2002-01-01
Heron Island is located at the sourthern end of Australia's 2,050 km-long Great Barrier Reef. Surrounded by coral reef and home to over 1000 species of fish, scuba divers and scientists alike are drawn to the island's resort and research station. The true-color image above was taken by Space Imaging's Ikonos satellite with a resolution of 4 meters per pixel-high enough to see individual boats tied up at the small marina. The narrow channel leading from the marina to the ocean was blasted and dredged decades ago, before the island became a national park. Since then the Australian government has implemented conservation measures, such as limiting the number of tourists and removing or recycling, instead of incinerating, all trash. One of the applications of remote sensing data from Ikonos is environmental monitoring, including studies of coral reef health. For more information about the island, read Heron Island. Image by Robert Simmon, based on data copyright Space Imaging
Spatiotemporal patterns of coral disease prevalence on Heron Island, Great Barrier Reef, Australia
Haapkylä, J.; Melbourne-Thomas, J.; Flavell, M.; Willis, B. L.
2010-12-01
Despite increasing research effort on coral diseases, little is known about factors driving disease dynamics on the Great Barrier Reef (GBR). This is the first study to investigate the temporal patterns of coral disease prevalence and potential drivers of disease around Heron Island, in the southern Capricorn Bunker sector of the GBR. Surveys were conducted in two austral summers and three winters between November 2007 and August 2009 on six sites around the island. Six diseases were detected: brown band syndrome (BrB), growth anomalies (GA), ulcerative white spots (UWS), white syndrome (WS), skeletal eroding band disease (SEB) and black band disease (BBD). The lowest overall mean disease prevalence was 1.87 ± 0.75% (mean ± SE) in November 2007 and the highest 4.22 ± 1.72% in August 2008. There was evidence of seasonality for two diseases: BrB and UWS. This is the first study to report a higher prevalence of BrB in the winter. BrB had a prevalence of 3.29 ± 0.58% in August 2008 and 1.53 ± 0.28% in August 2009, while UWS was the most common syndrome in the summer with a prevalence of 1.12 ± 0.31% in November 2007 and 2.67 ± 0.52% prevalence in January 2008. The prevalence of GAs and SEB did not depend on the season, although the prevalence of GAs increased throughout the study period. WS had a slightly higher prevalence in the summer, but its overall prevalence was low (disease prevalence (12% of Acropora and 3.3% of Montipora species were diseased respectively). These results highlight the correlations between coral disease prevalence, seasonally varying environmental parameters and coral community composition. Given that diseases are likely to reduce the resilience of corals, seasonal patterns in disease prevalence deserve further research.
Díez, Beatriz; Bauer, Karolina; Bergman, Birgitta
2007-01-01
The diversity and nitrogenase activity of epilithic marine microbes in a Holocene beach rock (Heron Island, Great Barrier Reef, Australia) with a proposed biological calcification “microbialite” origin were examined. Partial 16S rRNA gene sequences from the dominant mat (a coherent and layered pink-pigmented community spread over the beach rock) and biofilms (nonstratified, differently pigmented microbial communities of small shallow depressions) were retrieved using denaturing gradient gel electrophoresis (DGGE), and a clone library was retrieved from the dominant mat. The 16S rRNA gene sequences and morphological analyses revealed heterogeneity in the cyanobacterial distribution patterns. The nonheterocystous filamentous genus Blennothrix sp., phylogenetically related to Lyngbya, dominated the mat together with unidentified nonheterocystous filaments of members of the Pseudanabaenaceae and the unicellular genus Chroococcidiopsis. The dominance and three-dimensional intertwined distribution of these organisms were confirmed by nonintrusive scanning microscopy. In contrast, the less pronounced biofilms were dominated by the heterocystous cyanobacterial genus Calothrix, two unicellular Entophysalis morphotypes, Lyngbya spp., and members of the Pseudanabaenaceae family. Cytophaga-Flavobacterium-Bacteroides and Alphaproteobacteria phylotypes were also retrieved from the beach rock. The microbial diversity of the dominant mat was accompanied by high nocturnal nitrogenase activities (as determined by in situ acetylene reduction assays). A new DGGE nifH gene optimization approach for cyanobacterial nitrogen fixers showed that the sequences retrieved from the dominant mat were related to nonheterocystous uncultured cyanobacterial phylotypes, only distantly related to sequences of nitrogen-fixing cultured cyanobacteria. These data stress the occurrence and importance of nonheterocystous epilithic cyanobacteria, and it is hypothesized that such epilithic cyanobacteria
Beale, D J; Crosswell, J; Karpe, A V; Ahmed, W; Williams, M; Morrison, P D; Metcalfe, S; Staley, C; Sadowsky, M J; Palombo, E A; Steven, A D L
2017-12-31
The impact of anthropogenic factors arising from point and non-point pollution sources at a multi commodity marine port and its surrounding ecosystems were studied using sediment samples collected from a number of onshore (Gladstone Harbour and Facing Island) and offshore (Heron Island and Fitzroy Reefs) sites in Australia's Central Queensland. Sediment samples were analyzed for trace metals, organic carbon, polycyclic aromatic hydrocarbons (PAH), emerging chemicals of concern (ECC) and sterols. Similarly, the biological and biochemical interaction between the reef and its environment was analyzed by the multi-omic tools of next-generation sequencing characterization of the bacterial community and microbial community metabolic profiling. Overall, the trace elements were observed at the lower end of the Australian environmental guideline values at the offshore sites, while higher values were observed for the onshore locations Nickel and copper were observed above the high trigger value threshold at the onshore sites. The levels of PAH were below limits of detection across all sites. However, some of the ECC and sterols were observed at higher concentrations at both onshore and offshore locations, notably, the cholesterol family sterols and 17α-ethynylestradiol. Multi-omic analyses also indicated possible thermal and photo irradiation stressors on the bacterial communities at all the tested sites. The observed populations of γ-proteobacteria were found in combination with an increased pool of fatty acids that indicate fatty acid synthesis and utilisation of the intermediates of the shikimate pathways. This study demonstrates the value of applying a multi-omics approach for ecological assessments, in which a more detailed assessment of physical and chemical contaminants and their impact on the community bacterial biome is obtained. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.
2002-01-01
The skies over Northern India are filled with a thick soup of aerosol particles all along the southern edge of the Himalayan Mountains, and streaming southward over Bangladesh and the Bay of Bengal. Notice that the air over the Tibetan Plateau to the north of the Himalayas is very clear, whereas the view of the land surface south of the mountains is obstructed by the brownish haze. Most of this air pollution comes from human activities. The aerosol over this region is notoriously rich in sulfates, nitrates, organic and black carbon, and fly ash. These particles not only represent a health hazard to those people living in the region, but scientists have also recently found that they can have a significant impact on the region's hydrological cycle and climate (click to read the relevant NASA press release). This true-color image was acquired on December 4, 2001, by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra satellite. It is interesting to compare the image above with this earlier MODIS image over the region, acquired on October 23, 2001. Notice the difference in the clarity of the air over the region in the earlier image. Under the thick plume of aerosol, the Brahmaputra (upper right) and Ganges Rivers are still visible. The many mouths of the Ganges have turned the northern waters of the Bay of Bengal a murky brown as they empty their sediment-laden waters into the bay. Toward the upper lefthand corner of the image, there appears to be a fresh swath of snow on the ground just south of the Himalayas. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0100062 includes chemical, meteorological, physical and time series data collected from HERON ISLAND, KANGAROO ISLAND, MARIA ISLAND, MOORING_HERON...
Radiocesium dynamics in herons inhabiting a contaminated reservoir system
International Nuclear Information System (INIS)
Dombey, A.H.; Paine, D.; McFarlane, R.W.
1977-01-01
The little blue heron (Florida caerulea) and the green heron (Butorides virescens) nest at a radionuclide-contaminated reservoir on the Savannah River Plant near Aiken, South Carolina. Green herons distributed their nests singly along the periphery of the reservoir but fed their nestlings exclusively upon amphibians collected from adjacent uncontaminated Carolina bays. Radiocesium burdens in green heron nestlings did not exceed 5 pCi/g wet wt. and 12 regurgitated food pellets averaged 0.2 pCi/g. Twelve pairs of little blue herons established a heronry upon a small island and fed their nestlings fish and amphibians foraged from within the differentially radionuclide-contaminated reservoir system. Nestlings within the same nest did not exhibit significant differences in body burdens, and the maximum radiocesium burden determined was 27.4 pCi/g wet wt. Substantial differences were found between nestlings from different nests however. The radiocesium level of 43 regurgitated food pellets had a high correlation with observed levels in the nestlings, and variation in food contamination is believed to be the major contributor in the observed variation in the nestlings. The variable contamination of primary prey species was correlated with the differentially contaminated foraging sites and indicates that adult little blue herons tended to spatially partition the available foraging areas. (author)
National Oceanic and Atmospheric Administration, Department of Commerce — This archival package contains carbonate chemistry and environmental parameters data that were collected from a 200-day time series monitoring on the Heron Island...
Swan, Hilton B; Deschaseaux, Elisabeth S M; Jones, Graham B; Eyre, Bradley D
2017-07-01
Dimethylsulfoniopropionate (DMSP) and eleven other target zwitterions were quantified in the branch tips of six Acropora species and Stylophora pistillata hard coral growing on the reef flat surrounding Heron Island in the southern Great Barrier Reef (GBR), Australia. Hydrophilic interaction liquid chromatography mass spectrometry (HILIC-MS) was used for sample analysis with isotope dilution MS applied to quantify DMSP. The concentration of DMSP was ten times greater in A. aspera than A. valida, with this difference being maintained throughout the spring, summer and winter seasons. In contrast, glycine betaine was present in significantly higher concentrations in these species during the summer than the winter. Exposure of branch tips of A. aspera to air and hypo-saline seawater for up to 1 h did not alter the concentrations of DMSP present in the coral when compared with control samples. DMSP was the most abundant target zwitterion in the six Acropora species examined, ranging from 44-78% of all target zwitterions in A. millepora and A. aspera, respectively. In contrast, DMSP only accounted for 7% in S. pistillata, with glycine betaine and stachydrine collectively accounting for 88% of all target zwitterions in this species. The abundance of DMSP in the six Acropora species examined points to Acropora coral being an important source for the biogeochemical cycling of sulfur throughout the GBR, since this reef-building branching coral dominates the coral cover of the GBR. Graphical Abstract HILIC-MS extracted ion chromatogram showing zwitterionic metabolites from the branching coral Acropora isopora.
Kushlan, J.A.; Hancock, J.A.
2005-01-01
Herons and their close relatives, the egrets and bitterns, comprise sixty species in total and are found all over the world except in polar regions, and are a strikingly beautiful part of the wetlands they inhabit. They are particularly abundant and popular in South West USA, especially Florida. Herons are a diverse group, easily recognized by their long legs, necks and bills. Many species are notable for their sociality as they feed, roost, and nest together in single or mixed species assemblages. The authors have extensive experience of research and observation of these birds and this book provides an up to date comprehensive review of the herons of the world. Covering their biology, distribution, description, systematics, breeding, feeding, and conservation, James Hancock and James Kushlan have distilled their lifetimes' research on the heron into one volume. This volume is complemented by beautiful color paintings especially painted for the book, color photographs, and distribution maps.
DEFF Research Database (Denmark)
Santos, Isaac R.; Glud, Ronnie N.; Maher, Damien
2011-01-01
Little is known about how biogeochemical processes in permeable sediments affect the pH of coastal waters. We demonstrate that seawater recirculation in permeable sands can play a major role in proton (H+) cycling in a coral reef lagoon. The diel pH range (up to 0.75 units) in the Heron Island...... lagoon was the broadest ever reported for reef waters, and the night‐time pH (7.69) was comparable to worst‐case scenario predictions for seawater pH in 2100. The net contribution of coarse carbonate sands to the whole system H+ fluxes was only 9% during the day, but approached 100% at night when small...... scale (i.e., flow and topography‐induced pressure gradients) and large scale (i.e., tidal pumping as traced by radon) seawater recirculation processes were synergistic. Reef lagoon sands were a net sink for H+, and the sink strength was a function of porewater flushing rate. Our observations suggest...
Energy Technology Data Exchange (ETDEWEB)
Thomas, C.M.; Anthony, R.G.
1999-12-01
Great blue heron (Ardea herodias) eggs and prey items were collected from six colonies in Oregon and Washington, USA, during 1994 to 1995. Contaminant concentrations, reproductive success, and biomagnification factors were determined and effects of residue levels were measured by H4IIE rat hepatoma bioassays. Mean residue concentrations in heron eggs and prey items were generally low. However, elevated concentrations of polychlorinated biphenyls (PCBs) were detected in eggs and prey from Ross Island on the Willamette River. Biomagnification factors varied among sites. Sites were not significantly different in H4IIE tetrachlorodibenzo-p-dioxin equivalents (TCDD-EQs), although the TCDD-EQ for Karlson Island was 9 to 20 times greater than that of any other site. Large differences existed between toxic equivalents calculated from egg residue concentrations and TCDD-EQs, which indicated nonadditive interactions among the compounds. Tetrachlorodibenzo-p-dioxin equivalents and nest failure were positively correlated with TCDD concentration. Fledging and reproductive rates were similar to those determined for healthy heron populations, however, indicating that any adverse effects were occurring at the individual level and not at the colony level. Their results support the use of great blue herons as a biomonitor for contamination in aquatic ecosystems. Their relatively low sensitivity to organochlorine contaminants and high trophic position allows contaminant accumulation and biomagnification without immediate adverse effects that are often seen in other, more sensitive species.
Brussee, Brianne E.; Coates, Peter S.; Dwight, Ian; Young, Laura G.
2017-01-01
During 2011, four separate instances of indirect filial cannibalism, whereby adults consumed their young that died from unknown causes, were observed using video-monitoring techniques in a nesting colony of Black-crowned Night-Herons (Nycticorax nycticorax) on Alcatraz Island. Though they were not observed actively killing their young, in all four observations adult Black-crowned Night-Herons consumed their young following death (i.e., indirect filial cannibalism). We could not determine cause of chick mortality, but parental neglect was likely a contributing factor in at least two instances. Indirect filial cannibalism is not commonly documented among birds, and understanding how cannibalism contributes to nest failure can help researchers better understand factors that limit nesting populations.
Rattner, B.A.; Hatfield, J.S.; Melancon, M.J.; Custer, T.W.; Tillitt, D.E.
1994-01-01
Pipping black-crowned night-heron (Nycticorax nycticorax) embryos were collected from a relatively uncontaminated site (next to Chincoteague National Wildlife Refuge, VA) and three polluted sites (Cat Island, Green Bay, Lake Michigan, WI; Bair Island, San Francisco Bay, CA; West Marin Island, San Francisco Bay, CA). Hepatic cytochrome P-450-associated monooxygenases and cytochrome P-450 proteins, induced up to 85-fold relative to the reference site, were associated with concentrations of total polychlorinated biphenyls (PCBs) and 11 PCB congeners that are presumed to express toxicity through the arylhydrocarbon (Ah) receptor. Multiple regression revealed that up to 86% of the variation of cytochrome P450 measurements was accounted for by variation in the concentration of these PCB congeners. Toxic equivalents (TEQs) of sample extracts, predicted mathematically (summed product of PCB congener concentrations and toxic equivalency factors), and dioxin equivalents (TCDD-EQs), derived by bioassay (ethoxyresorufin-O-dealkylase activity of treated H4IIE rat hepatoma cells), were greatest in Cat Island samples. Cytochrome P450-associated monooxygenases and cytochrome P450 proteins were related to TEQs and TCDD-EQs; adjusted r-2 often exceeded 0.5 for the relation among mathematically predicted TEQs and cytochrome P450 measurements. These data extend previous observations in heron embryos of an association between P450 and total PCB burdens to include Ah-active PCB congeners, and presumably other compounds, which interact similarly with the Ah receptor. Benzyloxyresorufin O-dealkylase, ethoxyresorufin O-dealkylase, and cytochrome P450 1A appear to be the most reliable measures of exposure to Ah-active PCB congeners in black-crowned night-heron embryos. These findings provide further evidence that cytochrome P450-associated parameters have considerable value as a biomarker for assessing environmental contamination of wetlands.
Watson, Charlotte
2015-09-18
Morphological investigation into the paleate genus Paleanotus Schmarda 1861 of the family Chrysopetalidae from northern Australian coral reefs, primarily Lizard Island and outlying reefs, included a complex of very small, slender individuals (length < 5 mm). This complex resolved into 7 new species, described herein: Paleanotus inornatus n. sp., P. adornatus n. sp., P. chrysos n. sp., P. aquifolia n. sp., P. latifolia n. sp., P. silus n. sp., and P. silopsis n. sp. A key is provided to the new species and Paleanotus distinguished from Treptopale and Hyalopale, two closely related genera. Diagnostic features of the apical structure and shape of the notochaetal main paleae plus median paleae shape and raised rib pattern, differentiates each species from the other. Gametous states are described. Two cryptic species pairs (Paleanotus silopsis n. sp. and P. silus n. sp.; Paleanotus aquifolia n. sp. and P. latifolia n. sp.) were identified. In each case one species is restricted to either the NE or NW Australian coast. In each pair the most eastern point for the NW Australian species range occurs at Darwin, western Arnhemland, Northern Territory. Additional material for each species pair extends their respective ranges northwards: NW Australia to Thailand, Andaman Sea, eastern Indian Ocean or NE Australia, Great Barrier Reef to the Philippines, western Pacific Ocean. Cryptic morphology and potential genetic diversity is discussed in Paleanotus inornatus n. sp. and P. adornatus n. sp. that possess overlapping widespread distribution patterns across northern Australia and Indo-Pacific reefs. The smallest bodied taxon, Paleanotus chrysos n. sp. is the only species with a Coral Sea range encompassing Lizard Island, Heron Island and New Caledonia.
Early human occupation of a maritime desert, Barrow Island, North-West Australia
Veth, Peter; Ward, Ingrid; Manne, Tiina; Ulm, Sean; Ditchfield, Kane; Dortch, Joe; Hook, Fiona; Petchey, Fiona; Hogg, Alan; Questiaux, Daniele; Demuro, Martina; Arnold, Lee; Spooner, Nigel; Levchenko, Vladimir; Skippington, Jane; Byrne, Chae; Basgall, Mark; Zeanah, David; Belton, David; Helmholz, Petra; Bajkan, Szilvia; Bailey, Richard; Placzek, Christa; Kendrick, Peter
2017-07-01
Archaeological deposits from Boodie Cave on Barrow Island, northwest Australia, reveal some of the oldest evidence for Aboriginal occupation of Australia, as well as illustrating the early use of marine resources by modern peoples outside of Africa. Barrow Island is a large (202 km2) limestone continental island located on the North-West Shelf of Australia, optimally located to sample past use of both the Pleistocene coastline and extensive arid coastal plains. An interdisciplinary team forming the Barrow Island Archaeology Project (BIAP) has addressed questions focusing on the antiquity of occupation of coastal deserts by hunter-gatherers; the use and distribution of marine resources from the coast to the interior; and the productivity of the marine zone with changing sea levels. Boodie Cave is the largest of 20 stratified deposits identified on Barrow Island with 20 m3 of cultural deposits excavated between 2013 and 2015. In this first major synthesis we focus on the dating and sedimentology of Boodie Cave to establish the framework for ongoing analysis of cultural materials. We present new data on these cultural assemblages - including charcoal, faunal remains and lithics - integrated with micromorphology, sedimentary history and dating by four independent laboratories. First occupation occurs between 51.1 and 46.2 ka, overlapping with the earliest dates for occupation of Australia. Marine resources are incorporated into dietary assemblages by 42.5 ka and continue to be transported to the cave through all periods of occupation, despite fluctuating sea levels and dramatic extensions of the coastal plain. The changing quantities of marine fauna through time reflect the varying distance of the cave from the contemporaneous shoreline. The dietary breadth of both arid zone terrestrial fauna and marine species increases after the Last Glacial Maximum and significantly so by the mid-Holocene. The cave is abandoned by 6.8 ka when the island becomes increasingly distant
Leptospira Species in Feral Cats and Black Rats from Western Australia and Christmas Island.
Dybing, Narelle A; Jacobson, Caroline; Irwin, Peter; Algar, David; Adams, Peter J
2017-05-01
Leptospirosis is a neglected, re-emerging bacterial disease with both zoonotic and conservation implications. Rats and livestock are considered the usual sources of human infection, but all mammalian species are capable of carrying Leptospira spp. and transmitting pathogenic leptospires in their urine, and uncertainty remains about the ecology and transmission dynamics of Leptospira in different regions. In light of a recent case of human leptospirosis on tropical Christmas Island, this study aimed to investigate the role of introduced animals (feral cats and black rats) as carriers of pathogenic Leptospira spp. on Christmas Island and to compare this with two different climatic regions of Western Australia (one island and one mainland). Kidney samples were collected from black rats (n = 68) and feral cats (n = 59) from Christmas Island, as well as feral cats from Dirk Hartog Island (n = 23) and southwest Western Australia (n = 59). Molecular (PCR) screening detected pathogenic leptospires in 42.4% (95% confidence interval 29.6-55.9) of cats and 2.9% (0.4-10.2) of rats from Christmas Island. Sequencing of cat- and rat-positive samples from Christmas Island showed 100% similarity for Leptospira interrogans. Pathogenic leptospires were not detected in cats from Dirk Hartog Island or southwest Western Australia. These findings were consistent with previous reports of higher Leptospira spp. prevalence in tropical regions compared with arid and temperate regions. Despite the abundance of black rats on Christmas Island, feral cats appear to be the more important reservoir species for the persistence of pathogenic L. interrogans on the island. This research highlights the importance of disease surveillance and feral animal management to effectively control potential disease transmission.
Directory of Open Access Journals (Sweden)
Vovk M.V.
2012-11-01
Full Text Available The research was performed in the area of natural reserve "Dneprovsko-Orelsky" and its adjacent territory – the island Pogorely. We discovered the changes of number of grey heron in colonial settlements, determined the principal factors influencing the formation of spatial structure of island bird communities. The analysis of nest distribution towards tree breeding biotopes was performed and stability of spatial structure of bird colonies was proved. We were tracking the number dynamics of pioneer colony and revealed the principal ecological and anthropogenic factors influencing the fluctuation of its abundance.
ADAPTIVE CHARACTERISTICS OF HERONS PLUMAGE FOR THEIR WAY OF LIFE
Directory of Open Access Journals (Sweden)
Koshelev V. A.
2011-12-01
Full Text Available Feather cover of each bird species reflects spectra of species, age, sex and environmental attributes defined the phylogeny of taxa, habitat and life patterns. In turn, many ecological phenomena in the birds’ life patterns are directly dependent on the state of plumage (e.g., time of breeding, seasonal migration, roost flights. For the first time the quantitative characterization of six heron species' plumage were done as well as the description of powder down feathers. The adaptive features of feathers and various types of heron’s plumages were discussed.The structure of contour feathers of herons is related to the peculiarities of species life pattern. All the species have a relatively small number of contour feathers, despite their large body size. According to this index the herons are more similar to typical wading birds (gulls, sandpipers than for waterfowl. The total number of heron feathers slightly increase in winter, because they are migratory species. Structure of contour feathers of herons corresponds to that of other waterbirds. The rod is not bent, the feathers are large, and the mounting angle to the surface of the body is little. The cores of abdominal feather fracts reduce heat transfer and can be regarded as an adaptation factor to aquatic environment.Buoyancy is provided by heron’s feathers insignificantly, in contrast to the typical waterfowl species. Significant subcutaneous fat stores are typical for herons in spring, autumn and winter, increased buoyancy and being the energy reserves provide thermoregulation in cold environment. Our data indicate weak adaptation of herons’ plumage to aquatic environments, but also confirm its insulating properties, which is prove the herons semi-aquatic rather than aquatic life patterns.Due to color of plumage some three groups of herons were considered: white, mottled and camouflaged. Coloration of second and third group performs a protective function. We didn’t found a clear
Baird, Andrew H; Hoogenboom, Mia O; Huang, Danwei
2017-01-01
A new zooxanthellate reef-dwelling scleractinian coral species, Cyphastrea salae sp. n. (Scleractinia, Merulinidae), is described from Lord Howe Island Australia. The new species can be distinguished morphologically from the only other congeneric species on Lord Howe Island, C. microphthalma , by the number of primary septa (12 vs. 10) and the much taller corallites (mean ± SE: 1.0 ± 0.07 mm v 0.4 ± 0.04 mm). The relationship of C. salae to four of the other eleven currently accepted species in the genus was explored through analyses of nuclear (28S rDNA) and mitochondrial (noncoding intergenic region) gene sequences. Cyphastrea salae sp. n. forms a strongly supported clade that is distinct from a clade containing three species found commonly in Australia, C. chalcidicum , C. serailia , and C. microphthalma . One specimen was also found in the Solitary Islands, another high latitude location in south-eastern Australia. The discovery of a new species in the genus Cyphastrea on high latitude reefs in south-eastern Australia suggests that other new species might be found among more diverse genera represented here and that the scleractinian fauna of these isolated locations is more distinct than previously recognised.
Nesting season food habits of 4 species of Herons and Egrets at Lake Okeechobee, Florida
Smith, J.P.
1997-01-01
Based on the composition of nestling regurgitations collected during 3 breeding seasons, fish were the most important prey group for Great Egrets (Ardea alba: N = 200 nest-day samples; aggregate percent biomass [APB] = 73.4%), Snowy Egrets (Egretta thula: N = 115; APB = 91.4%), and Tricolored Herons (E. tricolor. N = 68; APB = 97.3%). For Little Blue Herons (E. caerulerr. N = 57), grass shrimp (Palaemoneles paludosus; APB = 39.7%) ranked higher in overall importance than all fishes combined (APB = 36.5%). Dietary overlap, as measured by Schoener's Similarity Index, was greatest between Snowy Egrets and Tricolored Herons (77%) and lowest between Tricolored Herons and Little Blue Herons (30%). Diet diversity, as measured by Shannon's Index, was highest for Great Egrets (2.04), intermediate for Snowy Egrets (1.71) and Tricolored Herons (1.68), and lowest for Little Blue Herons (1.60). Great Egrets ate a wider variety of fish species and sizes, especially larger fishes, and more crayfish than the other species. Little Blue Herons ate fewer fish and more grass shrimp and insects, and ate smaller forage fishes than Tricolored Herons but similar-sized fish as Snowy Egrets. The coarse-scale trophic composition of Snowy Egret and Tricolored Heron diets did not differ significantly, but Tricolored Herons ate larger forage fishes than Snowy Egrets. Pronounced interannual and intercolony variation in diet composition suggested that Great Egrets and Little Blue Herons switched prey types as hydrologic conditions and habitat availability changed. Conversely, lack of such variation suggested that Snowy Egrets and Tricolored Herons adjusted their foraging tactics to ensure contin-ued encounters with preferred prey despite changing habitat conditions. These results are generally consistent with other published data, help confirm some generalizations about foraging strategies and patterns of niche differentiation among these ecologically similar species, and have implications for
Sensitivity of coral cays to climatic variations, southern Great Barrier Reef, Australia
Energy Technology Data Exchange (ETDEWEB)
Flood, P G
1986-01-01
Analysis of available wind data for the years 1962-80 from Heron Island which is located within the southern Great Barrier Reef indicates that the annual wind energy vector has oscillated within a 45 degree arc from the SSE in the early 1960's to ESE in the late 1970's. Such changes in wind direction influence the direction of propagation of the waves which mold the shape of coral sand cays in this region. Documentation is provided which shows that the variability of the shoreline positions on Erskine Island, an uninhabited vegetated sand cays reflects this change. The implication is that contemporary shoreline erosion on Heron Island is not caused by the development associated with the tourist resort there. It is a symptom of the change in the propagation direction of the wind-induced waves which is related to long-term climatic change.
Directory of Open Access Journals (Sweden)
Andrew H. Baird
2017-03-01
Full Text Available A new zooxanthellate reef-dwelling scleractinian coral species, Cyphastrea salae sp. n. (Scleractinia, Merulinidae, is described from Lord Howe Island Australia. The new species can be distinguished morphologically from the only other congeneric species on Lord Howe Island, C. microphthalma, by the number of primary septa (12 vs. 10 and the much taller corallites (mean ± SE: 1.0 ± 0.07 mm v 0.4 ± 0.04 mm. The relationship of C. salae to four of the other eleven currently accepted species in the genus was explored through analyses of nuclear (28S rDNA and mitochondrial (noncoding intergenic region gene sequences. Cyphastrea salae sp. n. forms a strongly supported clade that is distinct from a clade containing three species found commonly in Australia, C. chalcidicum, C. serailia, and C. microphthalma. One specimen was also found in the Solitary Islands, another high latitude location in south-eastern Australia. The discovery of a new species in the genus Cyphastrea on high latitude reefs in south-eastern Australia suggests that other new species might be found among more diverse genera represented here and that the scleractinian fauna of these isolated locations is more distinct than previously recognised.
Whittington, I D
1998-10-01
There are approximately 25,000 species of fishes known in the world. The Monogenea are believed to be among the most host-specific of parasites and if each species of fish is host to a different species of monogenean, there could be almost 25,000 monogenean species on Earth. Currently, I estimate that between 3000 and 4000 of these are described. Australia has a rich marine fish fauna with approximately 3500 species of teleosts. If the same formula of one monogenean species per host fish species is applied, Australia marine fishes could host potentially 3500 species of monogeneans. The first monogenean species described from Australia was Encotyllabe pagrosomi MacCallum, 1917 and approximately 300 more species have since been described from the continent. Even in a region of Australia such as Heron Island on the Great Barrier Reef that has been a focus of sustained research on these parasites, only about 85 species are described from 40 of the most common, easily-caught species of fish. Reasons are discussed for the relatively small numbers of monogenean species described so far from Australia. Endemicity is difficult to judge, but only one is certain: Concinnocotyla australensis (Polystomatidae) from Neoceratodus forsteri (Dipnoi). Despite reductions in research funding, the value of parasite taxonomy must not be underestimated, particularly in regions of the world that have a rich diversity of potential hosts.
Lichen Monitoring Delineates Biodiversity on a Great Barrier Reef Coral Cay
Rogers, Paul C.; Rogers, Roderick W.; Hedrich, Anne E.; Moss, Patrick T.
2015-01-01
Coral islands around the world are threatened by changing climates. Rising seas, drought, and increased tropical storms are already impacting island ecosystems. We aim to better understand lichen community ecology of coral island forests. We used an epiphytic lichen community survey to gauge Pisonia (Pisonia grandis R.BR.), which dominates forest conditions on Heron Island, Australia. Nine survey plots were sampled for lichen species presence and abundance, all tree diameters and species, GPS...
Rattner, B.A.; Hatfield, J.S.; Melancon, M.J.; Custer, T.W.; Tillett, D.E.
1993-01-01
Pipping black-crowned night-heron (Nycticorax nycticorax) embryos were collected from undisturbed (Chincoteague National Wildlife Refuge, VA) and industrialized (Cat Island, Green Bay, WI; San Francisco Bay, CA) locations. Hepatic P450 associated monooxygenases (AHH, EROD, BROD, ECOD) and P450 proteins (CYP1A, CYP2B) were induced up to 85-fold, and were associated with burdens of total PCBs and 11 AHH-active PCB congeners. Dioxin equivalents (TCDD-EQs) of sample extracts, derived by bioassay (H4I1E rat hepatoma cell) and mathematically (product of PCB congener concentration and relative TCDD potency), revealed greatest TCDD-EQs in Cat Island samples. TCDD-EQs were associated with P450s, especially BROD, EROD and CYP1A (r2 = 0.35 to 0.66). TCDD-EQs derived by bioassay were highly correlated with TCDD-EQs derived mathematically (r2 = 0.58 to 0.67) . Multiple regressions were also performed to investigate relationships among P450s and PCB congeners. In summary, these data demonstrate that hepatic P450s of heron embryos are biomarkers of exposure to dioxin-like compounds and provide further evidence that this species has considerable value for assessing wetland and estuarine contamination.
Spendelow, J.A.; Kuter, M.
2004-01-01
Falkner Island (FICT), a unit of the U.S. Fish and Wildlife Service's Stewart B. McKinney National Wildlife Refuge (SBMNWR) since 1985, is located in Long Island Sound 5 km south of Guilford, CT. For more than three decades it has been the site of the only large breeding colony in Connecticut of the federally endangered Northwest Atlantic population of Roseate Terns (Sterna dougallii) and the state's largest colony of Common Terns (S. hirundo). Both species have been studied at this site since 1978 as part of the Falkner Island Tern Project (FITP), and since 1987 also as part of a regional Cooperative Roseate Tern Metapopulation Dynamics and Ecology Project (CRTMP), both coordinated by Dr. Jeffrey A. Spendelow of the U.S. Geological Survey's Patuxent Wildlife Research Center (USGS-PWRC). From 1997-2002 the Roseate Tern breeding population at this site declined by more than 50% from about 150 to about 70 nesting pairs, mostly as a result of the nocturnal predation and disturbance of tern chicks and eggs by Black-crowned Night-Herons (Nycticorax nycticorax). Here we report the results of research done with the goal of improving management of nocturnal predators and developing new practices/structures to reduce losses of tern eggs and chicks so as to prevent the abandonment of this site by Roseate Terns. Notification of release of the USGS 'Quick Response Funds' (QRF) that were to be used to support the part of this study entitled 'Nocturnal behavior/interactions of endangered Roseate Terns and Black-crowned Night-Herons', and final approval of the Study Plan for this research did not occur until after the breeding season in 2003 was well underway. As a result, some work will need to be completed during the 2004 field season. There are two major objectives of this study. The first is to collect basic information (a) on the nocturnal behavior and interactions of Roseate (and Common) Terns with predatory Black-crowned Night-Herons, and (b) on how the behavior of the
Unsworth, Nathan B; Stenos, John; Graves, Stephen R; Faa, Antony G; Cox, G Erika; Dyer, John R; Boutlis, Craig S; Lane, Amanda M; Shaw, Matthew D; Robson, Jennifer; Nissen, Michael D
2007-04-01
Australia has 4 rickettsial diseases: murine typhus, Queensland tick typhus, Flinders Island spotted fever, and scrub typhus. We describe 7 cases of a rickettsiosis with an acute onset and symptoms of fever (100%), headache (71%), arthralgia (43%), myalgia (43%), cough (43%), maculopapular/petechial rash (43%), nausea (29%), pharyngitis (29%), lymphadenopathy (29%), and eschar (29%). Cases were most prevalent in autumn and from eastern Australia, including Queensland, Tasmania, and South Australia. One patient had a history of tick bite (Haemaphysalis novaeguineae). An isolate shared 99.2%, 99.8%, 99.8%, 99.9%, and 100% homology with the 17 kDa, ompA, gltA, 16S rRNA, and Sca4 genes, respectively, of Rickettsia honei. This Australian rickettsiosis has similar symptoms to Flinders Island spotted fever, and the strain is genetically related to R. honei. It has been designated the "marmionii" strain of R. honei, in honor of Australian physician and scientist Barrie Marmion.
Colony Development and Density-Dependent Processes in Breeding Grey Herons
Directory of Open Access Journals (Sweden)
Takeshi Shirai
2013-01-01
Full Text Available The density-dependent processes that limit the colony size of colonially breeding birds such as herons and egrets remain unclear, because it is difficult to monitor colonies from the first year of their establishment, and the most previous studies have considered mixed-species colonies. In the present study, single-species colonies of the Grey Heron (Ardea cinerea were observed from the first year of their establishment for 16 years in suburban Tokyo. Colony size increased after establishment, illustrating a saturation curve. The breeding duration (days from nest building to fledging by a pair increased, but the number of fledglings per nest decreased, with colony size. The reproductive season in each year began earlier, and there was greater variation in the timing of individual breeding when the colony size was larger. The prolonged duration until nestling feeding by early breeders of the colony suggests that herons at the beginning of the new breeding season exist in an unsteady state with one another, likely owing to interactions with immigrant individuals. Such density-dependent interference may affect reproductive success and limit the colony size of Grey Herons.
Unsworth, Nathan B.; Graves, Stephen R.; Faa, Antony G.; Cox, G. Erika; Dyer, John R.; Boutlis, Craig S.; Lane, Amanda M.; Shaw, Matthew D.; Robson, Jennifer; Nissen, Michael D.
2007-01-01
Australia has 4 rickettsial diseases: murine typhus, Queensland tick typhus, Flinders Island spotted fever, and scrub typhus. We describe 7 cases of a rickettsiosis, with an acute onset and symptoms of fever (100%), headache (71%), arthralgia (43%), myalgia (43%), cough (43%), maculopapular/petechial rash (43%), nausea (29%), pharyngitis (29%), lymphadenopathy (29%), and eschar (29%). Cases were most prevalent in autumn and from eastern Australia, including Queensland, Tasmania, and South Australia. One patient had a history of tick bite (Haemaphysalis novaeguineae). An isolate shared 99.2%, 99.8%, 99.8%, 99.9%, and 100% homology with the 17 kDa, ompA, gltA, 16S rRNA, and Sca4 genes, respectively, of Rickettsia honei. This Australian rickettsiosis has similar symptoms to Flinders Island spotted fever, and the strain is genetically related to R. honei. It has been designated the “marmionii” strain of R. honei, in honor of Australian physician and scientist Barrie Marmion. PMID:17553271
'HERON' as a dark matter detector?
International Nuclear Information System (INIS)
Adams, J.S.; Bandler, S.R.; Brouer, S.M.; Enss, C.; Lanou, R.E.; Maris, H.J.; More, T.; Seidel, G.M.
