery of the N. maura population in the rice fields of the Ebro Delta depends on an integral change in agricultural management, including the reduced use of pollutants, the recovery of snake prey, and the maintenance of

[2000-year history of the ear syringe and its relationship to the enema. Images from the history of otorhinolaryngology, represented by instruments from the collection of the Ingolstadt Medical History Museum].

Science.gov (United States)

Feldmann, H

1999-08-01

SYRINGES WITH A PISTON AND THEIR USE AS "CLYSTER ORICULARIUS" IN THE ANCIENT ROME: Syringes with a piston were already known in ancient times and have been mentioned as a device for spraying rose water (Philon of Byzantium, about 230 BC), and for fighting fires (Heron of Alexandria about 110 AD). Celsus mentions it several times in his grand opus "De Medicina" (1st century AD) in the treatment of purulent discharge from the ear and for removing foreign bodies from the external ear canal. He always calls it "clyster oricularius", i.e. ear syringe, even when he describes its use in applications other than otological, such as in urology. Later the ear syringe fell from favor for a very long time and was reinvented only at the beginning of the 19th century. IRRIGATION OF THE BOWELS, FROM THE BAG SYRINGE TO THE PISTON SYRINGE: Irrigations of the bowels, clysters, were performed from ancient times to the 18th century with a baglike syringe using the bladder of animals as a pouch. Syringes with a piston were used by barbers and surgeons only for cleansing wounds or irrigating natural cavities of the body. Irrigation of the external ear canal had completely fallen from favor. In France in the 18th century large syringes with a piston made of tin oder brass came into use for enemas and replaced the old baglike devices. THE REINVENTION OF THE EAR SYRINGE AFTER THE PROTOTYPE OF THE ENEMA SYRINGE: Itard, an otologist in France in 1821, was the first to describe irrigating the ear with a syringe to remove hard wax. He recommended using an enema syringe ("seringue à lavement") for the procedure. Soon after his publication special ear syringes of appropriate size were developed and described by Beck in Freiburg, Germany, in 1827; by Fabrizi in Modena, Italy, 1839; and Schmalz in Dresden, Germany, 1846, who also introduced the kidney-shaped bowel for catching the water. Apart from that, small baglike syringes made of rubber were devised especially for use by the patient himself

Coastal waterbirds of El Chorro and Majahuas, Jalisco, México, during the non-breeding season, 1995-1996

Directory of Open Access Journals (Sweden)

Salvador Hernández-Vázquez

2001-03-01

Full Text Available We studied how waterbirds used two small estuaries during the non-breeding season of 1995-1996. These estuaries, El Chorro and Majahuas, were located in the middle of a large span of non-wetland habitat along the Pacific coast of México. Whereas El Chorro was basically a large and open waterbody, Majahuas was a long and narrow corridor flanked by mangroves. The two estuaries had 77 species throughout our study, but shared only 58, due to differences in their habitat. Seabirds comprised 66% of all the birds; grebes, ducks and rails 16%; shorebirds 12% and herons and egrets 5%. During late winter and early spring a very reduced number of migratory species accounted for the dominance of seabirds. Sterna hirundo and Phalacrocorax brasilianus accounted for 40 and 33%, respectively, of all the seabirds. Opening or closure of the estuary mouth at El Chorro affected the bird communities at both sites, by exposing or inundating a large mudflat in that estuary. Overall, however, time of the year was more important in the composition of the bird assemblages. Both estuaries should be considered as a single unit.Durante la estación no reproductiva de 1995-1996 estudiamos las aves acuáticas de los estuarios El Chorro y Majahuas, Jalisco, México. El Chorro es un cuerpo de agua más abierto, mientras que Majahuas está formado por canales rodeados por manglares. Registramos 77 especies de aves. Las aves marinas comprendieron el 66%, los patos y similares el 16%, las aves playeras el 12% y las garzas el 5%. Sterna hirundo y Phalacrocorax brasilianus representaron el 40 y 33%, respectivamente, del total de aves marinas. El que la bocabarra de El Chorro estuviera abierta o cerrada influyó en la concentración de aves en los dos esteros, debido a la exposición o inundación de áreas lodosas y arenosas. A pesar de las diferencias entre los dos estuarios, la época del año fue más importante en la composición de las comunidades de aves. Ambos esteros deben

Hydrology and Water Quality of the Rio Chama River, Northern New Mexico: Establishing a Base Line to Manage Flows

Science.gov (United States)

Salvato, L.; Crossey, L. J.

2013-12-01

The Rio Chama is the largest stream tributary to the Rio Grande in northern New Mexico. The river's geographic location in a semiarid region results in high rates of evapotranspiration and highly variable streamflow. The Rio Chama is part of the San Juan-Chama Drinking Water Project, in which water from the San Juan River, southern Colorado, is diverted across the continental divide to the Rio Chama. Surface water moves through Abiquiu, El Vado and Heron Reservoirs to the Rio Grande to supply Albuquerque with potable drinking water. The results of these anthropogenic influences are a modified flow regime, less variability, greater base-flows, and smaller peak flows. We examined selected locations throughout the Rio Chama system to provide base-line water quality data for ongoing studies. This information will contribute to the development of the best plan to optimize flow releases and maximize benefits of the stakeholders and especially the riparian and stream ecosystems. We report results of two sampling trips representing extremes of the hydrograph in summer 2012 and fall 2012. We collected field parameters, processed water samples, and analyzed them for major anions and cations. The geochemistry enables us to better understand the impact of monthly releases of San Juan river water. We captured two points of the river's streamflow range, 54 cubic feet per second in October 2012 and 1,000 cubic feet per second in August 2012 and looked for variability within the results. We found that the reservoirs exhibit varying anion concentrations from samples taken at different depths. We compared stream waters and selected well samples at a stream transect. These samples allowed us to compare shallow ground water with the stream, and they indicated that the changes in ground water are attributed to sulfate reduction. The anion and cation inputs were most likely derived from gypsum, calcite, and salts, as there are many creeks discharging into the Rio Chama whose drainage

Utility of Photochemical Traits as Diagnostics of Thermal Tolerance amongst Great Barrier Reef Corals

Directory of Open Access Journals (Sweden)

Matthew R. Nitschke

2018-02-01

Full Text Available Light availability is considered a key factor regulating the thermal sensitivity of reef building corals, where excessive excitation of photosystem II (PSII further exacerbates pressure on photochemical pathways already compromised by heat stress. Coral symbionts acclimate to changes in light availability (photoacclimation by continually fine-tuning the photochemical operating efficiency of PSII. However, how this process adjusts throughout the warmest months in naturally heat-tolerant or sensitive species is unknown, and whether this influences the capacity to tolerate transient heat stress is untested. We therefore examined the PSII photophysiology of 10 coral species (with known thermal tolerances from shallow reef environments at Heron Island (Great Barrier Reef, Australia, in spring (October-November, 2015 vs. summer (February-March, 2016. Corals were maintained in flow-through aquaria and rapid light curve (RLC protocols using pulse amplitude modulated (PAM fluorometry captured changes in the PSII photoacclimation strategy, characterized as the minimum saturating irradiance (Ek, and the extent of photochemical ([1 – C], operating efficiency vs. non-photochemical ([1 – Q] energy dissipation. Values of Ek across species were >2-fold higher in all coral species in spring, consistent with a climate of higher overall light exposure (i.e., higher PAR from lower cloud cover, rainfall and wind speed compared with summer. Summer decreases in Ek were combined with a shift toward preferential photochemical quenching in all species. All coral species were subsequently subjected to thermal stress assays. An equivalent temperature-ramping profile of 1°C increase per day and then maintenance at 32°C was applied in each season. Despite the significant seasonal photoacclimation, the species hierarchy of thermal tolerance [maximum quantum yields of PSII (Fv/Fm, monitored at dawn and dusk] did not shift between seasons, except for Pocillopora

Head stabilization in whooping cranes

Science.gov (United States)