1996-01-01
''HERON'', which is the acronym for '' Helium: Roton detection of Neutrinos'', is a project whose principal goal is a next generation detector of solar neutrinos from the p-p and 7 Be branches. It will utilize superfluid helium as the target material and employ event energy transport out of the target by phonon and roton processes unique to helium. Many of the challenges presented for dark matter detection are very similar to those for low energy solar neutrinos. We present new results from our feasibility studies for HERON which indicate an asymmetry in the roton emission distribution from stopping particles and the ability to detect simultaneously the ultraviolet fluorescence photons also emitted. These features are potentially valuable for solar neutrino detection and the question is explored as to whether or not the same helium technique could be valuable for WIMP dark matter detection
Multi-proxy monitoring approaches at Kangaroo Island, South Australia
Dixon, Bronwyn; Drysdale, Russell; Tyler, Jonathan; Goodwin, Ian
2017-04-01
Interpretations of geochemical signals preserved in young speleothems are greatly enhanced by comprehensive cave-site monitoring. In the light of this, a cave monitoring project is being conducted concurrently with the development of a new palaeoclimate record from Kelly Hill Cave (Kangaroo Island, South Australia). The site is strategically located because it is situated between longer-lived monitoring sites in southeastern and southwestern Australia, as well as being climatically 'upstream' from major population and agricultural centres. This study aims to understand possible controls on speleothem δ18O in Kelly Hill Cave through i. identification of local and regional δ18O drivers in precipitation; and ii. preservation and modification of climatic signals within the epikarst as indicated by dripwater δ18O. These aims are achieved through analysis of a five-year daily rainfall (amount and δ18O) dataset in conjunction with in-cave drip monitoring. Drivers of precipitation δ18O were identified through linear regression between δ18O values and local meteorological variables, air-parcel back trajectories, and synoptic-typing. Synoptically driven moisture sources were identified through the use of NCEP/NCAR climate reanalysis sea-level pressure, precipitable moisture, and outgoing longwave radiation data in order to trace moisture sources and travel mechanisms from surrounding ocean basins. Local controls on δ18O at Kelly Hill Cave are consistent with published interpretations of southern Australia sites, with oxygen isotopes primarily controlled by rainfall amount on both daily and monthly time scales. Back-trajectory analysis also supports previous observations that the Southern Ocean is the major source for moisture-bearing cold-front systems. However, synoptic typing of daily rainfall δ18O and amount extremes reveals a previously unreported tropical connection and moisture source. This tropical connection appears to be strongest in summer and autumn, but
The foraging behaviour of herons and egrets on the Magela Creek flood plain, Northern Territory
International Nuclear Information System (INIS)
Recher, H.F.; Holmes, R.T.
1982-03-01
Five species of diurnal herons are common on the Magela Creek flood plain and forage along the edges of natural and artifical waterbodies both inside and outside the Ranger Uranium Project Area. The species of heron differ in the kinds and sizes of prey they take, their foraging location, degree of sociality and foraging behaviour. Because it takes relatively large fish, the Great Egret, E. alba, is most likely to be affected by any contamination of the aquatic environment by heavy metals or radionuclides. The Nankeen Night Heron, Nycticorax caledonicus is also abundant on the flood plain and probably feeds on large fish and frogs. The other herons take smaller or immature prey or hunt mostly in terrestrial habitats and are therefore less likely to be affected by contamination of the aquatic environment
Legione, Alistair R; Amery-Gale, Jemima; Lynch, Michael; Haynes, Leesa; Gilkerson, James R; Sansom, Fiona M; Devlin, Joanne M
2016-04-28
We detected Chlamydia pecorum in two koalas ( Phascolarctos cinereus ) from a closed island population in Victoria, Australia, previously free of Chlamydia infection. The ompA and multilocus sequence type were most closely related to published isolates of livestock rather than koala origin, suggesting potential cross-species transmission of C. pecorum .
Ofwegen, van L.P.
2008-01-01
A collection of Sinularia specimens from Bremer and West Woody islands (Gulf of Carpentaria, Australia) is presented; thirteen different species were recognized, six of which are new to science and are described and figured: S. bremerensis, S. confusa, S. diffusa, S. linnei, S. papula and S.
DEFF Research Database (Denmark)
Graves, Gary R.
2015-01-01
I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid.......I observed black-crowned night-herons (Nycticorax nycticorax) swimming and kleptoparasitizing American coots (Fulica americana) at an artificial lake in Pinal County, Arizona. This appears to be the first record of interspecific kleptoparasitism by a swimming ardeid....
van der Schyff, V; Pieters, R; Bouwman, H
2016-06-01
Metal pollution issues are afforded the highest priority in developing countries. Only one previous study has addressed metals in African bird eggs. We determined the concentration of metals and metalloids in bird eggs from four sites in the Vaal River catchment (VRC) of South Africa to provide data on the current situation. We analysed 16 pools of 77 heron, ibis, darter, egret, and cormorant eggs for 18 metals and metalloids using ICP-MS. We found high concentrations of gold (Au), uranium (U), thallium (Tl), and platinum (Pt) in Grey Heron eggs from Baberspan. Great white egrets from Bloemhof Dam had high concentrations of mercury (Hg). Multivariate analyses revealed strong associations between Au and U, and between palladium (Pd) and Pt. The toxic reference value (TRV) for Hg was exceeded in seven pools. Selenium exceeded its TRV in one pool; in the same pool, copper (Cu) reached its TRV. Compared with other studies, VRC bird eggs had high concentrations of contaminants. Based on these high concentrations, human health might be at risk as Grey Herons and humans share similar food and are therefore exposed to the same contaminants.
Directory of Open Access Journals (Sweden)
Kathleen Hill
2017-10-01
Full Text Available Abstract Background Disparities in health status occur between people with differing socioeconomic status and disadvantaged groups usually have the highest risk exposure and the worst health outcome. We sought to examine the social disparities in the population prevalence of diabetes and in the development of treated end stage renal disease due to type 1 diabetes which has not previously been studied in Australia and New Zealand in isolation from type 2 diabetes. Methods This observational study examined the population prevalence of diabetes in a sample of the Australian population (7,434,492 using data from the National Diabetes Services Scheme and of treated end stage renal disease due to diabetes using data from the Australian and New Zealand Dialysis and Transplant Registry. The data were then correlated with the Australian Bureau of Statistics Socioeconomic Indexes for Areas for an examination of socioeconomic disparities. Results There is a social gradient in the prevalence of diabetes in Australia with disease incidence decreasing incrementally with increasing affluence (Spearman’s rho = .765 p < 0.001. There is a higher risk of developing end stage renal disease due to type 1 diabetes for males with low socioeconomic status (RR 1.20; CI 1.002–1.459 in comparison to females with low socioeconomic status. In Australia and New Zealand Aboriginal and Torres Strait Islanders, Maori and Pacific Islanders appear to have a low risk of end stage renal disease due to type 1 diabetes but continue to carry a vastly disproportionate burden of end stage renal disease due to type 2 diabetes (RR 6.57 CI 6.04–7.14 & 6.48 CI 6.02–6.97 respectively p < 0.001 in comparison to other Australian and New Zealanders. Conclusion Whilst low socioeconomic status is associated with a higher prevalence of diabetes the inverse social gradient seen in this study has not previously been reported. The social disparity seen in relation to treated end stage
Hill, Kathleen; Ward, Paul; Grace, Blair S; Gleadle, Jonathan
2017-10-11
Disparities in health status occur between people with differing socioeconomic status and disadvantaged groups usually have the highest risk exposure and the worst health outcome. We sought to examine the social disparities in the population prevalence of diabetes and in the development of treated end stage renal disease due to type 1 diabetes which has not previously been studied in Australia and New Zealand in isolation from type 2 diabetes. This observational study examined the population prevalence of diabetes in a sample of the Australian population (7,434,492) using data from the National Diabetes Services Scheme and of treated end stage renal disease due to diabetes using data from the Australian and New Zealand Dialysis and Transplant Registry. The data were then correlated with the Australian Bureau of Statistics Socioeconomic Indexes for Areas for an examination of socioeconomic disparities. There is a social gradient in the prevalence of diabetes in Australia with disease incidence decreasing incrementally with increasing affluence (Spearman's rho = .765 p < 0.001). There is a higher risk of developing end stage renal disease due to type 1 diabetes for males with low socioeconomic status (RR 1.20; CI 1.002-1.459) in comparison to females with low socioeconomic status. In Australia and New Zealand Aboriginal and Torres Strait Islanders, Maori and Pacific Islanders appear to have a low risk of end stage renal disease due to type 1 diabetes but continue to carry a vastly disproportionate burden of end stage renal disease due to type 2 diabetes (RR 6.57 CI 6.04-7.14 & 6.48 CI 6.02-6.97 respectively p < 0.001) in comparison to other Australian and New Zealanders. Whilst low socioeconomic status is associated with a higher prevalence of diabetes the inverse social gradient seen in this study has not previously been reported. The social disparity seen in relation to treated end stage renal disease due to type 2 diabetes for Aboriginal and Torres Strait
Inscribed polygons and Heron polynomials
International Nuclear Information System (INIS)
Varfolomeev, V V
2003-01-01
Heron's well-known formula expressing the area of a triangle in terms of the lengths of its sides is generalized in the following sense to polygons inscribed in a circle: it is proved that the area is an algebraic function of the lengths of the edges of the polygon. Similar results are proved for the diagonals and the radius of the circumscribed circle. The resulting algebraic equations are studied and elementary geometric applications of the algebraic results obtained are presented
Jones, M K; Beveridge, I
2001-09-01
Echinobothrium chisholmae n. sp. is described from Rhinobatos typus Bennett (Rhinobatidae), collected from Heron Island, Great Barrier Reef, Australia. E. chisholmae differs from all congeners in possessing 11 hooks in each dorsal and ventral group on the rostellum and groups of 3-6 hooklets on either side of the hooks. A single metacestode of E. chisholmae was collected from the decapod crustacean Penaeus longistylus Kubo. Yellow pigmentation of the cephalic peduncle in immature adults is caused by the accumulation of large vesicles in the distal cytoplasm of the tegument. The vesicles probably provide materials for spine formation. Ultrastructural examination of the rostellar musculature revealed that the muscles are stratified (striated-like), consisting of a periodic repetition of sarcomeres separated by perforated Z-like lines that are oblique to the long axes of the myofilaments.
Great Blue Herons in Puget Sound
2007-06-01
consolidation of the breeding population into relatively few, large reproductive centers. With the breeding population centralized, these colonies become...During nesting and reproduction , heron eggs and young fall prey to forest- associated raptors and other predators, further linking the complexity of...nests up to a meter wide and one-half meter deep. An adequate supply of nest material is also important; both deciduous and conifer twigs are utilized
Burger, J; Gochfeld, M
1993-09-01
Several species of herons and egrets frequently nest in colonies in areas where humans also concentrate. Since the birds feed on intermediate-sized fish that themselves concentrate pollutants, they can be used not only to assess the levels of contaminants in avian tissues but as indicators of contaminants in the environment. The concentration of heavy metals and selenium in the breast feathers of fledgling black-crowned night herons Nycticorax nycticorax and Chinese pond herons Ardeola bacchus from the Tu Jing Yan heronry outside Chengdu, Szechuan Province in China; and from fledgling black-crowned night heron, little egret Egretta garzetta, great egret Egretta alba and cattle egret Bubulcus ibis from the Mai Po heronry in Hong Kong, were determined. Breast feathers were also collected from adult great egrets in Hong Kong. Adult great egrets had significantly higher levels of all heavy metals than did young great egrets. There were no significant interspecific differences in metal levels among the young at Szechuan China, except for chromium (pond herons had higher levels). There were significant differences among the young nesting at Hong Kong for all metals examined. Great egrets had lower, and night herons had higher, levels of lead than the other young. Night herons also had the highest levels of cadmium, manganese, and selenium compared to the other young. Great egret chicks had the lowest mercury levels, while little egret had the highest levels. Lead levels for all the birds in both Hong Kong and Szechuan were among the highest in the world, and this was attributed to the continued use of leaded gasoline.
Lohr, Cheryl; Passeretto, Kellie; Lohr, Michael; Keighery, Greg
2015-12-01
Along the Pilbara coast of Western Australia (WA) there are approximately 598 islands with a total area of around 500 km(2). Budget limitations and logistical complexities mean the management of these islands tends to be opportunistic. Until now there has been no review of the establishment and impacts of weeds on Pilbara islands or any attempt to prioritise island weed management. In many instances only weed occurrence has been documented, creating a data deficient environment for management decision making. The purpose of this research was to develop a database of weed occurrences on WA islands and to create a prioritisation process that will generate a ranked list of island-weed combinations using currently available data. Here, we describe a model using the pairwise comparison formulae in the Analytical Hierarchy Process (AHP), four metrics describing the logistical difficulty of working on each island (island size, ruggedness, travel time, and tenure), and two well established measures of conservation value of an island (maximum representation and effective maximum rarity of eight features). We present the sensitivity of the island-weed rankings to changes in weights applied to each decision criteria using Kendall's tau statistics. We also present the top 20 ranked island-weed combinations for four modelling scenarios. Many conservation prioritisation tools exist. However, many of these tools require extrapolation to fill data gaps and require specific management objectives and dedicated budgets. To our knowledge, this study is one of a few attempts to prioritise conservation actions using data that are currently available in an environment where management may be opportunistic and spasmodic due to budgetary restrictions.
Hill, Elwood F.; Henry, Charles J.; Grove, Robert A.
2008-01-01
Mercury concentrations in the floodplain of the Carson River Basin in northwestern Nevada are some of the highest ever reported in a natural system. Thus, a portion of the basin including Lahontan Reservoir was placed on the U.S. Environmental Protection Agency’s Natural Priorities List for research and cleanup. Preliminary studies indicated that reproduction in piscivorous birds may be at risk. Therefore, a 10-year study (1997–2006) was conducted to evaluate reproduction of snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax) nesting on Gull Island in Lahontan Reservoir. Special attention was given to the annual flow of the Carson River, the resultant fluctuation of this irrigation reservoir, and the annual exposure of snowy egrets and night-herons to methylmercury (MeHg). The dynamic character of the river due to flooding and drought (drought effect) influenced snowy egret and night-heron reproduction more so than did MeHg contamination of eggs. During an extended drought (2000–2004) in the middle of the study, snowy egret nests containing eggs with concentrations of MeHg (measured as total mercury [THg] ∼ 100% MeHg) ≥0.80 μg THg/g, ww, all failed, but in 1997 and 2006 (wet years with general flooding), substantial numbers of young were produced (but fewer than at nests where eggs contained reproductive threshold of tolerance to MeHg may be associated with habitat quality (food type and abundance). Clearly, drought was the most important factor affecting snowy egret annual productivity. In contrast to snowy egrets, night-herons generally had fewer nests meeting the 0.80 μg THg/g criterion, and those above the criterion were less sensitive to mercury than were snowy egrets. Furthermore, night-herons appeared more tolerant of drought conditions than snowy egrets because they nested earlier, selected more protected nesting sites, and had a more generalist diet that provided additional food options including terrestrial
Hoverman, Suzanne; Ayre, Margaret
2012-12-01
SummaryIndigenous land owners of the Tiwi Islands, Northern Territory Australia have begun the first formal freshwater allocation planning process in Australia entirely within Indigenous lands and waterways. The process is managed by the Northern Territory government agency responsible for water planning, the Department of Natural Resources, Environment, The Arts and Sport, in partnership with the Tiwi Land Council, the principal representative body for Tiwi Islanders on matters of land and water management and governance. Participatory planning methods ('tools') were developed to facilitate community participation in Tiwi water planning. The tools, selected for their potential to generate involvement in the planning process needed both to incorporate Indigenous knowledge of water use and management and raise awareness in the Indigenous community of Western science and water resources management. In consultation with the water planner and Tiwi Land Council officers, the researchers selected four main tools to develop, trial and evaluate. Results demonstrate that the tools provided mechanisms which acknowledge traditional management systems, improve community engagement, and build confidence in the water planning process. The researchers found that participatory planning approaches supported Tiwi natural resource management institutions both in determining appropriate institutional arrangements and clarifying roles and responsibilities in the Islands' Water Management Strategy.
Thodis, Antonia; Itsiopoulos, Catherine; Kouris-Blazos, Antigone; Brazionis, Laima; Tyrovolas, Stefanos; Polychronopoulos, Evangelos; Panagiotakos, Demosthenes B
2018-02-01
To describe the study protocol of the MEDiterranean ISlands-Australia (MEDIS-Australia) Study modelled on the MEDIS Study conducted in Greece. The present study aims to explore adherence to the traditional Mediterranean diet pattern, determine enablers and barriers to adherence, explore the definition of Greek cuisine, and associations between adherence to the diet pattern and risk factors for cardiovascular disease (CVD) and metabolic syndrome in older Greek Australians originally from Greek islands and Cyprus. Now long-term immigrants, with at least 50 years in Australia, characteristics and risk factor profiles of older Greek islander-born Australians will be compared and contrasted to their counterparts living on Greek islands to evaluate the influence of migration on adherence. The present study is an observational study of cross-sectional design using a modified lifestyle and semi-quantitative food frequency questionnaire to capture sociodemographic, health, psychosocial and dietary characteristics, including cuisine, of 150 older Greek islander-born Australians. Anthropometric measures and medical history will be collected. Participants will be aged over 65 years, live independently, are originally from a Greek island and are free from CVD. Data collection is underway. Characteristics and behaviours associated with adherence, if identified, could be evaluated in future studies. For example, exploration of enablers or barriers to adherence to a Mediterranean dietary pattern in an Australian population. © 2017 Dietitians Association of Australia.
Energy Technology Data Exchange (ETDEWEB)
Tiller, Brett L.; Marco, Jeffrey D.; Rickard, William H.
2005-05-01
Excrement sample and livers of juvenile great blue herons were collected at nests at three widely separated colonies along the Hanford Reach of the Columbia River to test the validity of using excrement samples as indicators of metal concentrations in tissues of juvenile herons fed food collected by parent birds within a few kilometers of nests. There was no positive relation noted between metal concentrations in excrement and liver samples taken from the same nests. Statistically significant differences in metal concentrations were noted in excrement samples collected among the different heron colonies. Arsenic, Cd, Cr, and Pb concentrations (dry wt.) were higher in excrement than in liver samples but the opposite was noted for Cu, Hg, and Zn. Mercury concentrations in heron liver samples were biomagnified to a greater extent than Cd and Cr. Fledging success and eggshell thickness measurements were used as indicators of population health. These values were equivalent to or better than those noted for heron colonies elsewhere in the United States.
Chondrosarcoma in a wild great white heron from southern Florida.
Spalding, M G; Woodard, J C
1992-01-01
A typical chondrosarcoma is reported from the nictitating membrane of a great white heron (Ardea herodius occidentalis). This is the first report of a neoplasm in a free flying ciconiiform, and was the only one found in a survey of 957 carcasses from Florida.
Lichen Monitoring Delineates Biodiversity on a Great Barrier Reef Coral Cay
Directory of Open Access Journals (Sweden)
Paul C. Rogers
2015-05-01
Full Text Available Coral islands around the world are threatened by changing climates. Rising seas, drought, and increased tropical storms are already impacting island ecosystems. We aim to better understand lichen community ecology of coral island forests. We used an epiphytic lichen community survey to gauge Pisonia (Pisonia grandis R.BR., which dominates forest conditions on Heron Island, Australia. Nine survey plots were sampled for lichen species presence and abundance, all tree diameters and species, GPS location, distance to forest-beach edge, and dominant forest type. Results found only six unique lichens and two lichen associates. A Multi-Response Permutation Procedures (MRPP test found statistically distinct lichen communities among forest types. The greatest group differences were between interior Pisonia and perimeter forest types. Ordinations were performed to further understand causes for distinctions in lichen communities. Significant explanatory gradients were distance to forest edge, tree density (shading, and Pisonia basal area. Each of these variables was negatively correlated with lichen diversity and abundance, suggesting that interior, successionally advanced, Pisonia forests support fewer lichens. Island edge and presumably younger forests—often those with greater tree diversity and sunlight penetration—supported the highest lichen diversity. Heron Island’s Pisonia-dominated forests support low lichen diversity which mirrors overall biodiversity patterns. Lichen biomonitoring may provide a valuable indicator for assessing island ecosystems for conservation purposes regionally.
Short Note Brood parasitism in the Green-backed Heron ( Butorides ...
African Journals Online (AJOL)
Short Note Brood parasitism in the Green-backed Heron (Butorides striatus). R Yosef, P Zduniak. Abstract. Ostrich 2005, 76(1&2): 78–79. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.2989/00306520509485476 · AJOL African Journals Online.
Watson, Jennifer; Obersteller, Elizabeth A.; Rennie, Linda; Whitbread, Cherie
2001-01-01
Participatory research in Australia's Northern Territory sought opinions from nurses, general practitioners, Aboriginal health workers, and Aboriginal and Torres Strait Islanders on the development of culturally relevant foot care education for Indigenous people with diabetes. They decided to use a visual approach (posters and flip charts) to…
Perennial growth of hermatypic corals at Rottnest Island, Western Australia (32°S
Directory of Open Access Journals (Sweden)
Claire L. Ross
2015-02-01
Full Text Available To assess the viability of high latitude environments as coral refugia, we report measurements of seasonal changes in seawater parameters (temperature, light, and carbonate chemistry together with calcification rates for two coral species, Acropora yongei and Pocillopora damicornis from the southernmost geographical limit of these species at Salmon Bay, Rottnest Island (32°S in Western Australia. Changes in buoyant weight were normalised to colony surface areas as determined from both X-ray computed tomography and geometric estimation. Extension rates for A. yongei averaged 51 ± 4 mm y−1 and were comparable to rates reported for Acroporid coral at other tropical and high latitude locations. Mean rates of calcification for both A. yongei and P. damicornis in winter were comparable to both the preceding and following summers despite a mean seasonal temperature range of ∼6 °C (18.2°–24.3 °C and more than two-fold changes in the intensity of downwelling light. Seasonal calcification rates for A. yongei (1.31–2.02 mg CaCO3 cm−2 d−1 and P. damicornis (0.34–0.90 mg CaCO3 cm−2 d−1 at Salmon Bay, Rottnest Island were comparable to rates from similar taxa in more tropical environments; however, they appeared to decline sharply once summer temperatures exceeded 23 °C. A coral bleaching event observed in December 2013 provided further evidence of how coral at Rottnest Island are still vulnerable to the deleterious effects of episodic warming despite its high latitude location. Thus, while corals at Rottnest Island can sustain robust year-round rates of coral growth, even over cool winter temperatures of 18°–19 °C, there may be limits on the extent that such environments can provide refuge against the longer term impacts of anthropogenic climate change.
Decolonizing through integration: Australia's off-shore island territories
Directory of Open Access Journals (Sweden)
Roger Wettenhall
2016-11-01
Full Text Available Australia’s three small off-shore island territories – Norfolk Island in the Pacific Ocean and Christmas Island and the Cocos (Keeling Islands Group in the Indian Ocean – can be seen as monuments to 19th century British-style colonization, though their early paths to development took very different courses. Their transition to the status of external territories of the Australian Commonwealth in the 20th century – early in the case of Norfolk and later in the cases of Christmas and Cocos – put them on a common path in which serious tensions emerged between local populations which sought autonomous governance and the Commonwealth government which wanted to impose governmental systems similar to those applying to mainstream Australians. This article explores the issues involved, and seeks to relate the governmental history of the three island territories to the exploration of island jurisdictions developed in island studies research.
Results of bald eagle, osprey and great blue heron nest site surveys near Fort MacKay, Alberta
International Nuclear Information System (INIS)
Strom, K.; Balagus, P.
1996-01-01
As part of the environmental impact assessment process, a study was conducted to assess the occurrence of bald eagle, osprey and great blue heron on Syncrude's proposed oil sand leases near Fort MacKay. The objective of the study was to determine the relative abundance, habitat preferences and nesting occurrences of these different birds. Aerial count surveys were conducted to include coverage of the shorelines of four rivers and 22 lakes. Breeding activities of the osprey, bald eagle and great blue heron were observed in the regional study area, but not in the local study area. 14 refs., 1 tab., 4 figs
Gleeson, Ricky; Adlard, Robert
2011-10-01
Three new species of Ceratomyxa Thélohan, 1892 are described from the gall-bladders of two species of carcharhinid sharks collected off Heron and Lizard Islands on the Great Barrier Reef, Australia. Ceratomyxa carcharhini n. sp. and C. melanopteri n. sp. are described from Carcharhinus melanopterus (Quoy & Gaimard), and Ceratomyxa negaprioni n. sp. is described from Negaprion acutidens (Rüppell). These species are the first ceratomyxids reported from Australian elasmobranchs, and this is the first paper to formally characterise a novel Ceratomyxa species from an elasmobranch using both morphology and small subunit ribosomal DNA sequence data. Maximum parsimony and Bayesian inference analyses of the SSU rDNA dataset revealed that ceratomyxids from elasmobranchs form a sister clade to that of species infecting marine teleosts and Palliatus indecorus Schulman, Kovaleva & Dubina, 1979. Furthermore, the only sequenced freshwater ceratomyxid, Ceratomyxa shasta Noble, 1950, fell outside the overall marine ceratomyxid clade. These data show that Ceratomyxa, as currently recognised, is polyphyletic and ignites discussion on whether Ceratomyxa should be split. However, further taxon sampling, particularly in freshwater systems, is required to establish relevant biological divisions within the genus.
Wilson, Scott P; Verlis, Krista M
2017-04-15
Marine debris is one of the most significant issues facing oceans worldwide. The sources of this debris vary depending on proximity to urban centres and the nature of activities within an area. This paper examines the influence of tourism in the southern Great Barrier Reef (GBR), and its contribution to litter levels in the region. By conducting beach debris surveys on occupied and unoccupied islands, this study found that debris was prevalent throughout the region with significant differences in material types between locations. The greatest source of debris from publically accessible islands was tourist-related, with this source also influencing debris loads on nearby uninhabited islands. A focus on debris at Heron Island, showed that sites close to amenities had greater levels of tourist-sourced items like cigarette butts. These findings indicate the contribution of tourists to this problem and that working with operators and managers is needed to minimise visitor impacts. Copyright © 2017 Elsevier Ltd. All rights reserved.
Children of South Sea Island immigrants to Australia: factors associated with adjustment problems.
Kahn, M W; Fua, C
1995-01-01
Social-delinquent problem youth of South Sea Island immigrant to Australia parents, were compared to non-problem youth from the same circumstances, on family, sociocultural, personality, and substance abuse variables. Interviews and testing were done by members of their own community. A consistent pattern of differences most pronounced for males was found between the two groups although not all reached statistical significance. The problem youth compared to the non-problem youth tended to come from families somewhat lower in socioeconomic level, somewhat less traditional in culture, and notably more prone to discipline by physical punishment than by verbal reasoning. The problem youth had significantly lower self-esteem, significantly higher maladjustment test scores, and significantly greater use and problems with alcohol and drugs. They were more alienated and had less clearly established direction for their future. Recommendations for remediation are considered.
Golden, N.H.; Rattner, B.A.; Cohen, J.B.; Hoffman, D.J.; Russek-Cohen, E.; Ottinger, M.A.
2003-01-01
Although lead can attain high concentrations in feathers, interpretation of the biological significance of this phenomenon is difficult. As part of an effort to develop and validate non-invasive methods to monitor contaminant exposure in free-ranging birds, lead uptake by feathers of nestling black-crowned night-herons (Nycticorax nycticorax) was evaluated in a controlled exposure study. Four to six day-old heron nestlings (one/nest) at Chincoteague Bay, Virginia, received a single intraperitoneal injection of dosing vehicle (control; n=7) or a dose of lead nitrate in water (0.01, 0.05, or 0.25 mg Pb/g body weight of nestling; n=6 or 7/dose) chosen to yield feather lead concentrations found at low to moderately polluted sites. Nestlings were euthanized at 15 days of age. Lead accumulation in feathers was associated with concentrations in bone, kidney, and liver (r = 0.32 - 0.74, p feather lead concentration. Culmen growth rate was depressed in nestlings treated with the highest dose of lead, but not correlated with feather lead concentration. These findings provide evidence that feathers of nestling herons are a sensitive indicator of lead exposure and have potential application for the extrapolation of lead concentrations in other tissues and the estimation of environmental lead exposure in birds.
Golden, Nancy H; Rattner, Barnett A; Cohen, Jonathan B; Hoffman, David J; Russek-Cohen, Estelle; Ottinger, Mary Ann
2003-07-01
Although lead can attain high concentrations in feathers, interpretation of the biological significance of this phenomenon is difficult. As part of an effort to develop and validate noninvasive methods to monitor contaminant exposure in free-ranging birds, lead uptake by feathers of nestling black-crowned night herons (Nycticorax nycticorax) was evaluated in a controlled exposure study. Four- to 6-d-old heron nestlings (one/nest) at Chincoteague Bay, Virginia (USA), received a single intraperitoneal injection of dosing vehicle (control, n = 7) or a dose of lead nitrate in water (0.01, 0.05, or 0.25 mg Pb/g body wt of nestling; n = 6 or 7/dose) chosen to yield feather lead concentrations found at low- to moderately polluted sites. Nestlings were euthanized at 15 d of age. Lead accumulation in feathers was associated with concentrations in bone, kidney, and liver (r = 0.32-0.74, p feather lead concentration. Culmen growth rate was depressed in nestlings treated with the highest dose of lead but not correlated with feather lead concentration. These findings provide evidence that feathers of nestling herons are a sensitive indicator of lead exposure and have potential application for the extrapolation of lead concentrations in other tissues and the estimation of environmental lead exposure in birds.
International Nuclear Information System (INIS)
Barata, C.; Fabregat, M.C.; Cotin, J.; Huertas, D.; Sole, M.; Quiros, L.; Sanpera, C.; Jover, L.; Ruiz, X.; Grimalt, J.O.; Pina, B.
2010-01-01
Blood biomarkers and levels of major pollutants in eggs and feathers were used to determine pollution effects in nestlings of the Purple Heron Ardea purpurea and the Little Egret Egretta garzetta, sampled on three Ebro River (NE Spain) areas: a reference site, a site affected by the effluents of a chlor-alkali industry and the river Delta. The two impacted heron populations showed mutually different pollutant and response patterns, suggesting different sources of contamination. In the population nesting near the chlor-alkali plant, elevated levels of hexachlorobenzene (HCB) and polychlorobiphenyls (PCBs) in eggs, and mercury in feathers in A. purpurea chicks were related with reduced blood antioxidant defenses and increased levels of micronuclei. In Ebro Delta, high levels of plasmatic lactate dehydrogenase in A. purpurea chicks and high frequency of micronuclei in blood of both species were tentatively associated with intensive agricultural activities taking place in the area. These results provide the first evidence of a biological response in heron chicks to the release of pollutants at a chlor-alkali plant. - High levels of organochlorine and mercury levels in eggs and feathers were related with altered blood biomarkers of heron nesting chicks.
Directory of Open Access Journals (Sweden)
Rebecca Ritte
2017-04-01
This is the first time that the VPDC and RBDM birth data were linked in Victoria. The matched birth information established a more complete population profile of Aboriginal and/or Torres Strait Islander births. These data will provide a more accurate baseline to enhance the Victorian and Australian governments’ ability to plan services, allocate resources and evaluate funded activities aimed at eliminating disparity experienced by Aboriginal and/or Torres Strait Islander peoples. Importantly, it has established a more accurate denominator from which to calculate Aboriginal infant mortality rates for Victoria, Australia. *Until 2009, the mother’s Indigenous identification only was recorded in the VPDC
Directory of Open Access Journals (Sweden)
M. V. Vovk
2005-01-01
Full Text Available The article is devoted to the research of the settlements of heron on the accumulation of heavy metals in the soil. The author considers accumulation of trace elements in different soil horizons. The reasons of the prohibitions has been rate.
Host-guest interaction on Bruny and Magnetic Islands, Australia
Moyle, Brent Don
2017-01-01
Islands are integral to the earth’s biodiversity, with their distinct environments offering a haven for a variety of threatened species of plants, wildlife and unique human cultures. Worldwide, tourism activity profoundly impacts upon destinations, but the impacts on islands are noticeably more acute due to their fragile environments and isolated communities. Research has found that tourism can impact island communities in a variety of ways, including economically, socially and environmentall...
Iveson, J B; Shellam, G R; Bradshaw, S D; Smith, D W; Mackenzie, J S; Mofflin, R G
2009-06-01
Salmonella infections in Antarctic wildlife were first reported in 1970 and in a search for evidence linking isolations with exposure to human activities, a comparison was made of serovars reported from marine fauna in the Antarctic region from 1982-2004 with those from marine mammals in the Northern hemisphere. This revealed that 10 (83%) Salmonella enterica serovars isolated from Antarctic penguins and seals were classifiable in high-frequency (HF) quotients for serovars prevalent in humans and domesticated animals. In Australia, 16 (90%) HF serovars were isolated from marine birds and mammals compared with 12 (86%) HF serovars reported from marine mammals in the Northern hemisphere. In Western Australia, HF serovars from marine species were also recorded in humans, livestock, mussels, effluents and island populations of wildlife in urban coastal areas. Low-frequency S. enterica serovars were rarely detected in humans and not detected in seagulls or marine species. The isolation of S. Enteritidis phage type 4 (PT4), PT8 and PT23 strains from Adélie penguins and a diversity of HF serovars reported from marine fauna in the Antarctic region and coastal areas of Australia, signal the possibility of transient serovars and endemic Salmonella strains recycling back to humans from southern latitudes in marine foodstuffs and feed ingredients.
Golden, N.H.; Rattner, B.A.; Cohen, J.B.; Hoffman, D.J.; Ottinger, M.A.
2000-01-01
Lead is a known environmental toxicant, and poisoning resulting from the ingestion of lead shot has been well-documented in many species of waterfowl. However, much less is known regarding exposure and effects of free environmental lead in species of birds other than waterfowl. In an attempt to evaluate toxicity of lead to herons and to determine the usefulness of feathers as a non-invasive exposure-monitoring tool, black-crowned night-heron nestlings were dosed with lead to determine its distribution among tissues, and its effects on biochemical biomarkers, growth, and survival. Five-day-old heron nestlings (one per nest) at Chincoteague Bay, Virginia were given a single intra-peritoneal injection of dosing vehicle (control; N=7) or one of three lead solutions (as lead nitrate) (10, 50, or 250 mg/kg body weight of nestling; N=7 per dose) chosen to represent levels below, at, and above those found in moderately-polluted environments. All nestlings treated with lead exhibited dose-dependent inhibition of delta-aminolevulinic acid dehydratase (ALAD) activity compared to controls, and nestlings treated with the highest concentration showed a reduced carcass weight compared to controls. Of several measures of oxidative stress that were analyzed, significant differences were found between low- and high-dosed nestlings in hepatic total thiol and protein-bound sulfhydryl concentrations. No differences in survival were detected between dosed nestlings, controls, or uninjected siblings. Lead concentrations in several matrices, including feathers, are being determined to assess distribution among tissues and will also be examined for relationships with measures of effect.
Custer, Thomas W.; Golden, Nancy H.; Rattner, Barnett A.
2008-01-01
The pattern of elements in nestling black-crowned night-heron feathers from a rural Minnesota colony differed from colonies in industrialized regions of Maryland and Delaware. Except for chromium, however, the differences did not reflect the elements associated with waters and sediments of the Maryland and Delaware colonies. Therefore, elements in water and sediment do not necessarily bioaccumulate in night-heron feathers in relation to potential exposure. Although trace element patterns in feathers indicated differences among geographical locations, they did not separate all locations well and their usefulness as an indicator of natal colony location may be limited.
Coetzee, Maryke L; Smit, Nico J; Grutter, Alexandra S; Davies, Angela J
2008-06-01
Third-stage juveniles (praniza 3) of Gnathia grandilaris n. sp. were collected from the gill filaments and septa of 5 requiem sharks, including a white tip reef shark, Triaenodon obesus, and 4 grey reef sharks, Carcharhinus amblyrhynchos, at Lizard Island, Great Barrier Reef, Australia, in March 2002. Some juvenile gnathiids were then maintained in fresh sea water until they molted to adults. Adult males appeared 19 days following detachment of juveniles from host fishes, but no juveniles molted successfully into females. The current description is based, therefore, on bright field and scanning electron microscopy observations of adult males and third-stage juveniles. Unique features of the male include the triangular-shaped inferior medio-frontal process, 2 areolae on the dorsal surface of the pylopod, and a slender pleotelson (twice as long as wide) with lateral concavities. The third-stage juvenile has distinctive white pigmentation on the black pereon when alive, while the mandible has 9 triangular backwardly directed teeth. This species has the largest male and third-stage juvenile of any Gnathia spp. from Australia and of any gnathiid isopods associated with elasmobranchs.
van Riper, Carena J.; Kyle, Gerard T.; Sutton, Stephen G.; Barnes, Melinda; Sherrouse, Benson C.
2012-01-01
Coastal ecosystems are increasingly faced with human impacts. To better understand these changing conditions, biophysical and economic values of nature have been used to prioritize spatial planning efforts and ecosystem-based management of human activities. Less is known, however, about how to characterize and represent non-material values in decision-making. We collected on-site and mailback survey data (n = 209), and analyzed these data using the Social Values for Ecosystem Services (SolVES) GIS application to incorporate measures of social value and natural resource conditions on Hinchinbrook Island National Park, Australia. Our objectives in this paper are to: 1) determine the spatial distribution and point density of social values for ecosystem services; 2) examine the relationship between social values and natural resource conditions; and 3) compare social value allocations between two subgroups of outdoor recreationists. Results suggest that high priority areas exist on Hinchinbrook's land and seascapes according to the multiple values assigned to places by outdoor recreationists engaged in consumptive (e.g., fishing) and non-consumptive (e.g., hiking) activities. We examine statistically significant spatial clustering across two subgroups of the survey population for three value types that reflect Recreation, Biological Diversity, and Aesthetic qualities. The relationship between the relative importance of social values for ecosystem services and spatially-defined ecological data is explored to guide management decision-making in the context of an island national park setting.
National Aboriginal and Torres Strait Islander Education Strategy 2015
Education Council, 2015
2015-01-01
Despite determined effort much more needs to be done to close the gap in Aboriginal and Torres Strait Islander education outcomes. Aboriginal and Torres Strait Islander people are the first Australians with the oldest continuing cultures in human history. Governments across Australia affirm the right of Aboriginal and Torres Islander people to…
Third Culture Kid's Effect on Character of Cady Heron in Mean Girls
Hapsari, Laily
2017-01-01
This thesis focuses on the movie, Mean Girls, specifically one of the character, Cady Heron,as a Third Culture Kid trying to adapt in new society. The purpose of this study is to understand the effect of Third Culture Kid in the movie character in socializing with the new surroundings and explain the way how one of the characters in Mean Girls adapts to the new surroundings.The writer uses library research to collect the data with the novel as the main data, and several relevant books, journa...
Prey diversity for Three Species Herons in Pulau Dua Nature Reserve Serang Distrik, Banten Province
Directory of Open Access Journals (Sweden)
DEWI ELFIDASARI
2006-10-01
Full Text Available The diversity of prey consumed by three species herons (Casmerodius albus, Egretta garzetta and Bubulcus ibis was studied in Pulau Dua Nature Reserve Serang, Banten Province using video tapes by following a focal individual for five minutes. In the laboratory the film was analysed every minutes to select complete sequences of feeding behavior in foraging site. There were differences on diversity and size of prey that consumed by three species herons among the different feeding locations. Casmerodius albus which was feeding on mudflat and fisheries consumed Chanos chanos (15.6%, Oreochromis sp (9.4% and Periophtalmus sp. (7.3%, and 36.5% couldn’t be identified. Egretta garzetta was feeding on mudflat, fisheries and rice-field, consumed Periophtalmus sp (15.4%, Mugil dussumeieri (7.9%, Chanos chanos (4.7%, Oreochromis sp (0.5%, including small frog and crustacean (0.5%. Bubulcus ibis was feeding on rice-field and grassland, consumed many variety of insects (92 % and many variety of snail (1.9% in their diet. The insects that B. ibis consumed including grasshopper (26.8%, caterpillar (0.9% and other invertebrates (worm, crustacean that could not be identified (64.3%.
Barata, C; Fabregat, M C; Cotín, J; Huertas, D; Solé, M; Quirós, L; Sanpera, C; Jover, L; Ruiz, X; Grimalt, J O; Piña, B
2010-03-01
Blood biomarkers and levels of major pollutants in eggs and feathers were used to determine pollution effects in nestlings of the Purple Heron Ardea purpurea and the Little Egret Egretta garzetta, sampled on three Ebro River (NE Spain) areas: a reference site, a site affected by the effluents of a chlor-alkali industry and the river Delta. The two impacted heron populations showed mutually different pollutant and response patterns, suggesting different sources of contamination. In the population nesting near the chlor-alkali plant, elevated levels of hexachlorobenzene (HCB) and polychlorobiphenyls (PCBs) in eggs, and mercury in feathers in A. purpurea chicks were related with reduced blood antioxidant defenses and increased levels of micronuclei. In Ebro Delta, high levels of plasmatic lactate dehydrogenase in A. purpurea chicks and high frequency of micronuclei in blood of both species were tentatively associated with intensive agricultural activities taking place in the area. These results provide the first evidence of a biological response in heron chicks to the release of pollutants at a chlor-alkali plant. Copyright (c) 2009 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Patterson, H.M.; Swearer, S.E.
2008-01-01
Yellowtail kingfish, Seriola lalandi (Family Carangidae), sustain important commercial and recreational fisheries in New South Wales (NSW), Australia. However, little is known about their population structure, particularly whether the kingfish around Lord Howe Island (LHI) comprise a distinct stock, separate from that of the NSW stock. We examined the otolith chemistry from juvenile kingfish collected from LHI, several NSW sites and Elizabeth and Middleton reefs (EMR) and compared those elemental signatures to the juvenile portion of adult otoliths collected from LHI to determine where the adults may have originated. Our results indicate a robust separation in otolith signatures from different locations (error rate of classification ranged from 3.5% to 9.9%), and suggest that a significant proportion of the adult kingfish sampled (28%) may have originated in the waters around LHI or nearby EMR. Further research may indicate that the management of kingfish in NSW waters could benefit from a more spatially explicit strategy. (author). 32 refs., 3 figs., 2 tabs.
International Nuclear Information System (INIS)
MacIntosh, D.L.
1992-09-01
This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models
Energy Technology Data Exchange (ETDEWEB)
MacIntosh, D.L. (Indiana Univ., Bloomington, IN (United States). School of Public and Environmental Affairs); Suter, G.W. II; Hoffman, F.O. (Oak Ridge National Lab., TN (United States))
1992-09-01
This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models.
Piper (Piperaceae) in the Philippine Islands: the climbing species
Gardner, R.O.
2006-01-01
Piper in the Philippine Islands is reviewed. Fifteen climbing species are recognized (many fewer than in previous treatments) and distinguished in a key. Most are widely distributed through Malesia, with ranges that end eastwards in the Solomon Islands or Australia. Piper myrmecophilum, the only
International Nuclear Information System (INIS)
Lewis, S.E.; Brodie, J.E.; McCulloch, M.T.; Mallela, J.; Jupiter, S.D.; Stuart Williams, H.; Lough, J.M.; Matson, E.G.
2012-01-01
Coral cores were collected along an environmental and water quality gradient through the Whitsunday Island group, Great Barrier Reef (Australia), for trace element and stable isotope analysis. The primary aim of the study was to examine if this gradient could be detected in coral records and, if so, whether the gradient has changed over time with changing land use in the adjacent river catchments. Y/Ca was the trace element ratio which varied spatially across the gradient, with concentrations progressively decreasing away from the river mouths. The Ba/Ca and Y/Ca ratios were the only indicators of change in the gradient through time, increasing shortly after European settlement. The Mn/Ca ratio responded to local disturbance related to the construction of tourism infrastructure. Nitrogen isotope ratios showed no apparent trend over time. This study highlights the importance of site selection when using coral records to record regional environmental signals.
Esteban Fernandez-Juricic; Patrick A. Zollner; Cherie LeBlanc Fisher; Lynne M. Westphal
2007-01-01
We assessed the effects of the presence and the frequency of canoe and pedestrian disturbance during two breeding seasons on multiple behavioral responses (scanning, freezing, grooming, sleeping, moving, wing-raising, and standing-up) of Black-crowned Night Heron ( Nycticorax nycticorax ) nestlings in a breeding colony in southeast Chicago. Short-...
International Nuclear Information System (INIS)
Harris, M.L.; Elliott, J.E.; Butler, R.W.; Wilson, L.K.
2003-01-01
Human disturbance and loss of nesting habitat were more important factors than chlorinated hydrocarbons in changing heron reproductive success. - Over the period 1977-2000, eggs of Pacific great blue heron (Ardea herodias fannini) were collected from 23 colonies along the southern coast of British Columbia, Canada, and analyzed for persistent organochlorine (OC) pesticides and polychlorinated biphenyls (PCBs). Concentrations of OC pesticides in eggs declined sharply in the late 1970s, after which there were minimal changes. The sums of PCB congeners were not reduced appreciably during the 1980s and 1990s, but Aroclor 1260 concentrations suggested a sharp decline in PCB contamination of eggs in the late 1970s, similar to that shown for OC pesticides. Eggs collected along or near the Fraser River delta showed higher levels of most pesticides compared to other monitored colonies. Although the delta lands support a long-standing agricultural economy, the primary factors influencing OC levels in the delta colonies were thought to be driven by estuarine processes. We suggest two possible influencing factors were: 1) a greater rate of bioaccumulation in the estuary due to the deposition of particulates collected over a vast area encompassed by the Fraser River watershed; or 2) a higher rate of biomagnification in the estuary due to species differences at lower trophic levels of the heron food chain. Eggs from urban colonies contained higher levels of PCBs. The congener pattern was not clearly different from that observed in less contaminated eggs from rural and pulp mill-influenced colonies, except that colonies in Vancouver had greater proportions of PCB-66, suggesting a local source of Aroclor 1242. Productivity in the coastal heron colonies was highly variable over the period of study, with 71% of recorded colony-wide reproductive failures occurring in colonies near pulp mills. However, the predominant factors influencing reproductive success were probably disturbance
The Population Origins and Expansion of Feral Cats in Australia
Yurchenko, Andrey A.; David, Victor A.; Scott, Rachael; Koepfli, Klaus-Peter; Driscoll, Carlos; O’Brien, Stephen J.; Menotti-Raymond, Marilyn
2016-01-01
The historical literature suggests that in Australia, the domestic cat (Felis catus) had a European origin [~200 years before present (ybp)], but it is unclear if cats arrived from across the Asian land bridge contemporaneously with the dingo (4000 ybp), or perhaps immigrated ~40000 ybp in association with Aboriginal settlement from Asia. The origin of cats in Australia is important because the continent has a complex and ancient faunal assemblage that is dominated by endemic rodents and marsupials and lacks the large placental carnivores found on other large continents. Cats are now ubiquitous across the entire Australian continent and have been implicit in the range contraction or extinction of its small to medium sized (cats using 15 short tandem repeat (STR) genomic markers. Their origin appears to come exclusively from European founders. Feral cats in continental Australia exhibit high genetic diversity in comparison with the low diversity found in populations of feral cats living on islands. The genetic structure is consistent with a rapid westerly expansion from eastern Australia and a limited expansion in coastal Western Australia. Australian cats show modest if any population structure and a close genetic alignment with European feral cats as compared to cats from Asia, the Christmas and Cocos (Keeling) Islands (Indian Ocean), and European wildcats (F. silvestris silvestris). PMID:26647063
Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia from the Pacific
Directory of Open Access Journals (Sweden)
James Reimer
2012-11-01
Full Text Available The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, N. uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and N. caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, N. tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific.
Two new species of Neozoanthus (Cnidaria, Hexacorallia, Zoantharia) from the Pacific
Reimer, James Davis; Irei, Yuka; Fujii, Takuma
2012-01-01
Abstract The zoanthid genus Neozoanthus was originally described in 1972 from a single species in Madagascar. This monotypic genus was placed within its own family, Neozoanthidae, given its unusual characters of only partial sand encrustation, and an endodermal sphincter muscle combined with a brachycnemic mesenterial arrangement. Recently, undescribed specimens of Neozoanthus were discovered thousands of kilometers away in both Australia and Japan. While the phylogenetic and evolutionary aspects of Neozoanthus spp. are now somewhat well understood, the new specimens remained undescribed. Here we describe the specimens as two new species, Neozoanthus uchina sp. n. from the Middle Ryukyu Islands of southern Japan, and Neozoanthus caleyi sp. n. from the waters around Heron Island, on the Great Barrier Reef in Australia. Both species can be distinguished from each other and the type species, Neozoanthus tulearensis, by their distributions, oral disk colors, and average numbers of tentacles. Additionally, each species appears to have subtle differences in their cnidae. The division of Japanese and Australian specimens into two species is strongly supported by recently reported phylogenetic data. The discovery and description of these two species highlights how little is known of zoanthid species diversity in the Indo-Pacific. PMID:23275752
The Quarantine Protection of Sub-Antarctic Australia: Two Islands, Two Regimes
Directory of Open Access Journals (Sweden)
Sandra Potter
2007-11-01
Full Text Available Sub-Antarctic Heard Island and Macquarie Island are among Australia’s offshore properties susceptible to colonization by species introduced by humans. While both islands share World Heritage status and are IUCN Category Ia Protected Areas (Strict Nature Reserves, different quarantine protection regimes are in operation. Macquarie Island’s biosecurity appears to be less catered for while the means and likelihood of introductions are greater. The administrative, political, practical and geographical contexts within which quarantine management planning takes place variously impact on the level of quarantine protection provided to both islands. These and other remote sites of high conservation value are unlikely to receive heightened protection until the issues associated with such management contexts receive greater attention.
Response of roseate tern to a shoreline protection project on Falkner Island, Connecticut
Rogers, C.J.; Spendelow, J.A.; Guilfoyle, Michael P.; Fischer, Richard A.; Pashley, David N.; Lott, Casey A.
2007-01-01
subterranean channels, especially in the main revetment area, made it difficult to measure chick growth and productivity as had been done for more than 12 years prior to construction. Also, observations of color-banded adults that were unable to locate and feed their young inside the main revetment, and of adults returning to courtship behavior and renesting after having hatched chicks from their initial clutches, indicated that a minimum of 20% of the chicks (mostly first hatched A-chicks, which usually have high rates of survival to fledging) that entered the main revetment died after doing so in 2001. The mortality rate of Roseate Tern chicks that entered the secondary revetment on the southwest shelf, however, was not unusually high in 2001. In an attempt to reduce the likelihood of nesting and chick losses in these sub-colonies, a research team led by the USGS in 2002-2003 did not put nest boxes on the northeast and east shelf areas where previous losses had been high. However, losses of tern eggs and young chicks to predatory Black-crowned Night Herons (Nycticorax nycticorax) were so great in 2002?2003 that few Roseate Tern chicks survived long enough to move into the main revetment area and little comparative survival data were collected. The USFWS continues to remove predatory night herons, to monitor the location and success of nesting Roseate Terns and to fill in some of problem areas near the tern nests in the main revetment. The extensive chick-searching fieldwork and observational procedures used by the USGS-led research team to determine the growth and survival of the Roseate Tern chicks at Falkner Island were not used in 2004?2005. The number of chicks lost in the revetment during these years is not known. Without additional fill, loss of chicks of this endangered species in the main revetment may rise again even though the night heron predation problem has been reduced.
McNamara, M K A; Adlard, R D; Bray, R A; Sasal, P; Cribb, T H
2012-06-01
Species richness and biogeography of the monorchiid genus Hurleytrematoides was studied by the examination of 2834 individuals of 45 species of Chaetodontidae at six major sites in the tropical Indo-West Pacific: Heron Island, Lizard Island, Ningaloo (Western Australia), Palau, New Caledonia and Moorea (French Polynesia). In total, 18 species were distributed among six sites; descriptions are provided for eight new species: H. boucheti n. sp., H. combesi n. sp., H. deblocki n. sp., H. dollfusi n. sp., H. euzeti n. sp., H. kulbickii n. sp., H. pasteuri n. sp., and H. planesi n. sp. Overall richness ranged from zero to five Hurleytrematoides species per chaetodontid species. Seven Hurleytrematoides species were found at only one locality and eleven were found at multiple localities. Only one species, H. morandi, was found at all localities. Individual localities had between six (Moorea) and 10 (Heron Island) species; we attribute Moorea's depauperate parasite fauna to its isolation and distance from the Indo-Philippine centre of biological diversity. Using cluster analysis of 18 species of Hurleytrematoides and 45 species of chaetodontids sampled in the Indo-West Pacific, we show that the localities on the Great Barrier Reef (Heron Island and Lizard Island) and New Caledonia have the most similar chaetodontid and parasite fauna of any locality pairs. Cluster analysis results also show that the similarity of the chaetodontid assemblages at five of the six localities is relatively high and that Ningaloo has the most distinct fauna. Similarity values based on sharing of species of Hurleytrematoides are generally lower than those for their hosts; Moorea, Ningaloo and Palau all have low similarity to New Caledonia and Great Barrier Reef sites. We attribute these distinctions to the differential dispersal capability of the fish and their parasites. Chaetodontids have long-lived mobile pelagic larvae, the dispersal of which would be most affected by prominent
Sources of Dengue Viruses Imported into Queensland, Australia, 2002–2010
Northill, Judith A.; Pyke, Alyssa T.
2012-01-01
To assess risk for importation of dengue virus (DENV) into Queensland, Australia, and sources of imported viruses, we sequenced the envelope region of DENV isolates from symptomatic patients with a history of travel during 2002–2010. The number of imported dengue cases greatly increased over the surveillance period, some of which were associated with domestic outbreaks. Patients reported traveling to (in order) Asia, Papua New Guinea, Pacific Island countries, and non–Asia-Pacific countries. By using phylogenetic methods, we assigned DENV isolates from returning residents and overseas visitors with viremia to a specific genotypic group. Genotypes circulating in Asia were extremely diverse. Genotyping and molecular clock analysis supported Asian origination of a strain that caused an outbreak of DENV-4 in Pacific Island countries during 2007–2009, and subsequently, in Innisfail, Australia, in 2009. Our findings indicate that Asia is a major source of DENVs that are imported into Australia, causing a risk for epidemics. PMID:23092682
Energy Technology Data Exchange (ETDEWEB)
MacIntosh, D.L. [Indiana Univ., Bloomington, IN (United States). School of Public and Environmental Affairs; Suter, G.W. II; Hoffman, F.O. [Oak Ridge National Lab., TN (United States)
1992-09-01
This report presents a pair of wildlife exposure models developed for use in investigating the risks to wildlife of releases of mercury and PCBS. The species modeled are the great blue heron and mink The models may be used to estimate the exposure experienced by mink and herons, to help establish remedial action goals and to identify research needs. Because mercury and PCBs bioaccumulate through dietary uptake, the models simulate the food webs supporting the two species. Sources of contaminants include surface water, sediment, sediment pore water, and soil. The model are stochastic equilibrium models. Two types of variance in the input parameters are distinguished: stochastic variance among individual mink and herons and ignorance concerning true parameter values. The variance in the output due to stochastic parameters indicates the expected variance among the receptors. The variance due to ignorance indicates the extent to which the model outputs could be unpaved by additional sampling and measurement. The results of the models were compared to concentrations measured in great blue heron eggs and nestlings from colonies on the Clinch and Tennessee Rivers. The predicted concentrations agreed well with the measured concentrations. In addition, the variances in measured values among individuals was approximately equal to the total stochastic variance predicted by the models.
Nest survival is influenced by parental behaviour and heterospecifics in a mixed-species colony
Brussee, Brianne E.; Coates, Peter S.; Hothem, Roger L.; Howe, Kristy; Casazza, Michael L.; Eadie, John M.
2016-01-01
Studies of avian nest success often focus on examining influences of variation in environmental and seasonal factors. However, in-depth evaluations can also incorporate variation in individual incubation behaviour to further advance our understanding of avian reproductive ecology. We examined these relationships in colonially nesting Black-crowned Night-Herons Nycticorax nycticorax using intensive video-monitoring methods to quantify incubation behaviours. We modelled nest survival as a function of both extrinsic factors and incubation behaviours over a 3-year period (2010–12) on Alcatraz Island, USA. Model-averaged parameter estimates indicated that nest survival increased as a function of greater incubation constancy (% of time spent incubating eggs within a 24-h period), and average daily precipitation throughout the nesting stage. Common Ravens Corvus corax are the only known nest predator of Night-Herons on Alcatraz Island, as on many other coastal Pacific islands. We also investigated the effects of heterospecific nesting of California Gulls Larus californicus and Western Gulls Larus occidentalis in a mixed-species colony with Night-Herons, based on nesting proximity data collected over a 2-year period (2011–12). This second analysis indicated that, in addition to incubation behaviours, nesting heterospecifics are an important factor for explaining variation in Night-Heron nest survival. However, contrary to our original expectation, we found that Night-Herons experienced increased nest survival with increasing distance from gull colony boundaries. These results may apply to other areas with multiple colonial nesting species and similar predator communities and climatic patterns.
The Population Origins and Expansion of Feral Cats in Australia.
Spencer, Peter B S; Yurchenko, Andrey A; David, Victor A; Scott, Rachael; Koepfli, Klaus-Peter; Driscoll, Carlos; O'Brien, Stephen J; Menotti-Raymond, Marilyn
2016-03-01
The historical literature suggests that in Australia, the domestic cat (Felis catus) had a European origin [~200 years before present (ybp)], but it is unclear if cats arrived from across the Asian land bridge contemporaneously with the dingo (4000 ybp), or perhaps immigrated ~40000 ybp in association with Aboriginal settlement from Asia. The origin of cats in Australia is important because the continent has a complex and ancient faunal assemblage that is dominated by endemic rodents and marsupials and lacks the large placental carnivores found on other large continents. Cats are now ubiquitous across the entire Australian continent and have been implicit in the range contraction or extinction of its small to medium sized (cats using 15 short tandem repeat (STR) genomic markers. Their origin appears to come exclusively from European founders. Feral cats in continental Australia exhibit high genetic diversity in comparison with the low diversity found in populations of feral cats living on islands. The genetic structure is consistent with a rapid westerly expansion from eastern Australia and a limited expansion in coastal Western Australia. Australian cats show modest if any population structure and a close genetic alignment with European feral cats as compared to cats from Asia, the Christmas and Cocos (Keeling) Islands (Indian Ocean), and European wildcats (F. silvestris silvestris). © The American Genetic Association 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
M. Julian Caley
2011-09-01
Full Text Available Recently, the Census of Marine Life has explored methods to assess coral reef diversity by combining standardized sampling (to permit comparison across sites with molecular techniques (to make rapid counts of species possible. To date, this approach has been applied across geographically broad scales (seven sites spanning the Indian, Pacific and Atlantic Oceans, focusing on similar habitats at all sites (10–12 m forereef. Here we examine crustacean spatial diversity patterns for a single atoll, comparing results for four sites (comprising forereef, backreef, and lagoon habitats at French Frigate Shoals (FFS, Northwestern Hawaiian Islands, Hawaii, USA, within the Papahanaumokuakea Marine National Monument. The Bray-Curtis index of similarity across these habitats at FFS was the same or greater than the similarity between similar habitats on Heron Island and Lizard Island in the Great Barrier Reef and much greater than similarity between more widely separated localities in the Indo-Pacific Ocean (e.g., Ningaloo, Moorea, French Polynesia or the Line Islands. These results imply that, at least for shallow reefs, sampling multiple locations versus sampling multiple habitats within a site maximizes the rate at which we can converge on the best global estimate of coral reef biodiversity.
Energy Technology Data Exchange (ETDEWEB)
Wienburg, Claire L.; Shore, Richard F
2004-11-01
Large scale temporal and spatial changes in the exposure of terrestrial vertebrates to PCBs have been monitored in the UK by measuring liver residues in sparrowhawks (Accipiter nisus), kestrels (Falco tinnunculus) and grey herons (Ardea cinerea) from throughout the country. Residues in the three species are typically characterised by large intra- and inter-specific variation. Data for 306 sparrowhawks, 186 kestrels and 47 herons collected between 1992 and 1997 as part of a national Predatory Bird Monitoring Scheme were examined to determine how much of this variation was explained by body condition, age and sex, rather than other factors. In all three species, body condition was the single most important factor and accounted for up to 49% of the variation in PCB liver residues; starved birds had the highest liver concentrations. Age and sex were also significant but of lesser importance. Adult sparrowhawks and kestrels had liver PCB residues that were 2 to 10-fold higher than in first-year birds. Sex did not affect residue magnitude in a consistent manner. PCB concentrations in the liver were higher in males than females in both first-year and adult kestrels and in first-year sparrowhawks, but adult female sparrowhawks had similar PCB residues to adult males. Liver residues also varied seasonally. PCB concentrations in first-year sparrowhawks increased during the first year following fledging and a similar pattern was detected in adult female sparrowhawks following egg laying. When these physiological factors were taken into account, it was evident that while kestrels with high fat scores had significantly lower PCB concentrations than either sparrowhawks or herons, liver residues were similar in all three species when birds were in a starved condition. Overall during 1992-1997, the combined influence of body condition, age and sex explained more of the variation in liver PCB concentrations than species differences or other factors, such as geographical variation
Money, Manipulation and Misunderstanding on Manus Island
DEFF Research Database (Denmark)
Wallis, Joanne; Dalsgaard, Steffen
2016-01-01
Island, on domestic affairs in PNG, and on the relationship between PNG and Australia. Overall, it concludes that the costs arising from the money, manipulation and misunderstanding generated by the centre seem likely to outweigh the purported benefits, particularly for Manusians and other ordinary Papua...
Guay, P.-J.; Chesser, R.T.; Mulder, R.A.; Afton, A.D.; Paton, D.C.; McCracken, K.G.
2010-01-01
Musk Ducks (Biziura lobata) are endemic to Australia and occur as two geographically isolated populations separated by the Nullarbor Plain, a vast arid region in southern Australia. We studied genetic variation in Musk Duck populations at coarse (eastern versus western Australia) and fine scales (four sites within eastern Australia). We found significant genetic structure between eastern and western Australia in the mtDNA control region (??ST = 0. 747), one nuclear intron (??ST = 0.193) and eight microsatellite loci (FST = 0.035). In contrast, there was little genetic structure between Kangaroo Island and adjacent mainland regions within eastern Australia. One small population of Musk Ducks in Victoria (Lake Wendouree) differed from both Kangaroo Island and the remainder of mainland eastern Australia, possibly due to genetic drift exacerbated by inbreeding and small population size. The observed low pairwise distance between the eastern and western mtDNA lineages (0.36%) suggests that they diverged near the end of the Pleistocene, a period characterised by frequent shifts between wet and arid conditions in central Australia. Our genetic results corroborate the display call divergence and Mathews' (Austral Avian Record 2:83-107, 1914) subspecies classification, and confirm that eastern and western populations of Musk Duck are currently isolated from each other. ?? 2010 Springer Science+Business Media B.V.
Directory of Open Access Journals (Sweden)
Harriet Whiley
2016-06-01
Full Text Available Rickettsiosis is a potentially fatal tick borne disease. It is caused by the obligate intracellular bacteria Rickettsia, which is transferred to humans through salivary excretions of ticks during the biting process. Globally, the incidence of tick-borne diseases is increasing; as such, there is a need for a greater understanding of tick–host interactions to create more informed risk management strategies. Flinders Island spotted fever rickettsioses has been identified throughout Australia (Tasmania, South Australia, Queensland and Torres Strait Islands with possible identifications in Thailand, Sri Lanka and Italy. Flinders Island spotted fever is thought to be spread through tick bites and the reptile tick Bothriocroton hydrosauri has been implicated as a vector in this transmission. This study used qPCR to assay Bothriocroton hydrosauri ticks collected from Tiliqua rugosa (sleepy lizard hosts on mainland South Australia near where spotted fever cases have been identified. We report that, although we discovered Rickettsia in all tick samples, it was not Rickettsia honei. This study is the first to use PCR to positively identify Rickettsia from South Australian Bothriocroton hydrosauri ticks collected from Tiliqua rugosa (sleepy lizard hosts. These findings suggest that B. hydrosauri may be a vector of multiple Rickettsia spp. Also as all 41 tested B. hydrosauri ticks were positive for Rickettsia this indicates an extremely high prevalence within the studied area in South Australia.
Turner, P A; Streever, W J
1997-12-01
Knowledge of oviposition sites selected by wetland mosquitoes could improve mosquito control and guide wetland rehabilitation practices to avoid creating or exacerbating a mosquito problem. Two studies that enumerated Aedes vigilax eggshells found in salt marsh soil on the western portion of Kooragang Island in New South Wales, Australia, allowed an evaluation of oviposition sites. In one study, the density of eggshells found in samples collected from a large area was related to environmental factors, including distance from nearby drainage channels, vegetation cover, elevation, and terrain characteristics. Multiple-regression analysis suggested eggshell densities were positively correlated with the presence of depressions and ponds, vegetation cover, and distance from culverts, but negatively related to elevation. In another study, eggshell density was related to relative elevation and vegetation species within each of two 400-m2 plots on Kooragang Island. In all but one instance, samples from bare soil contained fewer eggshells than samples with vegetation cover at both plots. Eggshell density did not differ between the two dominant vegetation species, Sarcocornia quinqueflora and Sporobolus virginicus, although bare soil of one plot had a mean eggshell density similar to that of soil with S. quinqueflora cover. Eggshells were at highest density at intermediate elevations at one plot but at low elevations at the other.
STS-56 Earth observation of Perth in Western Australia
1993-01-01
STS-56 Earth observation taken aboard Discovery, Orbiter Vehicle (OV) 103, is probably the best view of Perth in Western Australia. (For orientation purposes, note that the coastline runs north and south). The major feature on the coast is the large estuary of the Swan River. The large port city of Perth is situated on the north bank and the smaller city of Freemantle on the south bank by the sea. Smaller seaside towns trail off north and south of this center of urban life. Inland lies a prominent escarpment, more than 600 feet high, seen running down the middle of the view and dividing the lighter-colored coastal lowlands from the highlands where dark-colored tree savanna and desert scrub dominates the land. The Moore River can be seen entering the sea at the top of the frame. Rottnest Island is visible in the sea and Garden Island near bottom edge of the frame. Perth is the largest economic center in Western Australia. It receives natural gas from an offshore field hundreds of miles
Brown, Alex; Kritharides, Leonard
2012-10-01
Recent years have seen the Cardiac Society of Australia and New Zealand (CSANZ) focus its attention on improving outcomes for Indigenous people within Australia and New Zealand. The most visible of these activities has been the convening of conferences devoted specifically to understanding and overcoming the burden of cardiovascular disparities experienced by Aboriginal and Torres Strait Islanders within Australia and Maori and Pacific Islander populations within New Zealand. Following from the success of the first meeting, the second was held in Alice Springs in 2011. Alongside plenary sessions discussing primary prevention, improved care, secondary prevention and the social and cultural determinants of cardiovascular diseases (CVD), targeted workshops outlined the issues and priority activities for the CSANZ into the future. These included discussion of Workforce, Improving Chronic Care, Reducing the burden of Rheumatic Heart Disease and Reducing Disparities in Hospital Care. Copyright © 2012 Australian and New Zealand Society of Cardiac and Thoracic Surgeons (ANZSCTS) and the Cardiac Society of Australia and New Zealand (CSANZ). Published by Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Colvin, R.M.; Witt, G.Bradd; Lacey, Justine
2016-01-01
Wind is recognised as a key source of renewable energy. Despite broad public support for the sector, wind energy proposals have routinely triggered social conflict and localised opposition. To promote social acceptance and avoid conflict, the wind energy sector undertakes community engagement. This paper interrogates the community engagement undertaken in King Island (Tasmania, Australia) for a large scale wind energy development proposal which did not proceed to implementation due to external economic factors. Despite the proponent's adoption of what was described as a ‘best practice’ community engagement strategy, the proposal caused significant social conflict for the community. In-depth interviews (n=30) were conducted with members of the King Island community and were qualitatively analysed through the social identity lens. Five key drivers of the local conflict were identified: problematic pre-feasibility engagement; the lack of a third-party facilitator of the community consultative committee; holding a vote which polarised the community; the lack of a clear place in the engagement process for local opposition, and; the significance of local context. These findings are instructive for improving community engagement practice for wind energy and other energy generation and land use change sectors. - Highlights: • Community engagement for a controversial wind energy proposal is analysed. • Key factors driving local conflict are identified and discussed. • The social identity approach provides understanding of hidden complexities. • Implications for community engagement practice are discussed.
Quarantine, exports and animal disease in Australia 1901-2010.
Turner, Aj
2011-09-01
The Constitution forming the Australian Commonwealth Government on 1 January 1901 provided that animal and animal products imported into and exported from Australia would be under the authority of the national government. By mutual agreement, the Quarantine Act 1908 provided for the states to continue the delivery of services under contract until 1995 when the Commonwealth took back full responsibility for quarantine services. In the 1940s, 50s and 60s there were world pandemics of livestock diseases and Australia ceased the import of many species. By the 1970s, the livestock industries sought relaxation of import restrictions to gain access to diversified genetic stock. By the use of new technologies, many species can now be imported into Australia through tight importation protocols. With the advent of the World Trade Organization and implementation of the Sanitary Phytosanitary Agreement, Australia has developed a risk-based framework to support the development of import conditions for animals and animal products. Australia's 'Acceptable Level of Protection' has been set to provide a low likelihood of disease entry. Being an island continent, Australia can apply strong controls over imports and exports of all commodities and relatively few outbreaks of exotic animal diseases have occurred by breach of quarantine, but the outbreaks of rinderpest in 1923 and equine influenza in 2007 were notable exceptions. © 2011 The Author. Australian Veterinary Journal © 2011 Australian Veterinary Association.
End-stage kidney disease among indigenous peoples of Australia and New Zealand.
McDonald, Stephen P
2013-05-01
Although possessing different anthropological origins, there are similarities in the epidemiology of end-stage kidney disease (ESKD) among the indigenous peoples of Australia (the Australian Aborigines and Torres Strait Islanders) and New Zealand (Maori and Pacific Peoples). In both countries there is a substantially increased rate of ESKD among these groups. This is more marked in Australia than in New Zealand, but in both countries the relative rate (in comparison to non-indigenous rates) as well as absolute rate have nearly stabilized in recent years. The excess risk affects females particularly-in contrast to the non-indigenous picture. Among Aboriginal and Torres Strait Islander people in Australia, there is a strong age interaction, with the most marked risk being among those aged 25 to 45 years. Indigenous peoples are less likely to be treated with home dialysis, and much less likely to receive a kidney transplant. In particular, rates of living donation are very low among indigenous groups in both countries. Outcomes during dialysis treatment and during transplantation are inferior to those of nonindigenous ones, even after adjustment for the higher prevalence of comorbidities. The underlying causes for these differences are complex, but the slowing and possible stabilization of incident rate changes is heartening.
National Research Council Canada - National Science Library
Matthew, William
1999-01-01
.... Overall system performance of three prototype HSMs was evaluated at a commercial oil production facility at Barrow Island, Australia, and a single prototype was evaluated for potential use in deep...
Protein (Cyanobacteria): 553736347 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_023070590.1 NZ_AWNH01000001 1117:18358 ... 1150:46430 1301283:66978 ... 47251:4271 1385935:793 ... dna alkyla...tion repair enzyme Leptolyngbya sp. Heron Island J MTADQISKTLRDLADPAIAEHSQRFFKTGKGE
The remittances of migrant Tongan and Samoan nurses from Australia
Directory of Open Access Journals (Sweden)
Brown Richard PC
2004-04-01
Full Text Available Abstract Background Migration and remittances are of considerable importance in the small Pacific island states. There has been a significant migration of skilled health workers in recent decades to metropolitan fringe states, including Australia and New Zealand. This paper reports the findings of a re-analysis of survey of Samoan and Tongan migrants in Australia where the sample is split between nurse households and others. Methods The study analyzes the survey data with a view to comparing the remittance behaviour and determinants of remittances for nurses and other migrant households, using both descriptive, cross-tabulations and appropriate econometric methods. Results It is found that a significantly higher proportion of nurse households sent remittances home, and, on average remitted more. Remittances of nurse households did not decline significantly over time contrary to what has generally been predicted. This was in contrast to other migrant households in the sample, for whom remittances showed a sharp decline after 15 years absence. Remittances contribute much more to the income of migrant sending countries, than the cost of the additional human capital in nurse training. Conclusions Given the shortage of nurses in Australia and New Zealand, and therefore the high demand for immigrant nurses, investment by Pacific island governments and families in nurse training constitutes a rational use of economic resources. Policies encouraging investment in home countries may be more effective than policies directly discouraging brain drain in contributing to national development.
Mihrshahi, Seema; Vaughan, Lisa; Fa'avale, Nicola; De Silva Weliange, Shreenika; Manu-Sione, Inez; Schubert, Lisa
2017-01-13
Reducing the prevalence of obesity and chronic disease are important priorities. Maori and Pacific Islander communities living in Australia have higher rates of obesity and chronic disease than the wider Australian population. This study aims to assess the effectiveness of the Good Start program, which aims to improve knowledge, attitudes and practices related to healthy eating and physical activity amongst Maori and Pacific Islander communities living in Queensland. The intervention was delivered to children aged 6-19 years (N = 375) in schools by multicultural health workers. Class activities focused on one message each term related to healthy eating and physical activity using methods such as cooking sessions and cultural dance. The evaluation approach was a quantitative uncontrolled pre-post design. Data were collected each term pre- and post-intervention using a short questionnaire. There were significant increases in knowledge of correct servings of fruit and vegetables, knowledge of sugar and caffeine content of common sugar-sweetened drinks, recognition of the consequences of marketing and upsizing, and the importance of controlling portion size (all P well as the importance of physical activity for preventing heart disease (P emphasis on reducing intake of junk food may be beneficial. The study has shown that the Good Start Program was effective in engaging children from Maori and Pacific Island backgrounds and in improving knowledge, and some attitudes and practices, related to healthy eating and physical activity. The evaluation contributes valuable information about components and impacts of this type of intervention, and considerations relevant to this population in order to successfully change behaviours and reduce the burden of chronic disease.
Lingue e migrazione. Un caso di studio: l’Australia
Directory of Open Access Journals (Sweden)
Thomas Wulstan Christiansen
2016-01-01
Full Text Available Abstract – This chapter focuses upon two contrasting features of the linguistic situation in Australia. On the one hand, together with nationhood, the past hundred or so years have seen the evolution of a distinct national variety of English in Australia recognizable also outside Australia. On the other, Australia, though a young nation, has been continuously inhabited by the various Aborigine and Torre Strait Islander communities for thousands of years. These have traditionally spoken a wide variety of different languages, some of which of great interest to linguists due to their peculiarity. Increasingly, although the use of Aborigine languages has until very recently been in steady decline, since the 1950s in particular, diverse ethnic groups speaking a variety of languages, both European and Asian, have settled in Australia. The National Policy on Languages (1987 formally directed Australia towards multilingualism and the teaching of English as a first and second language is promoted together with that of Aborigine and community languages. Consequently, Australia has been one of the first nations to try to capitalise on its own linguistic diversity, both as a means of strengthening links with the outside world and as a way of promoting a multiethnic and multicultural society at home. Australia presents then an interesting case study for those working with discourse in immigration domains who are concerned with the way that language policy (or the lack of one may effect social harmony and serve not only as an indicator of the way that migrants are received and treated, but also a catalyst in itself for greater mutual respect.
Telemedicine in the Solomon Islands: 2006 to 2009.