Kinloch, M.R.; Cronin, T.W.; Olsen, Glenn H.; Chavez-Ramirez, Felipe

2005-01-01

The whooping crane (Grus americana) is the tallest bird in North America, yet not much is known about its visual ecology. How these birds overcome their unusual height to identify, locate, track, and capture prey items is not well understood. There have been many studies on head and eye stabilization in large wading birds (herons and egrets), but the pattern of head movement and stabilization during foraging is unclear. Patterns of head movement and stabilization during walking were examined in whooping cranes at Patuxent Wildlife Research Center, Laurel, Maryland USA. Four whooping cranes (1 male and 3 females) were videotaped for this study. All birds were already acclimated to the presence of people and to food rewards. Whooping cranes were videotaped using both digital and Hi-8 Sony video cameras (Sony Corporation, 7-35 Kitashinagawa, 6-Chome, Shinagawa-ku, Tokyo, Japan), placed on a tripod and set at bird height in the cranes' home pens. The cranes were videotaped repeatedly, at different locations in the pens and while walking (or running) at different speeds. Rewards (meal worms, smelt, crickets and corn) were used to entice the cranes to walk across the camera's view plane. The resulting videotape was analyzed at the University of Maryland at Baltimore County. Briefly, we used a computerized reduced graphic model of a crane superimposed over each frame of analyzed tape segments by means of a custom written program (T. W. Cronin, using C++) with the ability to combine video and computer graphic input. The speed of the birds in analyzed segments ranged from 0.30 m/s to 2.64 m/s, and the proportion of time the head was stabilized ranged from 79% to 0%, respectively. The speed at which the proportion reached 0% was 1.83 m/s. The analyses suggest that the proportion of time the head is stable decreases as speed of the bird increases. In all cases, birds were able to reach their target prey with little difficulty. Thus when cranes are walking searching for food

The Potential Use of Wolbachia-Based Mosquito Biocontrol Strategies for Japanese Encephalitis.

Directory of Open Access Journals (Sweden)

Claire L Jeffries

Full Text Available Japanese encephalitis virus (JEV is a zoonotic pathogen transmitted by the infectious bite of Culex mosquitoes. The virus causes the development of the disease Japanese encephalitis (JE in a small proportion of those infected, predominantly affecting children in eastern and southern Asia. Annual JE incidence estimates range from 50,000-175,000, with 25%-30% of cases resulting in mortality. It is estimated that 3 billion people live in countries in which JEV is endemic. The virus exists in an enzootic transmission cycle, with mosquitoes transmitting JEV between birds as reservoir hosts and pigs as amplifying hosts. Zoonotic infection occurs as a result of spillover events from the main transmission cycle. The reservoir avian hosts include cattle egrets, pond herons, and other species of water birds belonging to the family Ardeidae. Irrigated rice fields provide an ideal breeding ground for mosquitoes and attract migratory birds, maintaining the transmission of JEV. Although multiple vaccines have been developed for JEV, they are expensive and require multiple doses to maintain efficacy and immunity. As humans are a "dead-end" host for the virus, vaccination of the human population is unlikely to result in eradication. Therefore, vector control of the principal mosquito vector, Culex tritaeniorhynchus, represents a more promising strategy for reducing transmission. Current vector control strategies include intermittent irrigation of rice fields and space spraying of insecticides during outbreaks. However, Cx. Tritaeniorhynchus is subject to heavy exposure to pesticides in rice fields, and as a result, insecticide resistance has developed. In recent years, significant advancements have been made in the potential use of the bacterial endosymbiont Wolbachia for mosquito biocontrol. The successful transinfection of Wolbachia strains from Drosophila flies to Aedes (Stegomyia mosquitoes has resulted in the generation of "dengue-refractory" mosquito

Quality assessment of a storm overflow, by using different frequency monitoring (northern France)

Science.gov (United States)

Ivanovsky, Anastasia; Dumoulin, David; Criquet, Justine; Prygiel, Jean; Pohu, Jérôme; Hottin, Frédéric; Billon, Gabriel

2016-04-01

The Heron lake is a storm-water pond of 30 hectare constructed in the 70's to avoid the flooding in the city of Villeneuve d'Ascq (Lille urban area in Northern France). This facility could also receive some untreated urban wastewaters during high rainfall events. The water level is regulated by automatic pumps, which periodically discharge the overflow into a natural watercourse, the Marque River. Located in an urban area, the lake is qualified as eutrophic because of the high nutrients concentration, which stimulates the presence of cyanobacteria. Recently, the invasive macrophyte Elodea nuttallii colonized the lake. This proliferation causes ecological troubles like anoxic events or even obstruction of the pumps, thereby increasing the risk of flooding. Two types of monitoring (low and high frequencies) were implemented to assess the functioning of this lake and to estimate its impact to the river. The low frequency monitoring consisted on punctual screenings on the dissolved phase and monthly grab samplings from February 2014 to February 2015. Physicochemical parameters (oxygen, temperature, conductivity, pH, solid particulate matter, dissolved organic carbon) and nutrients (NO3-, NH4+ and PO43-) were recorded. Additionally, a high frequency monitoring was undertaken (with measurements every 10 minutes) was performed by using a buoy equipped with different sensors for measuring oxygen, turbidity, temperature, conductivity, pH and phytoplankton pigments. Furthermore, both the discharge lake flow and the pluviometry were recorded at the scale of the day. Although all the data are not yet fully interpreted, several key points have already been evidenced: (i) at the entrance of the lake, the water is enriched in urban sewage; (ii) some significant differences of oxygenation exist between the entrance and the rest of the lake due to both waste waters inputs in the entrance channel and atmosphere-water interactions; (iii) eutrophication occurs at the beginning of the

Diversidade e abundância sazonal da avifauna em duas planícies de maré no estuário da baía da Babitonga, norte de Santa Catarina Diversity and abundance of birds in two tidal flat in Babitonga Bay estuary, north of Santa Catarina state, Brazil

Directory of Open Access Journals (Sweden)

Alexandre V. Grose

2013-03-01

Full Text Available Informações sobre a ocorrência de aves nos ambientes estuarinos de Santa Catarina ainda são escassas. O objetivo deste trabalho foi registrar a diversidade, abundância e variação sazonal das aves em duas planícies de maré na baía da Babitonga. As amostragens foram realizadas durante um ano (maio de 2006 a abril 2007. No total foram identificadas 25 espécies, sendo 15 no Linguado (LG e 24 na desembocadura do Monte de Trigo (MT. Apenas uma espécie foi exclusiva no LG Himantopus melanurus (Vieillot, 1817, enquanto dez espécies ocorreram apenas no MT. O número de espécies em MT foi superior ao encontrado em LG. A espécie mais abundante em MT foi Rynchops niger (Linnaeus, 1758 e em LG foi Egretta caerulea (Linnaeus, 1758. Durante alguns meses foram registradas espécies migratórias neárticas em ambas as áreas, o que representou um acréscimo na diversidade. A extensa planície de maré formada pelo fechamento do canal do Linguado tem sido muito ocupada por aves, possivelmente pela maior disponibilidade de alimento.Information of birds in estuaries of Santa Catarina is scarce. This work aimed to collect data on diversity, abundance and seasonal variation on this community. Sampling of birds in two tidal flats in Babitonga Bay estuary was carried out during one year (May 2006 to April 2007. A total of 25 species were identified, being 15 in Linguado (LG and 24 in Monte de Trigo (MT. Only one species was unique in LG (Himantopus melanurus Vieillot, 1817 and 10 in MT. The number of species in MT was higher than in LG due to the conservation condition. The most abundant species on MT was the Black Skimmer [Rynchops niger (Linnaeus, 1758] and in the LG was the Little Blue Heron [Egretta caerulea (Linnaeus, 1758]. During some months Nearctic migratory species were recorded in both areas, representing an increase in diversity. The extensive tidal flat formed by the closure of the channel in LG is widely used by birds, possibly because of

Association between long-acting reversible contraceptive use, teenage pregnancy, and abortion rates in England

Directory of Open Access Journals (Sweden)

Connolly A

2014-11-01

Full Text Available Anne Connolly,1 Guilhem Pietri,2 Jingbo Yu,3 Samantha Humphreys4 1The Ridge Medical Practice, Cousen Road, Bradford, UK; 2HERON – A PAREXEL® Company, London, UK; 3Merck & Co, Inc., Whitehouse Station, NJ, USA; 4Merck Sharp & Dohme Limited, Hertfordshire, UK Background: Since the late 1990s, the British government has launched major strategies to address high teenage pregnancy and abortion rates in England. These have focused in part on improving access to contraception through national campaigns. This study assessed teenage pregnancy and abortion rate trends since 1998 and possible associations with usage of long-acting reversible contraceptives (LARCs. Methods: Teenage conception rates and age-specific abortion rates were obtained from the Office for National Statistics and the Department of Health. LARC usage data was obtained for Depo-Provera, Implanon/Nexplanon, intrauterine devices, Mirena, and Noristerat from the IMS British Pharmaceutical Index, IMS Hospital Pharmacy Audit, IMS Disease Analyzer, and KT-31 reports. Through linear regression methods, changes in conception and abortion-related outcomes during 1998–2011 and the associations with LARC usage were assessed. Results: Conception rates for girls younger than 18 years of age decreased significantly between 1998–2011, from 46.6 to 30.7 per 1,000 girls. A statistically significant association was observed between this decrease and increased LARC usage (P=0.0024 in this population. Abortion rates among females aged <18 years or aged 18–19 years decreased between 1998–2011, and their associations with increased LARC usage were statistically significant (P=0.0029 and P=0.0479, respectively. The pattern in older women was complex; abortion rates in women aged 20–24 years or 25–34 years increased slightly from 1998 to 2011, with stabilization during 2007–2011. Conclusion: Increased LARC usage in England was significantly associated with decreased teenage pregnancy rates

Efficacy and tolerability of naproxen/esomeprazole magnesium tablets compared with non-specific NSAIDs and COX-2 inhibitors: a systematic review and network analyses

Directory of Open Access Journals (Sweden)

Datto C

2013-02-01

Full Text Available Catherine Datto,1 Richard Hellmund,1 Mohd Kashif Siddiqui21AstraZeneca Pharmaceuticals LP, Wilmington, DE, USA; 2HERON PVT India, Chandigarh, UT, IndiaAbstract: Non-steroidal anti-inflammatory drugs (NSAIDs, such as non-selective NSAIDs (nsNSAIDs or selective cyclooxygenase-2 (COX-2 inhibitors, are commonly prescribed for arthritic pain relief in patients with osteoarthritis (OA, rheumatoid arthritis (RA, or ankylosing spondylitis (AS. Treatment guidelines for chronic NSAID therapy include the consideration for gastroprotection for those at risk of gastric ulcers (GUs associated with the chronic NSAID therapy. The United States Food and Drug Administration has approved naproxen/esomeprazole magnesium tablets for the relief of signs and symptoms of OA, RA, and AS, and to decrease the risk of developing GUs in patients at risk of developing NSAID-associated GUs. The European Medical Association has approved this therapy for the symptomatic treatment of OA, RA, and AS in patients who are at risk of developing NSAID-associated GUs and/or duodenal ulcers, for whom treatment with lower doses of naproxen or other NSAIDs is not considered sufficient. Naproxen/esomeprazole magnesium tablets have been compared with naproxen and celecoxib for these indications in head-to-head trials. This systematic literature review and network meta-analyses of data from randomized controlled trials was performed to compare naproxen/esomeprazole magnesium tablets with a number of additional relevant comparators. For this study, an original review examined MEDLINE®, Embase®, and the Cochrane Controlled Trials Register from database start to April 14, 2009. Using the same methodology, a review update was conducted to December 21, 2009. The systematic review and network analyses showed naproxen/esomeprazole magnesium tablets have an improved upper gastrointestinal tolerability profile (dyspepsia and gastric or gastroduodenal ulcers over several active comparators (naproxen

Shillapoo Wildlife Area 2007 Follow-up HEP Report.

Energy Technology Data Exchange (ETDEWEB)

Ashley, Paul R.

2008-03-01

In April and May 2007 the Regional HEP Team (RHT) conducted a follow-up HEP analysis on the Egger (612 acres) and Herzog (210 acres) parcels located at the north end of the Shillapoo Wildlife Area. The Egger and Herzog parcels have been managed with Bonneville Power Administration funds since acquired in 1998 and 2001 respectively. Slightly more than 936 habitat units (936.47) or 1.14 HUs per acre was generated as an outcome of the 2007 follow-up HEP surveys. Results included 1.65 black-capped chickadee HUs, 280.57 great blue heron HUs, 581.45 Canada goose HUs, 40 mallard HUs, and 32.80 mink HUs. Introduction A follow-up Habitat Evaluation Procedures (HEP) (USFWS 1980) analysis was conducted by the Columbia Basin Fish and Wildlife Authority's (CBFWA) Regional HEP Team (RHT) during April and May 2007 to document changes in habitat quality and to determine the number of habitat units (HUs) to credit Bonneville Power Administration (BPA) for providing operation and maintenance (O&M) funds since WDFW acquired the parcels. The 2007 follow-up HEP evaluation was limited to Shillapoo Wildlife Area (SWA) parcels purchased with Bonneville Power Administration funds. D. Budd (pers. comm.) reported WDFW purchased the 612 acre Egger Farms parcel on November 2, 1998 for $1,737,0001 and the 210 acre Herzog acquisition on June 21, 2001 for $500,000 with Memorandum of Agreement funds (BPA and WDFW 1996) as partial fulfillment of BPA's wildlife mitigation obligation for construction of Bonneville and John Day Dams (Rasmussen and Wright 1989). Anticipating the eventual acquisition of the Egger and Herzog properties, WDFW conducted HEP surveys on these lands in 1994 to determine the potential number of habitat units to be credited to BPA. As a result, HEP surveys and habitat unit calculations were completed as much as seven years prior to acquiring the sites. The term 'Shillapoo Wildlife Area' will be used to describe only the Herzog and Egger parcels in this

Antagonistic Effects of Ocean Acidification and Rising Sea Surface Temperature on the Dissolution of Coral Reef Carbonate Sediments

Directory of Open Access Journals (Sweden)

Daniel Trnovsky

2016-11-01

Full Text Available Increasing atmospheric CO2 is raising sea surface temperature (SST and increasing seawater CO2 concentrations, resulting in a lower oceanic pH (ocean acidification; OA, which is expected to reduce the accretion of coral reef ecosystems. Although sediments comprise most of the calcium carbonate (CaCO3 within coral reefs, no in situ studies have looked at the combined effects of increased SST and OA on the dissolution of coral reef CaCO3 sediments. In situ benthic chamber incubations were used to measure dissolution rates in permeable CaCO3 sands under future OA and SST scenarios in a coral reef lagoon on Australia’s Great Barrier Reef (Heron Island. End of century (2100 simulations (temperature +2.7°C and pH -0.3 shifted carbonate sediments from net precipitating to net dissolving. Warming increased the rate of benthic respiration (R by 29% per 1°C and lowered the ratio of productivity to respiration (P/R; ΔP/R = -0.23, which increased the rate of CaCO3 sediment dissolution (average net increase of 18.9 mmol CaCO3 m-2 d-1 for business as usual scenarios. This is most likely due to the influence of warming on benthic P/R which, in turn, was an important control on sediment dissolution through the respiratory production of CO2. The effect of increasing CO2 on CaCO3 sediment dissolution (average net increase of 6.5 mmol CaCO3 m-2 d-1 for business as usual scenarios was significantly less than the effect of warming. However, the combined effect of increasing both SST and pCO2 on CaCO3 sediment dissolution was non-additive (average net increase of 5.6 mmol CaCO3 m-2 d-1 due to the different responses of the benthic community. This study highlights that benthic biogeochemical processes such as metabolism and associated CaCO3 sediment dissolution respond rapidly to changes in SST and OA, and that the response to multiple environmental changes are not necessarily additive.