Martiniuk, Alexandra; Negin, Joel; Hersch, Fred; Dalipanda, Tenneth; Jagilli, Rooney; Houasia, Patrick; Gorringe, Lilijana; Christie, Annie
2011-01-01
Telemedicine has been used in the Solomon Islands since 2000. We used quantitative and qualitative methods to examine telemedicine use in the Solomon Islands from January 2006 to June 2009. During the study period 66 telemedicine cases were submitted to the store and forward telemedicine system being used there. These included orthopaedic, oncology, cardiothoracic, infectious, congenital, gastroenterology and dermatology cases. Most cases (52%) were submitted by doctors at the National Referral Hospital (NRH) in Honiara. The majority of responses came from the NRH (27%). A final, firm recommendation regarding patient diagnosis and/or care was given for 46% of the cases. Interviews were conducted with 23 stakeholders in the Solomon Islands and in Australia to better understand the current and future use of telemedicine. The interviews identified the fragility of the Solomon Islands infrastructure, including the lack of training, as the largest barrier to the future use of telemedicine. The best use of telemedicine appears to be case sharing within the Solomon Islands, with connections to clinicians in other countries as a secondary benefit when particular expertise is required.
ANZUS in Revision: Changing Defense Features of Australia and New Zealand in the Mid-1980s
1991-02-01
Allan C. Brownfeld, "Fragility of Alliance Illustrated in New Zealand," Washington Times, 12 September 1984, 3C-4C; Beaglehole, 8 ; Graham Ansell , 4 1...RAN purchased three US-built Adams -class guided missile destroyers . In the 1970s Australia decided to buy four Perry-class guided missiles frigates...According to Graham Ansell , the New Zealand high commissioner for Australia, his government understands the "Pacific way" of the islands . New Zealand
Phylogenetic analysis reveals multiple introductions of Cynodon species in Australia.
Jewell, M; Frère, C H; Harris-Shultz, K; Anderson, W F; Godwin, I D; Lambrides, C J
2012-11-01
The distinction between native and introduced flora within isolated land masses presents unique challenges. The geological and colonisation history of Australia, the world's largest island, makes it a valuable system for studying species endemism, introduction, and phylogeny. Using this strategy we investigated Australian cosmopolitan grasses belonging to the genus Cynodon. While it is believed that seven species of Cynodon are present in Australia, no genetic analyses have investigated the origin, diversity and phylogenetic history of Cynodon within Australia. To address this gap, 147 samples (92 from across Australia and 55 representing global distribution) were sequenced for a total of 3336bp of chloroplast DNA spanning six genes. Data showed the presence of at least six putatively introduced Cynodon species (C. transvaalensis, C. incompletus, C. hirsutus, C. radiatus, C. plectostachyus and C. dactylon) in Australia and suggested multiple recent introductions. C. plectostachyus, a species often confused with C. nlemfuensis, was not previously considered to be present in Australia. Most significantly, we identified two common haplotypes that formed a monophyletic clade diverging from previously identified Cynodon species. We hypothesise that these two haplotypes may represent a previously undescribed species of Cynodon. We provide further evidence that two Australian native species, Brachyachne tenella and B. convergens belong in the genus Cynodon and, therefore, argue for the taxonomic revision of the genus Cynodon. Copyright © 2012 Elsevier Inc. All rights reserved.
Island Movements: Thinking with the Archipelago
Directory of Open Access Journals (Sweden)
Jonathan Pugh
2013-05-01
Full Text Available Whether in Homer or Plato, Shakespeare or Huxley, throughout history, thinking about islands has shaped how we think about human nature and our place in the world. However, to date archipelagos have received far less attention. This is problematic because we live, increasingly, in a world of island-island movements and not static forms. Not only in the more obvious cases of the Caribbean, Hawaii or the Philippines but, as Stratford et al (2011 say, many ‘continental forms’ like Canada and Australia are in fact archipelagos composed of thousands of island movements. To this list we can add more manufactured archipelagos: wind turbine arrays, industrial oil and military constellations. The key question therefore arises: what does it mean to think with the archipelago? This paper argues firstly that archipelagic thinking denaturalizes the conceptual basis of space and place, and therefore engages ‘the spatial turn’ presently sweeping the social sciences and humanities. Secondly, such thinking highlights the trope of what I call ‘metamorphosis’, of the adaptation and transformation of material, cultural and political practices through island movements. In both cases, I argue that thinking with the archipelago requires an important shift in how we frame analysis and engagement.
Directory of Open Access Journals (Sweden)
Paul A Thuesen
Full Text Available BACKGROUND: Indo-Pacific high island streams experience extreme hydrological variation, and are characterised by freshwater fish species with an amphidromous life history. Amphidromy is a likely adaptation for colonisation of island streams following stochastic events that lead to local extirpation. In the Wet Tropics of north-eastern Australia, steep coastal mountain streams share similar physical characteristics to island systems. These streams are poorly surveyed, but may provide suitable habitat for amphidromous species. However, due to their ephemeral nature, common non-diadromous freshwater species of continental Australia are unlikely to persist. Consequently, we hypothesise that coastal Wet Tropics streams are faunally more similar, to distant Pacific island communities, than to nearby faunas of large continental rivers. METHODS/PRINCIPAL FINDINGS: Surveys of coastal Wet Tropics streams recorded 26 species, 10 of which are first records for Australia, with three species undescribed. This fish community is unique in an Australian context in that it contains mostly amphidromous species, including sicydiine gobies of the genera Sicyopterus, Sicyopus, Smilosicyopus and Stiphodon. Species presence/absence data of coastal Wet Tropics streams were compared to both Wet Tropics river networks and Pacific island faunas. ANOSIM indicated the fish fauna of north-eastern Australian coastal streams were more similar to distant Pacific islands (R = 0.76, than to nearby continental rivers (R = 0.98. MAIN CONCLUSIONS/SIGNIFICANCE: Coastal Wet Tropics streams are faunally more similar to distant Pacific islands (79% of species shared, than to nearby continental fauna due to two factors. First, coastal Wet Tropics streams lack many non-diadromous freshwater fish which are common in nearby large rivers. Second, many amphidromous species found in coastal Wet Tropics streams and Indo-Pacific islands remain absent from large rivers of the Wet Tropics
Cyronak, T.; Santos, I. R.; Erler, D.; Maher, D. T.; Eyre, B.
2013-12-01
The carbon chemistry of coral reef lagoons can be highly variable over short time scales. While much of the diel variability in seawater carbon chemistry is explained by biological processes, external sources such as river and groundwater seepage may deliver large amounts of organic and inorganic carbon to coral reefs and represent a poorly understood feedback to ocean acidification. Here, we assess the impact of submarine groundwater discharge (SGD) on pCO2 variability in two coral reef lagoons with distinct SGD driving mechanisms. Diel variability of pCO2 in the two ecosystems was explained by a combination of biological drivers and SGD inputs. In Rarotonga, a South Pacific volcanic island, SGD was driven primarily by a steep terrestrial hydraulic gradient, and the lagoon was influenced by the high pCO2 (5,501 μatm) of the fresh groundwater. In Heron Island, a Great Barrier Reef coral cay, SGD was dominated by seawater recirculation through sediments (i.e. tidal pumping) and pCO2 was mainly impacted through the stimulation of biological processes. The Rarotonga water column had a relatively higher average pCO2 (549 μatm) than Heron Island (471 μatm). However, pCO2 exhibited a greater diel range in Heron Island (778 μatm) than in Rarotonga (507 μatm). The Rarotonga lagoon received 31.2 mmol CO2 m-2 d-1 from SGD, while the Heron Island lagoon received 12.3 mmol CO2 m-2 d-1. Over the course of this study both systems were sources of CO2 to the atmosphere (3.00 to 9.67 mmol CO2 m-2 d-1), with SGD-derived CO2 contributing a large portion to the air-sea CO2 flux. The relationship between both water column pH and aragonite saturation state (ΩAr) and radon (222Rn) concentrations indicate that SGD may enhance the local acidification of some coral reef lagoons. Studies measuring the carbon chemistry of coral reefs (e.g. community metabolism, calcification rates) may need to consider SGD-derived CO2.
Hothem, R.L.; Roster, D.L.; King, K.A.; Keldsen, T.J.; Marois, Katherine C.; Wainwright, S.E.
1995-01-01
Between 1989 and 1991, reproduction by black-crowned night-herons (Nycticorax nycticorax) and snowy egrets (Egretta thula) was studied at sites in San Francisco Bay. Eggs were collected from these and other bay sites and from South Wilbur Flood Area, a reference site in California's San Joaquin Valley. Eggs were analyzed for inorganic trace elements, organochlorine pesticides, and polychlorinated biphenyls (PCBs). Results were compared among sites and years and with results of previous studies. There was some evidence of impaired reproduction, but concentrations of contaminants were generally lower than threshold levels for such effects. Egg hatchability was generally good, with predation being the factor that most limited reproductive success. Mean PCB concentrations were generally higher in eggs from the south end of San Francisco Bay than from the north, but the only temporal change, an increase, was observed at Alcatraz Island. There were spatial differences for p,p'-DDE in night-heron eggs in 1990, but the highest mean concentration of DDE was in night-heron eggs from South Wilbur in 1991. Temporal declines in maximum concentrations of DDE in eggs were observed in the bay, but means did not change significantly over time, At Bair Island in the southern end of the bay, mean concentrations of mercury decreased while selenium increased in night-heron eggs over time, but there were no clear bay-wide spatial or temporal trends for either element.
GENDER, WORK AND ETHNIC IDEOLOGY: CASTELLORIZIAN GREEKS IN PERTH, AUSTRALIA
Chryssanthopoulou, Vassiliki
2003-01-01
This article analyses the values and practices surrounding work among the Castellorizian migrants of Perth, Western Australia. The article compares and analyses the occupational and class patterns of the Castellorizians of Perth and those of their original community on the island of Castellorizo, to focus upon the construction of Castellorizian ethnic identity. Castellorizian men, with an occupational background in business and the professions, selectively deploy elements of regional Castello...
Hofmann, Harald; Newborn, Dean; Cartwright, Ian
2017-04-01
Freshwater lenses underneath barrier islands are dynamic systems affected by changing sea levels and groundwater use. They are vulnerable to contamination and over-abstraction. Residence times of fresh groundwater in barrier islands are poorly understood and have mostly been assessed by modelling approaches and estimates without fundamental validation with geochronological data. Assessing residence time and recharge rates will improve significantly our understanding of hydrological processes of coastal environments that will in turn allow us to make informed decisions on groundwater use and environmental protection. This project focused on groundwater recharge rates and residence times of the fresh water aquifer system of North Stradbroke Island, south-east Queensland, Australia. Groundwater bores, wetlands and submarine groundwater discharge points in the tidal areas (wonky holes) were sampled along a transect across the island and were analysed for major ion chemistry and stable isotopes (δ2H, δ18O, δ13C) in combination with 3H and 14C analysis. Calculated 3H using a 95% exponential-piston flow model and 14C ages range from 12 to >100 years and modern to 3770 years, respectively, indicating a highly heterogeneous aquifer system with mixing from low and high conductive areas. The major ion chemistry in combination with stable and radiogenic isotopes suggests that a significant groundwater component derives from the fractured rock basement and older sedimentary formations underlying the sand dunes of the island. The results help refining the conceptual and numerical groundwater flow model for North Stradbroke island in this particular case but also demonstrate the possible complexity of barrier island hydrogeology.
The zooplankton of Mgazana, a mangrove estuary in Transkei
African Journals Online (AJOL)
continent. The estuary is in an excellent state of preservation and all three species of mangrove trees which occur south of K.osi Bay (260 54' S) are recorded here (Avicennia marina, Bruguieria gymnorhiza .... of Heron Island a shallow ford or drift occurs where depth may be less than 0,25 m at low tide. Above the island the ...
A white pelican and egrets in the Merritt Island National Wildlife Refuge
1999-01-01
A white pelican and several small egrets rest on the bank of a pond in in the waters of the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. White pelicans inhabit marshy lakes and along the Pacific and Texas coasts. They winter from Florida and southern California south to Panama, chiefly in coastal lagoons. They are frequently seen flying in long lines, flapping and sailing in unison, but also ride rising air currents to soar gracefully in circles. The range of the egret includes southern and eastern states, Mexico, Central and South America, and the West Indies. The Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.
Black-necked stilts share nesting in the Merritt Island National Wildlife Refuge
1999-01-01
A black-necked stilt waits near its nesting mate nest in the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. Stilts usually produce three or four brown-spotted buff eggs in a shallow depression lined with grass or shell fragments. In the nesting season they are particularly agressive. Stilts are identified by a distinct head pattern of black and white, very long red legs, and straight, very thin bill. Their habitat is salt marshes and shallow coastal bays from Delaware and northern South America in the East, and freshwater marshes from Oregon and Saskatchewan to the Gulf Coast. The 92,000-acre wildlife refuge is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.
Comparative genomics identifies distinct lineages of S. Enteritidis from Queensland, Australia.
Graham, Rikki M A; Hiley, Lester; Rathnayake, Irani U; Jennison, Amy V
2018-01-01
Salmonella enterica is a major cause of gastroenteritis and foodborne illness in Australia where notification rates in the state of Queensland are the highest in the country. S. Enteritidis is among the five most common serotypes reported in Queensland and it is a priority for epidemiological surveillance due to concerns regarding its emergence in Australia. Using whole genome sequencing, we have analysed the genomic epidemiology of 217 S. Enteritidis isolates from Queensland, and observed that they fall into three distinct clades, which we have differentiated as Clades A, B and C. Phage types and MLST sequence types differed between the clades and comparative genomic analysis has shown that each has a unique profile of prophage and genomic islands. Several of the phage regions present in the S. Enteritidis reference strain P125109 were absent in Clades A and C, and these clades also had difference in the presence of pathogenicity islands, containing complete SPI-6 and SPI-19 regions, while P125109 does not. Antimicrobial resistance markers were found in 39 isolates, all but one of which belonged to Clade B. Phylogenetic analysis of the Queensland isolates in the context of 170 international strains showed that Queensland Clade B isolates group together with the previously identified global clade, while the other two clades are distinct and appear largely restricted to Australia. Locally sourced environmental isolates included in this analysis all belonged to Clades A and C, which is consistent with the theory that these clades are a source of locally acquired infection, while Clade B isolates are mostly travel related.
Palmer, Jonathan G.; Cook, Edward R.; Turney, Chris S. M.; Allen, Kathy; Fenwick, Pavla; Cook, Benjamin I.; O'Donnell, Alison; Lough, Janice; Grierson, Pauline; Baker, Patrick
2015-01-01
Agricultural production across eastern Australia and New Zealand is highly vulnerable to drought, but there is a dearth of observational drought information prior to CE (Christian Era) 1850. Using a comprehensive network of 176 drought-sensitive tree-ring chronologies and one coral series, we report the first Southern Hemisphere gridded drought atlas extending back to CE 1500. The austral summer (December-February) Palmer drought sensitivity index reconstruction accurately reproduces historically documented drought events associated with the first European settlement of Australia in CE 1788, and the leading principal component explains over 50 percent of the underlying variance. This leading mode of variability is strongly related to the Interdecadal Pacific Oscillation tripole index (IPO), with a strong and robust antiphase correlation between (1) eastern Australia and the New Zealand North Island and (2) the South Island. Reported positive, negative, and neutral phases of the IPO are consistently reconstructed by the drought atlas although the relationship since CE 1976 appears to have weakened.
Coral reproduction on the world’s southernmost reef at Lord Howe Island, Australia
DEFF Research Database (Denmark)
Baird, Andrew H.; Cumbo, Vivian R.; Gudge, Sallyann
2015-01-01
Despite a recent expansion in the geographic extent of coral reproductive research, there remain many regions in the Indo-Pacific where knowledge is limited. For example, Lord Howe Island is the southernmost reef system in the world (31° S); however, very little is known of the reproductive biology...... of the coral fauna. Here, aspects of the reproductive biology and the timing of reproduction for 40 of the approximately 65 species that occur on Lord Howe Island are documented. In December 2010, field assessments of the stage of gamete maturity in Acropora spp. colonies suggested that 5 species spawned...
Dioxin, PCB and PBDE exposure in grey heron (ardea cinerea)
Energy Technology Data Exchange (ETDEWEB)
Fernandes, A.; Thompson, H.; Dsilva, K.; White, S.; Rose, M. [Central Science Laboratory, York (United Kingdom)
2004-09-15
In the United Kingdom recent investigations have detected elevated levels of mortality and bone disease in grey herons at an established colony in Nottinghamshire along the course of the river Trent (4). The causes of mortality are unclear but deformities recorded in the other birds include multiple fracture of the tarsus, tibia and metacarpal bones. These findings have prompted a pilot study into assessing the level of environmental contaminants in the tissue and eggs of these birds. Two classes of contaminants have the potential to cause the deformities observed in the birds - heavy metals such as selenium, cadmium, arsenic mercury and lead, and halogenated organic contaminants such as dioxins, and PCBs. This paper discusses levels of these contaminants in the samples of eggs taken from the colony. Additional samples of eggs were also collected from a colony in Hertfordshire and from a site in the north of the country. The discussion will be limited to the halogenated organic contaminants as the levels of heavy metals were similar in all sites and were generally at or above background levels. Given the increased utilisation of brominated flame retardant chemicals over the last decade and the similarities in structure and environmental persistence of some of these compounds to the dioxins and PCBs, polybrominated diphenylethers (PBDEs) were also measured in the samples.
A new species of the genus Paracypria (Crustacea: Ostracoda: Cypridoidea) from the Fiji Islands.
Chand, Prerna; Kamiya, Takahiro
2016-08-30
A new marine species of the genus Paracypria (Paracypria fijiensis n. sp.) is reported from the Fiji Islands, a small island archipelago in the South Pacific Ocean. This is the first report of a Paracypria species from the Fiji Islands. Descriptions of soft parts and valves of Paracypria fijiensis n. sp. are presented herein, and morphological comparisons are made with existing Paracypria species from Australia, Japan and New Caledonia. Although eight coastal sites were sampled across the Fiji Islands, the new Paracypria species was found at only three sites. Large numbers of P. fijiensis n. sp. were recorded from intertidal flats, indicating it to be highly tolerant of the dynamic intertidal zone conditions.
A photovoltaic generator on coconut island
Sheridan, N. R.
A description is given of the design principles of a photovoltaic—diesel power generator that has been constructed on Coconut Island, Torres Strait, to supply a village of 130 people with 240 V: 50 Hz electricity. Even though the solar fraction is only 0.4, the system sets a precedent for Australia with an array size of 23 kW. The uniqueness arises, however, from the fact that it is a stand-alone, inverter-driven system of considerable size with a sine-wave output.
Gangoso, Laura; López-López, Pascual; Grande, Juan Manuel; Mellone, Ugo; Limiñana, Rubén; Urios, Vicente; Ferrer, Miguel
2013-01-01
The adaptive transition between behavioral strategies, such as the shift from migratoriness to sedentariness, remains an outstanding question in evolutionary ecology. Density-dependent variation in the age of first breeding has been proposed as a feasible mechanism through which long-lived migratory birds with deferred sexual maturity should become sedentary to persist on islands. Although this pattern seems to hold for most raptors and herons, a few exceptions have been identified. One of these exceptions is the Eleonora's falcon, a long-distance migratory bird, which shows one of the most peculiar adaptations in the timing of reproduction and food requirements among raptors. Here, we compiled data concerning demography, banding recoveries and satellite tracking of Eleonora's falcons to discuss likely explanations for the exceptional behavior of this insular long-distance migratory species. New data reveal that Eleonora's falcons do return to the natal colonies in their first year and young birds are able to breed. However, in contrast to previous hypothesis, the highly specialized strategy of this and other ecologically similar species, as well as the virtual lack of food during winter at breeding areas prevent them from becoming sedentary on islands. Although the ultimate mechanisms underlying the process of sedentarization remain poorly understood, the evidence provided reveal the existence of important trade-offs associated with ecological specialization that may become particularly relevant in the present context of global change.
DEFF Research Database (Denmark)
Santos, Isaac R.; Eyre, Bradley D.; Glud, Ronnie N.
2012-01-01
Porewater flow enhances mineralization rates in organic-poor permeable sands. Here, a series of sediment column experiments were undertaken to assess the potential effect of advective porewater transport on denitrification in permeable carbonate sands collected from Heron Island (Great Barrier Re...
Pliocene-Quaternary history of Futuna island, south Vanuatu, southwest Pacific
International Nuclear Information System (INIS)
Neef, G.; McCulloch, M.T.
2001-01-01
Uranium-series ages from thermal ionisation mass spectrometry are reported here for the raised coral reefs of Futuna Island, which lies adjacent to the eastern margin of the backarc Futuna Trough in south Vanuatu, southwest Pacific. U-series ages from coral from the lowest raised reef indicate that its upper part is most likely to be ca 210 ka, whereas the most elevated raised reef has a likely age of ca 520 ka (range 600-440 ka). The inferred Pliocene-Quaternary history for Futuna Island and the adjacent Futuna Trough is: (i) formation of the Pliocene - Early Quaternary basaltic-andesite cone in a southeast part of the Vanuatu Island Arc; (ii) inception of the Futuna Trough (adjacent to the west margin of Futuna Island) since 1.8Ma; (iii) subsequent uplift of the volcanic cone above sea-level caused ∼ 500 m of its upper part to be removed by marine erosion; (iv) the island then subsided and at least 160 m of limestone was deposited on the truncated cone; and (v) during the period 520 ka to ca 210 ka seven fringing reefs formed at the margin of the cone as the island was uplifted. Since ca 210 ka Futuna further subsided and, as a result, the post ca 210 ka history of the island is obscure. Copyright (2001) Geological Society of Australia
Observations ornithologiques au Sénégal
Rose, John; Virondeau, Anthony; Magne, Jean-François; Diop, Moussa Séga; Hooijmeijer, J.C.E.W.; Barlow, Clive
2016-01-01
Ornithological observations in Senegal. We present observations made in Senegal in January 2015. Five sightings of rare species are described: a White-crested Tiger Heron Tigriornis leucolopha in the Saloum delta, a Shorteared Owl Asio flammeus in Madeleine Islands National Park, an Egyptian
Supply constraints : Australia and Canada coal industry face logistics and capacity challenges
International Nuclear Information System (INIS)
Borsato, J.
2010-01-01
Australia and Canada are benefiting from a global increase in coal consumption, but face challenges regarding coal and coal export capacity. Coal is Australia's biggest export commodity, accounting for over 50 percent of world coking coal exports, with almost 75 percent of those exports destined for Asian markets, primarily Japan. However, the number of ships delayed at Australian ports hit a record of 223 bulk carriers in early 2010. Compared to Canada, Australia faces greater logistical issues getting coal into port and onto ships at its 9 loading terminals. Two of Canada's 3 major shipping terminals, Westshore and Neptune, have some additional capacity. Its third terminal, Ridley Island, has considerable potential to carry more coal. With 98 percent of all coal moved by rail in Australia, rail issues also hinder growth. A national approach to planning freight transport on both roads and rail is being developed. While infrastructure issues remain the single greatest barrier to export growth for Australia's coal sector, Canada's most immediate issues pertain to mine permitting and mine-site expansion. In 2009, Canada exported 28 million tonnes of coal, 90 percent of it metallurgical. With approximately 70 million tonnes of annual production, mostly in British Columbia and Alberta, coal remains the number one commodity in Canada carried by rails and shipped from ports. 1 fig.
Energy Technology Data Exchange (ETDEWEB)
Shield, M.; Charlesworth, M.; Paakkonen, S.
2006-03-15
Acrolein, 2-propenal, was evaluated as a microbiocide for control of sulphate-reducing bacteria (SRB) in a sub-sea pipeline and an onshore process plant operated by ChevronTexaco Australia Pty Ltd (CVX) in the North West Shelf (NWS) of Australia. An initial trial compared the efficacy of acrolein with that of a glutaraldehyde, quaternary amine blend (GQB) for control of SRB implicated in microbiologically induced corrosion (MIC) of the sub-sea pipeline. Based on improved performance, acrolein subsequently replaced the GQB for routine microbiocide treatment of the pipeline. In addition, a plant trial assessed the impact of acrolein supplementation of the existing tetrakishydroxy-methyl phosphonium sulphate (THPS) microbiocide programme for control of SRB in process plant operations. This paper overviews both the pipeline and plant trials as well as the programme implementation of acrolein microbiocide for routine pipeline treatment. In addition to an improved performance and safety profile, complete conversion of the microbiocide programme to acrolein is projected to result in direct savings of 40%, with further potential for secondary operational cost savings. on behalf of Ampol and Caltex; and, in 1964, the company discovered oil in commercial quantities on Barrow Island (BWI) off the North West Shelf of Australia. Today, CVX continues hydrocarbon production operations on BWI with over 300 million barrels produced since inception. BWI volumes have been augmented since 1989 through hydrocarbon recovery operations near Thevenard Island (TVI), a small island located 25 km north-north west of Onslow. To date, more than 146 million barrels have been processed through facilities on TVI. With the process plant covering only a small corner of the island, the majority of land mass on TVI is classified as a nature reserve for the protection of plants and animals. Important wildlife found on the island include green and flatback turtles that nest on the islands beaches. In
2004-01-01
KENNEDY SPACE CENTER, FLA. White pelicans swim in a lake north of Kennedy Space Center. In the distance, at right, is a great blue heron. White pelicans winter from Florida and southern California south to Panama. Great blue herons range across the breadth of the United States, as well as north to Alaska and Canada and south to Mexico and the West Indies. The Center shares a boundary north, south and west with the 92,000-acre Merritt Island National Wildlife Refuge, which is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.
New Zealand and Australia wind energy in a non subsidised market environment
Energy Technology Data Exchange (ETDEWEB)
Lieshout, P. van [DesignPower New Zealand Ltd., Wellington (New Zealand)
1996-12-31
Significant preliminary work has been undertaken by New Zealand and Australian Power/Generation Companies regarding Wind Power. Turbines are installed in Australia and New Zealand to test the wind and the technical applicability in the Australian wind diesel and the New Zealand high wind speed environment. Projects in Esperance, Thursday Island and King Island illustrate hybrid wind diesel applications. A single Wind Turbine Generator (WTG) has been successfully operated in New Zealand for the last 3 years. A new 3.5 MW wind farm is operational and Resource Consent has been granted for a 65 MW wind farm in New Zealand. Design Power is very proud to be involved in many of the New Zealand and Australian projects. It is obvious that wind power is just starting here, however the start has been promising and it is expected that wind power is here to stay. This paper will address some of the issues associated with wind power in New Zealand and Australia, particularly those that are different from Europe and America. It shows the opportunities and challenges regarding the operation of WTGs in these countries. It addresses the non subsidized electrical pricing structure and the influence of the economically necessary high wind speeds or diesel systems on the choice of technology, particularly the control algorithm of WTGs and the subsystems. It reviews several of the issues associated with predicting the amount of energy that a WTG can generate, again taking into account the high wind speed control algorithms. It further addresses the issue of embedded generation and the influence that a wind farm might have on the electrical network. It continues to address issues associated with wind diesel systems. The paper concludes that wind power will be viable in the near future both in New Zealand and Australia, but also that care should be taken with data analysis and hardware choices during the next phase of implementation of wind power in New Zealand and Australia. 7 figs.
Cryptosporidiosis: A Disease of Tropical and Remote Areas in Australia.
Lal, Aparna; Cornish, Lisa Michelle; Fearnley, Emily; Glass, Kathryn; Kirk, Martyn
2015-09-01
Cryptosporidiosis causes gastroenteritis and is transmitted to humans via contaminated water and food, and contact with infected animals and people. We analyse long-term cryptosporidiosis patterns across Australia (2001-2012) and review published Australian studies and jurisdictional health bulletins to identify high risk populations and potential risk factors for disease. Using national data on reported cryptosporidiosis, the average annual rate of reported illness was 12.8 cases per 100 000 population, with cycles of high and low reporting years. Reports of illness peak in summer, similar to other infectious gastrointestinal diseases. States with high livestock densities like New South Wales and Queensland also record a spring peak in illnesses. Children aged less than four years have the highest rates of disease, along with adult females. Rates of reported cryptosporidiosis are highest in the warmer, remote regions and in Aboriginal and Torres Strait Islander populations. Our review of 34 published studies and seven health department reports on cryptosporidiosis in Australia highlights a lack of long term, non-outbreak studies in these regions and populations, with an emphasis on outbreaks and risk factors in urban areas. The high disease rates in remote, tropical and subtropical areas and in Aboriginal and Torres Strait Islander populations underscore the need to develop interventions that target the sources of infection, seasonal exposures and risk factors for cryptosporidiosis in these settings. Spatial epidemiology can provide an evidence base to identify priorities for intervention to prevent and control cryptosporidiosis in high risk populations.
Verdon, Sarah; McLeod, Sharynne
2015-01-01
Internationally, cultural renewal and language revitalisation are occurring among Indigenous people whose lands were colonised by foreign nations. In Australia, the Aboriginal and Torres Strait Islander people are striving for the re-voicing of their mother tongue and the re-practicing of their mother culture to achieve cultural renewal in the…
Directory of Open Access Journals (Sweden)
Laura Gangoso
Full Text Available BACKGROUND: The adaptive transition between behavioral strategies, such as the shift from migratoriness to sedentariness, remains an outstanding question in evolutionary ecology. Density-dependent variation in the age of first breeding has been proposed as a feasible mechanism through which long-lived migratory birds with deferred sexual maturity should become sedentary to persist on islands. Although this pattern seems to hold for most raptors and herons, a few exceptions have been identified. One of these exceptions is the Eleonora's falcon, a long-distance migratory bird, which shows one of the most peculiar adaptations in the timing of reproduction and food requirements among raptors. METHODOLOGY/PRINCIPAL FINDINGS: Here, we compiled data concerning demography, banding recoveries and satellite tracking of Eleonora's falcons to discuss likely explanations for the exceptional behavior of this insular long-distance migratory species. CONCLUSIONS/SIGNIFICANCE: New data reveal that Eleonora's falcons do return to the natal colonies in their first year and young birds are able to breed. However, in contrast to previous hypothesis, the highly specialized strategy of this and other ecologically similar species, as well as the virtual lack of food during winter at breeding areas prevent them from becoming sedentary on islands. Although the ultimate mechanisms underlying the process of sedentarization remain poorly understood, the evidence provided reveal the existence of important trade-offs associated with ecological specialization that may become particularly relevant in the present context of global change.
Ammar, Khalaf Nour Abd El-Wahed
2015-04-01
Apharyngostrigea ardeolina and Echinoparyphium recurvatum are two important digenean parasites that were recovered from small intestine of grey heron with an infection rate (16.2%) and (8.8%) respectively. The surface topography of two species was redescribed by both light and scanning electron microscopy. Using SEM studies showed that the body surface of two trematodes were covered by contact receptors, several types of sensory tegumental papillae which may have useful function in orientation and feeding through increasing the surface area of absorption, could also play a role in sensation or in selection of the materials for ingestion by the fluke. The head collar of E. recurvatum is reniform in shape, bearing uninterrupted double row of 41 collar finger-like spines, a total including 4 end group ones on both ventral corners., tegumental spines were tongue-shaped without a terminal tip.
Directory of Open Access Journals (Sweden)
Seema Mihrshahi
2017-01-01
Full Text Available Abstract Background Reducing the prevalence of obesity and chronic disease are important priorities. Maori and Pacific Islander communities living in Australia have higher rates of obesity and chronic disease than the wider Australian population. This study aims to assess the effectiveness of the Good Start program, which aims to improve knowledge, attitudes and practices related to healthy eating and physical activity amongst Maori and Pacific Islander communities living in Queensland. Methods The intervention was delivered to children aged 6–19 years (N = 375 in schools by multicultural health workers. Class activities focused on one message each term related to healthy eating and physical activity using methods such as cooking sessions and cultural dance. The evaluation approach was a quantitative uncontrolled pre-post design. Data were collected each term pre- and post-intervention using a short questionnaire. Results There were significant increases in knowledge of correct servings of fruit and vegetables, knowledge of sugar and caffeine content of common sugar-sweetened drinks, recognition of the consequences of marketing and upsizing, and the importance of controlling portion size (all P < 0.05. There was also increases in knowledge of physical activity recommendations (P < 0.001, as well as the importance of physical activity for preventing heart disease (P < 0.001 and improving self-esteem (P < 0.001. In terms of attitudes, there were significant improvements in some attitudes to vegetables (P = 0.02, and sugar-sweetened drinks (P < 0.05. In terms of practices and behaviours, although the reported intake of vegetables increased significantly (P < 0.001, the proportion of children eating discretionary foods regularly did not change significantly, suggesting that modifying the program with an increased emphasis on reducing intake of junk food may be beneficial. Conclusion The study has shown that the Good
International Nuclear Information System (INIS)
Cooper, M.B.; Duggleby, J.C.
1980-12-01
Radiation surveys of the Monte Bello Islands test site in Western Australia, and the Emu test site in South Australia, were carried out in 1972 and 1978. The results have been published in ARL reports ARL/TR--010 and ARL/TR--012. The detailed field and analytical data which formed the basis of those publications are given
HEALTH COVER, THE CASE OF MARTIN AND CAROLINA IN AUSTRALIA
Directory of Open Access Journals (Sweden)
Maximiliano E KORSTANJE
2014-07-01
Full Text Available This research examines, from a qualitative perspective, some public opinion related to issues associated with the management of a tensed situation. In that process, it identifies some of the subtle differences in the Anglo-Latino cultural expectations. Martin, an Argentine tourist, contracted the Gullien-Barre syndrome in Australia, while enjoying his honeymoon vacation on a Tasmanian island with his partner Carolina. With the passing of days, Martin lost his mobility and was finally hospitalized in emergency. Doctors induced Martin into a coma temporarily because his muscles were paralyzed by the action of the virus. Health costs were more expensive than the family could absorb in Australia. The family had to request the intervention of the Argentine embassy and chancellery for help. In other words, this incident contrasts two world views: hospitality as the institution that historically developed to care and protect travelers versus hospitality as the commercial practice of exploitation.
Islam, M Mofizul; Oni, Helen T; Lee, K S Kylie; Hayman, Noel; Wilson, Scott; Harrison, Kristie; Hummerston, Beth; Ivers, Rowena; Conigrave, Katherine M
2018-03-29
Aboriginal and Torres Strait Islander Community Controlled Health Services (ACCHSs) around Australia have been asked to standardise screening for unhealthy drinking. Accordingly, screening with the 3-item AUDIT-C (Alcohol Use Disorders Identification Test-Consumption) tool has become a national key performance indicator. Here we provide an overview of suitability of AUDIT-C and other brief alcohol screening tools for use in ACCHSs. All peer-reviewed literature providing original data on validity, acceptability or feasibility of alcohol screening tools among Indigenous Australians was reviewed. Narrative synthesis was used to identify themes and integrate results. Three screening tools-full AUDIT, AUDIT-3 (third question of AUDIT) and CAGE (Cut-down, Annoyed, Guilty and Eye-opener) have been validated against other consumption measures, and found to correspond well. Short forms of AUDIT have also been found to compare well with full AUDIT, and were preferred by primary care staff. Help was often required with converting consumption into standard drinks. Researchers commented that AUDIT and its short forms prompted reflection on drinking. Another tool, the Indigenous Risk Impact Screen (IRIS), jointly screens for alcohol, drug and mental health risk, but is relatively long (13 items). IRIS has been validated against dependence scales. AUDIT, IRIS and CAGE have a greater focus on dependence than on hazardous or harmful consumption. Detection of unhealthy drinking before harms occur is a goal of screening, so AUDIT-C offers advantages over tools like IRIS or CAGE which focus on dependence. AUDIT-C's brevity suits integration with general health screening. Further research is needed on facilitating implementation of systematic alcohol screening into Indigenous primary healthcare.
A history of mass spectrometry in Australia
Energy Technology Data Exchange (ETDEWEB)
Downard, K.M.; de Laeter, J.R. [University of Sydney, Sydney, NSW (Australia)
2005-09-01
An interest in mass spectrometry in Australia can be traced back to the 1920s with an early correspondence with Francis Aston who first visited these shores a decade earlier. The region has a rich tradition in both the development of the field and its application, from early measurements of ionization and appearance potentials by Jim Morrison at the Council for Scientific and Industrial Research (CSIR) around 1950 to the design and construction of instrumentation including the first use of a triple quadrupole mass spectrometer for tandem mass spectrometry, the first suite of programs to simulate ion optics (SIMION), the development of early TOF/TOF instruments and orthogonal acceleration and the local design and construction of several generations of a sensitive high-resolution ion microprobe (SHRIMP) instrument. Mass spectrometry has been exploited in the study and characterization of the constituents of this nation's unique flora and fauna from Australian apples, honey, tea plant and eucalyptus oil, snake, spider, fish and frog venoms, coal, oil, sediments and shale, environmental studies of groundwater to geochronological dating of limestone and granite, other terrestrial and meteoritic rocks and coral from the Great Barrier Reef. This article traces the history of mass spectrometry in its many guises and applications in the island continent of Australia. It focuses on contributions of scientists who played a major role in the early establishment of mass spectrometry in Australia. In general, those who are presently active in the field, and whose histories are incomplete, have been mentioned at best only briefly despite their important contributions to the field.
Gastrointestinal parasites of feral cats from Christmas Island.
Adams, P J; Elliot, A D; Algar, D; Brazell, R I
2008-01-01
To investigate the gastrointestinal parasites present in feral cats on Christmas Island, with particular interest in the protozoan parasite Toxoplasma gondii. Faecal and serum samples were collected from 28 and 25 cats respectively that were trapped as part of an ongoing eradication program being run on Christmas Island by the Department of Environment and Conservation. Faecal samples were screened microscopically for helminth and protozoan parasites. Serum samples were screened for antibodies to T gondii using a commercial indirect immunofluorescence assay (IFA) and a latex agglutination test (LAT). The most common helminth parasites detected were Toxocara cati (present in 15 of 28 faecal samples), Strongyloides sp (13/28), Aelurostrongylus abstrusus, (7/28), an unidentified capillarid (6/28) and Ancylostoma sp (4/28). Based on serology, T gondii was the most common parasite detected (protozoan or otherwise) with antibodies detected in 24 serum samples by IFA and 23 serum samples by LAT. Cats on Christmas Island harbour many of the helminth and protozoan parasites reported from feral cats elsewhere in Australia. The high seroprevalence of T gondii in these cats indicates a high level of exposure to the parasite in this environment.