Biogeography of tropical Indo-West Pacific parasites: a cryptic species of Transversotrema and evidence for rarity of Transversotrematidae (Trematoda) in French Polynesia.

Science.gov (United States)

Cribb, Thomas H; Adlard, Robert D; Bray, Rodney A; Sasal, Pierre; Cutmore, Scott C

2014-04-01

We sought transversotrematid trematodes from French Polynesian fishes by examining 304 individual scaled fishes of 53 species from seven families known to harbour the family elsewhere. A single species was found at two locations in the Tuamotus Archipelago on two species of Chaetodontidae (Chaetodon auriga and Chaetodon ephippium) and one species of Lutjanidae (Lutjanus gibbus). The species closely resembles Transversotrema borboleta Hunter & Cribb, 2012 from chaetodontids and lutjanids of the northern Great Barrier Reef (GBR) but differs from it consistently in 8 base positions of ITS2 rDNA. This level of variation exceeds that between some clearly morphologically distinct pairs of species of Transversotrema and the form from French Polynesia is thus interpreted as a distinct, though cryptic, species and named Transversotrema polynesiae n. sp. The new species forms part of a complex of species, here characterised as the T. borboleta complex, associated with chaetodontids and lutjanids in the tropical Indo-West Pacific. Most of the putative species within this complex are yet to be described. Comparison of identical numbers of matched samples of fishes from French Polynesia, Heron Island (southern GBR) and Lizard Island (northern GBR) revealed 1, 4 and 10 species of Transversotrema respectively suggesting that the French Polynesian fauna is depauperate for this family. In addition to those species apparently missing from suitable hosts in French Polynesia, several species from further west infect fishes (especially Nemipteridae) that are themselves absent from French Polynesia. This dramatic east-west decline in richness contrasts strongly with what is known for monogeneans, which appear to maintain their richness over the same scale, and is more precipitate than is known for other groups of trematodes. The decline might be explained in part by the absence of the as yet unknown first intermediate hosts in French Polynesia. However, we predict that it is explained

Ecological study of a wetland in Vercelli area. Bird community of 'palude di San Genuario' (Crescentino-Fontanetto Po); Studio ecologico di una zona umida del Vercellese. La comunita' ornitica della palude di S. Genuario (Crescentino-Fontanetto Po)

Energy Technology Data Exchange (ETDEWEB)

Cellerino, A.; Rossi, G.L. [ENEA, Divisione Protezione dell' Uomo e degli Ecosistemi, Centro Ricerche Saluggia, Vercelli (Italy)

2001-07-01

The Palude di San Genuario, that includes an artificial wetland zone, has been declared a Community importance site according to Directive CEE n. 92/43 (Habitat), because of the rare bird species living in (as Botarus stellaris, Ardea purpurea, Circus aeruginosus). This research has the aim to improve the knowledge about natural characteristics, the ornithological community and the conservation degree of the area. The study has been carried out by the Sezione Componente Biotica dell'Ecosistema of the ENEA Research Center of Saluggia during 1996, 1997, 1998. It has been possible to describe the ornithological wintering and reproductive community, defining it in terms of diversity by the application of indices (Shannon-Weaver, Berger-Parker, Pielou, Simpson). Besides, the community has been analyzed by the calculation of the curves of relative abundance distribution verifying the consistency in respect to four theoretic models. Using Brichetti and Gariboldi's system of evaluation for the nesting species (based on italian species) and verifying the species considered by the Red List of italian birds, by the work of Tucker and Heath concerning the european species of conservation interest (1994) and by International Convention (Berna and Bonn) as well as European Directives (Birds Directive), it has been possible to point out that the most interesting species belong to wetlands habitats. In accordance with these results, some managerial hypothesis have been elaborated in order to preserve the area. [Italian] La palude di S. Genuario, che racchiude una zona umida di origine artificiale, e' stata individuata come sito di Importanza Comunitaria, ai sensi della Direttiva CEE n. 92/43 ({sup H}abitat{sup )}, per le specie avifaunistiche rare che ospita (Tarabuso, Airone rosso, Falco di palude). Questo studio ha lo scopo di costituire uno strumento conoscitivo riguardante le caratteristiche naturali, i popolamenti ornitici e lo stato di conservazione del sito

Ecological study of a wetland in Vercelli area. Bird community of 'palude di San Genuario' (Crescentino-Fontanetto Po); Studio ecologico di una zona umida del Vercellese. La comunita' ornitica della palude di S. Genuario (Crescentino-Fontanetto Po)

Energy Technology Data Exchange (ETDEWEB)

Cellerino, A; Rossi, G L [ENEA, Divisione Protezione dell' Uomo e degli Ecosistemi, Centro Ricerche Saluggia, Vercelli (Italy)

2001-07-01

The Palude di San Genuario, that includes an artificial wetland zone, has been declared a Community importance site according to Directive CEE n. 92/43 (Habitat), because of the rare bird species living in (as Botarus stellaris, Ardea purpurea, Circus aeruginosus). This research has the aim to improve the knowledge about natural characteristics, the ornithological community and the conservation degree of the area. The study has been carried out by the Sezione Componente Biotica dell'Ecosistema of the ENEA Research Center of Saluggia during 1996, 1997, 1998. It has been possible to describe the ornithological wintering and reproductive community, defining it in terms of diversity by the application of indices (Shannon-Weaver, Berger-Parker, Pielou, Simpson). Besides, the community has been analyzed by the calculation of the curves of relative abundance distribution verifying the consistency in respect to four theoretic models. Using Brichetti and Gariboldi's system of evaluation for the nesting species (based on italian species) and verifying the species considered by the Red List of italian birds, by the work of Tucker and Heath concerning the european species of conservation interest (1994) and by International Convention (Berna and Bonn) as well as European Directives (Birds Directive), it has been possible to point out that the most interesting species belong to wetlands habitats. In accordance with these results, some managerial hypothesis have been elaborated in order to preserve the area. [Italian] La palude di S. Genuario, che racchiude una zona umida di origine artificiale, e' stata individuata come sito di Importanza Comunitaria, ai sensi della Direttiva CEE n. 92/43 ({sup H}abitat{sup )}, per le specie avifaunistiche rare che ospita (Tarabuso, Airone rosso, Falco di palude). Questo studio ha lo scopo di costituire uno strumento conoscitivo riguardante le caratteristiche naturali, i popolamenti ornitici e lo stato di conservazione del sito. La ricerca

[The beginning of western medical education].

Science.gov (United States)

Kee, C D

1992-01-01

Our country had quite an advanced system of medical education during the era of the Koryo Kingdom, and during the Choson Dynasty, the Kyong Guk Dae Jon, in which a systematized medical education was clearly described, was compiled in the era of King Sejong. However, the educational system was not for Western medicine. Western medicine was first introduced to our country in the 9th year of King Injo (1631) when Chong Du Won, Yi Yong Jun, etc. returned from Yon Gyong (Beiuin) with Chik Bang Oe Gi. Knowledge of Western medicine was disseminated by Shil Hak (practical learning) scholars who read a translation in Chinese characters, of Chik Bang Oe Gi. Yi Ik (Song Ho), Yi Gyu Gyong (O ju), Choe Han Gi (Hye Gang), Chong Yak Yong (Ta San), etc., read books of Western medicine and introduced in writing the excellent theory of Western medicine. In addition, Yu Hyong Won (Pan Gye), Pak Ji Won (Yon Am), Pak Je Ga (Cho Jong), etc., showed much interest in Western medicine, but no writings by them about western medicine can be found. With the establishment of a treaty of amity with Japan in the 13th year of King Kojong (1876), followed by the succession of amity treaties with Western powers, foreigners including medical doctors were permitted to flow into this country. At that time, doctors Horace N. Allen, W. B. Scranton, John W. Heron, Rosetta Sherwood (Rosetta S. Hall), etc., came to Korea and inaugurated hospitals, where they taught Western medicine to Korean students. Dr. Horace N. Allen, with the permission of king Kojong, established Che Jung Won in April 1885, and in March 1886, he began at the hospital to provide education of Western medicine to Korean students who were recrutied by the Korean Government. However, the education was not conduted on a regular basis, only training them for work as assistants. This is considered to be the pioneer case of Western medical education in this country. Before that time, Japanese medical doctors came to Korea, but there are no

Nineteenth century mercury: Hazard to wading birds and cormorants of the Carson River, Nevada

Science.gov (United States)

Henny, Charles J.; Hill, E.F.; Hoffman, D.J.; Spalding, Marilyn G.; Grove, Robert A.

2002-01-01

Contemporary mercury interest relates to atmospheric deposition, contaminated fish stocks and exposed fish-eating wildlife. The focus is on methylmercury (MeHg) even though most contamination is of inorganic (IoHg) origin. However, IoHg is readily methylated in aquatic systems to become more hazardous to vertebrates. In response to a classic episode of historical (1859a??1890) IoHg contamination, we studied fish-eating birds nesting along the lower Carson River, Nevada. Adult double-crested cormorants (Phalacrocorax auritus), snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax) contained very high concentrations of total mercury (THg) in their livers (geo. means 134.8g/g wet weight (ww), 43.7 and 13.5, respectively) and kidneys (69.4, 11.1 and 6.1, respectively). Apparently tolerance of these concentrations was possible due to a threshold-dependent demethylation coupled with sequestration of resultant IoHg. Demethylation and sequestration processes also appeared to have reduced the amount of MeHg redistributed to eggs. However, the relatively short time spent by adults in the contaminated area before egg laying was also a factor in lower than expected concentrations of mercury in eggs. Most eggs (100% MeHg) had concentrations below 0.80g/g ww, the putative threshold concentration where reproductive problems may be expected; there was no conclusive evidence of mercury-related depressed hatchability. After hatching, the young birds were fed diets by their parents averaging 0.36a??1.18gMeHg/g ww through fledging. During this four to six week period, accumulated mercury concentrations in the organs of the fledglings were much lower than found in adults, but evidence was detected of toxicity to their immune (spleen, thymus, bursa), detoxicating (liver, kidneys) and nervous systems. Several indications of oxidative stress were also noted in the fledglings and were most apparent in young cormorants containing highest concentrations of

Nineteenth century mercury hazard to wading birds and cormorants of the Carson River, Nevada

Science.gov (United States)

Henny, C.J.; Hill, E.F.; Hoffman, D.J.; Spalding, M.G.; Grove, R.A.

2002-01-01

Contemporary mercury interest relates to atmospheric deposition, contaminated fish stocks and exposed fish-eating wildlife. The focus is on methylmercury (MeHg) even though most contamination is of inorganic (IoHg) origin. However, IoHg is readily methylated in aquatic systems to become more hazardous to vertebrates. In response to a classic episode of historical (1859-1890) IoHg contamination, we studied fish-eating birds nesting along the lower Carson River, Nevada. Adult double-crested cormorants (Phalacrocorax auritus), snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax) contained very high concentrations of total mercury (THg) in their livers (geo. means 134.8 g/g wet weight [ww], 43.7, and 13.5, respectively) and kidneys (69.4, 11.1, and 6.1, respectively). Apparently tolerance of these concentrations was possible due to post-absorption demethylation and sequestration of resultant IoHg. Demethylation and sequestration processes also appeared to have reduced the amount of MeHg redistributed to eggs. However, the relatively short time spent by adults in the contaminated area before egg laying was also a factor in lower than expected concentrations of mercury in eggs. Most eggs (100% MeHg) had concentrations below 0.80 g/g ww, the putative threshold concentration where reproductive problems may be expected; there was no conclusive evidence of depressed hatchability. After hatching, the young birds were fed diets by their parents averaging 0.36 to 1.18 gMeHg/g ww through fledging. During this four to six week period, accumulated mercury concentrations in the organs of the fledglings were much lower than found in adults, but evidence was detected of toxicity to their immune (spleen, thymus, bursa), detoxicating (liver, kidneys) and nervous systems. Several indications of oxidative stress were also noted in the fledglings and were most apparent in young cormorants containing highest concentrations of mercury. This stress was

On birds, ascetics, and kings in Central Java R?m?yana Kakawin, 24.95–126 and 25

Directory of Open Access Journals (Sweden)

Andrea Acri

2010-12-01

Full Text Available In the first part of the paper I introduce stanzas 95-126 of Sarga 24 and the whole of Sarga 25 of the Old Javanese R?m?ya?a, which present the most difficult and least understood pieces of poetry in the whole of Old Javanese literature. The two sections, displaying a close relationship between each other on account of several shared lexical items and corresponding motifs, describe in allegorical terms animals, birds and plants in order to satirically represent ascetic and political characters of mid-9th century Central Java. Because of their idiosyncratic language and style, and because of their allegorical content which find no correspondences in the Bha??ik?vya or other Sanskrit versions of the R?m?ya?a, they have been for long regarded as a ‘corpus alienum’ in the poem. The thesis of interpolation was criticized by Hooykaas (1958a/b/c, who, however, did not rule out the possibility of their having been composed by a ‘second hand’. Having tried to distinguish the various textual layers that characterize those sections, I turn to analyse their contents along the lines set out in the masterful article by Aichele (1969 ‘Vergessene Metaphern als Kriterien der Datierung des altjavanischen R?m?ya?a’, discussing the allegories depicted there in comparison with the contemporary ?iwag?ha metrical inscription. By taking into account additional Old Javanese textual and visual documents, I suggest a fine-tuning for some of the identifications advanced by the German scholar. In particular, I argue that the character of Wibh??a?a (instead of Lak?ma?a, as argued by Aichele in the poem could allegorically represent King Rakai Kayuwa?i, and that the satirical descriptions of various kinds of water-birds of the heron family deceiving the freshwater fishes are to be taken as a critique directed to historical figures representing covert agents of the ?ailendra prince B?laputra disguised as ?aiva (and not Buddhist ascetics. My conclusion is that the

The extending of ranges of some bird species at the north-eastern border of their distribution due to intra-century climate changes

Directory of Open Access Journals (Sweden)

Oleg V. Glushenkov

2017-10-01

Full Text Available The paper presents an overview of the phenomenon of range expanding of birds located at the northeastern limit of their range. The study area is located in the Volga-Kama Krai in the Chuvash Republic, adjacent to the River Volga. It is situated northwards and southwards of 56° N, and westwards and eastwards of 49° E, in a band of about 400 km. The problem is considered in aspect of the intra-century changes of climatic conditions in the region and in European Russia as a whole. The analysis of the relationship between the range expansion of some bird species and the intra-century climate changes was based on ornithological and climatological material available for the study area. We have used material on climate change in the Chuvashian Republic and Volga-Kama Krai since 1926, taking into account recent data of Roshydromet and Intergovernmental Panel on Climate Change. The idea of this study was based on the theory of climatic cycles of different periodicity, the theory of recent global climate change and the hypothesis of cyclic dynamics of the ranges of waterfowl in the context of centuries-old and intra-century climate change in Northern Eurasia. In the framework of the problem, we have studied ornithological material dated from the late 19th till the early 21st century, authored by Bogdanov, Ruzsky, Zhitkov, Buturlin, Artobolevsky, Volchanetsky, Pershakov, Popov, Glushenkov and others. As shown the intra-century climate changes do quite likely affect the northward and northeastward range expansion of such bird species as Cygnus olor, Anas strepera, Aythya ferina, Hieraaetus pennatus, Aquila heliaca, and Fulica atra. Climate changes can also be judged on the base of the shift in the arrival timing to earlier dates for some birds. It is most clearly manifested for early arriving species (Grus grus, Ardea cinerea, Actitis hypoleucos. It is also true for the later arriving Pernis apivorus and Merops apiaster whose existence depends on the

[A study on Horace N. Allen's medicine and recognition of Korean body].