Directory of Open Access Journals (Sweden)
Arianne Reis
2013-11-01
Full Text Available This paper compares and contrasts the management systems and governance structures of two island sites with national and international World Heritage recognition: Lord Howe Island (off the mid-east coast of Australia and Fernando de Noronha (off the north-east coast of Brazil. Using historical and contemporary references, the paper explores the manner in which two distinct approaches to governance are implicated in the daily living of community members, and considers their socioeconomic activities. We use the case of tourism and World Heritage management as examples of the complexities involved in the different forms of governance structures adopted by these two small oceanic islands: similar in nature and official status, but significantly different when the outcomes of their governance practices are analysed. In the final part of the paper, we suggest mechanisms and approaches that can promote sustainable local engagement with island issues.
Cryptosporidiosis: A Disease of Tropical and Remote Areas in Australia.
Directory of Open Access Journals (Sweden)
Aparna Lal
2015-09-01
Full Text Available Cryptosporidiosis causes gastroenteritis and is transmitted to humans via contaminated water and food, and contact with infected animals and people. We analyse long-term cryptosporidiosis patterns across Australia (2001-2012 and review published Australian studies and jurisdictional health bulletins to identify high risk populations and potential risk factors for disease. Using national data on reported cryptosporidiosis, the average annual rate of reported illness was 12.8 cases per 100 000 population, with cycles of high and low reporting years. Reports of illness peak in summer, similar to other infectious gastrointestinal diseases. States with high livestock densities like New South Wales and Queensland also record a spring peak in illnesses. Children aged less than four years have the highest rates of disease, along with adult females. Rates of reported cryptosporidiosis are highest in the warmer, remote regions and in Aboriginal and Torres Strait Islander populations. Our review of 34 published studies and seven health department reports on cryptosporidiosis in Australia highlights a lack of long term, non-outbreak studies in these regions and populations, with an emphasis on outbreaks and risk factors in urban areas. The high disease rates in remote, tropical and subtropical areas and in Aboriginal and Torres Strait Islander populations underscore the need to develop interventions that target the sources of infection, seasonal exposures and risk factors for cryptosporidiosis in these settings. Spatial epidemiology can provide an evidence base to identify priorities for intervention to prevent and control cryptosporidiosis in high risk populations.
Mills, Jane; Felton-Busch, Catrina; Park, Tanya; Maza, Karen; Mills, Frances; Ghee, McCauley; Hitchins, Marnie; Chamberlain-Salaun, Jennifer; Neuendorf, Nalisa
2014-01-01
Attempts to recruit Aboriginal and Torres Strait Islander students into nursing degrees have made minimal impact on the number of registered nurses working in Australia's healthcare sector. Yet increasing the number of Indigenous nurses remains one of the most important objectives in strategies to close the health gap between Indigenous and…
Hierarchical genetic structure of the introduced wasp Vespula germanica in Australia.
Goodisman, M A; Matthews, R W; Crozier, R H
2001-06-01
The wasp Vespula germanica is a highly successful invasive pest. This study examined the population genetic structure of V. germanica in its introduced range in Australia. We sampled 1320 workers and 376 males from 141 nests obtained from three widely separated geographical areas on the Australian mainland and one on the island of Tasmania. The genotypes of all wasps were assayed at three polymorphic DNA microsatellite markers. Our analyses uncovered significant allelic differentiation among all four V. germanica populations. Pairwise estimates of genetic divergence between populations agreed with the results of a model-based clustering algorithm which indicated that the Tasmanian population was particularly distinct from the other populations. Within-population analyses revealed that genetic similarity declined with spatial distance, indicating that wasps from nests separated by more than approximately 25 km belonged to separate mating pools. We suggest that the observed genetic patterns resulted from frequent bottlenecks experienced by the V. germanica populations during their colonization of Australia.
New flags, upward forces and sheltered harbours: The new ‘Great Game’ in the Pacific Islands region
Directory of Open Access Journals (Sweden)
Kowasch, Matthias
2014-03-01
Full Text Available The centre of the global economy and the US-geostrategic focus seem to be shifting to the Asia-Pacific region. The present paper deals with the role of Pacific Island states in this new ‘Great Game’ between China and Western powers. Pacific Island states have a long tradition in building non-confrontational and open ties with rival powers. While only four countries in the Pacific have known mineral resources, others depend mainly on tourism, fisheries and remittances. China is interested in the vast mineral resources in the Pacific Island region, visible in increasing investment. Nevertheless, Australia remains the principal economic and key security partner for most of the Island states. Besides a painful colonial history, unequal distribution of mining benefits and social disparities are reasons for independence movements. Besides a painful colonial history, unequal distribution of mining benefits and social disparities are reasons for independence movements that are another issue in Pacific Island politics.
Directory of Open Access Journals (Sweden)
Kaveh Deilami
2016-08-01
Full Text Available Numerous studies have identified associations between the surface urban heat island (SUHI effect (i.e., SUHI, hereinafter is referred to as UHI and urban growth, particularly changes in land cover patterns. This research questions their causal links to answer a key policy question: If cities restrict urban expansion and encourage people to live within existing urban areas, will that help in controlling UHI? The question has been answered by estimating four models using data from Brisbane, Australia: Model 1—cross-sectional ordinary least square (OLS regression—to examine the association between the UHI effect and land cover patterns in 2013; Model 2—cross-sectional geographically weighted regression (GWR—to examine whether the outputs generated from Model 1 possess significant spatial variations; Model 3—longitudinal OLS—to examine whether changes in land cover patterns led to changes in UHI effects between 2004 and 2013; and Model 4—longitudinal GWR—to examine whether the outputs generated from Model 3 vary significantly over space. All estimations were controlled for potential confounding effects (e.g., population, employment and dwelling densities. Results from the cross-sectional OLS and GWR models were consistent with previous findings and showed that porosity is negatively associated with the UHI effect in 2013. In contrast, population density has a positive association. Results from the longitudinal OLS and GWR models confirm their causal linkages and showed that an increase in porosity level reduced the UHI effect, whereas an increase in population density increased the UHI effect. The findings suggest that even a containment of population growth within existing urban areas will lead to the UHI effect. However, this can be significantly minimized through proper land use planning, by creating a balance between urban and non-urban uses of existing urban areas.
High resolution record of the Last Glacial Maximum in eastern Australia
Petherick, Lynda; Moss, Patrick; McGowan, Hamish
2010-05-01
A continuous, high resolution (average ca. 22 year) record encompassing the Last Glacial Maximum (LGM) has been developed using multiple proxies (aeolian sediment flux, grain size, pollen and charcoal) in lake sediment from Tortoise Lagoon (TOR), North Stradbroke Island, Queensland, Australia. The presence of Asteraceae tubilifloreae and spineless Asteraceae (common indicators of glacial conditions in Australia) at TOR indicates significantly cooler temperatures (mean annual temperature up to 6oC lower than today). In addition to the palaeoclimatic reconstruction, a record of palaeodust transport pathways for eastern Australia was developed using ICP-MS trace element analysis and geochemical "fingerprinting" of TOR aeolian sediment to continental dust source areas. Vectors between dominant dust source areas and North Stradbroke Island allowed the reconstruction of the position and intensity of LGM dust transport pathways. Furthermore, changes in likely synpotic scale conditions can be postulated based on the position of the dust transport corridors. Similarities between the vegetation at TOR during the LGM and that at temperate sites e.g. Caledonia Fen, Victoria (Kershaw et al. 2007), Redhead Lagoon, New South Wales (Williams et al. 2006) and Barrington Tops, New South Wales (Sweller and Martin 2001) suggests that this record reflects regional conditions across southeastern Australia. The TOR record also correlates well with that from nearby Native Companion Lagoon which suggests that the LGM was actually an extended period of ca. 8 - 10 kyr, characterised by 2 periods of increased aridity (ca. 30 - 26.5 kyr and 21 - 19.5 kyr) (Petherick et al. 2008). A growing number of records from across the Southern Hemisphere e.g. New Zealand (Suggate and Almond 2003; Alloway et al. 2007; Newnham et al. 2007), Chile (Denton et al. 1999), Antarctica (Röthlisberger et al. 2002; EPICA 2006) and Australia (Smith 2009) also show evidence that the LGM encompassed a longer period of
Ivers, Rebecca Q; Hunter, Kate; Clapham, Kathleen; Coombes, Julieann; Fraser, Sarah; Lo, Serigne; Gabbe, Belinda; Hendrie, Delia; Read, David; Kimble, Roy; Sparnon, Anthony; Stockton, Kellie; Simpson, Renee; Quinn, Linda; Towers, Kurt; Potokar, Tom; Mackean, Tamara; Grant, Julian; Lyons, Ronan A; Jones, Lindsey; Eades, Sandra; Daniels, John; Holland, Andrew J A
2015-01-01
Introduction Although Aboriginal and Torres Strait Islander children in Australia have higher risk of burns compared with non-Aboriginal children, their access to burn care, particularly postdischarge care, is poorly understood, including the impact of care on functional outcomes. The objective of this study is to describe the burden of burns, access to care and functional outcomes in Aboriginal and Torres Strait Islander children in Australia, and develop appropriate models of care. Methods and analysis All Aboriginal and Torres Strait Islander children aged under 16 years of age (and their families) presenting with a burn to a tertiary paediatric burn unit in 4 Australian States (New South Wales (NSW), Queensland, Northern Territory (NT), South Australia (SA)) will be invited to participate. Participants and carers will complete a baseline questionnaire; follow-ups will be completed at 3, 6, 12 and 24 months. Data collected will include sociodemographic information; out of pocket costs; functional outcome; and measures of pain, itch and scarring. Health-related quality of life will be measured using the PedsQL, and impact of injury using the family impact scale. Clinical data and treatment will also be recorded. Around 225 participants will be recruited allowing complete data on around 130 children. Qualitative data collected by in-depth interviews with families, healthcare providers and policymakers will explore the impact of burn injury and outcomes on family life, needs of patients and barriers to healthcare; interviews with families will be conducted by experienced Aboriginal research staff using Indigenous methodologies. Health systems mapping will describe the provision of care. Ethics and dissemination The study has been approved by ethics committees in NSW, SA, NT and Queensland. Study results will be distributed to community members by study newsletters, meetings and via the website; to policymakers and clinicians via policy fora, presentations and
Vision and foraging in cormorants: more like herons than hawks?
Directory of Open Access Journals (Sweden)
Craig R White
Full Text Available BACKGROUND: Great cormorants (Phalacrocorax carbo L. show the highest known foraging yield for a marine predator and they are often perceived to be in conflict with human economic interests. They are generally regarded as visually-guided, pursuit-dive foragers, so it would be expected that cormorants have excellent vision much like aerial predators, such as hawks which detect and pursue prey from a distance. Indeed cormorant eyes appear to show some specific adaptations to the amphibious life style. They are reported to have a highly pliable lens and powerful intraocular muscles which are thought to accommodate for the loss of corneal refractive power that accompanies immersion and ensures a well focussed image on the retina. However, nothing is known of the visual performance of these birds and how this might influence their prey capture technique. METHODOLOGY/PRINCIPAL FINDINGS: We measured the aquatic visual acuity of great cormorants under a range of viewing conditions (illuminance, target contrast, viewing distance and found it to be unexpectedly poor. Cormorant visual acuity under a range of viewing conditions is in fact comparable to unaided humans under water, and very inferior to that of aerial predators. We present a prey detectability model based upon the known acuity of cormorants at different illuminances, target contrasts and viewing distances. This shows that cormorants are able to detect individual prey only at close range (less than 1 m. CONCLUSIONS/SIGNIFICANCE: We conclude that cormorants are not the aquatic equivalent of hawks. Their efficient hunting involves the use of specialised foraging techniques which employ brief short-distance pursuit and/or rapid neck extension to capture prey that is visually detected or flushed only at short range. This technique appears to be driven proximately by the cormorant's limited visual capacities, and is analogous to the foraging techniques employed by herons.
Characterizing Lithospheric Thickness in Australia using Ps and Sp Scattered Waves
Ford, H. A.; Fischer, K. M.; Rychert, C. A.
2008-12-01
The purpose of this study is to constrain the morphology of the lithosphere-asthenosphere boundary throughout Australia using scattered waves. Prior surface wave studies have shown a correlation between lithospheric thickness and the three primary geologic provinces of Australia, with the shallowest lithosphere located beneath the Phanerozoic province to the east, and the thicker lithosphere located beneath the Proterozoic and Archean regions. To determine lithospheric thickness, waveform data from twenty permanent broadband stations spanning mainland Australia and the island of Tasmania were analyzed using Ps and Sp migration techniques. Waveform selection for each station was based on epicentral distance (35° to 80° for Ps and 55° to 80° for Sp), and event depth (no greater than 300 km for Sp). For both Ps and Sp a simultaneous deconvolution was performed on the data for each of the twenty stations, and the resulting receiver function for each station was migrated to depth. Data were binned with epicentral distance to differentiate direct discontinuity phases from crustal reverberations (for Ps) and other teleseismic arrivals (for Sp). Early results in both Ps and Sp show a clear Moho discontinuity at most stations in addition to sharp, strong crustal reverberations seen in many of the Ps images. In the eastern Phanerozoic province, a strong negative phase at 100-105 km is evident in Ps for stations CAN and EIDS. The negative phase lies within a depth range that corresponds to the negative velocity gradient between fast lithosphere and slow asthenosphere imaged by surface waves. We therefore think that it is the lithosphere- asthenosphere boundary. On the island of Tasmania, a negative phase at 70-75 km in Ps images at stations TAU and MOO also appears to be the lithosphere-asthenosphere boundary. In the Proterozoic and Archean regions of the Australian continent, initial results for both Ps and Sp migration indicate clear crustal phases, but significantly
Hoffman, David J.; Henny, Charles J.; Hill, Elwood F.; Grove, Robert A.; Kaiser, James L.; Stebbins, Katherine R.
2009-01-01
A 10-year study (1997-2006) was conducted to evaluate reproduction and health of aquatic birds in the Carson River Basin of northwestern Nevada (on the U.S. Environmental Protection Agency Natural Priorities List) due to high mercury (Hg) concentrations from past mining activities. This part of the study evaluated physiological associations with blood Hg in young snowy egrets (Egretta thula) and black-crowned night-herons (Nycticorax nycticorax), and organ biochemistry and histopathological effects in snowy egrets on Lahontan Reservoir (LR) from the period 2002-2006. LR snowy egret geometric mean total Hg concentrations (μg/g ww) ranged from 1.5 to 4.8 for blood, 2.4 to 3.1 liver, 1.8 to 2.5 kidneys, 1.7 to 2.4 brain, and 20.5 to 36.4 feathers over these years. For night-herons, mean Hg for blood ranged from 1.6 to 7.4. Significant positive correlations were found between total Hg in blood and five plasma enzyme activities of snowy egrets suggesting hepatic stress. Histopathological findings revealed vacuolar changes in hepatocytes in LR snowy egrets as well as correlation of increased liver inflammation with increasing blood and tissue Hg. Hepatic oxidative effects were manifested by decreased hepatic total thiol concentration and glutathione reductase activity and elevated hepatic thiobarbituric acid-reactive substances (TBARS), a measure of lipid peroxidation. However, other hepatic changes indicated compensatory mechanisms in response to oxidative stress, including decreased oxidized glutathione (GSSG) concentration and decreased ratio of GSSG to reduced glutathione. In young black-crowned night-herons, fewer correlations were apparent. In both species, positive correlations between blood total Hg and plasma uric acid and inorganic phosphorus were suggestive of renal stress, which was supported by histopathological findings. Both oxidative effects and adaptive responses to oxidative stress were apparent in kidneys and brain. Vacuolar change and inflammation in
Zhou, Yihui; Yin, Ge; Asplund, Lillemor; Stewart, Kathryn; Rantakokko, Panu; Bignert, Anders; Ruokojärvi, Päivi; Kiviranta, Hannu; Qiu, Yanling; Ma, Zhijun; Bergman, Åke
2017-06-01
Polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) are highly toxic to humans and wildlife. In the present study, PCDD/Fs were analyzed in the eggs of whiskered terns (Chlidonias hybrida), and genetically identified eggs from black-crowned night herons (Nycticorax nycticorax) sampled from two lakes in the Yangtze River Delta area, China. The median toxic equivalent (TEQ) of PCDD/Fs were 280 (range: 95-1500) and 400 (range: 220-1100) pg TEQ g -1 lw (WHO, 1998 for birds) in the eggs of black-crowned night heron and whiskered tern, respectively. Compared to known sources, concentrations of PCDDs relative to the sum of PCDD/Fs in bird eggs, demonstrated high abundance of octachlorodibenzo-p-dioxin (OCDD), 1,2,3,4,6,7,8-heptaCDD and 1,2,3,6,7,8-hexaCDD indicating pentachlorophenol (PCP), and/or sodium pentachlorophenolate (Na-PCP) as significant sources of the PCDD/Fs. The presence of polychlorinated diphenyl ethers (PCDEs), hydroxylated and methoxylated polychlorinated diphenyl ethers (OH- and MeO-PCDEs, known impurities in PCP products), corroborates this hypothesis. Further, significant correlations were found between the predominant congener CDE-206, 3'-OH-CDE-207, 2'-MeO-CDE-206 and OCDD, indicating a common origin. Eggs from the two lakes are sometimes used for human consumption. The WHO health-based tolerable intake of PCDD/Fs is exceeded if eggs from the two lakes are consumed regularly on a weekly basis, particularly for children. The TEQs extensively exceed maximum levels for PCDD/Fs in hen eggs and egg products according to EU legislation (2.5 pg TEQ g -1 lw). The results suggest immediate action should be taken to manage the contamination, and further studies evaluating the impacts of egg consumption from wild birds in China. Likewise, studies on dioxins and other POPs in common eggs need to be initiated around China. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Cribb, Thomas H; Bray, Rodney A; Hall, Kathryn A; Cutmore, Scott C
2015-09-01
Species of the faustulid genus Antorchis Linton, 1911 of the tropical Indo-West Pacific are reviewed. We recognise five species in the region, including a novel form. Antorchis nasonis n. sp. is described from Naso annulatus (Quoy & Gaimard) and N. tonganus (Valenciennes) on the southern Great Barrier Reef (GBR). We interpret specimens reported from Naso hexacanthus (Bleeker) from Japan as the same species. This species appears to be the only faustulid known from acanthurid fishes and differs from all other species in the genus in having the prominent dorsal genital invagination close to the posterior end of the body. In addition, new host and locality records are reported for two described species of Antorchis, A. pomacanthi (Hafeezullah & Siddiqi, 1970) and A. tsushimaensis (Machida, 1971). The wide distribution of A. pomacanthi was further demonstrated by the generation of identical ITS2 rDNA sequences for specimens from Ningaloo Reef off Western Australia, off Lizard and Heron Islands (GBR) and off New Caledonia, localities separated by up to 5,300 km. The host-specificity of the genus is considered.
Kiyokawa, S.; Ito, T.; Ikehara, M.; Yamaguchi, K. E.; Naraoka, H.; Onoue, T.; Horie, K.; Sakamoto, R.; Aihara, Y.; Miki, T.
2013-12-01
The 3.2-3.1 Ga Dixon island-Cleaverville formations are well-preserved Banded Iron Formation (BIF) within hydrothermal oceanic sequence at oceanic island arc setting (Kiyokawa et al., 2002, 2006, 2012). The stratigraphy of the Dixon Island (3195+15Ma) -Cleaverville (3108+13Ma) formations shows the well preserved environmental condition at the Mesoarchean ocean floor. The stratigraphy of these formations are formed about volcano-sedimentary sequences with hydrothermal chert, black shale and banded iron formation to the top. Based on the scientific drilling of DXCL project at 2007 and 2011, detail lithology between BIF sequence was clearly understood. Four drilling holes had been done at coastal sites; the Dixon Island Formation is DX site (100m) and the Cleaverville Formation is CL2 (40m), CL1 (60m) and CL3 (200m) sites and from stratigraphic bottom to top. Coarsening and thickening upward black shale-BIF sequences are well preserved of the stratigraphy form the core samples. The Dixon Island Formation consists komatiite-rhyolite sequences with many hydrothermal veins and very fine laminated cherty rocks above them. The Cleaverville Formation contains black shale, fragments-bearing pyroclastic beds, white chert, greenish shale and BIF. The CL3 core, which drilled through BIF, shows siderite-chert beds above black shale identified before magnetite lamination bed. U-Pb SHRIMP data of the tuff in lower Dixon Island Formation is 3195+15 Ma and the pyroclastic sequence below the Cleaverville BIF is 3108+13 Ma. Sedimentation rate of these sequence is 2-8 cm/ 1000year. The hole section of the organic carbon rich black shales below BIF are similar amount of organic content and 13C isotope (around -30per mill). There are very weak sulfur MIF signal (less 0.2%) in these black shale sequence. Our result show that thick organic rich sediments may be triggered to form iron rich siderite and magnetite iron beds. The stratigraphy in this sequence quite resemble to other Iron
Probabilistic estimation of dune retreat on the Gold Coast, Australia
Palmsten, Margaret L.; Splinter, Kristen D.; Plant, Nathaniel G.; Stockdon, Hilary F.
2014-01-01
Sand dunes are an important natural buffer between storm impacts and development backing the beach on the Gold Coast of Queensland, Australia. The ability to forecast dune erosion at a prediction horizon of days to a week would allow efficient and timely response to dune erosion in this highly populated area. Towards this goal, we modified an existing probabilistic dune erosion model for use on the Gold Coast. The original model was trained using observations of dune response from Hurricane Ivan on Santa Rosa Island, Florida, USA (Plant and Stockdon 2012. Probabilistic prediction of barrier-island response to hurricanes, Journal of Geophysical Research, 117(F3), F03015). The model relates dune position change to pre-storm dune elevations, dune widths, and beach widths, along with storm surge and run-up using a Bayesian network. The Bayesian approach captures the uncertainty of inputs and predictions through the conditional probabilities between variables. Three versions of the barrier island response Bayesian network were tested for use on the Gold Coast. One network has the same structure as the original and was trained with the Santa Rosa Island data. The second network has a modified design and was trained using only pre- and post-storm data from 1988-2009 for the Gold Coast. The third version of the network has the same design as the second version of the network and was trained with the combined data from the Gold Coast and Santa Rosa Island. The two networks modified for use on the Gold Coast hindcast dune retreat with equal accuracy. Both networks explained 60% of the observed dune retreat variance, which is comparable to the skill observed by Plant and Stockdon (2012) in the initial Bayesian network application at Santa Rosa Island. The new networks improved predictions relative to application of the original network on the Gold Coast. Dune width was the most important morphologic variable in hindcasting dune retreat, while hydrodynamic variables, surge and
Taxonomic uncertainty and the loss of biodiversity on Christmas Island, Indian Ocean.
Eldridge, Mark D B; Meek, Paul D; Johnson, Rebecca N
2014-04-01
The taxonomic uniqueness of island populations is often uncertain which hinders effective prioritization for conservation. The Christmas Island shrew (Crocidura attenuata trichura) is the only member of the highly speciose eutherian family Soricidae recorded from Australia. It is currently classified as a subspecies of the Asian gray or long-tailed shrew (C. attenuata), although it was originally described as a subspecies of the southeast Asian white-toothed shrew (C. fuliginosa). The Christmas Island shrew is currently listed as endangered and has not been recorded in the wild since 1984-1985, when 2 specimens were collected after an 80-year absence. We aimed to obtain DNA sequence data for cytochrome b (cytb) from Christmas Island shrew museum specimens to determine their taxonomic affinities and to confirm the identity of the 1980s specimens. The Cytb sequences from 5, 1898 specimens and a 1985 specimen were identical. In addition, the Christmas Island shrew cytb sequence was divergent at the species level from all available Crocidura cytb sequences. Rather than a population of a widespread species, current evidence suggests the Christmas Island shrew is a critically endangered endemic species, C. trichura, and a high priority for conservation. As the decisions typically required to save declining species can be delayed or deferred if the taxonomic status of the population in question is uncertain, it is hoped that the history of the Christmas Island shrew will encourage the clarification of taxonomy to be seen as an important first step in initiating informed and effective conservation action. © 2013 Society for Conservation Biology.
Ariese, C.E.
2012-01-01
General Introduction The reefs surrounding the Houtman Abrolhos in Western Australia were a notorious hazard to shipping in the seventeenth and eighteenth centuries (fig. 1). The Dutch East India Company (VOC) made sure to mark this island group on its maps and skippers had strict instructions to
Petherick, Lynda M.; McGowan, Hamish A.; Kamber, Balz S.
2009-04-01
The southeast Australian dust transport corridor is the principal pathway through which continental emissions of dust from central and eastern Australia are carried to the oceans by the prevailing mid-latitude westerly circulation. The analysis of trace elements of aeolian dust, preserved in lake sediment on North Stradbroke Island, southeast Queensland, is used to reconstruct variation in the intensity and position of dust transport to the island over the past 25,000 yrs. Separation of local and long traveled dust content of lake sediments is achieved using a unique, four-element (Ga, Ni, Tl and Sc) separation method. The local and continental chronologies of aeolian deposition developed by this study show markedly different records, and indicate varied responses to climate variability on North Stradbroke Island (local aeolian sediment component) and in eastern and central Australia (long traveled dust component). The provenance of the continental component of the record to sub-geologic catchment scales was accomplished using a ternary mixing model in which the chemical identification of dusts extracted, from the lake sediments, was compared to potential chemical characteristics of surface dust from the source areas using 16 trace elements. The results indicate that the position and intensity of dust transport pathways during the late Quaternary varied considerably in response to changing atmospheric circulation patterns as well as to variations in sediment supply to dust source areas, which include the large anabranching river systems of the Lake Eyre and Murray-Darling Basins.
Fire regimes and vegetation change in tropical northern Australia during the late-Holocene
Mackenzie, Lydia; Moss, Patrick; Ulm, Sean; Sloss, Craig; Heijnis, Henk; Jacobsen, Geraldine
2016-04-01
This study explores the impact of human occupation and abandonment on fire regimes and vegetation communities in the South Wellesley Islands, Gulf of Carpentaria, tropical northern Australia, using charcoal and pollen analysis from four sediment records. Pollen analysis from wetland sediments reveal vegetation succession from mangrove communities to hypersaline mudflats and open woodlands occurred during the late-Holocene. Aquatic species replaced salt tolerant species as the prograding shoreline and dune development formed the Marralda wetlands by 800 cal a BP on the south east coast of Bentinck Island. Wetlands developed on the north and west coast by 500 and 450 cal a BP, respectively. The timing of wetland initiation indicates localised late-Holocene sea level regression, stabilisation and coastal plain development in the Gulf of Carpentaria. Wetland initiation encouraged permanent human occupation of the South Wellesley archipelago, with ongoing archaeological research finding permanent occupation in the last 1500 years, followed by a significant increase in sites from 700 years ago, which peaks over the last 300 years. Macro-charcoal (>125μm) accumulation rates provide a record of fire intensity and frequency across the Island. Both local and regional fire events increase in the last 700 years as traditional owners occupied the Island, with local fires occurring every 104 and 74 years on average (N= 4 and 5 respectively). In the 1950's traditional Indigenous Kaiadilt fire management practices ceased, with the frequency and peak magnitude of fire events significantly increasing and vegetation communities becoming more open. The South Wellesley Islands were unoccupied until the 1980's and were not influenced by European occupation. This study of an Island ecosystem during the late-Holocene provides insight into the effect of human presence and fire regimes on vegetation composition and distribution in a fire resilient environment.
The One-humped Camel in the Canary Islands: History and Present Status
Directory of Open Access Journals (Sweden)
Wilson, RT.
2015-01-01
Full Text Available The one-humped camel (Camelus dromedarius L. is not indigenous to the Canary Islands but based on historical references was introduced at the very beginning of the fifteenth century. The camel thrived in the subtropical dry environment. A long period of isolation from other animals of the same species meant that the animals were virtually disease free. This made the Islands an ideal base for exporting camels to new areas such that camels from the Canaries went to Peru in the sixteenth century, to Brazil in the eighteenth century, Venezuela and Bolivia in the early part of the nineteenth century and Australia in 1840. Camels went to several Caribbean islands in the middle of the nineteenth century. More recently (late twentieth and early twenty-first centuries some animals were exported from the islands to mainland Europe, notably France, Spain and the Netherlands, and to South America. Camels have been used in military operations, as transport and draught animals in support of agriculture and have found a role in the tourist industry. In early 2013 there were some 1,300 camels distributed over four of the larger islands of the archipelago in herds varying in size from a single animal to herds of as many as 150 head: a large group of about 400 heads kept in a Safari Park on the island of Fuerteventura is considered as the national conservation herd. The "Canary" camel has recently been shown to be genetically distinct from most other populations and it has been proposed that it should be designated as a distinct breed.
Czech Academy of Sciences Publication Activity Database
Hladil, Jindřich; Gemperle, Antonín; Carew, J. L.; Bosák, Pavel; Slavík, Ladislav; Pruner, Petr; Charvatova, K.; Mylroie, J. E.; Jell, J. S.
2003-01-01
Roč. 5, Abstracts of the Contributions of the EGS-AGU-EUG Joint Assembly Nice. (2003), s. Abstract Number 05312 ISSN 1029-7006. [EGS-AGU-EUG Joint Assembly. 06.04.2003-11.04.2003, EGS-AGU-EUG Joint Assembly] R&D Projects: GA AV ČR IAA3013209 Institutional research plan: CEZ:AV0Z3013912 Keywords : microbial diagenesis * carbonate platforms * Quaternary Subject RIV: DB - Geology ; Mineralogy http://www.cosis.net/abstracts/EAE03/05312/EAE03-J-05312-1.pdf
HIV diagnoses in indigenous peoples: comparison of Australia, Canada and New Zealand.
Shea, Beverley; Aspin, Clive; Ward, James; Archibald, Chris; Dickson, Nigel; McDonald, Ann; Penehira, Mera; Halverson, Jessica; Masching, Renee; McAllister, Sue; Smith, Linda Tuhiwai; Kaldor, John M; Andersson, Neil
2011-09-01
In industrial countries, a number of factors put indigenous peoples at increased risk of HIV infection. National surveillance data between 1999 and 2008 provided diagnoses for Aboriginal and Torres Strait Islanders (Australia), First Nations, Inuit and Métis (Canada excluding Ontario and Quebec) and Māori (New Zealand). Each country provided similar data for a non-indigenous comparison population. Direct standardisation used the 2001 Canadian Aboriginal male population for comparison of five-year diagnosis rates in 1999-2003 and 2004-2008. Using the general population as denominators, we report diagnosis ratios for presumed heterosexual transmission, men who have sex with men (MSM) and intravenous drug users (IDU). Age standardised HIV diagnosis rates in indigenous peoples in Canada in 2004-2008 (178.1 and 178.4/100 000 for men and women respectively) were higher than in Australia (48.5 and 12.9/100 000) and New Zealand (41.9 and 4.3/100 000). Higher HIV diagnosis rates related to heterosexual contact among Aboriginal peoples, especially women, in Canada confirm a widening epidemic beyond the conventional risk groups. This potential of a generalised epidemic requires urgent attention in Aboriginal communities; available evidence can inform policy and action by all stakeholders. Although less striking in Australia and New Zealand, these findings may be relevant to indigenous peoples in other countries.
Harvesting Australia's mineral wealth
Energy Technology Data Exchange (ETDEWEB)
1982-07-01
Anderson Strathclyde plc is becoming increasingly involved in supplying equipment for the coal industry in Australia. It now has 2 subsidiary companies based in Australia: Anderson Strathclyde Australia and A B Rea.
Ivers, Rebecca Q; Hunter, Kate; Clapham, Kathleen; Coombes, Julieann; Fraser, Sarah; Lo, Serigne; Gabbe, Belinda; Hendrie, Delia; Read, David; Kimble, Roy; Sparnon, Anthony; Stockton, Kellie; Simpson, Renee; Quinn, Linda; Towers, Kurt; Potokar, Tom; Mackean, Tamara; Grant, Julian; Lyons, Ronan A; Jones, Lindsey; Eades, Sandra; Daniels, John; Holland, Andrew J A
2015-10-13
Although Aboriginal and Torres Strait Islander children in Australia have higher risk of burns compared with non-Aboriginal children, their access to burn care, particularly postdischarge care, is poorly understood, including the impact of care on functional outcomes. The objective of this study is to describe the burden of burns, access to care and functional outcomes in Aboriginal and Torres Strait Islander children in Australia, and develop appropriate models of care. All Aboriginal and Torres Strait Islander children aged under 16 years of age (and their families) presenting with a burn to a tertiary paediatric burn unit in 4 Australian States (New South Wales (NSW), Queensland, Northern Territory (NT), South Australia (SA)) will be invited to participate. Participants and carers will complete a baseline questionnaire; follow-ups will be completed at 3, 6, 12 and 24 months. Data collected will include sociodemographic information; out of pocket costs; functional outcome; and measures of pain, itch and scarring. Health-related quality of life will be measured using the PedsQL, and impact of injury using the family impact scale. Clinical data and treatment will also be recorded. Around 225 participants will be recruited allowing complete data on around 130 children. Qualitative data collected by in-depth interviews with families, healthcare providers and policymakers will explore the impact of burn injury and outcomes on family life, needs of patients and barriers to healthcare; interviews with families will be conducted by experienced Aboriginal research staff using Indigenous methodologies. Health systems mapping will describe the provision of care. The study has been approved by ethics committees in NSW, SA, NT and Queensland. Study results will be distributed to community members by study newsletters, meetings and via the website; to policymakers and clinicians via policy fora, presentations and publication in peer-reviewed journals. Published by the BMJ
Men's health and communities of practice in Australia.
Henwood, Maree; Shaw, Amie; Cavanagh, Jillian; Bartram, Timothy; Marjoribanks, Timothy; Kendrick, Madeleine
2017-04-10
Purpose The purpose of this paper is to examine the social opportunities for Aboriginal and Torres Strait Islander men created through Men's Groups/Sheds across urban, regional and remote areas of Australia. Men's Sheds are a safe space, resembling a work-shop setting or backyard shed, where men are encouraged to socialise and participate in health promotion, informal learning and engage in meaningful tasks both individually and at the community level. Design/methodology/approach Explore five case study sites through Wenger's (1998) active communities of practice (CoP). Qualitative methods are presented and analysed; methods comprise semi-structured interviews and yarning circles (focus groups). Five Indigenous leaders/coordinators participated in semi-structured interviews, as well as five yarning circles with a total of 61 Indigenous men. Findings In a societal context in which Indigenous men in Australia experience a number of social and health issues, impeding their quality of life and future opportunities, the central finding of the paper is that the effective development of social relations and socially designed programs through Men's Groups, operating as CoP, may contribute to overcoming many social and health well-being concerns. Originality/value Contributions will provide a better understanding of how Indigenous men are engaging with Men's Sheds, and through those interactions, are learning new skills and contributing to social change.
Integrative Analysis of the Physical Transport Network into Australia.
Directory of Open Access Journals (Sweden)
Robert C Cope
Full Text Available Effective biosecurity is necessary to protect nations and their citizens from a variety of threats, including emerging infectious diseases, agricultural or environmental pests and pathogens, and illegal wildlife trade. The physical pathways by which these threats are transported internationally, predominantly shipping and air traffic, have undergone significant growth and changes in spatial distributions in recent decades. An understanding of the specific pathways and donor-traffic hotspots created by this integrated physical transport network is vital for the development of effective biosecurity strategies into the future. In this study, we analysed the physical transport network into Australia over the period 1999-2012. Seaborne and air traffic were weighted to calculate a "weighted cumulative impact" score for each source region worldwide, each year. High risk source regions, and those source regions that underwent substantial changes in risk over the study period, were determined. An overall risk ranking was calculated by integrating across all possible weighting combinations. The source regions having greatest overall physical connectedness with Australia were Singapore, which is a global transport hub, and the North Island of New Zealand, a close regional trading partner with Australia. Both those regions with large amounts of traffic across multiple vectors (e.g., Hong Kong, and those with high levels of traffic of only one type (e.g., Bali, Indonesia with respect to passenger flights, were represented among high risk source regions. These data provide a baseline model for the transport of individuals and commodities against which the effectiveness of biosecurity controls may be assessed, and are a valuable tool in the development of future biosecurity policy.
International Nuclear Information System (INIS)
Fergusson, C.L.; Fanning, C.M.