Science.gov (United States)

Lee, Young Ah

2011-12-31

Je Jung Won was the first modern-style Government hospital built by the Korean King Ko-Jong in April 1885, and it was the medical missionary Horace Newton Allen(1858~1932) who made one of the greatest contributions to the establishment of the hospital. Allen was an American missionary. He graduated from Ohio Wesleyan University with a degree in theology in 1881, and completed one-yearcourse at Miami Medical College. In Korea and America he worked as a physician, a missionary, an American diplomatic minister to Korea and a Korean minister's secretary to America. While acting as a mediator between Korea and America, he knew and recorded the domestic and foreign situation of Korea during Gaehwagi(the civilized and enlightened age). Thus to study him is to understand Korea's Gaehwagi as well as to research American medical missionaries. During his stay in Korea(1884~1905), Allen steadily wrote diaries and letters about Korean politics, diplomacy, society, culture, and medicine. Thus his public/private record through diaries and letters(the quantity of these materials amounts to several thousands) supplements the Korean early modern era's historical record. However, until now these materials have received little scholarly attention from researchers except for a few historians of missionary work between Korea and America, or of Korean modern medicine. I intended to use these materials to suggest a new perspective on the study of Korean Gaehwagi. Allen, along with John W. Heron, who came to Seoul on June 21st 1885, treated about 10,460 Korean patients in the first year of the opening of JeJungWon. They made "the first annual report of the Korean Government Hospital". This report explained how Allen and Heron regarded and treated Korean patients. Allen's diaries, letters and other writings offer a realistic view of how the western people actually recognized the Korean people at that time. As a western doctor, Allen had an ambivalent attitude toward Korean medical concepts

Monitoring Corals and Submerged Aquatic Vegetation in Western Pacific Using Satellite Remote Sensing Integrated with Field Data

Science.gov (United States)

Roelfsema, C. M.; Phinn, S. R.; Lyons, M. B.; Kovacs, E.; Saunders, M. I.; Leon, J. X.

2013-12-01

Corals and Submerged Aquatic Vegetation (SAV) are typically found in highly dynamic environments where the magnitude and types of physical and biological processes controlling their distribution, diversity and function changes dramatically. Recent advances in the types of satellite image data and the length of their archives that are available globally, coupled with new techniques for extracting environmental information from these data sets has enabled significant advances to be made in our ability to map and monitor coral and SAV environments. Object Based Image Analysis techniques are one of the most significant advances in information extraction techniques for processing images to deliver environmental information at multiple spatial scales. This poster demonstrates OBIA applied to high spatial resolution satellite image data to map and monitor coral and SAV communities across a variety of environments in the Western Pacific that vary in their extent, biological composition, forcing physical factors and location. High spatial resolution satellite imagery (Quickbird, Ikonos and Worldview2) were acquired coincident with field surveys on each reef to collect georeferenced benthic photo transects, over various areas in the Western Pacific. Base line maps were created, from Roviana Lagoon Solomon island (600 km2), Bikini Atoll Marshall Island (800 Km2), Lizard Island, Australia (30 km2) and time series maps for geomorphic and benthic communities were collected for Heron Reef, Australia (24 km2) and Eastern Banks area of Moreton Bay, Australia (200 km2). The satellite image data were corrected for radiometric and atmospheric distortions to at-surface reflectance. Georeferenced benthic photos were acquired by divers or Autonomous Underwater Vehicles, analysed for benthic cover composition, and used for calibration and validation purposes. Hierarchical mapping from: reef/non-reef (1000's - 10000's m); reef type (100's - 1000's m); 'geomorphic zone' (10's - 100's m); to

Toxicological Benchmarks for Wildlife

Energy Technology Data Exchange (ETDEWEB)

Sample, B.E. Opresko, D.M. Suter, G.W.

1993-01-01

Ecological risks of environmental contaminants are evaluated by using a two-tiered process. In the first tier, a screening assessment is performed where concentrations of contaminants in the environment are compared to no observed adverse effects level (NOAEL)-based toxicological benchmarks. These benchmarks represent concentrations of chemicals (i.e., concentrations presumed to be nonhazardous to the biota) in environmental media (water, sediment, soil, food, etc.). While exceedance of these benchmarks does not indicate any particular level or type of risk, concentrations below the benchmarks should not result in significant effects. In practice, when contaminant concentrations in food or water resources are less than these toxicological benchmarks, the contaminants may be excluded from further consideration. However, if the concentration of a contaminant exceeds a benchmark, that contaminant should be retained as a contaminant of potential concern (COPC) and investigated further. The second tier in ecological risk assessment, the baseline ecological risk assessment, may use toxicological benchmarks as part of a weight-of-evidence approach (Suter 1993). Under this approach, based toxicological benchmarks are one of several lines of evidence used to support or refute the presence of ecological effects. Other sources of evidence include media toxicity tests, surveys of biota (abundance and diversity), measures of contaminant body burdens, and biomarkers. This report presents NOAEL- and lowest observed adverse effects level (LOAEL)-based toxicological benchmarks for assessment of effects of 85 chemicals on 9 representative mammalian wildlife species (short-tailed shrew, little brown bat, meadow vole, white-footed mouse, cottontail rabbit, mink, red fox, and whitetail deer) or 11 avian wildlife species (American robin, rough-winged swallow, American woodcock, wild turkey, belted kingfisher, great blue heron, barred owl, barn owl, Cooper's hawk, and red

APF530 versus ondansetron, each in a guideline-recommended three-drug regimen, for the prevention of chemotherapy-induced nausea and vomiting due to anthracycline plus cyclophosphamide–based highly emetogenic chemotherapy regimens: a post hoc subgroup analysis of the Phase III randomized MAGIC trial

Directory of Open Access Journals (Sweden)

Schnadig ID

2017-05-01

Full Text Available Ian D Schnadig1, Richy Agajanian2, Christopher Dakhil3, Nashat Gabrail4, Jeffrey Vacirca5, Charles Taylor6, Sharon Wilks7, Eduardo Braun8, Michael C Mosier9, Robert B Geller10, Lee Schwartzberg11, Nicholas Vogelzang12 1Compass Oncology, US Oncology Research, Tualatin, OR, 2The Oncology Institute of Hope and Innovation, Whittier, CA, 3Cancer Center of Kansas, Wichita, KS, 4Gabrail Cancer Center, Canton, OH, 5North Shore Hematology Oncology, East Setauket, NY, 6Tulsa Cancer Institute, Tulsa, OK, 7Cancer Care Centers of South Texas, San Antonio, TX, 8Michiana Hematology Oncology, Westville, IN, 9Biostatistics, EMB Statistical Solutions, LLC, Overland Park, KS, 10Medical Affairs, Heron Therapeutics, Inc., San Diego, CA, 11West Cancer Center, Germantown, TN, 12Comprehensive Cancer Centers of Nevada, Las Vegas, NV, USA Background: APF530, a novel extended-release granisetron injection, was superior to ondansetron in a guideline-recommended three-drug regimen in preventing delayed-phase chemotherapy-induced nausea and vomiting (CINV among patients receiving highly emetogenic chemotherapy (HEC in the double-blind Phase III Modified Absorption of Granisetron In the prevention of CINV (MAGIC trial.Patients and methods: This MAGIC post hoc analysis evaluated CINV prevention efficacy and safety of APF530 versus ondansetron, each with fosaprepitant and dexamethasone, in patient subgroup receiving an anthracycline plus cyclophosphamide (AC regimen. Patients were randomized 1:1 to APF530 500 mg subcutaneously (granisetron 10 mg or ondansetron 0.15 mg/kg intravenously (IV (≤16 mg; stratification was by planned cisplatin ≥50 mg/m2 (yes/no. Patients were to receive fosaprepitant 150 mg IV and dexamethasone 12 mg IV on day 1, then dexamethasone 8 mg orally once daily on day 2 and twice daily on days 3 and 4. Patients were mostly younger females (APF530 arm, mean age 54.1 years, female, 99.3%; ondansetron arm, 53.8 years, female 98.3%. The primary