2002-01-01
Ordovician quartz turbidites of the Lachlan Fold Belt in southeastern Australia accumulated in a marginal sea and overlapped an adjoining island arc (Molong volcanic province) developed adjacent to eastern Gondwana. The turbidite succession in the Shoalhaven River Gorge, in the southern highlands of New South Wales, has abundant outcrop and graptolite sites. The succession consists of, from the base up, a unit of mainly thick-bedded turbidites (undifferentiated Adaminaby Group), a unit with conspicuous bedded chert (Numeralla Chert), a unit with common thin-bedded turbidites [Bumballa Formation (new name)] and a unit of black shale (Warbisco Shale). Coarse to very coarse sandstone in the Bumballa Formation is rich in quartz and similar to sandstone in the undifferentiated Adaminaby Group. Detrital zircons from sandstone in the Bumballa Formation, and from sandstone at a similar stratigraphic level from the upper Adaminaby Group of the Genoa River area in eastern Victoria, include grains as young as 453-473 Ma, slightly older than the stratigraphic ages. The dominant detrital ages are in the interval 500-700 Ma (Pacific Gondwana component) with a lessor concentration of Grenville ages (1000-1300 Ma). This pattern resembles other Ordovician sandstones from the Lachlan Fold Belt and also occurs in Triassic sandstones and Quaternary sands from eastern Australia. The Upper Ordovician succession is predominantly fine grained, which reflects reduced clastic inputs from the source in the Middle Cambrian to earliest Ordovician Ross-Delamerian Fold Belts that developed along the eastern active margin of Gondwana. Development of subduction zones in the Late Ordovician marginal sea are considered to be mainly responsible for the diversion of sediment and the resulting reduction in the supply of terrigenous sand to the island arc and eastern part of the marginal sea. Sixty zircons from each sample were analysed and results are presented. Methods following standard procedures
Neubeck, Lis; Lin, Stella Hsi-Man; Ferry, Cate; Gallagher, Robyn
2016-04-01
A core curriculum for the continuing professional development of nurses has recently been published by the Council on Cardiovascular Nursing and Allied Professions of the European Society of Cardiology. This core curriculum was envisaged to bridge the educational gap between qualification as a nurse and an advance practice role. In addition, the shared elements and international consensus on core themes creates a strong pathway for nursing career development that is directly relevant to Australia. Education programs for nurses in Australia must meet the mandatory standards of the Australian Nursing and Midwifery Accreditation Council (ANMAC), but without a national core curriculum, there can be considerable variation in the content of such courses. The core curriculum is developed to be adapted locally, allowing the addition of nationally relevant competencies, for example, culturally appropriate care of Aboriginal and Torres Strait Islander individuals. Two existing specialist resources could be utilised to deliver a tailored cardiovascular core curriculum; the Heart Education Assessment and Rehabilitation Toolkit (HEART) online (www.heartonline.org.au) and HeartOne (www.heartone.com.au). Both resources could be further enhanced by incorporating the core curriculum. The release of the European core curriculum should be viewed as a call to action for Australia to develop a core curriculum for cardiovascular nurses. Copyright © 2015 Australian and New Zealand Society of Cardiac and Thoracic Surgeons (ANZSCTS) and the Cardiac Society of Australia and New Zealand (CSANZ). Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Andrzej Grzywacz
2014-12-01
Full Text Available Passeromyia is a muscid genus previously known from the Old World Afrotropical and Oriental regions and eastwards from Australia and the West Pacific. The genus is known from nest-dwelling larvae which may be parasites of the nestlings. This study was aimed to identify of the Passeromyia species in the Iranian Persian Gulf Islands.The flies were collected during April 2010 to March 2011 on the 4 Iranian Persian Gulf islands, Greater Tunb, Lesser Tunb, Abu-Mousa and Qeshm with fly bottle trap and entomological net.During this sampling, 18 representatives of P. heterochaeta, a species with free-living haematophagous larvae, have been collected. The species is reported herein from Greater Tunb, Lesser Tunb, Abu-Mousa and Qeshm islands.This is the first Palaearctic record of the species as well as the first report of the genus Passeromyia from the Palaearctic Region.
Ground for concern. Australia's uranium and human survival. [Australia
Energy Technology Data Exchange (ETDEWEB)
Elliot, M
1977-01-01
The book contains a number of articles which propose that Australia should not mine and export its uranium in order to influence the nuclear establishment against uncontrollable proliferation. Topics covered include: uranium mining in Australia, reactor safety, nuclear wastes, nuclear weapons proliferation, nuclear theft and the politics of the nuclear industry.
International Nuclear Information System (INIS)
Cuevas-Cubria, C.; Schultz, A.; Petchey, R.; Beaini, F.; New, R.
2011-04-01
Securing access to affordable, reliable and clean energy is one of the great challenges facing governments around the world. The Australian Government is committed to ensuring the security of Australia's domestic energy systems as a fundamental part of Australia's social and economic prosperity. Energy in Australia 2011 is a key reference for anyone with an interest in Australian energy issues. It provides a detailed overview of energy in Australia from production to consumption, and serves as a useful resource to inform industry, government and the community.
West, Roianne; Foster, Kim; Usher, Kim
2016-01-01
Australian Aboriginal and Torres Strait Islander people have higher rates of morbidity and mortality thanother Australians. One proposed strategy to improve this situation is to increase the participation ofAboriginal and Torres Strait Islander people, including Aboriginal and Torres Strait Islander nurses, inthe health workforce. Although the numbers of Aboriginal and Torres Strait Islander students under-taking tertiary nursing courses have increased, completion rates have not kept pace. The study aimedto describe Aboriginal and Torres Strait Islander nursing students’ experiences of enablers for successfulcourse completion and to develop a narrative of student experience. A qualitative study using a strengths-based approach with a narrative analysis of semi-structured interview data was conducted across fourschools of Nursing in Queensland, Australia. Eight final-year Aboriginal and Torres Strait Islander nursingstudents volunteered to participate in the study. A collective story with the overarching plotline Creatingwalking tracks to success was developed. Six threads of experience emerged: Making a difference, Valu-ing Indigeneity, Healing strength of connections, Resisting racism, Embracing support, and perseveringtowards completion. Key success factors included resilient attributes, building supportive connectionsand having positive expectations of the future, along with sustained institutional support from Aboriginaland Torres Strait Islander nurse academics and clinicians. Development of tailored resilience-buildingtraining for Aboriginal and Torres Strait Islander nursing students and appointment of Aboriginal andTorres Strait Islander academics in Schools of Nursing that include such students may facilitate futuresuccessful completions in other programs.
Unravelling feeding territoriality in the Little Blue Heron, Egretta caerulea, in Cananéia, Brazil
Directory of Open Access Journals (Sweden)
E Moralez-Silva
Full Text Available Habitat use by the Little Blue Heron (Egretta caerulea and discovery of feeding territoriality are discussed here. The results showed the existence of a territorial individual defending an area (2,564.46 ± 943.56 m² close to the mangrove, and non-territorial individuals (9.17 ± 2.54 in the rest of a demarcated area (mean area for the non-territorial: 893.25 ± 676.72. A weak positive correlation (r = 0.47, df = 46, p < 0.05 was found between the overlapping of territorial and non-territorial individuals (2.85 ± 3.07 m² and the mean overlapped area for territorial individuals (171.41 ± 131.40 m². Higher capture (1.52 ± 1.14 × 1.00 ± 1.37 catches/minutes and success rates (0.45 ± 0.31 × 0.21 ± 0.27 and lower energy expenditure rates (45.21 ± 14.96 × 51.22 ± 14.37 steps/minutes; and 3.65 ± 2.55 × 4.94 ± 3.28 stabs/minutes were observed for individuals foraging in areas close to the mangrove. The results suggest that the observed territorial behaviour is more related to a number of food parameters than to intruder pressure, and also that the observed territoriality might be related to defense of areas with higher prey availability.
Mackie, F E; Kainer, G; Adib, N; Boros, C; Elliott, E J; Fahy, R; Munro, J; Murray, K; Rosenberg, A; Wainstein, B; Ziegler, J B; Singh-Grewal, D
2015-01-01
The objectives of this paper are to prospectively determine the incidence of paediatric systemic lupus erythematosus (pSLE) in Australia as well as describe the demographics, clinical presentation and one-year outcome. Newly diagnosed cases of pSLE were ascertained prospectively from October 2009 to October 2011 through the Australian Paediatric Surveillance Unit (a national monthly surveillance scheme for notification of childhood rare diseases) as well as national subspecialty groups. Questionnaires were sent to notifying physicians at presentation and at one year. The annual incidence rate was 0.32 per 10(5) children aged less than 16 years. The incidence was significantly higher in children of Asian or Australian Aboriginal and Torres Strait Islander parents. Approximately one-third of children underwent a renal biopsy at presentation and 7% required dialysis initially although only one child had end-stage kidney disease (ESKD) at one-year follow-up. The incidence of pSLE in Australia is comparable to that worldwide with a significantly higher incidence seen in children of Asian and Australian Aboriginal and Torres Strait Islander backgrounds. Renal involvement is common but progression to ESKD, at least in the short term, is rare. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.
Maple-Brown, Louise J; Hughes, Jaquelyne T; Lu, Zhong X; Jeyaraman, Kanakamani; Lawton, Paul; Jones, Graham Rd; Ellis, Andrew; Sinha, Ashim; Cass, Alan; MacIsaac, Richard J; Jerums, George; O'Dea, Kerin
2014-01-01
Low levels of serum 25-hydroxy vitamin D (25(OH)D), have been associated with development of type 2 diabetes and cardiovascular disease (CVD); however there are limited data on serum 25(OH)D in Indigenous Australians, a population at high risk for both diabetes and CVD. We aimed to assess levels of serum 25(OH)D in Aboriginal and Torres Strait Islander Australians and to explore relationships between 25(OH)D and cardio-metabolic risk factors and diabetes. 592 Aboriginal and/or Torres Strait Islander Australian participants of The eGFR (estimated glomerular filtration rate) Study, a cross-sectional analysis of a cohort study performed in 2007-2011, from urban and remote centres within communities, primary care and tertiary hospitals across Northern Territory, Far North Queensland and Western Australia. Assessment of serum 25(OH)D, cardio-metabolic risk factors (central obesity, diabetes, hypertension, history of cardiovascular disease, current smoker, low HDL-cholesterol), and diabetes (by history or HbA1c ≥6.5%) was performed. Associations were explored between 25(OH)D and outcome measures of diabetes and number of cardio-metabolic risk factors. The median (IQR) serum 25(OH)D was 60 (45-77) nmol/L, 31% had 25(OH)D 72 nmol/L, respectively) after adjusting for known cardio-metabolic risk factors. The percentage of 25(OH)D levels Aboriginal and Torres Strait Islander Australians from Northern and Central Australia. Low 25(OH)D level was associated with adverse cardio-metabolic risk profile and was independently associated with diabetes. These findings require exploration in longitudinal studies.
Reef, Ruth; Pandolfi, John M; Lovelock, Catherine E
2012-08-01
The growth rate hypothesis (GRH) links growth rates with organism elemental stoichiometry. Support for the GRH was found for many animal species, but less so for plants. This is the first study to test the GRH in macroalgae. Tropical coral reef macroalgae from three lineages, Caulerpa serrulata (Chlorophyta), Laurencia intricata (Rhodophyta), and Sargassum polyphyllum (Phaeophyceae) were grown enriched with nitrogen or phosphorous and under control conditions at Heron Island on the Great Barrier Reef, Australia. Growth rate, photosynthesis, nucleic acid composition, and elemental stoichiometry were measured. Nutrient enrichment had positive effects on photosynthetic rates and on investment in RNA. However, growth rate was not correlated with either photosynthetic rates or RNA content; thus, we did not find support for the GRH in tropical macroalgae. Macroalgae, especially L. intricata, accumulated P to very high levels (>0.6% of dry weight). The growth rate response to tissue P concentrations was unimodal. Above 0.21%, P accumulation had negative effects on growth. Nitrogen was not stored, but evidence of futile cycling was observed. The capacity to store large amounts of P is probably an adaptation to the low and patchy nutrient environment of the tropical oceans.
Cancer epidemiology in the pacific islands - past, present and future.
Moore, Malcolm A; Baumann, Francine; Foliaki, Sunia; Goodman, Marc T; Haddock, Robert; Maraka, Roger; Koroivueta, Josefa; Roder, David; Vinit, Thomas; Whippy, Helen J D; Sobue, Tomotaka
2010-01-01
The Pacific Ocean contains approximately 25,000 islands, stretching from Papua New Guinea to Easter Island, populated by mixtures of Melanesians, Micronesians and Polynesians, as well as migrant groups from Asia and Europe. The region encompasses a third of the surface of the earth although it is sparsely populated at a total of around 9 million. With the exception of some of the more populated islands, such as New Zealand and Hawaii, few surveys of chronic diseases have been conducted, but it is increasingly recognized that obesity, diabetes and associated conditions are emerging public health problems and clearly there is a need for cooperation to optimize control. Here we focus on cancer registry and epidemiological findings for Papua New Guinea, the Solomons, Vanuatu, Samoa, New Caledonia, Fiji, Polynesia, French Polynesia, Maori in New Zealand, Native Hawaiians, Micronesia, including Guam, and Aboriginal populations in Australia as assessed by PubMed searches and perusal of the International Agency for Cancer Research descriptive epidemiology database. Overall, the major cancers in males are oral and liver in Papua New Guinea and the Solomon Islands, and lung and prostate elsewhere (Fiji being exceptional in demonstrating a predominance of esophageal cancer), whereas in females it is breast and either cervix or lung, depending largely on whether cervical cancer screening program is active. In certain locations thyroid cancer is also very prevalent in females. The similarities and variation point to advantages for collaborative research to provide the evidence-base for effective cancer control programs in the region.
Socioeconomic disparities in the mental health of Indigenous children in Western Australia
Directory of Open Access Journals (Sweden)
Shepherd Carrington CJ
2012-09-01
Full Text Available Abstract Background The burden of mental health problems among Aboriginal and Torres Strait Islander children is a major public health problem in Australia. While socioeconomic factors are implicated as important determinants of mental health problems in mainstream populations, their bearing on the mental health of Indigenous Australians remains largely uncharted across all age groups. Methods We examined the relationship between the risk of clinically significant emotional or behavioural difficulties (CSEBD and a range of socioeconomic measures for 3993 Indigenous children aged 4–17 years in Western Australia, using a representative survey conducted in 2000–02. Analysis was conducted using multivariate logistic regression within a multilevel framework. Results Almost one quarter (24% of Indigenous children were classified as being at high risk of CSEBD. Our findings generally indicate that higher socioeconomic status is associated with a reduced risk of mental health problems in Indigenous children. Housing quality and tenure and neighbourhood-level disadvantage all have a strong direct effect on child mental health. Further, the circumstances of families with Indigenous children (parenting quality, stress, family composition, overcrowding, household mobility, racism and family functioning emerged as an important explanatory mechanism underpinning the relationship between child mental health and measures of material wellbeing such as carer employment status and family financial circumstances. Conclusions Our results provide incremental evidence of a social gradient in the mental health of Aboriginal and Torres Strait Islander children. Improving the social, economic and psychological conditions of families with Indigenous children has considerable potential to reduce the mental health inequalities within Indigenous populations and, in turn, to close the substantial racial gap in mental health. Interventions that target housing quality, home
Gypsum ground: a new occurrence of gypsum sediment in playas of central Australia
Xiang Yang Chen; Bowler, James M.; Magee, John W.
1991-06-01
There are many playas (dry salt lakes) in arid central Australia (regional rainfall about 250 mm/y and pan evaporation around 3000 mm/y). Highly soluble salts, such as halite, only appear as a thin (several centimetres thick), white, ephemeral efflorescent crust on the dry surface. Gypsum is the major evaporite precipitating both at present and preserved in sediment sequences. One type of gypsum deposit forms a distinctive surface feature, which is here termed "gypsum ground". It consists of a thick (up to 80 cm) gypsum zone which rises from the surrounding smooth white playa surface and is overlain by a heaved brown crust. The gypsum zone, with an average gypsum content above 60%, consists of pure gypsum sublayers and interlayered clastic bands of sandy clay. The gypsum crystals are highly corroded, especially in the direction parallel to the c-axis and on the upper sides where illuviated clay has accumulated in corrosion hollows. Overgrowth parallel to the a- and b-axes is very common, forming highly discoidal habits. These secondary changes (corrosion and overgrowth) are well-developed in the vadose zone and absent from crystals below the long-term watertable (depth around 40 cm). These crystal characteristics indicate a rainwater leaching process. At Lake Amadeus, one of the largest playas (800 km 2) of central Australia, such gypsum ground occupies 16% of the total area. The gypsum ground is interpreted as an alteration of a pre-existing gypsum deposit which probably extended across the whole playa before breaking down, leaving a playa marginal terrace and several terrace islands within the gypsum ground. This pre-existing gypsum deposit, preserved in the residual islands, consists of pure, pale, sand-sized lenticular crystals. It is believed to have been deposited during an episode of high regional watertable, causing active groundwater seepage and more frequent surface brine in the playa. A later fall in watertable, probably resulting from climatic change
International Nuclear Information System (INIS)
Quiros, Laia; Ruiz, Xavier; Sanpera, Carolina; Jover, Lluis; Pina, Benjamin
2008-01-01
The frequency of micronuclei (MN) in peripheral erythrocytes was tested for 59 heron nestlings (Ardea purpurea, Egretta garzetta and Bubulcus ibis) sampled at two areas (polluted and reference) on the River Ebro (NE Spain) and at its Delta during Spring 2006. Flow-cytometry analysis revealed higher (three- to six-fold) MN counts in samples from the most polluted site relative to samples from the reference area. Samples from the Delta showed intermediate values. Age, morphometric parameters (weight, tarsus size and bill-head length) and maturation status showed no significant differences among the different populations for each species; nor were they correlated with MN levels. The data suggest that elevated levels of MN in chicks in impacted areas reflected the chemical pollution of their nesting sites. The use of nestlings for this assay appears to be a convenient, non-destructive method to assess the impact of pollution in natural bird populations. - Frequency of micronucleated erythrocytes in peripheral blood of waterbird nestlings correlates with chemical pollution loads in their nesting sites
PV-diesel hybrid powers island nature reserve
Energy Technology Data Exchange (ETDEWEB)
Corkish, R. [University of New South Wales (Australia). Centre for Photovoltaic Engineering
2001-03-01
A short paper reports how by replacing a diesel-electric power supply with a PV-diesel-battery hybrid system, the diesel generator running time has been cut by 87%. The system provides all the power needs (including for the lighthouse, the lighthouse keeper's family, and a few visitors) on Montague Island nature reserve off Australia. The old system consisted of a pair of diesel-fuelled generator sets rated at 10 and 20 kVA. The main purposes for the changes were environmental, safety (in terms of transporting diesel fuel), and financial. Liquefied petroleum gas is now used for water heating and cooking. The reasons for not going for wind power are given. A diagram shows load and array power profiles for a May day in 1999.
Algae Reefs in Shark Bay, Western Australia, Australia
1990-01-01
Numerous algae reefs are seen in Shark Bay, Western Australia, Australia (26.0S, 113.5E) especially in the southern portions of the bay. The south end is more saline because tidal flow in and out of the bay is restricted by sediment deposited at the north and central end of the bay opposite the mouth of the Wooramel River. This extremely arid region produces little sediment runoff so that the waters are very clear, saline and rich in algae.
EPA's Heat Island Effect Site provides information on heat islands, their impacts, mitigation strategies, related research, a directory of heat island reduction initiatives in U.S. communities, and EPA's Heat Island Reduction Program.
DEFF Research Database (Denmark)
Whittaker, Robert James; Fernández-Palacios, José María; Matthews, Thomas J.
2017-01-01
Islands provide classic model biological systems. We review how growing appreciation of geoenvironmental dynamics of marine islands has led to advances in island biogeographic theory accommodating both evolutionary and ecological phenomena. Recognition of distinct island geodynamics permits gener...
Persistent organic pollutants in soils and sediments from James Ross Island, Antarctica
International Nuclear Information System (INIS)
Klanova, Jana; Matykiewiczova, Nina; Macka, Zdenek; Prosek, Pavel; Laska, Kamil; Klan, Petr
2008-01-01
Soil and sediment samples from James Ross Island were analyzed for their PCB, OCP and PAH contents. Soil concentrations ranged between 0.51 and 1.82 ng g -1 for seven indicator PCB congeners, between 0.49 and 1.34 ng g -1 for HCH congeners, between 0.51 and 3.68 ng g -1 for the sum of p,p'-DDT, DDE, and DDD, and between 34.9 and 171 ng g -1 for the sum of 16 EPA PAHs. Sediment levels from 0.32 to 0.83 ng g -1 were found for PCBs, from 0.14 to 0.76 ng g -1 for HCHs, from 0.19 to 1.15 ng g -1 for DDTs, and from 1.4 to 205 ng g -1 for PAHs. A prevalence of low-mass PAHs, less chlorinated PCBs, and more volatile chemicals indicates that the long-range atmospheric transport from populated areas of Africa, South America, and Australia is the most probable contamination source for the solid matrices in James Ross Island. - A survey of soil, sediment and air contamination in James Ross Island, Antarctica serves as a baseline study for evaluation of an anthropogenic impact of the new research facility
Tenarife Island, Canary Island Archipelago, Atlantic Ocean
1991-01-01
Tenarife Island is one of the most volcanically active of the Canary Island archipelago, Atlantic Ocean, just off the NW coast of Africa, (28.5N, 16.5W). The old central caldera, nearly filled in by successive volcanic activity culminating in two stratocones. From those two peaks, a line of smaller cinder cones extend to the point of the island. Extensive gullies dissect the west side of the island and some forests still remain on the east side.
Runstadler, J A; Angles, J M; Pedersen, N C
2006-11-01
The genetic polymorphism at the dog leucocyte antigen (DLA) class II loci DQA1, DQB1 and DRB1 was studied in a large genetically diverse population of feral and wild-type dogs from the large island nations of Indonesia (Bali), Australia and New Guinea (Bali street dog, dingo and New Guinea singing dog, respectively). Sequence-based typing (SBT) of the hypervariable region of DLA-DRB1, -DQA1 and -DQB1 alleles was used to determine genetic diversity. No new DQA1 alleles were recognized among the three dog populations, but five novel DLA-DRB1 and 2 novel DLA-DQB1 allele sequences were detected. Additional unknown alleles were postulated to exist in Bali street dogs, as indicated by the large percentage of individuals (15%-33%) that had indeterminate DRB1, DQA1 and DQB1 alleles by SBT. All three groups of dogs possessed alleles that were relatively uncommon in conventional purebreds. The New Guinea singing dog and dingo shared alleles that were not present in the Bali street dogs. These findings suggested that the dingo was more closely related to indigenous dogs from New Guinea. Feral dog populations, in particular large ones such as that of Bali, show genetic diversity that existed prior to phenotypic selection for breeds originating from their respective regions. This diversity needs to be identified and maintained in the face of progressive Westernization. These populations deserve further study as potential model populations for the evolution of major histocompatibility complex alleles, for the study of canine genetic diversity, for the development of dog breeds and for studies on the comigration of ancestral human and dog populations.
Pockett, Rosalie; Peate, Michelle; Hobbs, Kim; Dzidowska, Monika; L Bell, Melanie; Baylock, Brandi; Epstein, Irwin
2016-12-01
To describe the demographics, professional characteristics, self-reported professional development needs and research involvement of oncology social workers in Australia and to describe perceived barriers to provision of quality psychosocial care. A cross-sectional online survey was administered to social workers working in the oncology field who were contacted through three professional organizations; the Australian Association of Social Workers, Oncology Social Work Australia and the Psycho-oncology Co-operative Research Group, the University of Sydney. A snowball recruitment method was adopted to maximize the sample size. Two thirds of respondents had over 10 years professional practice experience but with lesser experience in oncology settings. Twenty-eight percent had post-graduate qualifications. Professional development needs were reported as moderate or high by 68% of respondents. No association between professional needs and work setting was found. Years of experience in oncology practice and living in an urban area increased the likelihood of involvement in research. Barriers to psychosocial care included poor understandings of the social work role, time constraints and an inadequate number of social work positions. In this first Australian study of the social work oncology workforce, the results demonstrated active, well-qualified and experienced social workers providing frontline services to people with cancer and their caregivers in geographically diverse locations across Australia. Inadequate resources and a lack of integrated psychosocial care were identified as barriers to comprehensive cancer care. The need for Aboriginal and Torres Strait Islander social workers was identified as an urgent workforce priority. © 2016 John Wiley & Sons Australia, Ltd.
DEFF Research Database (Denmark)
Hackett, Maree L.; Hackett, Maree L.; Farnbach, Sara
2016-01-01
for a study aiming to determine the validity, sensitivity and specificity of the culturally adapted 9-item Patient Health Questionnaire (aPHQ-9). Methods and analysis Cross-sectional validation study. A total of 500 people who self-identify as Aboriginal and/or Torres Strait Islander, are ≥18 €...years of age......© Published by the BMJ Publishing Group Limited. Introduction A freely available, culturally valid depression screening tool is required for use by primary care services across Australia to screen for depression in Aboriginal and/or Torres Strait Islander populations. This is the protocol...
Recent developments in suicide prevention among the Indigenous peoples of Australia.
Dudgeon, Pat; Holland, Christopher
2018-04-01
Suicide is an Aboriginal and Torres Strait Islander (hereafter 'Indigenous') population health issue. Over 2015-2016, the Aboriginal and Torres Strait Islander Suicide Prevention Project (ATSISPEP) aimed to identify success factors in Indigenous suicide prevention. For non-Indigenous practitioners working with indigenous clients at risk of suicide, ATSISPEP identified important considerations to make treatment more effective. The start is acknowledging the differences in the historical, cultural, political, social and economic experiences of Indigenous peoples, and their greater exposure to trauma, psychological distress and risks to mental health. These mental health difficulties are specific and more prevalent amongst Indigenous peoples and communities due to the ongoing impacts of colonisation in Australia including a range of social determinants impacting on the well-being of Indigenous peoples today. Working effectively with Indigenous clients also includes being able to establish culturally safe work environments, and the ability of non-Indigenous practitioners to work in a culturally competent and trauma-informed manner. There are also considerations regarding time protocols and client follow-up. Further, postvention responses might be required. Supporting selective suicide prevention activity among younger people (and other groups at increased risk) and community-level work is an important complement to working with Indigenous individuals at risk of suicide.
1992-01-01
This easterly looking view shows the seven major volcanic islands of the Canary Island chain (28.0N, 16.5W) and offers a unique view of the islands that have become a frequent vacation spot for Europeans. The northwest coastline of Africa, (Morocco and Western Sahara), is visible in the background. Frequently, these islands create an impact on local weather (cloud formations) and ocean currents (island wakes) as seen in this photo.
Gofton, Alexander W; Waudby, Helen P; Petit, Sophie; Greay, Telleasha L; Ryan, Una M; Irwin, Peter J
2017-08-01
Anaplasma and Ehrlichia spp. are tick-borne pathogens that can cause severe disease in domestic animals, and several species are responsible for emerging zoonoses in the northern hemisphere. Until recently, the only members of these genera reported in Australia (A. marginale, A. centrale, and A. platys) were introduced from other continents, through the importation of domestic animals and their associated ticks. However, unique Anaplasma and Ehrlichia 16S rRNA gene sequences were recently detected for the first time in native Australian ticks, particularly in Amblyomma triguttatum subsp. ticks from southwest Western Australia (WA). We used molecular techniques to survey Am. triguttatum subsp. ticks from four allopatric populations in southern and western Australia for Anaplasma and Ehrlichia species, and described here the phylogeny of these novel organisms. An A. bovis variant (genotype Y11) was detected in ticks from two study sites; Yanchep National Park (12/280, 4.3%) and Barrow Island (1/69, 1.4%). Phylogenetic analysis of 16S rRNA and groEL gene sequences concluded that A. bovis genotype Y11 is a unique genetic variant, distinct from other A. bovis isolates worldwide. Additionally, a novel Ehrlichia species was detected in Am. triguttatum subsp. from three of the four study sites; Yanchep National Park (18/280, 6.4%), Bungendore Park (8/46, 17.4%), and Innes National Park (9/214, 4.2%), but not from Barrow Island. Phylogenetic analysis of 16S, groEL, gltA, and map1 gene sequences revealed that this Ehrlichia sp. is most closely related to, but clearly distinct from, E. ruminantium and Ehrlichia sp. Panola Mountain. We propose to designate this new species 'Candidatus Ehrlichia occidentalis'. Anaplasma bovis genotype Y11 and 'Candidatus E. occidentalis' are the first Anaplasma and Ehrlichia species to be recorded in native Australian ticks. Copyright © 2017 Elsevier GmbH. All rights reserved.
Climate Change. Solutions for Australia
Energy Technology Data Exchange (ETDEWEB)
Coleman, T.; Hoegh-Guldberg, O.; Karoly, D.; Lowe, I.; McMichael, T.; Mitchell, C.; Pearman, G.; Scaife, P.; Reynolds, A. (eds.)
2004-06-01
The Australian Climate Group was convened in late 2003 by WWF Australia and the Insurance Australia Group (IAG) in response to the increasing need for action on climate change in Australia. This group proposes a set of solutions to lower the risk that climate change will reach a dangerous level.
The ecology of and fishery for Coryphaena spp. in the waters around Australia and New Zealand
Directory of Open Access Journals (Sweden)
Michael J. Kingsford
1999-12-01
Full Text Available Two species of dolphinfish, Coryphaena hippurus and Coryphaena equiselis, are found in Australian waters and off the north-eastern coast of New Zealand. Both species (also called Mahi-mahi, or dorado are generally found in tropical waters, but only C. hippurus is captured in southern waters (to 34°S. Dolphinfish are caught by recreational and commercial fishers, using either trolled or baited lines. Most catch records do not allow the identification of fish to the species level. Dolphinfish are also an incidental catch of foreign and domestic pelagic fisheries (e.g. long-lining for tunas and billfishes and 10-70 tonnes are taken per year in the Australia-New Zealand region. Although Coryphaena are known to associate with objects (e.g. traps for carangids and navigation buoys and are a focus for recreational fishers, Fish Attraction Devices (FADs are not used by commercial fishers off the coast of Australia and New Zealand. FADs are, however, used by fishers in the Pacific Islands. Recreational catches of Coryphaena may exceed the commercial catch in some areas. Good data for New South Wales, Australia, gave estimates of 11.7 and 12.7 tonnes of Coryphaena caught in 1994 and 1995 respectively, which represented 1.1-1.8x the recorded commercial catch. Approximately ~12,600 fish have been tagged since 1973 around Australia and data on returns are only available for 108 fish (0.86% recovery. Tagged Coryphaena were found to move distances of up to 440 kilometres and at estimated speeds of up to 20 kilometres per day. The time between tag and recapture varied from 0-360 days and fish moved 0-440 kilometres. The majority of fish were caught around the same drifting object near where they were tagged. The collection of Coryphaena larvae in Queensland and New South Wales, along the east coast of Australia, indicates spawning in these waters. Most larvae have been collected in the austral summer and autumn and typically in surface waters well offshore
Directory of Open Access Journals (Sweden)
Braun Michael P.
2016-08-01
Full Text Available The Australasian region is a centre of biodiversity and endemism, mainly based on the tropical climate in combination with the large amount of islands. During the Pleistocene, islands of the Sahul Shelf (Australia, New Guinea, Aru Islands had been part of the same land mass, while islands within the Wallacea (Lesser Sunda Islands, Moluccas, Sulawesi etc. remained isolated. We investigated biogeographical avian diversification patterns of two species complexes across the Wallacea and the Sahul Shelf: the Eclectus Parrot Eclectus roratus Wagler, 1832, and the Rainbow Lorikeet Trichoglossus haematodus Linnaeus, 1771. Both species are represented by a large number of described geographical subspecies. We used mitochondrial cytochrome b (cyt b sequences for phylogenetic and network analysis to detect biogeographic roles of islands and avian diversification patterns. The number of threatened taxa in this region is increasing rapidly and there is an urgent need for (sub-species conservation in this region. Our study provides first genetic evidence for treating several island taxa as distinct species. In both species complexes similar genetic patterns were detected. Genetic diversification was higher across the islands of the Wallacea than across the islands of the Sahul Shelf. Divergence in E. roratus can be dated back about 1.38 million years ago, whereas in the younger T. haematodus it was 0.80 million years ago. Long distance dispersal was the most likely event for distribution patterns across the Wallacea and Sahul Shelf. The geographic origin of the species-complex Eclectus roratus spp. is supposed to be Wallacean, but for the species-complex Trichoglossus haematodus spp. it is supposed to be non-Wallacean. Trichoglossus euteles, so far considered a distinct species, clearly belongs to the Trichoglossus-haematodus-complex. The only case of sympatry in the complex is the distribution of T. (h. euteles and T. h. capistratus on Timor, which means a
Regional approach to the management of fruit flies in the Pacific Island countries and territories
International Nuclear Information System (INIS)
Allwood, Allan
2000-01-01
Of the 4,500 species of fruit flies (family Tephritidae) world-wide, over 350 species occur in the Pacific region. Of these, at least 25 species are regarded as being of major economic importance to fruit and vegetable production and to international trade within the region. Recognition of the economic importance of fruit flies to horticultural production and trade increased markedly in the 1980s due to the imposition of restrictions on the use of ethylene dibromide (EDB) fumigation by trading partners. This treatment was the mainstay of quarantine treatments for fresh fruits and vegetables susceptible to fruit fly infestations and destined for markets in Australia, New Zealand, USA, Japan and Canada. Small, but economically significant, markets for fresh fruits and vegetables in the Pacific rim countries disappeared because alternative quarantine treatments for EDB fumigation were not available. Countries, such as Cook Islands, Fiji, Tonga and Samoa, looked for modern technologies to overcome these constraints to export. As well as quarantine treatment technologies, procedures new to the Pacific Island countries, such as quality assurance systems and quarantine pathways, had to be included into the production and marketing chains. Quarantine surveillance, particularly for exotic fruit flies, became a prerequisite for trade in fresh fruits and vegetables. The emphasis on fruit flies also regionally increased because of the increasing number of incursions of exotic fruit flies into the region over the past 10-12 years. Outbreaks of exotic fruit flies in the Solomon Islands (1984-85), Nauru (1984-85), Northern Australia (1995 and 1998), New Zealand (1996), French Polynesia (1995-96), and Palau (1995-96) demonstrated the vulnerability of the Pacific Island countries and territories (PICTs) to these incursions. To address the increased threat of introduction of exotic fruit flies through increased tourism and regional travellers, a regional approach to the management
International Nuclear Information System (INIS)
Anon.
1984-01-01
The mining of uranium in Australia is criticised in relation to it's environmental impact, economics and effects on mine workers and Aborigines. A brief report is given on each of the operating and proposed uranium mines in Australia
Australia - a nuclear weapons testing ground
International Nuclear Information System (INIS)
Dobbs, Michael.
1993-01-01
Between 1952 and 1958 Britain conducted five separate nuclear weapons trials in Australia. Australia had the uninhabited wide open spaces and the facilities which such tests need and Britain was able to use its special relationship with Australia to get agreement to conduct atomic tests in Australia and establish a permanent test site at Maralinga. Other non-nuclear tests were conducted between 1953-1963. The story of Britain's involvement in atomic weapons testing in Australia is told through its postal history. Both official and private covers are used to show how the postal communications were established and maintained throughout the test years. (UK)
Multidecadal shoreline changes of atoll islands in the Marshall Islands
Ford, M.
2012-12-01
Atoll islands are considered highly vulnerable to the impacts of continued sea level rise. One of the most commonly predicted outcomes of continued sea level rise is widespread and chronic shoreline erosion. Despite the widespread implications of predicted erosion, the decadal scale changes of atoll island shorelines are poorly resolved. The Marshall Islands is one of only four countries where the majority of inhabited land is comprised of reef and atoll islands. Consisting of 29 atolls and 5 mid-ocean reef islands, the Marshall Islands are considered highly vulnerable to the impacts of sea level rise. A detailed analysis of shoreline change on over 300 islands on 10 atolls was undertaken using historic aerial photos (1945-1978) and modern high resolution satellite imagery (2004-2012). Results highlight the complex and dynamic nature of atoll islands, with significant shifts in shoreline position observed over the period of analysis. Results suggest shoreline accretion is the dominant mode of change on the islands studied, often associated with a net increase in vegetated island area. However, considerable inter- and intra-atoll variability exists with regards to shoreline stability. Findings are discussed with respect to island morphodynamics and potential hazard mitigation and planning responses within atoll settings.
Winterbottom, Richard; Hoese, Douglass F
2015-03-17
The gobiid genus Trimma currently contains 75 valid species, with another 20-30 known but undescribed species. There are 29 species in Australian waters (six undescribed). This paper describes the six new species, and provides redescriptions of most of the 23 previously described species known from the region, as well as a key for all the species. The six new species are: T. insularum (endemic to Cocos (Keeling) Islands), T. kitrinum (Fiji to Great Barrier Reef), T. meristum (Cape York to the Bismark Archipelago and Fiji), T. pentherum (Great Barrier Reef to Fiji and the South-West Islands of Palau), T. readerae (Australia to Japan), and T. xanthum (Palau to Fiji, Great Barrier Reef to Christmas Island). The following 23 species have been recorded from Australian waters, and most are redescribed here: T. anaima (Comores to Fiji), T. annosum (Maldives to the Phoenix Islands, Taiwan to the southern Great Barrier Reef), T. benjamini (southern Vietnam to the Marshall Islands, Samoa and southern Barrier Reef), T. caesiura (Ryukyus through the Marshall Islands to Samoa and Elizabeth Reef on the Lord Howe Rise), T. capostriatum (New Caledonia to eastern Australia and Papua New Guinea), T. maiandros (Java to the Ryukyus, Marshalls to Great Barrier Reef), T. emeryi (Comores to Ryukyus and Samoa), T. fangi (western South China Sea through to the Solomons), T. flavatrum (Ryukyu Islands to Western Australia and Samoa), T. hoesei (Chagos Archipelago, central Indian Ocean to Palau and Solomons), T. lantana (Australia, Solomons, northern New Guinea, South-West Islands of Palau), T. macrophthalmus (Ryukyu Islands to Cocos (Keeling) Islands and Samoa), T. milta (Taiwan to Western Australia, Society Islands and Hawaii), T. nasa (Sumbawa, Indonesia to Fiji), T. necopinum (northern tip of Cape York to Sydney), T. nomurai (Japan to northern Australia and New Caledonia), T. okinawae (western Thailand to Japan and the Phoenix Islands, north-west Australia to the Great Barrier Reef), T
Foundation Investigation for Ground Based Radar Project-Kwajalein Island, Marshall Islands
1990-04-01
iL_ COPY MISCELLANEOUS PAPER GL-90-5 i iFOUNDATION INVESTIGATION FOR GROUND BASED RADAR PROJECT--KWAJALEIN ISLAND, MARSHALL ISLANDS by Donald E...C!assification) Foundatioa Investigation for Ground Based Radar Project -- Kwajalein Island, Marshall Islands 12. PERSONAL AUTHOR(S) Yule, Donald E...investigation for the Ground Based Radar Project -- Kwajalein Island, Marshall Islands , are presented.- eophysical tests comprised of surface refrac- tion
Uranium production in Australia
International Nuclear Information System (INIS)
Fisk, B.G.
1984-01-01
The history of uranium mining and milling in Australia is briefly outlined, particular attention being given to the development of Australia's only two operating mills, Nabarlek and Ranger, and its only operating mine, Ranger. The latter project is used to illustrate the prerequisites for development of the industry and the complex roles of the various parties involved in establishing a new mine: equity holders, customers, financiers, the securities industry, trade unions, and the public. The moves currently being taken to resolve the future of the industry in Australia, particularly the examination of issues relating to Australia's role in the nuclear fuel cycle being conducted by the Australian Science and Technology Council, preclude any firm conclusions being drawn, but the various options open to the government are reviewed and the record of Australian governments and unions and the attitude of the Australian public are described. (Author) (3 tabs., fig.)
McNamara, Bridgette J; Banks, Emily; Gubhaju, Lina; Williamson, Anna; Joshy, Grace; Raphael, Beverley; Eades, Sandra J
2014-12-01
To assess the cross-cultural validity of two Kessler psychological distress scales (K-10 and K-5) by examining their measurement properties among older Aboriginal and Torres Strait Islanders and comparing them to those in non-Aboriginal individuals from NSW Australia. Self-reported questionnaire data from the 45 and Up Study for 1,631 Aboriginal and 231,774 non-Aboriginal people were used to examine the factor structure, convergent validity, internal consistency and levels of missing data of K-10 and K-5. We found excellent agreement in classification of distress of Aboriginal participants by K-10 and K-5 (weighted kappa=0.87), high internal consistency (Cronbach's alpha K-10: 0.93, K-5: 0.88), and factor structures consistent with those for the total Australian population. Convergent validity was evidenced by a strong graded relationship between the level of distress and the odds of: problems with daily activities due to emotional problems; current treatment for depression or anxiety; and poor quality of life. K-10 and K-5 scales are promising tools for measuring psychological distress among Aboriginal and Torres Strait Islanders aged 45 and over in research and clinical settings. © 2014 Public Health Association of Australia.
Australia's approach to monetary policy
Jane Sneddon Little
2002-01-01
According to Australia's Reserve Bank Act, the central bank's broad policy objectives include maintaining the stability of the currency, full employment, and the economic prosperity and welfare of the people of Australia. In 1993 the Reserve Bank of Australia adopted a specific, and thus transparent, inflation target as its operating objective; it aims to keep overall inflation between 2 percent and 3 percent on average over the business cycle.
Migration from India to Australia.
Awasthi, S P; Chandra, A
1994-01-01
"The article examines the contemporary trends and future prospects of migration from India to Australia. The focus is on Indian Settlers and Temporary Entrants admitted to Australia for employment and Indian students admitted to Australia for higher studies. The volume of emigration for permanent residence during the early 1990s has made India one of the leading source countries of migration to Australia. A majority of Indians admitted as Settlers every year join the labor force. Recent data indicate that, among Indian Settlers, there is a preponderance of unsponsored Independent Skilled Migrants. Given the anticipated growth in the number of Indian students, the coming years are likely to witness a spurt in Skilled Temporary Workers from India." excerpt
Roelfsema, C. M.; Phinn, S. R.; Lyons, M. B.; Kovacs, E.; Saunders, M. I.; Leon, J. X.
2013-12-01
Corals and Submerged Aquatic Vegetation (SAV) are typically found in highly dynamic environments where the magnitude and types of physical and biological processes controlling their distribution, diversity and function changes dramatically. Recent advances in the types of satellite image data and the length of their archives that are available globally, coupled with new techniques for extracting environmental information from these data sets has enabled significant advances to be made in our ability to map and monitor coral and SAV environments. Object Based Image Analysis techniques are one of the most significant advances in information extraction techniques for processing images to deliver environmental information at multiple spatial scales. This poster demonstrates OBIA applied to high spatial resolution satellite image data to map and monitor coral and SAV communities across a variety of environments in the Western Pacific that vary in their extent, biological composition, forcing physical factors and location. High spatial resolution satellite imagery (Quickbird, Ikonos and Worldview2) were acquired coincident with field surveys on each reef to collect georeferenced benthic photo transects, over various areas in the Western Pacific. Base line maps were created, from Roviana Lagoon Solomon island (600 km2), Bikini Atoll Marshall Island (800 Km2), Lizard Island, Australia (30 km2) and time series maps for geomorphic and benthic communities were collected for Heron Reef, Australia (24 km2) and Eastern Banks area of Moreton Bay, Australia (200 km2). The satellite image data were corrected for radiometric and atmospheric distortions to at-surface reflectance. Georeferenced benthic photos were acquired by divers or Autonomous Underwater Vehicles, analysed for benthic cover composition, and used for calibration and validation purposes. Hierarchical mapping from: reef/non-reef (1000's - 10000's m); reef type (100's - 1000's m); 'geomorphic zone' (10's - 100's m); to
Directory of Open Access Journals (Sweden)
Sia Rosalind Juo Ling
2017-01-01
Full Text Available Haidian Island, which situated at the Northern part of Haikou City of Hainan Province, is an island within a city. Haidian Island is unique in term of it's development which centered around an university, the Hainan University, besides some others important landmarks, such as Haikou city hospital, Baishamen municipal park, Golf Driving Range etc. All commercials, residential, recreational activities etc are planned to serve Hainan University in particular. The study, taking ‘Haidian Island Area Development Control Plan’ as case study, would like to look into the importance of transportation and traffic planning. The study used observation, site investigation and traffic study methods to gather data needed. Firstly the study analyzed the current state of transportation system for Haidian Island in accordance to the Island Development Control plan and Haikou master plan and identified the problems. Then, the study made some recommendations for these problems. The study highlighted the important of non-motorized, cycling and walking as the main transportation system for an education-based island and as supportive to domestic tourism activities found. The transportation planning suggested by the study took ‘green and low-carbon’ approaches considered the role of University as the core activity in the island.
Champoux, Louise; Boily, Monique
2017-12-31
Since 1991, great blue heron (Ardea herodias) eggs have been collected and analyzed for mercury (Hg), persistent organic contaminants (OCs), brominated and non-brominated flame retardants (FRs) as well as stable isotopes δ 13 C and δ 15 N. In the present study, temporal trends of contaminants were analyzed in eggs sampled in four regions along the St. Lawrence River (Quebec, Canada) and inland sites using new and previously published data. Most contaminants declined significantly over time in most regions. Globally, the highest annual change, -17.5%, was found for pp'-DDD, while the smallest annual decline, -0.54%, was observed for Hg. Concentrations of ΣDDT and ΣFR 8 (sum of 8 congeners) decreased by -11.6% and -7.3%, respectively. Declines in ΣPCBs differed among regions, from -5.6% in the fluvial section to -14.7% in the inland region. The highest concentration of ΣFR 8 was measured in eggs from Grande Ile in the fluvial section of the river in 1996 (2.39μg/g). Stable isotope ratios also showed temporal trends in some regions: δ 13 C decreased in the fluvial section and increased in Gulf region, while δ 15 N decreased in the fluvial section and increased in the upper estuary. Significant positive relationships were found between ΣDDT, ΣPCBs and ΣFRs and δ 15 N and δ 13 C in freshwater colonies, but not in estuarine or marine colonies. These results suggest that changes in trophic level and foraging areas over time were influential factors with respect to contaminant burden in great blue heron eggs in the fluvial section, but not in the other regions. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.
The Australian Bureau of Census and Statistics reported on 27 August 1979 that Australia's total population was 14,376,400 at the end of the first quarter of 1979. Net immigration gain during the same period was 12,700. Natural increase was 32,100--births were 57,100 and deaths were 25,000. In January 1979, Australia introduced a new immigration scheme to improve methods of selecting immigrants. Points are awarded on the basis of personal qualities and employability; an applicant must score 60 out of 100. This scheme supersedes the earlier system under which immigrants were selected on the family reunion criterion and employability. Migrants from Britain and Ireland made up the bulk of the new comers, but their proportion has dropped from 50% in the mid-1960s to 30% in early 1979. In contrast, Asian immigrants have risen from 2% to 22% over the same period. Asian immigration began in the mid-1960s with the relaxation of the "White Australia" policy which barred non-European migrants, and increased when the ban was abolished by Prime Minister Gough Whitlam in 1973.
Harrison, Gillian
2010-01-01
This paper presents a historical perspective to the development of community music in Australia. Finding political support in Australia's progressive arts policies of the late 1970s, community music is discussed as embracing the principles of access and equity and supporting the development of musical skills in the context of social change and…
Islands and non-islands in native and heritage Korean
Directory of Open Access Journals (Sweden)
Boyoung eKim
2016-02-01
Full Text Available To a large extent, island phenomena are cross-linguistically invariable, but English and Korean present some striking differences in this domain. English has wh-movement and Korean does not, and while both languages show sensitivity to wh-islands, only English has island effects for adjunct clauses. Given this complex set of differences, one might expect Korean/English bilinguals, and especially heritage Korean speakers (i.e. early bilinguals whose L2 became their dominant language during childhood to be different from native speakers, since heritage speakers have had more limited exposure to Korean, may have had incomplete acquisition and/or attrition, and may show significant transfer effects from the L2. Here we examine islands in heritage speakers of Korean in the U.S. Through a series of four formal acceptability experiments comparing these heritage speakers with native speakers residing in Korea, we show that the two groups are remarkably similar. Both show clear evidence for wh-islands and an equally clear lack of adjunct island effects. Given the very different linguistic environment that the heritage speakers have had since early childhood, this result lends support to the idea that island phenomena are largely immune to environmental influences and stem from deeper properties of the processor and/or grammar. Similarly, it casts some doubt on recent proposals that islands are learned from the input.
Women and Ultramodern Buddhism in Australia
Directory of Open Access Journals (Sweden)
Anna Halafoff
2018-05-01
Full Text Available Buddhists started arriving in Australia in large numbers during the mid-1800s, and the first Buddhist societies and centres began to be formed in the mid-late 1900s. This paper examines the role of women in bringing Buddhism to and establishing it in Australia. Women have featured prominently in a small amount of scholarship, including Paul Croucher’s (1989 Buddhism in Australia: 1848–1988 and Cristina Rocha and Michelle Barker’s (eds. 2011 edited volume on Buddhism in Australia: Traditions in Change. This paper draws on these sources, but primarily on more recent digital oral histories of prominent Buddhist women and men in Australia, recorded as part of the first stage of the Buddhist Life Stories of Australia project in 2014–2015. These first-hand accounts bring the early female pioneers of Buddhism in Australia to life and provide a rich re-telling of this history with emphasis on women’s contributions to it. We also argue that these women’s experiences can best be understood through a framework of ‘ultramodern Buddhism,’ built upon theories of modern and post-modern Buddhism, as many of these women were trailblazers bridging dualisms of tradition and modernity, Asia and the West, and adhering to both feminist and Buddhist principles.
Class renormalization: islands around islands
International Nuclear Information System (INIS)
Meiss, J.D.
1986-01-01
An orbit of 'class' is one that rotates about a periodic orbit of one lower class with definite frequency. This contrasts to the 'level' of a periodic orbit which is the number of elements in its continued fraction expansion. Level renormalization is conventionally used to study the structure of quasi-periodic orbits. The scaling structure of periodic orbits encircling other periodic orbits in area preserving maps is discussed here. Fixed points corresponding to the accumulation of p/q bifurcations are found and scaling exponents determined. Fixed points for q > 2 correspond to self-similar islands around islands. Frequencies of the island boundary circles at the fixed points are obtained. Importance of this scaling for the motion of particles in stochastic regions is emphasized. (author)
Australia: uranium and nuclear policy
International Nuclear Information System (INIS)
Crick, R.
1991-01-01
Australia's uranium and nuclear policies have gone through several stages of development since the commercialisation of the industry. The early stages laid the foundations and built the superstructure of Australia's uranium development, export and safeguards policies. The uranium industry and other governments have understood the nature and operation of these policies. An important aim of this paper will be to explain the design and current construction stage of policies. This needs to be done against the background of broader industry developments. Within the past twelve months (1989/90) there have been dramatic changes, both within Australia and internationally, which have affected the uranium market. Internationally, we have seen the spot price indicators for uranium fall to an all time low. Within Australia, we have seen the removal of the fixed floor price requirement for the sale of Australia uranium. This was replaced by a requirement that contract prices reflect the market. This change in policy allowed the outcome of several major long-term contract renegotiations to be approved. It also allowed Australian producers to secure several new long-term contracts, despite the overall depressed state of the market. The 'three mines' policy remains in place although only two, Ranger in Northern Territory and Olympic Dare in Southern Australia are currently operating. The biggest unknown is the extent of future uranium demand. (author)
Bird, Jennifer; Rotumah, Darlene; Bennett-Levy, James; Singer, Judy
2017-05-29
In Australia, mental health services are undergoing major systemic reform with eMental Health (eMH) embedded in proposed service models for all but those with severe mental illness. Aboriginal and Torres Strait Islander service providers have been targeted as a national priority for training and implementation of eMH into service delivery. Implementation studies on technology uptake in health workforces identify complex and interconnected variables that influence how individual practitioners integrate new technologies into their practice. To date there are only two implementation studies that focus on eMH and Aboriginal and Torres Strait Islander service providers. They suggest that the implementation of eMH in the context of Aboriginal and Torres Strait Islander populations may be different from the implementation of eMH with allied health professionals and mainstream health services. The objective of this study is to investigate how Aboriginal and Torres Strait Islander service providers in one regional area of Australia used eMH resources in their practice following an eMH training program and to determine what types of eMH resources they used. Individual semistructured qualitative interviews were conducted with a purposive sample of 16 Aboriginal and Torres Strait Islander service providers. Interviews were co-conducted by one indigenous and one non-indigenous interviewer. A sample of transcripts were coded and thematically analyzed by each interviewer and then peer reviewed. Consensus codes were then applied to all transcripts and themes identified. It was found that 9 of the 16 service providers were implementing eMH resources into their routine practice. The findings demonstrate that participants used eMH resources for supporting social inclusion, informing and educating, assessment, case planning and management, referral, responding to crises, and self and family care. They chose a variety of types of eMH resources to use with their clients, both culturally
Uranium exploration in Australia
International Nuclear Information System (INIS)
Battey, G.C.; Hawkins, B.W.
1977-01-01
As a result of exploration which recommenced in 1966 Australia's uranium reserves increased from 6,200 tonnes in 1967 to 227,000 tonnes uranium by June 1976. Most discoveries in the early 1950's were made by prospectors. The increase in reserves during the past decade is the result of exploration by companies utilising improved technology in areas selected as geologically favourable. These reserves were established at relatively low cost. In the Alligator Rivers Uranium Province the ''vein'' type deposits at Jabiluka, Ranger, Koongarra and Nabarlek contain 17% of the world's reserves. Most of these discoveries resulted from the investigation of airborne radiometric anomalies but cover over the prospective host rocks will necessitate the future use of costlier and more indirect exploration techniques. There was exploration for sandstone type uranium deposits in most of Australia's sedimentary basins. The greatest success was achieved in the Lake Frome Basin in South Australia. Other deposits were found in the Ngalia and Amadeus Basins in Central Australia and in the Westmoreland area, N.W. Queensland. A major uranium deposit was found in an unusual environment at Yeelirrie, Western Australia where carnotite occurs in a caliche and clay host which fills a shallow, ancient drainage channel. Although caliche occurrences are relatively widespread on the Precambrian shield no other economic deposit has been found. Recent discoveries in the Georgetown area of Queensland indicate the presence of another uranium province but it is too early to assess its potential. The ore occurs in clastic sediments at the base of a volcanic sequence overlying a Precambrian basement. Several companies which have established large uranium reserves have a number of additional attractive prospects. Exploration activity in Australia in 1975 was at a lower level than in previous years, but the potential for discovering further deposits is considered to be high
A voyage to Terra Australis: human-mediated dispersal of cats.
Koch, K; Algar, D; Searle, J B; Pfenninger, M; Schwenk, K
2015-12-04
Cats have been transported as human commensals worldwide giving rise to many feral populations. In Australia, feral cats have caused decline and extinction of native mammals, but their time of introduction and origin is unclear. Here, we investigate hypotheses of cat arrival pre- or post-European settlement, and the potential for admixture between cats of different invasion events. We analyse the genetic structure and diversity of feral cats from six locations on mainland Australia, seven Australian islands and samples from Southeast Asia and Europe using microsatellite and mitochondrial DNA data. Our results based on phylogeographic model selection are consistent with a European origin of cats in Australia. We find genetic distinctiveness of Australian mainland samples compared with Dirk Hartog Island, Flinders Island, Tasman Island and Cocos (Keeling) Island samples, and genetic similarities between some of the island populations. Historical records suggest that introduction of cats to these islands occurred at the time of European exploration and/or in connection with the pearling, whaling and sealing trades early in the 19th century. On-going influx of domestic cats into the feral cat population is apparently causing the Australian mainland populations to be genetically differentiated from those island populations, which likely are remnants of the historically introduced cat genotypes. A mainly European origin of feral cats in Australia, with possible secondary introductions from Asia following the initial establishment of cats in Australia is reasonable. The islands surrounding Australia may represent founding populations and are of particular interest. The results of the study provide an important timeframe for the impact of feral cats on native species in Australia.
Ring, Ian T; O'Brien, John F
2007-10-15
To highlight recent reductions in mortality rates in Australia and identify conditions and population groups with the greatest potential for further reduction in mortality rates. International benchmarking and intranational comparisons of mortality rates were used to identify areas with the greatest potential for improvement. Latest data from Organisation for Economic Cooperation and Development (OECD) countries confirm that, while Japan's death rates remain the lowest in the world, Australia's are decreasing rapidly and we now rival Switzerland for second overall ranking. When the contributions of specific conditions are compared, the areas with the greatest potential for reductions are circulatory diseases (especially ischaemic heart disease); suicide; injury and violence; smoking-related conditions; and cancers amenable to prevention/early detection. Intranational comparisons show considerable scope for reduction in inequalities, especially those between Aboriginal and Torres Strait Islander peoples and other Australians, between males and females, and between low and high socioeconomic groups. These conditions and inequalities are highly interrelated, as differentials in health status are often mediated through broader societal inequalities. Australia should aim to become the country with the lowest mortality rate in the world. This could realistically be achieved by benchmarking performance nationally and internationally, applying current knowledge and available interventions, matching policies with funding, and implementing systemic national programs and activities to promote health and prevent "illth".
Directory of Open Access Journals (Sweden)
Ross Young
2011-09-01
Full Text Available Australia is the driest inhabited continent on earth and, more importantly, experiences the most variable rainfall of all the continents on our planet. The vast majority of Australians live in large cities on the coast. Because wastewater treatments plants were all located near the coast, it was thought that large scale recycling would be problematic given the cost of infrastructure and pumping required to establish recycled water schemes. This all changed when Australia experienced a decade of record low rainfall and water utilities were given aggressive targets to increase the volume of water recycled. This resulted in recycled water being accepted as a legitimate source of water for non-drinking purposes in a diversified portfolio of water sources to mitigate climate risk. To ensure community support for recycled water, Australia lead the world in developing national guidelines for the various uses of recycled water to ensure the protection of public health and the environment. Australia now provides a great case study of the developments in maximizing water recycling opportunities from policy, regulatory and technological perspectives. This paper explores the evolution in thinking and how approaches to wastewater reuse has changed over the past 40 years from an effluent disposal issue to one of recognizing wastewater as a legitimate and valuable resource. Despite recycled water being a popular choice and being broadly embraced, the concept of indirect potable reuse schemes have lacked community and political support across Australia to date.
Gwynn, Josephine; Lock, Mark; Turner, Nicole; Dennison, Ray; Coleman, Clare; Kelly, Brian; Wiggers, John
2015-08-01
Gaps exist in researchers' understanding of the 'practice' of community governance in relation to research with Aboriginal and Torres Strait Islander peoples. We examine Aboriginal community governance of two rural NSW research projects by applying principles-based criteria from two independent sources. One research project possessed a strong Aboriginal community governance structure and evaluated a 2-year healthy lifestyle program for children; the other was a 5-year cohort study examining factors influencing the mental health and well-being of participants. The National Health and Medical Research Council of Australia's 'Values and ethics: guidelines for ethical conduct in Aboriginal and Torres Strait Islander research' and 'Ten principles relevant to health research among Indigenous Australian populations' described by experts in the field. Adopt community-based participatory research constructs. Develop clear governance structures and procedures at the beginning of the study and allow sufficient time for their establishment. Capacity-building must be a key component of the research. Ensure sufficient resources to enable community engagement, conduct of research governance procedures, capacity-building and results dissemination. The implementation of governance structures and procedures ensures research addresses the priorities of the participating Aboriginal and Torres Strait Islander communities, minimises risks and improves outcomes for the communities. Principles-based Aboriginal and Torres Strait Islander community governance of research is very achievable. Next steps include developing a comprehensive evidence base for appropriate governance structures and procedures, and consolidating a suite of practical guides for structuring clear governance in health research. © 2015 National Rural Health Alliance Inc.
Directory of Open Access Journals (Sweden)
Gisela Kaplan
2013-07-01
Full Text Available In many avian species, vocal repertoire expands and changes throughout life as new syllables are added and sounds adapted to neighbours and circumstances. Referential signals, on the other hand, demand stability and lack of variation so that their meaning can be understood by conspecifics at all times. It is not known how stable such signals may be when the context is changed entirely but the point of reference remains unchanged. We investigated these questions in a rare case of forced translocation of an avian species, the Australian magpie (Gymnorhina tibicen, from Australia to the remote Fijian island of Taveuni decades ago. By using playbacks of vocalisations to 45 magpie groups in Australia, we first established that magpies use functionally referential signals in their alarm call repertoire signalling aerial danger (measured as looking up in response to a specific alarm call even though the speakers were on the ground. With these results in hand, we then used the same playbacks to magpie groups on the island of Taveuni. Our results showed that the meaning of one specific call (eagle alarm call is stable and maintained even in populations that have been isolated from Australian conspecifics over many (at least 10 generations. To our knowledge, this is the first time such a stability of a referential signal has been shown in the natural habitat.
Barik, S S; Sahani, R; Prasad, B V R; Endicott, P; Metspalu, M; Sarkar, B N; Bhattacharya, S; Annapoorna, P C H; Sreenath, J; Sun, D; Sanchez, J J; Ho, S Y W; Chandrasekar, A; Rao, V R
2008-05-01
The population genetics of the Indian subcontinent is central to understanding early human prehistory due to its strategic location on the proposed corridor of human movement from Africa to Australia during the late Pleistocene. Previous genetic research using mtDNA has emphasized the relative isolation of the late Pleistocene colonizers, and the physically isolated Andaman Island populations of Island South-East Asia remain the source of claims supporting an early split between the populations that formed the patchy settlement pattern along the coast of the Indian Ocean. Using whole-genome sequencing, combined with multiplexed SNP typing, this study investigates the deep structure of mtDNA haplogroups M31 and M32 in India and the Andaman Islands. The identification of a so far unnoticed rare polymorphism shared between these two lineages suggests that they are actually sister groups within a single haplogroup, M31'32. The enhanced resolution of M31 allows for the inference of a more recent colonization of the Andaman Islands than previously suggested, but cannot reject the very early peopling scenario. We further demonstrate a widespread overlap of mtDNA and cultural markers between the two major language groups of the Andaman archipelago. Given the "completeness" of the genealogy based on whole genome sequences, and the multiple scenarios for the peopling of the Andaman Islands sustained by this inferred genealogy, our study hints that further mtDNA based phylogeographic studies are unlikely to unequivocally support any one of these possibilities. (c) 2008 Wiley-Liss, Inc.
International Nuclear Information System (INIS)
Milliken, R.
1987-01-01
Britain and Australia have become locked in a battle of wills and wits over a nuclear legacy that is now more than 30 years old. At stake is the issue of who will pay to clean up a stretch of the central Australian outback where at least 23 kilograms of plutonium are buried in nuclear graveyards or scattered in fine particles on the ground. The plutonium was left there after a series of British nuclear weapons tests in the 1950s and 1960s. The cost of cleaning it up today, and rendering the ground safe the the Aborigines who claim it as their tribal homeland, has been estimated at up to $158 million. Australia's minister for resources, Senator Gareth Evans, went to London in October 1986 to try to involve the British in the cleanup. But Britain is still taking the stand that it had discharged any obligations on this score long ago. This question is at the heart of controversy that began mounting in the late 1970s over the British nuclear tests. It was then that Aborigines and test veterans from Britain and Australia started alleging that they had been exposed to unduly high doses of radiation. Clearly, the nuclear tests, which began as a political exercise between Britain and Australia more than 30 years ago, seem destined to remain the source of much legal, diplomatic, and financial fallout between the two countries for a long time to come
Tuppiap Qeqertaa (Tobias Island): a newly discovered island off northeast Greenland
DEFF Research Database (Denmark)
Bennike, O.; Mikkelsen, N.; Forsberg, René
2006-01-01
The small island of Tuppiap Qeqertaa, formerly known as Tobias circle divide or Tobias Island, is situated 80 km off the northeast Greenland coast. The island was discovered in 1993 and is approximately 2 km long and 1.5 km wide. Most of the island is covered by an ice cap that rises to 35 in abo...
Australia`s uranium opportunities
Energy Technology Data Exchange (ETDEWEB)
Alder, K.
1996-12-31
The book is a personal account by an insider who was deeply involved in the rise and fall of the Australian Atomic Energy Commission (AAEC), and in particular in its efforts to bring Australia into the nuclear age. It reveals the thinking behind the Commission`s research programmes and major projects, such as the centrifuge enrichment program and Jervis Bay Nuclear Power project. It shows how politics, politicians and sensational journalism had disastrous effects on the AAEC, its programmes and aspirations. ills.
International Nuclear Information System (INIS)
Rangin, C.; Maury, R.C.; Bellon, H.; Cotten, J.; Polve, M.; Priadi, B.; Soeria-Atmadja, R.; Joron, J.L.
1997-01-01
Eocene BABB basalts intruded by tholeiitic and calk-alkalic island arc magmatic rocks are reported from the north arm of Sulawesi (Indonesia). Age and geochemical similarities between these basalts and those drilled in the Celebes Sea indicate this North Sulawesi volcanic arc was built on the same oceanic crust. The 25 deg late Neogene clockwise rotation of the north arm of Sulawesi following its collision with fragments of Australia (Sula, Buton) is not sufficient to explain the asymmetrical magnetic anomalies in the Celebes basin. The North Sulawesi island arc could be interpreted as having progressively retreated northward on its own Celebes sea back arc basin, during an episode of Palaeogene-early Neogene tectonic erosion along the trench. (authors)
Diomede Islands, Bering Straight
2008-01-01
The Diomede Islands consisting of the western island Big Diomede (also known as Imaqliq, Nunarbuk or Ratmanov Island), and the eastern island Little Diomede (also known as Krusenstern Island or Inaliq), are two rocky islands located in the middle of the Bering Strait between Russia and Alaska. The islands are separated by an international border and the International Date Line which is approximately 1.5 km from each island; you can look from Alaska into tomorrow in Russia. At the closest land approach between the United States, which controls Little Diomede, and Russia, which controls Big Diomede, they are 3 km apart. Little Diomede Island constitutes the Alaskan City of Diomede, while Big Diomede Island is Russia's easternmost point. The first European to reach the islands was the Russian explorer Semyon Dezhnev in 1648. The text of the 1867 treaty finalizing the sale of Alaska uses the islands to designate the border between the two nations. The image was acquired July 8, 2000, covers an area of 13.5 x 10.8 km, and is located at 65.8 degrees north latitude, 169 degrees west longitude. The U.S. science team is located at NASA's Jet Propulsion Laboratory, Pasadena, Calif. The Terra mission is part of NASA's Science Mission Directorate.
Sociodemographic Factors Influencing Island Food Consumption in the Pacific Islander Health Study
Baumhofer, Nicole Kau'i
2016-01-01
This dissertation explores the relationships between island food consumption, sociodemographic variables, and cardiovascular risk using data from the Pacific Islander Health Study (PIHS). Chapter 1 explores the associations between self-reported level of island food consumption and key covariates. Island food consumption was modeled using Poisson regression and adjusted for demographic, socioeconomic, and cultural characteristics. Increased Pacific Island cultural affinity was the strongest p...
Paradise Islands? Island States and Environmental Performance
Directory of Open Access Journals (Sweden)
Sverker C. Jagers
2016-03-01
Full Text Available Island states have been shown to outperform continental states on a number of large-scale coordination-related outcomes, such as levels of democracy and institutional quality. The argument developed and tested in this article contends that the same kind of logic may apply to islands’ environmental performance, too. However, the empirical analysis shows mixed results. Among the 105 environmental outcomes that we analyzed, being an island only has a positive impact on 20 of them. For example, island states tend to outcompete continental states with respect to several indicators related to water quality but not in aspects related to biodiversity, protected areas, or environmental regulations. In addition, the causal factors previously suggested to make islands outperform continental states in terms of coordination have weak explanatory power in predicting islands’ environmental performance. We conclude the paper by discussing how these interesting findings can be further explored.
Long-term follow-up for keystone design perforator island flap for closure of myelomeningocele.
Donaldson, Christopher; Murday, Hamsaveni K M; Gutman, Matthew J; Maher, Rory; Goldschlager, Tony; Xenos, Chris; Danks, R Andrew
2018-04-01
We have previously reported a small series on the closure of large myelomeningocele (MMC) defects with a keystone design perforator island flap (KDPIF) in a paediatric neurosurgical centre in Australia. We are now presenting an updated longer term follow-up of an expanded series demonstrating longer term durability of this vascularized flap for large myelomeningocele defects. The prospective data from the Monash Neurosurgical Database were used to select all cases of MMC between December 2008 and September 2016. Retrospective analysis of the neurosurgical database revealed an additional three patients who underwent KDPIF closure at the Monash Medical Centre for MMC repair at birth. Wound healing was satisfactory in all six cases. With delayed follow-up, there was no associated skin flap separation, skin flap dehiscence, skin flap necrosis, cerebro-spinal fluid leak, however two infections were encountered, both resolved with conservative management including antibiotics and simple washout. In this expanded case series with increased longevity of follow-up, the keystone design perforator island flap remains a robust alternative for closure of large myelomeningocele defects.
Directory of Open Access Journals (Sweden)
Lawrence David
2012-07-01
Full Text Available Abstract Background Statistical time series derived from administrative data sets form key indicators in measuring progress in addressing disadvantage in Aboriginal and Torres Strait Islander populations in Australia. However, inconsistencies in the reporting of Indigenous status can cause difficulties in producing reliable indicators. External data sources, such as survey data, provide a means of assessing the consistency of administrative data and may be used to adjust statistics based on administrative data sources. Methods We used record linkage between a large-scale survey (the Western Australian Aboriginal Child Health Survey, and two administrative data sources (the Western Australia (WA Register of Births and the WA Midwives’ Notification System to compare the degree of consistency in determining Indigenous status of children between the two sources. We then used a logistic regression model predicting probability of consistency between the two sources to estimate the probability of each record on the two administrative data sources being identified as being of Aboriginal and/or Torres Strait Islander origin in a survey. By summing these probabilities we produced model-adjusted time series of neonatal outcomes for Aboriginal and/or Torres Strait Islander births. Results Compared to survey data, information based only on the two administrative data sources identified substantially fewer Aboriginal and/or Torres Strait Islander births. However, these births were not randomly distributed. Births of children identified as being of Aboriginal and/or Torres Strait Islander origin in the survey only were more likely to be living in urban areas, in less disadvantaged areas, and to have only one parent who identifies as being of Aboriginal and/or Torres Strait Islander origin, particularly the father. They were also more likely to have better health and wellbeing outcomes. Applying an adjustment model based on the linked survey data increased
Australia's uranium export potential
International Nuclear Information System (INIS)
Mosher, D.V.
1981-01-01
During the period 1954-71 in Australia approximately 9000 MT of U 3 O 8 was produced from five separate localities. Of this, 7000 MT was exported to the United Kingdom and United States and the balance stockpiled by the Australian Atomic Energy Commission (AAEC). Australia's uranium ore reserves occur in eight deposits in three states and the Northern Territory. However, 83% of Australia's reserves are contained in four deposits in lower Proterozoic rocks in the East Alligator River region of the Northern Territory. The AAEC has calculated Australia's recoverable uranium reserves by eliminating estimated losses during the mining and milling of the ores. AAEC has estimated reasonably assured resources of 289,000 MT of uranium at a recovery cost of less than US$80 per kilogram uranium. The companies have collectively announced a larger ore reserve than the Australian Atomic Energy Commission. This difference is a result of the companies adopting different ore reserve categories. On August 25, 1977, the federal government announced that Australia would develop its uranium resources subject to stringent environmental controls, recognition of Aboriginal Land Rights, and international safeguards. Australian uranium production should gradually increase from 1981 onward, growing to 10,000 to 15,000 MT by 1985-86. Further increases in capacity may emerge during the second half of the 1980s when expansion plans are implemented. Exploration for uranium has not been intensive due to delays in developing the existing deposits. It is likely that present reserves can be substantially upgraded if more exploration is carried out. 6 figures, 3 tables
Muhs, Daniel; Pigati, Jeffrey S.; Schumann, R. Randall; Skipp, Gary L.; Porat, Naomi; DeVogel, Stephen B.
2018-01-01
Along most of the Pacific Coast of North America, sand dunes are dominantly silicate-rich. On the California Channel Islands, however, dunes are carbonate-rich, due to high productivity offshore and a lack of dilution by silicate minerals. Older sands on the Channel Islands contain enough carbonate to be cemented into aeolianite. Several generations of carbonate aeolianites are present on the California Channel Islands and represent the northernmost Quaternary coastal aeolianites on the Pacific Coast of North America. The oldest aeolianites on the islands may date to the early Pleistocene and thus far have only been found on Santa Cruz Island. Aeolianites with well-developed soils are found on both San Miguel Island and Santa Rosa Island and likely date to the middle Pleistocene. The youngest and best-dated aeolianites are located on San Miguel Island and Santa Rosa Island. These sediments were deposited during the late Pleistocene following the emergence of marine terraces that date to the last interglacial complex (~ 120,000 yr to ~ 80,000 yr). Based on radiocarbon and luminescence dating, the ages of these units correspond in time with marine isotope stages [MIS] 4, 3, and 2. Sea level was significantly lower than present during all three time periods. Reconstruction of insular paleogeography indicates that large areas to the north and northwest of the islands would have been exposed at these times, providing a ready source of carbonate-rich skeletal sands. These findings differ from a previously held concept that carbonate aeolianites are dominantly an interglacial phenomenon forming during high stands of sea. In contrast, our results are consistent with the findings of other investigators of the past decade who have reported evidence of glacial-age and interstadial-age aeolianites on coastlines of Australia and South Africa. They are also consistent with observations made by Darwin regarding the origin of aeolianites on the island of St. Helena, in the
Uranium exploration and mining in Australia
International Nuclear Information System (INIS)
Wutzler, B.
1984-01-01
Uranium minerals were discovered in Australia in the years 1850 to 1900 already, but most of them were not recognised as such. It was not until 1894 that the first significant uranium find was made in Carcoar, west of Sydney. At that time, the uranium output of the world, which only amounted to a few hundred cwts, was for the most part obtained from mining areas close to the border between Saxony and Bohemia. In South Australia, uranium ore was mined experimentally for the production of radium at Radium Hill from 1906 onwards and at Mt. Painter from 1910 onwards. It was not until World War II, however, that uranium gained importance as a valuable raw material that could also be used for military purposes. The second phase of uranium mining in Australia commenced in 1944. Within ten years Australia's presumed uranium potential was confirmed by extensive exploration. The development of uranium mining in Australia is described in the present paper. (orig.)
Indigenous actinorhizal plants of Australia
Indian Academy of Sciences (India)
Indigenous species of actinorhizal plants of Casuarinaceae, Elaeagnaceae and Rhamnaceae are found in specific regions of Australia. Most of these plants belong to Casuarinaceae, the dominant actinorhizal family in Australia. Many of them have significant environmental and economical value. The other two families with ...
Recent developments: Japan and Australia
International Nuclear Information System (INIS)
Anon.
1990-01-01
Recent developments in the nuclear industry in Japan and Australia are briefly reviewed. Topics discussed include: the world energy situation; and nuclear power generation trends and completion the nuclear fuel cycle in Japan. Recent events that suggest possible policy changes in Australia are briefly discussed
Asian student migration to Australia.
Shu, J; Hawthorne, L
1996-01-01
"This paper presents an overview of Asian student migration to Australia, together with an analysis of political and educational aspects of the overseas student programme. It focuses on some significant consequences of this flow for Australia. The characteristics of key student groups are contrasted to provide some perspective of the diversity of historical and cultural backgrounds, with the source countries of Malaysia, Indonesia and PRC [China] selected as case studies. Since the issue of PRC students in Australia has attracted considerable public attention and policy consideration, particular focus is placed on their experience." (SUMMARY IN FRE AND SPA) excerpt
The new energy technologies in Australia
International Nuclear Information System (INIS)
Le Gleuher, M.; Farhi, R.
2005-06-01
The large dependence of Australia on the fossil fuels leads to an great emission of carbon dioxide. The Australia is thus the first greenhouse gases emitter per habitant, in the world. In spite of its sufficient fossil fuels reserves, the Australia increases its production of clean energies and the research programs in the domain of the new energies technology. After a presentation of the australia situation, the authors detail the government measures in favor of the new energy technologies and the situation of the hydroelectricity, the wind energy, the wave and tidal energy, the biomass, the biofuels, the solar energy, the ''clean'' coal, the hydrogen and the geothermal energy. (A.L.B.)
Status of Radiotherapy around the World: Australia, New Zealand and Papua New Guinea. Chapter 25.8
International Nuclear Information System (INIS)
Koh, Eng-Siew; Hanna, T.P.; Barton, M.B.