Reprodução de Nycticorax nycticorax (Linnaeus no litoral de Santa Catarina, Brasil Reproduction of the Nycticorax nycticorax (Linnaeus in the Santa Catarina's coast, Brazil

Directory of Open Access Journals (Sweden)

Joaquim O. Branco

2005-06-01

Full Text Available O savacu Nycticorax nycticorax (Linnaeus, 1758 é uma espécie de hábitos crepusculares e noturnos, com ampla distribuição geográfica. Sua biologia reprodutiva tem sido intensivamente estudada nos países de ocorrência, entretanto, no Brasil, é comumente citada nos levantamentos de ornitólogos, mas não existem informações disponíveis sobre seu ciclo de vida. Esse trabalho objetiva contribuir para o conhecimento da biologia reprodutiva dessa espécie no litoral catarinense. As amostragens foram realizadas nos anos de 2000 a 2002 na Ilha dos Pássaros e de 2002 na Ilha dos Lobos, Santa Catarina. As maiores abundâncias de exemplares e ninhos com ovos ocorreram em outubro, sendo que o comprimento médio dos ovos variou entre 5,02 ± 0,23 a 5,07 ± 0,21 cm e o volume 31,71 ± 2,64 a 35,92 ± 3,47 cm³ e as maiores freqüências de filhotes em novembro, culminando o abandono da colônia em meados de janeiro. Foram identificados sete itens nos regurgitos dos filhotes, sendo que os peixes marinhos representaram 44,4% da massa total. O principal predador na colônia foi o urubu-comum, que atuou sobre os ovos no início da temporada e os filhotes no final.The black-crowned night heron N. nycticorax (Linnaeus, 1758 is a aquatic bird with twilight and night habits, with wide geographical distribution. His reproductive biology has been studied intensively at the occurrence countries, however, in Brazil, it is mentioned commonly in the ornithologists' risings, but available information don't exist on his life cycle. This work aims to contribute for the knowledge of the reproductive biology of that species in the Santa Catarina coast. The samplings were accomplished in the years from 2000 to 2002 in the Ilha dos Pássaros and of 2002 in the Ilha dos Lobos, Santa Catarina. The largest abundances of individuals and nests with eggs happened in October, and the medium length of the eggs varied between 5.02 ± 0.23 to 5.07 ± 0.21 cm and the volume 31

Acid Volatile Sulfides (avs) and the Bioavailability of Trace Metals in the Channel of the SÃO Francisco River, Sepetiba Bay - de Janeiro-Brazil

Science.gov (United States)

Monte, Christiane; Rodrigues, Ana Paula; Marinho, Matheus; Quaresma, Tássia; Machado, Wilson

2014-05-01

difference between the transects. According to the studies done previously in the area for concentrations of AVS MADDOCK et at. (2007) found values greater than 290 μmol g-1, MACHADO et al. (2008) found concentrations between 5.2-121 μmol g-1 in the Herons Cove and RODRIGUES (2013) found concentrations between 14.26 to 41.46 μmol g-1 in the Engenho's Sac.The results may reflect the oxic conditions of the environment, which interferes with the reduction of SO4. Additionally, other mechanisms of metal retention in the sediment may be occurring at the site, together with the interfering sulfide. Key words: estuary sediment and simultaneous extraction of metals.

The challenges of a possible exploitation of shale gas in Denmark

Science.gov (United States)

Jacobsen, Ole S.; Kidmose, Jacob; Johnsen, Anders R.; Gravesen, Peter; Schovsbo, Niels H.

2017-04-01

Extraction of shale gas has in recent years attracted increasing interest internationally and in Denmark. The potential areas for shale gas extraction from Alum shale in Denmark are defined as areas where Alum shale is at least 20 m thick, gas mature and buried at 1.5 to 7 km depth. Sweet Spots are areas where Alum shale potentially has a high utility value. Sweet Spots are identified and cover an area of approximately 6,800 km2 and are divided into two subareas; where the shale is at 1.5-5 km depth (2,400 km2) or at 5-7 km depth (4,400 km2). The shale in the upper depth interval has the greatest interest, as these areas are localized most accurate as the production from the deep interval is less costly. Many potential risks has been identified by exploitation of unconventional gas, of which groundwater contamination, waste management and radioactive substances are classified as the most important. The international literature reports a water demand with an average of about 18,000 m3 for older wells whereas newer fracking methods have less water usage. Based heron the estimated water consumption is between 20 million to 66 million m3 water in Danish shale gas production well and thus significantly in the total water budget. Consumption of water for shale gas will however be distributed over a number of years. The temporal development in water usage will depend on how quickly the gas wells are developed. The available groundwater resource in Denmark is estimated to about 1 billion m3 / year. Groundwater abstraction has been slightly falling the last decades and is now totally 700 million m3 / year. The use of surface water in Denmark is thus negligible. Although groundwater attraction is only 70 % of the available, the resource is overexploited in many areas due to water consumption is very unevenly distributed varying from region to region. The composition of potential hydraulic fracturing liquids in Denmark is at present unknown, but is expected to be selected

Aves acuáticas de la Laguna de Agua Dulce y el Estero El Ermitaño, Jalisco, México

Directory of Open Access Journals (Sweden)

Salvador Hernández Vázquez

2005-06-01

and 73 in Ermitaño.The higher species richness and abundance was observed during winter, when migratory species arrived. Most species prefered shallow waters, except seabirds which prefered protected areas such as dunes in Agua Dulce. Other groups, like ducks and related species, prefered low salinity areas, for example in the south-east area of Ermitaño. The higher abundance of the shorebirds was found when the water level on the estuary was low. Herons were seen often at areas with high salinity and influenced by tides (e.g. mouth of Ermitaño. Rev. Biol. Trop. 53(1-2: 229-238. Epub 2005 Jun 24

Using constructivist teaching strategies in high school science classrooms to cultivate positive attitudes toward science

Science.gov (United States)

Heron, Lory Elen

This study investigated the premise that the use of constructivist teaching strategies (independent variable) in high school science classrooms can cultivate positive attitudes toward science (dependent variable) in high school students. Data regarding the relationship between the use of constructivist strategies and change in student attitude toward science were collected using the Science Attitude Assessment Tool (SAAT) (Heron & Beauchamp, 1996). The format of this study used the pre-test, post-test, control group-experimental group design. The subjects in the study were high school students enrolled in biology, chemistry, or environmental science courses in two high schools in the western United States. Ten teachers and twenty-eight classes, involving a total of 249 students participated in the study. Six experimental group teachers and four control group teachers were each observed an average of six times using the Science Observation Guide (Chapman, 1995) to measure the frequency of observed constructivist behaviors. The mean for the control group teachers was 12.89 and the mean for experimental group teachers was 20.67; F(1, 8) = 16.2, p =.004, revealing teaching behaviors differed significantly between the two groups. After a four month experimental period, the pre-test and post-test SAAT scores were analyzed. Students received a score for their difference in positive attitude toward science. The null hypothesis stating there would be no change in attitude toward science as a subject, between students exposed to constructivist strategies, and students not exposed to constructivist strategies was rejected F(1, 247) = 8.04, p =.005. The control group had a generally higher reported grade in their last science class than the experimental group, yet the control group attitude toward science became more negative (-1.18) while attitude toward science in the experimental group became more positive (+1.34) after the four-month period. An analysis of positive

Site remediation guided by risk assessment

International Nuclear Information System (INIS)

McBean, E.A.; Gowing, A.; Pieczonka, G.

2002-01-01

'Full text:' Risk assessment (RA) provides an effective tool for identifying hazards with respect to human health and ecological receptors, hazards that arise from contaminants in the environment. Risk assessment relies upon: hazard identification/problem formulation; toxicity assessment; exposure assessment; and risk characterization. Hence, risk assessment provides an effective guide for site remediation through the identification of the associated risks arising from pre- and potential post-remediation activities. As a demonstration of this decision-making process, a site-specific risk assessment (SSRA) was performed on a chemical producing facility. Historical waste practices during the production of DDT compounds resulted in impacted site soils and sediment and soils of the creek passing through the facility. The purpose of the SSRA was to derive site-specific cleanup values for the impacted on-site soils, creek sediments, and embankment soils, incorporating human and ecological receptors associated with the environmental media. The human exposure pathways considered were dermal contact, incidental ingestion, and inhalation of the various soils. The potential human receptors were industrial workers, construction workers, trespassers, and off-site residents. Ingestion of fish from the creek by residents was also evaluated in the human health risk assessment (HHRA). Food web analyses were used to evaluate the impact of exposure to chemical compounds in aquatic sediments and related soils by ecological receptors such as the great blue heron, raccoon, and mink. The SSRA involved modelling the daily chemical intake by receptors and the transfer of chemicals to identified secondary media (e.g., ambient air or animal tissues) that are also potential exposure media. These models, while using the site-specific chemical data in the source media, possess uncertainties associated with default parameters that are only approximations and not site-specific (e.g., soil

Exergy in School?

Directory of Open Access Journals (Sweden)

Tomaž Kranjc

2017-04-01

Full Text Available Students at all levels of physics instruction have difficulties dealing with energy, work and heat in general and, in particular, with the concepts of efficiency and ideal heat engine, and the maximum performance of refrigerators and heat pumps (Cochran & Heron, 2006; Bucher, 1986. The reason for the difficulties is an insufficient understanding of the second law of thermodynamics (Kesidou & Duit, 1992. In order to make these topics less difficult, the concept of exergy — well established as a powerful analytical tool in technical thermodynamics — describing the “quality” of energy, seems in our judgment to be worthy of inclusion in the physics curriculum at all levels. Its introduction does not add another law. It facilitates the understanding of irreversibilities (as the destruction of exergy and gives a deeper meaning to the second law. In the treatment of heat engines the second-law efficiency throws a new light on the notions of an ideal and a real engine (similarly for a refrigerator or a heat pump. Exergy introduces, in a natural way, a distinction between various forms of energy according to its quality — availability for performing work. “Energy reserves”, which can be better understood with the help of exergy, are of practical interest. From the thermodynamic point of view, a more correct term would be “availability reserves”; all around us, there are huge quantities of energy (in atmosphere, in oceans etc, but of very limited availability, i.e., of limited exergy. In order to identify common misconceptions and difficulties encountered by students in the learning of the first and second law of thermodynamics, particularly in connection with heat engines and similar cyclic devices, we conducted a combined research among students of the Primary School Education at the Faculty of Education (UPR PeF and of Biodiversity, Bioinformatics and Mediterranean Agriculture at the Faculty of Mathematics, Natural Sciences and

Opening Talk: Opening Talk

Science.gov (United States)

Doebner, H.-D.

2008-02-01

) with 170 participants and 89 contributions in the proceedings; it was centred on the foundations and extensions of quantum theory, on quantisation methods and on q-algebras. In QTS2-2001 in Cracow (Poland) with 175 participants and 81 contributions; the main topics were applications of quantum mechanics, representations of algebras and group theoretical techniques in physics. In the symposium QTS3-2003 in Cincinnati (USA) with 145 participants and 92 contributions, quantum field theory, loop quantum gravity, string and brane theory was discussed. The focus in QTS4-2005 in Varna (Bulgaria) with 228 participant and 105 contributions, was on conformal field theory, quantum gravity, noncommutative geometry and quantum groups. Three proceedings volumes were published with World Scientific and one volume with Heron Press. The promising and interesting programme for QTS5-2007 in Valladolid (Spain) attracted more than 200 participants; the contributions will be published in a special issue of Journal of Physics A: Mathematical and Theoretical and a volume of Journal of Physics: Conference Series. This shows the wide scope of symmetry in connection with quantum physics and related sciences. In the background of the symposia series is the Conference Board with presently 13 members. The Board encourages scientists and Institutions to present detailed proposals for a QTS symposium; it agrees to one proposal and is prepared to assist in matters of organisation; the local organisers are responsible for the scientific programme and for the organisation, including the budget. The Board decided that the next symposium QTS6 will be held 2009 at the University of Kentucky in Lexington (USA); Alan Shapere is the chairman of the Local Organizing committee. In the name of all of you I express my appreciation and my thanks to the members of the Local Organizing Committee of QTS5, especially to Mariano del Olmo. The programme is outstanding; it covers recent and new developments in our field

Abundance, Distribution and Estimated Consumption (kg fish) of Piscivorous Birds Along the Yakima River, Washington State; Implications for Fisheries Management, 2002 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Major, III, Walter; Grassley, James M.; Ryding, Kristen E. (University of Washington, Quantitive Ecology Program, Seattle, WA)

2003-05-01

This report is divided into two chapters. The abstract for chapter one is--Understanding of the abundance and spatial and temporal distributions of piscivorous birds and their potential consumption of fish is an increasingly important aspect of fisheries management. During 1999-2002, we determined the abundance and distribution and estimated the maximum consumption (kg biomass) of fish-eating birds along the length of the Yakima River in Washington State. Sixteen different species were observed during the 4-yr study, but only half of those were observed during all years. Abundance and estimated consumption of fish within the upper and middle sections of the river were dominated by common mergansers (Mergus merganser) which are known to breed in those reaches. Common mergansers accounted for 78 to 94% of the estimated total fish take for the upper river or approximately 28,383 {+-} 1,041 kg over the 4 yrs. A greater diversity of avian piscivores occurred in the lower river and potential impacts to fish populations was more evenly distributed among the species. In 1999-2000, great blue herons potentially accounted for 29 and 36% of the fish consumed, whereas in 2001-2002 American white pelicans accounted for 53 and 55%. We estimated that approximately 75,878 {+-} 6,616 kg of fish were consumed by piscivorous birds in the lower sections of the river during the study. Bird assemblages differed spatially along the river with a greater abundance of colonial nesting species within the lower sections of the river, especially during spring and the nesting season. The abundance of avian piscivores and consumption estimates are discussed within the context of salmonid supplementation efforts on the river and juvenile out-migration. The abstract for chapter two is--Consumption of fish by piscivorous birds may be a significant constraint on efforts to enhance salmonid populations within tributaries to the Columbia River in Washington State. During 1999-2002, we determined the

Water quality, streamflow conditions, and annual flow-duration curves for streams of the San Juan–Chama Project, southern Colorado and northern New Mexico, 1935-2010

Science.gov (United States)

Falk, Sarah E.; Anderholm, Scott K.; Hafich, Katya A.

2013-01-01

, Horse Lake Creek, and Willow Creek watersheds, which are underlain mostly by Cretaceous-aged marine shale, was compositionally similar and had large concentrations of sulfate relative to the other streams in the study area, though the water from the Navajo River had lower specific-conductance values than did the water from Horse Lake Creek above Heron Reservoir and Willow Creek above Azotea Creek. Generally, surface-water quality varied with streamflow conditions throughout the year. Streamflow in spring and summer is generally a mixture of base flow (the component of streamflow derived from groundwater discharged to the stream channel) diluted with runoff from snowmelt and precipitation events, whereas streamflow in fall and winter is generally solely base flow. Major- and trace-element concentrations in the streams sampled were lower than U.S. Environmental Protection Agency primary and secondary drinking-water standards and New Mexico Environment Department surface-water standards for the streams. In general, years with increased annual discharge, compared to years with decreased annual discharge, had a smaller percentage of discharge in March, a larger percentage of discharge in June, an interval of discharge derived from snowmelt runoff that occurred later in the year, and a larger discharge in June. Additionally, years with increased annual discharge generally had a longer duration of runoff, and the streamflow indicators occurred at dates later in the year than the years with less snowmelt runoff. Additionally, the seasonal distribution of streamflow was more strongly controlled by the change in the amount of annual discharge than by changes in streamflow over time. The variation of streamflow conditions over time at one streamflow-gaging station in the study area, Navajo River at Banded Peak Ranch, was not significantly monotonic over the period of record with a Kendall’s tau of 0.0426 and with a p-value of 0.5938 for 1937 to 2009 (a trend was considered