2017-01-01
Australia has a population of over 22 million and New Zealand 4 million people. Both are classified as high income countries. In 2007, there were over 100 000 new cases of cancer diagnosed in Australia (excluding basal and squamous cell carcinoma of the skin), with the most commonly diagnosed cancers being prostate, bowel, breast, melanoma of the skin and lung cancer. The incidence profiles are similar in New Zealand. In both countries, lung cancer accounted for the most cancer deaths in 2008 (19%), followed by colorectal, prostate and breast cancers. In Australia, the age standardized death rate per 100 000 population due to cancer is 140.8 for men and 92.9 for women. The relative survival rate for cancer patients in Australia is among the best in an international comparison of six developed nations. Radiotherapy services across Australia and New Zealand are predominantly outpatient based and provided in public sector specialist cancer care facilities. According to the IAEA’s DIRAC database, there are currently 69 radiotherapy centres in Australia and eight in New Zealand. Megavoltage linacs for standard 3-D external beam radiotherapy, brachytherapy, as well as stereotactic radiotherapy for both cranial and extracranial applications are available in selected large metropolitan based centres. Across Australia and New Zealand, a wide range of current imaging technologies, including CT, magnetic resonance imaging (MRI), and positron emission tomography, are available for incorporation into radiation treatment planning. IMRT was first introduced around 2001 for head and neck cancers and is now available in most radiotherapy centres for selected tumour sites and clinical indications. Papua New Guinea, classified in the low and middle income group, has a current population of over 6.8 million people dispersed over 600 islands. Registrations at the National Cancer Registry do not document the true burden of cancer in Papua New Guinea. It is estimated that there are
Researching Pacific island livelihoods:
DEFF Research Database (Denmark)
Egelund Christensen, Andreas; Mertz, Ole
2010-01-01
on contemporary theories of nissology and conceptual analytical frameworks for island research. Through a review of selected case-study-based island literature on changing livelihoods coming out of the South Pacific, we wish to illustrate and discuss advantages of finding common grounds for small island studies....... The focus is on two dimensions of island livelihood, migration and natural resource management, both of which are significant contributors in making island livelihoods and shaping Pacific seascapes. We argue that there is still a substantial lack of studies targeting small island dynamics that are empirical...
78 FR 63860 - Amendment of Class D Airspace; Kwajalein Island, Marshall Islands, RMI
2013-10-25
...This action amends the Kwajalein Island Class D airspace description by amending the geographic coordinates for Bucholz Army Airfield (AAF), Kwajalein Island, Marshall Islands, RMI. The Bucholz AAF geographic coordinates information was updated in the Kwajalein Island Class E airspace descriptions in 2011, but was inadvertently overlooked in the Kwajalein Island Class D airspace description. This action ensures the safety of aircraft operating in the Kwajalein Island airspace area. This is an administrative action and does not affect the operating requirements of the airspace.
Stepping-stones to the Edge: Artistic Expressions of Islandness in an Ocean of Islands
Directory of Open Access Journals (Sweden)
Laurie Brinklow
2013-05-01
Full Text Available Since the earliest of times, islands have captured the artistic imagination—and, often, for the artist who finds his or her muse in being ‘islanded’, the smaller the island the better. Archipelagos offer an ideal setting for artists who take their inspiration from place: on small islands off islands they can experience an intensity of island living they might not otherwise have on a main island: boundedness and connection, isolation and community. This paper examines expressions of islandness by artists who live on islands off islands that are poles apart—‘archipelagos’ of the Canadian North Atlantic and the Great Southern Ocean. It draws upon interviews with those artists and writers to consider the nature of humans’ attachment and attraction to islands, exploring through the lens of phenomenology what Stratford et al. call the “entanglement between and among islands”.
Lexicography in Australia | Delbridge | Lexikos
African Journals Online (AJOL)
The emergence of Australian English as the national language is traced, and its relations with the Australian Aboriginal languages touched on. The greatest change in the language setting came with Australia's immigration policy in its post-World War II form. This resulted in the government's eventual recognition of Australia ...
Sus scrofa: Population Structure, Reproduction and Condition in Tropical North Eastern Australia
Directory of Open Access Journals (Sweden)
NELSON, John E.
2009-01-01
Full Text Available Three feral pig populations inhabiting contrasting environments along the north easterncoast of Australia have been investigated with respect to population structure, individual condition andreproduction. The population on Prince of Wales Island contains a large proportion of juvenile andsub-adult pigs but lacks pigs in the higher age classes. Individuals also breed at an earlier age thananimals of the mainland populations. Pig populations on Cape York Peninsula show a largerproportion of older animals and feral pigs living in rainforest habitats show a low proportion ofanimals in very young and very old age classes. Pigs from the lowland rainforest population are inbetter condition than those of the other populations for most of the year, reflecting the availability offood all year round in this environment. Differences in the population structure of the threepopulations are discussed with respect to fecundity and several mortality factors such as predation anddiseases/parasites.
The report of the Royal Commission into British nuclear tests in Australia
International Nuclear Information System (INIS)
Anon.
1985-01-01
The conclusions and recommendations of the Royal commission into British nuclear tests conducted in Australia between 1952 and 1963 are presented. The recommendations include that action should be commenced immediately to effect a clean-up of Maralinga and Emu so that they are fit for unrestricted habitation by the traditional Aboriginal owners as soon as practicable; all costs of any future clean-ups at Maralinga, Emu and the Monte Bello Islands should be borne by the United Kingdom Government; a Maralinga Commission should be established to determine the clean-up criteria, oversee the clean-up and co-ordinate all future Range management; the Australian government should make compensation to those persons and descendants of those persons who have a traditional interest in sites at the former Maralinga Prohibited Area for loss of use and enjoyment of their lands since the beginning, and as a result of the atomic tests program
International Nuclear Information System (INIS)
Clark, G.H.; Bartsch, F.J.K.
1994-06-01
As part of an assessment into the consequences of a potential accident at the National Medical Cyclotron, Camperdown, NSW., Australia, two meteorological stations were installed to monitor the winds, temperatures and atmospheric dispersion conditions. The data will be used to assess environmental impacts of the Cyclotron's operation. In spite of the relatively poor performance of the stations, the wind data indicated significant effects of local buildings and the general urban surface roughness features. The prevailing winds during the study were from the north-north-west at night and south-south-west or north-east sea breezes during the day. Atmospheric stability/dispersion categories were typical of an urban heat island location. 11 refs., 10 tabs, 6 figs
Early history of IVF in Australia
Directory of Open Access Journals (Sweden)
Kristina Janežič
2014-08-01
Full Text Available Background: The 1970s and 1980s represent the early era of in vitro fertilization (IVF research. This article is a concise review of the early history of IVF, focusing on the contributions made by Australian pioneers.Objectives: To research the history of the early days of IVF in Australia.Search Strategy: ‘IVF history’ was used as a search criteria in PubMed.Selection criteria: We selected articles that were dealing with Australian research on IVF in 1970–1980s and were also statistically sound where applicable.Data collection and analysis: We collected, processed, and analyzed the data, and summed up two decades of IVF research in Australia.Main results: The first ideas about introducing IVF research in Australia started in 1970. Years of trials and hard work bore success and the first baby was born in 1980. IVF procedures then spread quickly across Australia.Conclusions: Australia was a leading force in the early days of IVF and with many innovative approaches contributed greatly to the development of IVF as we know it today.
Does Lyme disease exist in Australia?
Collignon, Peter J; Lum, Gary D; Robson, Jennifer Mb
2016-11-07
There is no convincing evidence that classic Lyme disease occurs in Australia, nor is there evidence that the causative agent, Borrelia burgdorferi, is found in Australian animals or ticks. Lyme disease, however, can be acquired overseas but diagnosed in Australia; most people presenting with laboratory-confirmed Lyme disease in Australia were infected in Europe. Despite the lack of evidence that Lyme disease can be acquired in Australia, growing numbers of patients, their supporters, and some politicians demand diagnoses and treatment according to the protocols of the "chronic Lyme disease" school of thought. Antibiotic therapy for chronic "Lyme disease-like illness" can cause harm to both the individual (eg, cannula-related intravenous sepsis) and the broader community (increased antimicrobial resistance rates). Until there is strong evidence from well performed clinical studies that bacteria present in Australia cause a chronic debilitating illness that responds to prolonged antibiotics, treating patients with "Lyme disease-like illness" with prolonged antibiotic therapy is unjustified, and is likely to do much more harm than good.
International Nuclear Information System (INIS)
Mackay, G.A.
1978-01-01
Western world requirements for uranium based on increasing energy consumption and a changing energy mix, will warrant the development of Australia's resources. By 1985 Australian mines could be producing 9500 tonnes of uranium oxide yearly and by 1995 the export value from uranium could reach that from wool. In terms of benefit to the community the economic rewards are considerable but, in terms of providing energy to the world, Australias uranium is vital
Directory of Open Access Journals (Sweden)
Michael A. Tabak
2015-01-01
Full Text Available Non-native rats (Rattus spp. threaten native island species worldwide. Efforts to eradicate them from islands have increased in frequency and become more ambitious in recent years. However, the long-term success of some eradication efforts has been compromised by the ability of rats, particularly Norway rats (Rattus norvegicus which are good swimmers, to recolonize islands following eradications. In the Falkland Islands, an archipelago in the South Atlantic Ocean, the distance of 250 m between islands (once suggested as the minimum separation distance for an effective barrier to recolonization has shown to be insufficient. Norway rats are present on about half of the 503 islands in the Falklands. Bird diversity is lower on islands with rats and two vulnerable passerine species, Troglodytes cobbi (the only endemic Falkland Islands passerine and Cinclodes antarcticus, have greatly reduced abundances and/or are absent on islands with rats. We used logistic regression models to investigate the potential factors that may determine the presence of Norway rats on 158 islands in the Falkland Islands. Our models included island area, distance to the nearest rat-infested island, island location, and the history of island use by humans as driving variables. Models best supported by data included only distance to the nearest potential source of rats and island area, but the relative magnitude of the effect of distance and area on the presence of rats varied depending on whether islands were in the eastern or western sector of the archipelago. The human use of an island was not a significant parameter in any models. A very large fraction (72% of islands within 500 m of the nearest potential rat source had rats, but 97% of islands farther than 1,000 m away from potential rat sources were free of rats.
Australia's role in Pacific energy trade
International Nuclear Information System (INIS)
McColl, G.
1989-01-01
This paper discusses Australia's resources and the expansion of its steaming coal exports. The author reviews Australia's development of its natural gas resources and future prospects for exporting to the Pacific region
Progress on RERTR issues in Australia
International Nuclear Information System (INIS)
Ripley, M.I.; Horlock, K.W.
2002-01-01
Australia has long been involved with and sympathetic to the goals of the RERTR program. This overview paper gives a brief introduction to RERTR-related activities in Australia since RERTR-2000. (author)
Tay-Sachs disease: current perspectives from Australia
Directory of Open Access Journals (Sweden)
Lew RM
2015-01-01
Full Text Available Raelia M Lew,1,7 Leslie Burnett,2,3,4 Anné L Proos,2 Martin B Delatycki5,6 1Department of Obstetrics and Gynecology, QEII Research Institute for Mothers and Infants, The University of Sydney, Australia; 2NSW Health Pathology North, Royal North Shore Hospital, St Leonards, Australia; 3SEALS, Prince of Wales Hospital, Randwick, Australia; 4Sydney Medical School-Northern, Royal North Shore Hospital E25, University of Sydney, Sydney, Australia; 5Department of Clinical Genetics, Austin Health, Heidelberg, Australia; 6Bruce Lefroy Centre for Genetic Health Research, Murdoch Childrens Research Institute, Parkville, Australia; 7Department of Obstetrics and Gynaecology, Dentistry and Health Sciences, Faculty of Medicine, The University of Melbourne, Melbourne, Australia Abstract: Tay-Sachs disease (TSD is a fatal, recessively inherited neurodegenerative condition of infancy and early childhood. Although rare in most other populations, the carrier frequency is one in 25 in Ashkenazi Jews. Australian high-school-based TSD preconception genetic screening programs aim to screen, educate, and optimize reproductive choice for participants. These programs have demonstrated high uptake, low psychological morbidity, and have been shown to result in fewer than expected Jewish TSD-affected births over 18 years of operation. The majority of Jewish individuals of reproductive age outside of the high school screening program setting in Australia have not accessed screening. Recent recommendations advocate supplementing the community high school screening programs with general practitioner- and obstetrician-led genetic screening of Ashkenazi Jewish individuals for TSD and other severe recessive diseases for which this group is at risk. Massively parallel DNA sequencing is expected to become the testing modality of choice over the coming years. Keywords: Tay-Sachs disease, genetic screening, Australia
33 CFR 80.717 - Tybee Island, GA to St. Simons Island, GA.
2010-07-01
... Island. (j) An east-west line from the southernmost extremity of Sea Island across Goulds Inlet to St... Tybee Island 255° true across Tybee Inlet to the shore of Little Tybee Island south of the entrance to... shoreline across Cabretta Inlet. (g) A north-south line (longitude 81°16.9′ W.) drawn from the south...
Energy Transition Initiative: Island Energy Snapshot - U.S. Virgin Islands (Fact Sheet)
Energy Technology Data Exchange (ETDEWEB)
2015-03-01
This profile provides a snapshot of the energy landscape of the U.S. Virgin Islands (USVI) - St. Thomas, St. John, and St. Croix. The Virgin Islands archipelago makes up the northern portion of the Lesser Antilles and the western island group of the Leeward Islands, forming the border between the Atlantic Ocean and the Caribbean Sea.
Kayaalp, Pelin; Schwarz, Michael P; Stevens, Mark I
2013-03-01
Hylaeus is the only globally distributed colletid bee genus, with subgeneric and species-level diversity highest in Australia. We used one mitochondrial and two nuclear genes to reconstruct a phylogeny using Bayesian analyses of this genus based on species from Australia, Asia, Africa, Europe, Hawai'i, the New World and New Zealand. Our results concord with a ca. 30Mya Hylaeus crown age inferred by earlier studies, and we show that Hylaeus originated in Australia. Our phylogeny indicates only two dispersal events out of Australia, both shortly after the initial diversification of extant taxa. One of these dispersals was into New Zealand with only a minor subsequent radiation, but the second dispersal out of Australia resulted in a world-wide distribution. This second dispersal and radiation event, combined with very extensive early radiation of Hyleaus in Australia, poses a conundrum: what kinds of biogeographical and ecological factors could simultaneously drive global dispersal, yet strongly constrain further successful migrations out of Australia when geographical barriers appear to be weak? We argue that for hylaeine bees movement into new niches and enemy-free spaces may have favoured initial dispersal events, but that subsequent dispersals would not have entailed the original benefits of new niche space. Copyright © 2012 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Jaime Gómez
2006-12-01
Full Text Available The breeding success of a double-brooding colony of Boat-billed Herons Cochlearius cochlearius was studied in pasturelands of Costa Rica. Mean clutch size in the first clutches (2.9 eggs/nest was higher than in second and repeat clutches (2.3 eggs/nest. Breeding success was similar in the first attempt and second attempts(20.7 % and 21.7 %, respectively. In both attempts earlier nests enjoyed a higher breeding success. Starvation of the youngest chicks within the nest and destruction of nests by bad weather conditions were the main factors related to nestling death. No effects of human activity on the reproduction of the breeding colony were observed. Rev. Biol. Trop. 54 (4: 1131-1134. Epub 2006 Dec. 15Estudiamos el éxito reproductivo de una colonia del ave Cochlearius cochlearius en una zona ganadera de Costa Rica. El promedio de huevos por nido fue mayor durante el periodo de primeras puestas (2.9 huevos/nido que durante el periodo de segundas puestas y reposiciones (2.3 huevos/nido. El éxito reproductor de los dos periodos fue similar (20.7 % y 21.7 %, respectivamente. En ambos tuvieron más éxito las parejas que comenzaron la puesta antes. Las principales causas de mortandad fueron inanición de los pollos más jóvenes del nido y la destrucción de los nidos debido a condiciones climáticas adversas. No notamos efectos adversos por la actividad humana
46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the...′ W. (Port Royal Sound Lighted Whistle Buoy “2PR”); thence to the easternmost extremity of Hilton Head...
Building nuclear skills in Australia
International Nuclear Information System (INIS)
Cameron, R.
2007-01-01
Demand for nuclear skills in Australia has traditionally been met by recruitment but as the nuclear industry grows worldwide, such skills are in demand. This paper discusses he likely numbers of skilled people needed for a nuclear industry in Australia and what initiatives have been, or could be in, taken to address the needs
International Nuclear Information System (INIS)
Switkowski, Z.
2007-01-01
Full text: After a twenty year pause in discussion of nuclear power in Australia, the public debate has resumed in this past year - partly in search for clean, non fossil fuel energy alternatives, and partly from the different political strategies in the lead up to this year's federal election. Although there is evidence of a revival of interest in the nuclear power globally, countries considering installing their first nuclear reactor confront formidable obstacles including community concerns and long lead times. This presentation will describe the Climate Change context which shapes political and corporate strategies, possible nuclear scenarios for Australia, solutions to the still long list of reservations, and likely milestones ahead. It concludes that if we are to decarbonise our economy, and continue on a path of improving standards of living and prosperity, then any strategy for adding the required base-load electricity generation capacity must consider nuclear power for Australia
Codd, A. L.; Gross, L.
2018-03-01
We present a new inversion method for Electrical Resistivity Tomography which, in contrast to established approaches, minimizes the cost function prior to finite element discretization for the unknown electric conductivity and electric potential. Minimization is performed with the Broyden-Fletcher-Goldfarb-Shanno method (BFGS) in an appropriate function space. BFGS is self-preconditioning and avoids construction of the dense Hessian which is the major obstacle to solving large 3-D problems using parallel computers. In addition to the forward problem predicting the measurement from the injected current, the so-called adjoint problem also needs to be solved. For this problem a virtual current is injected through the measurement electrodes and an adjoint electric potential is obtained. The magnitude of the injected virtual current is equal to the misfit at the measurement electrodes. This new approach has the advantage that the solution process of the optimization problem remains independent to the meshes used for discretization and allows for mesh adaptation during inversion. Computation time is reduced by using superposition of pole loads for the forward and adjoint problems. A smoothed aggregation algebraic multigrid (AMG) preconditioned conjugate gradient is applied to construct the potentials for a given electric conductivity estimate and for constructing a first level BFGS preconditioner. Through the additional reuse of AMG operators and coarse grid solvers inversion time for large 3-D problems can be reduced further. We apply our new inversion method to synthetic survey data created by the resistivity profile representing the characteristics of subsurface fluid injection. We further test it on data obtained from a 2-D surface electrode survey on Heron Island, a small tropical island off the east coast of central Queensland, Australia.
Patten, N. L.; Harrison, P. L.; Mitchell, J. G.
2008-09-01
Transmission electron microscopy (TEM) was used to determine whether Acropora muricata coral colonies from the Great Barrier Reef (GBR), Australia, harboured virus-like particles (VLPs). VLPs were present in all coral colonies sampled at Heron Island (southern GBR) and in tagged coral colonies sampled in at least two of the three sampling periods at Lizard Island (northern GBR). VLPs were observed within gastrodermal and epidermal tissues, and on rarer occasions, within the mesoglea. These VLPs had similar morphologies to known prokaryotic and eukaryotic viruses in other systems. Icosahedral VLPs were observed most frequently, however, filamentous VLPs (FVLPs) and phage were also noted. There were no clear differences in VLP size, morphology or location within the tissues with respect to sample date, coral health status or site. The most common VLP morphotype exhibited icosahedral symmetry, 120-150 nm in diameter, with an electron-dense core and an electronlucent membrane. Larger VLPs of similar morphology were also common. VLPs occurred as single entities, in groups, or in dense clusters, either as free particles within coral tissues, or within membrane-bound vacuoles. VLPs were commonly observed within the perinuclear region, with mitochondria, golgi apparatus and crescent-shaped particles frequently observed within close proximity. The host(s) of these observed VLPs was not clear; however, the different sizes and morphologies of VLPs observed within A. muricata tissues suggest that viruses are infecting either the coral animal, zooxanthellae, intracellular bacteria and/or other coral-associated microbiota, or that the one host is susceptible to infection from more than one type of virus. These results add to the limited but emerging body of evidence that viruses represent another potentially important component of the coral holobiont.
The renewable energy market in Australia
International Nuclear Information System (INIS)
2002-01-01
Australia is committed to an 8 per cent reduction in its emissions of greenhouse gases above 1990 levels as a result of the Kyoto Protocol for the period 2008-2012. At present, the emissions stand at 17.4 per cent above 1990 levels. Total electrical power in Australia resulting from renewable energy is in the order of 10.5 per cent. A mandatory renewable energy target of 9500 gigawatt hour (GWh) of extra renewable energy is to be produced annually by 2010, under the Renewable Energy (Electricity) Act. An emissions trading system has been implemented, involving one renewable energy certificate (REC) created for each megawatt hour of renewable energy generated. A significant expansion of the demand for renewable energy is expected in Australia over the next ten years, according to the Australian Greenhouse Office. Increased opportunities for local and international firms operating in the field of renewable energy are being created by the Australian government through initiatives such as the Renewable Energy Commercialization Program, and the Renewable Remote Power Generation Program. Solar, biomass, and wind power are comprised in the wealth of renewable energy resources in Australia. The market remains largely undeveloped. Firms from the United States and the European Union are the leading exporters of renewable energy technology to Australia. Public utilities and independent power producers having entered the deregulated electricity market are the consumers of renewable energy technology and services. A country with minimal duties in most cases, Australia has much in common with Canada, including similar regulatory and legal systems. Australia applies a 10 per cent goods and services tax, which would apply to Canadian exports. It was advised to consult the Australian Customs Service for additional information concerning duties that might be applicable to the renewable energy industry. 28 refs., 3 tabs
Evolution of stone management in Australia.
Lee, Ming-Chak; Bariol, Simon Virgil
2011-11-01
What's known on the subject? and What does the study add? There is very little contemporary data regarding stone management in Australia. This study assesses the impact of technological advances on stone management practises, and raises questions as to why there is an increasing rate of intervention for stone disease in Australia. Knowledge of management trends as demonstrated in this paper give individual surgeons a guideline for contemporary practise in this country. • To examine trends in the operative management of upper urinary tract stone disease in Australia over the past 15 years. • The Medicare Australia and Australian Institute of Health and Welfare databases were used to determine the annual number of renal colic presentations and procedural interventions undertaken for stone disease. • In Australia over the past 15 years, the annual number of procedural interventions for upper urinary tract stones has increased, primarily due to the rising number of endoscopic procedures performed. • During this period, shock wave lithotripsy numbers have remained steady whilst open and percutaneous procedures have been in decline. • The introduction of and subsequent preference for less invasive techniques has changed the management pathway of patients presenting with stone disease in Australia. • Further studies are necessary to determine whether this escalation in endoscopic procedures is due to an increase in the incidence of stone disease, earlier detection, a lower intervention threshold or a higher retreatment rate. © 2011 THE AUTHORS. BJU INTERNATIONAL © 2011 BJU INTERNATIONAL.
Chambers, Lynda E.; Loyn, Richard H.
2006-05-01
Seasonal and annual movements of Australian waterbirds are generally more complex than those of their Northern Hemisphere counterparts, and long-term data are needed to understand their relationships with climatic variables. This paper explores a long-term (1973 2002) set of waterbird counts from coastal Victoria and relates them to climatic data at local and continental scales. Three species (Black Swan Cygnus atratus, White-faced Heron Egretta novaehollandiae and Grey Teal Anas gracilis) were chosen for this analysis. Black Swans have large local breeding populations near the study region; White-faced Herons have smaller local breeding populations and Grey Teal breed extensively in ephemeral inland floodplains, such as those in the Murray-Darling Basin. All showed significant relationships with streamflow, regional rainfall and the Southern Oscillation Index (SOI) at appropriate scales and time-lags, with streamflow explaining the most variance. Black Swans showed a strong seasonal cycle in abundance and local climate variables had the greatest influence on the counts. Numbers were positively correlated with streamflow in southern Victoria three to six seasons before each count. Broader-scale climatic patterns were more important for the other two species. Numbers of White-faced Herons were positively correlated with streamflow or rainfall over various parts of Australia seven to nine seasons before each count. Numbers of Grey Teal showed weak seasonal cycles, and were negatively correlated with rainfall in Victoria or the Murray-Darling Basin in the seasons before or during each count, and positively with streamflow in the Murray-Darling Basin 15 18 months before each count.
Cogeneration in Australia. Situation and prospects
International Nuclear Information System (INIS)
1997-01-01
This Research Paper is mainly concerned with the status and prospects for cogeneration in Australia. An introductory chapter reviews the fundamentals of cogeneration, covering both technical and institutional aspects. A range of technologies are employed in cogeneration: these technologies and their efficiency and environmental impact effects are discussed in Chapter 2. The economics of cogeneration are a major factor in the profitability of current and potential plants. Potential factors affecting cogeneration economics are discussed .The status of cogeneration in Australia is reviewed for each State and Territory, and includes a number of case studies of existing plants. Government (federal, state, territory) policies that have a significant impact on the attractiveness of cogeneration are reviewed. Finally, the future prospects for cogeneration in Australia, drawing on the preceding chapters and a review of estimated potentials for cogeneration in Australia are presented
Recent developments in Australia's uranium mining industry
International Nuclear Information System (INIS)
Lambert, I.B.; McKay, A.D.
1998-01-01
Australia's economic, demonstrated resources of uranium (U) at the end of 1996 amounted to 622,000 tonnes U, the largest of any country. Uranium is currently produced at two mining/milling operations in Australia - Ranger in the Alligator Rivers Region of the Northern Territory, and Olympic Dam in South Australia. Improved market conditions and recent changes to Government policies have encouraged Australian companies to commit to the expansion of existing operations and the development of new uranium mines. Australia's annual production is likely to increase from its present level of 6000 tonncs (t) U 3 O 8 to approximately 12 000 t U 3 O 8 by the year 2000. (author)
Sun, Jing; Buys, Nicholas
2016-03-01
To evaluate the impact of a meditative singing program on the health outcomes of Aboriginal and Torres Strait Islander people. The study used a prospective intervention design. The study took place in six Aboriginal and Torres Strait Islander communities and Community Controlled Health Services in Queensland, Australia. Study participants were 210 Australian Aboriginal and Torres Strait Islander adults aged 18 to 71 years, of which 108 were in a singing intervention group and 102 in a comparison group. A participative community-based community singing program involving weekly singing rehearsals was conducted over an 18-month period. Standardized measures in depression, resilience, sense of connectedness, social support, and singing related quality of life were used. The general linear model was used to compare differences pre- and postintervention on outcome variables, and structural equation modeling was used to examine the pathway of the intervention effect. Results revealed a significant reduction in the proportion of adults in the singing group classified as depressed and a concomitant significant increase in resilience levels, quality of life, sense of connectedness, and social support among this group. There were no significant changes for these variables in the comparison group. The participatory community singing approach linked to preventative health services was associated with improved health, resilience, sense of connectedness, social support, and mental health status among Aboriginal and Torres Strait Islander adults. © The Author(s) 2016.
Real wages in Australia and Canada, 1870-1913
DEFF Research Database (Denmark)
Greasley, David; Madsen, Jakob Brøchner; Oxley, Les
2000-01-01
Australia's and Canada's real wage experiences between 1870 and 1913 were distinctive. Faster productivity growth underpinned Canada's overtaking of Australia's wage levels. The globalization forces of migration and trade also shaped their comparative wages, principally by reducing wage growth...... in Canada. Immigration increased slightly Australia's real wages, but reduced wage levels in Canada, and tempered there the beneficial effects of rising productivity and improving terms of trade. In contrast, wage earners' share of national income rose after 1890 in Australia, with the productivity slowdown...... hitting chiefly rents and profits. Distributional shifts favouring wage earners in Australia, and the depressing effects of mass immigration on wages in Canada, limited Canada's wage lead before 1914, despite her faster productivity growth...
DEFF Research Database (Denmark)
Jensen, Lars
This book is a critical intervention into debates on Australia's cultural history. The book demonstrates the interconnectedness of themes commonly seen as separate discursive formations, and shows the fruitfulness of bringing a combined cultural studies and postcolonial approach to bear on a number...
Exploration of Aboriginal and Torres Strait Islander perspectives of Home Medicines Review.
Swain, Lindy S; Barclay, Lesley
2015-01-01
In Australia, Home Medicines Review (HMR) has been found to be an important tool to raise awareness of medication safety, reduce adverse events and improve medication adherence. Aboriginal and Torres Strait Islander people are 'underserviced' by the HMR program and are the most likely of all Australians to miss out on HMRs despite their high burden of chronic disease and high rates of hospitalisation due to medication misadventure. The goal of this study was to explore Aboriginal and Torres Strait Islander perspectives of the Home Medicines Review program and their suggestions for an 'improved' or more readily accessible model of service. Eighteen semi-structured focus groups were conducted with 102 Aboriginal and Torres Strait Islander patients at 11 Aboriginal Health Services (AHSs). Participants who were multiple medication users and understood English were recruited to the study by AHS staff. Seven focus groups were conducted for people who had already used the HMR program (User, n=23) and 11 focus groups were conducted for people who had not had an HMR (Non User, n=79). Focus groups were recorded, de-identified and transcribed. Transcripts were coded and analysed for themes. Focus groups continued and concepts were explored until no new findings were being generated and thus saturation of data occurred. Focus group participants who had not had an HMR had little or no awareness of the HMR program. All the participants felt that lack of awareness and promotion of the HMR program were contributing factors to the low uptake of the HMR program by Aboriginal and Torres Strait Islander people. Most participants felt that an HMR would assist them to better understand their medicines, would empower them to seek information about medicines, would improve relationships with health professionals and would increase the likelihood of medication adherence. Most of the User participants reported that the HMR interview had been very useful for learning more about their
What causes southeast Australia's worst droughts?
Ummenhofer, Caroline C.; England, Matthew H.; McIntosh, Peter C.; Meyers, Gary A.; Pook, Michael J.; Risbey, James S.; Gupta, Alexander Sen; Taschetto, Andréa S.
2009-02-01
Since 1995, a large region of Australia has been gripped by the most severe drought in living memory, the so-called ``Big Dry''. The ramifications for affected regions are dire, with acute water shortages for rural and metropolitan areas, record agricultural losses, the drying-out of two of Australia's major river systems and far-reaching ecosystem damage. Yet the drought's origins have remained elusive. For Southeast Australia, we show here that the ``Big Dry'' and other iconic 20th Century droughts, including the Federation Drought (1895-1902) and World War II drought (1937-1945), are driven by Indian Ocean variability, not Pacific Ocean conditions as traditionally assumed. Specifically, a conspicuous absence of Indian Ocean temperature conditions conducive to enhanced tropical moisture transport has deprived southeastern Australia of its normal rainfall quota. In the case of the ``Big Dry'', its unprecedented intensity is also related to recent higher temperatures.
Leonard Lardaro
2010-01-01
How can a state like Rhode Island have such a high unemployment rate? This question has been asked often over the past year, especially since at one point, Rhode Island found itself with the dubious distinction of having the highest unemployment rate in the United States. Following that extreme, Rhode Island seemed to settle into a niche where its rank was third nationally.
DEFF Research Database (Denmark)
Ulstrup, Karin Elizabeth; Hill, R.; Van Oppen, M. J. H.
2008-01-01
Seasonal variation in the composition of the algal endosymbiont community and photo-physiology was determined in the corals Pocillopora damicornis, which show high local fidelity to one symbiont type (Symbiodinium C1), and Acropora valida, with a mixed Symbiodinium symbiont community, comprising...... members of both clades A and C. The relative abundances of Symbiodinium types varied over time. A significant decline in symbiont densities in both coral species during the summer of 2005 coincided with a NOAA ‘hotspot' warning for Heron Island. This also coincided with a relative increase in the presence...
Rudiastuti, A. W.; Munawaroh; Setyawan, I. E.; Pramono, G. H.
2018-04-01
Sustainable coastal management is playing an important role in coastal resources conservation, particularly on small islands. Karimata archipelago has unique characteristics and great potential to be developed as a tourism object, one of which is Karimata Island as the largest island and also reserve area. The concept of ecotourism focuses on the ecology conservation, economic benefits, and social life. Ecotourism aims to build sustainable tourism that provides economically viable and social benefits to the community. This study aims to develop coastal management strategy based on ecotourism at Karimata Island. Spatial approaching through coastal type was done. Qualitative descriptive analysis and SWOT are used to develop sustainable management strategies for the coast of Karimata Island, where the opportunities and challenges to the development of coastal ecotourism Karimata Island also included. If this potential is optimally utilized, it can be relied as an economic opportunity for local communities. Structurally shaped coast, marine depositional coast and coast build by organism are several of coastal types found at Karimata Island. Coastal ecosystems inhabited Karimata Island are mangroves, coral reefs, and macro-algae. Karimata Island have not been optimally utilized for tourist destinations. The biggest obstacle encountered is the accessibility from Kalimantan or other island at Karimata islands. Several problems related to the utilization of coastal resources were found such as mangrove and coral reef damage, also regulation that less supportive. The results of this study are expected to provide an overview of solutions for the development of coastal tourism potentials in Karimata Island.
Self-sustained magnetic islands
Energy Technology Data Exchange (ETDEWEB)
Chatenet, J H; Luciani, J F [Ecole Polytechnique, 91 - Palaiseau (France); Garbet, X [Association Euratom-CEA, Centre d` Etudes de Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. de Recherches sur la Fusion Controlee
1996-06-01
Numerical simulations of a single magnetic island evolution are presented in the regime where the island width is smaller than an ion Larmor radius. It is shown that the island rotation is controlled by particle diffusion due to collisions or a background of microturbulence. As expected from the theory of a stationary island, there exist cases where linearly stable magnetic perturbation are nonlinearly self-sustained. This situation corresponds to large poloidal beta and temperature gradient. The drive is due to diamagnetic frequency effects. However, this situation is not generic, and islands can also decay. It is found that a magnetic island is self-sustained for a negative off-diagonal diffusion coefficient. This case occurs in a tokamak if the inward particle pinch is due to the temperature gradient. (author). 30 refs.
Self-sustained magnetic islands
International Nuclear Information System (INIS)
Chatenet, J.H.; Luciani, J.F.; Garbet, X.
1996-06-01
Numerical simulations of a single magnetic island evolution are presented in the regime where the island width is smaller than an ion Larmor radius. It is shown that the island rotation is controlled by particle diffusion due to collisions or a background of microturbulence. As expected from the theory of a stationary island, there exist cases where linearly stable magnetic perturbation are nonlinearly self-sustained. This situation corresponds to large poloidal beta and temperature gradient. The drive is due to diamagnetic frequency effects. However, this situation is not generic, and islands can also decay. It is found that a magnetic island is self-sustained for a negative off-diagonal diffusion coefficient. This case occurs in a tokamak if the inward particle pinch is due to the temperature gradient. (author)
76 FR 65988 - Importation of Mangoes From Australia
2011-10-25
...), and (ii) The mangoes were inspected prior to export from Australia and found free of C. mangiferae, L.... APHIS-2011-0040] RIN 0579-AD52 Importation of Mangoes From Australia AGENCY: Animal and Plant Health... concerning the importation of fruits and vegetables to allow the importation of fresh mangoes from Australia...
Examining supply changes in Australia's cocaine market.
Hughes, Caitlin E; Chalmers, Jenny; Bright, David A; Matthew-Simmons, Francis; Sindicich, Natasha
2012-05-01
Media attention to cocaine use and supply has increased following some of the largest cocaine seizures in Australia's history. Whether there has been an expansion in supply remains unclear. This paper examines the evidence behind assertions of increased supply in Australia and the scale and nature of any apparent increase, using proxy indicators of cocaine importation, distribution and use. Eight proxies of cocaine importation, distribution and use were adopted, including amount of importation, mode of importation and supply flows to Australia. Each proxy indicator was sourced using publicly available and Australia-wide data, including information on the total weight of border seizures, mode of detection and country of embarkation of individual seizures. Data permitting, trends were examined for up to a 12 year period (1997-1998 to 2009-2010). Since 2006-2007 there was evidence of increased cocaine importation, albeit less than between 1998-1999 and 2001-2002. There were further signs that the 2006-2007 expansion coincided with a diversification of trafficking routes to and through Australia (beyond the traditional site of entry-Sydney) and shifts in the geographic distribution of use. The congruity between indicators suggests that there has been a recent expansion in cocaine supply to and distribution within Australia, but that the more notable shift has concerned the nature of supply, with an apparent growth in importation and distribution beyond New South Wales. The diversification of cocaine supply routes may increase risks of market entrenchment and organised crime throughout Australia. © 2011 Australasian Professional Society on Alcohol and other Drugs.
Metallogenic relationships to tectonic evolution - the Lachlan Orogen, Australia
Bierlein, Frank P.; Gray, David R.; Foster, David A.
2002-08-01
Placing ore formation within the overall tectonic framework of an evolving orogenic system provides important constraints for the development of plate tectonic models. Distinct metallogenic associations across the Palaeozoic Lachlan Orogen in SE Australia are interpreted to be the manifestation of interactions between several microplates and three accretionary complexes in an oceanic back-arc setting. In the Ordovician, significant orogenic gold deposits formed within a developing accretionary wedge along the Pacific margin of Gondwana. At the same time, major porphyry Cu-Au systems formed in an oceanic island arc outboard of an evolved magmatic arc that, in turn, gave rise to granite-related Sn-W deposits in the Early Silurian. During the ongoing evolution of the orogen in the Late Silurian to Early Devonian, sediment-hosted Cu-Au and Pb-Zn deposits formed in short-lived intra-arc basins, whereas a developing fore-arc system provided the conditions for the formation of several volcanogenic massive sulphide deposits. Inversion of these basins and accretion to the Australian continental margin triggered another pulse of orogenic gold mineralisation during the final consolidation of the orogenic belt in the Middle to Late Devonian.
Reliving Island Life: Staging Stories of the Blasket Islands
Directory of Open Access Journals (Sweden)
Daithí Kearney
2017-10-01
Full Text Available The Blasket Islands are located off the south-west coast of Ireland. No longer inhabited, the Great Blasket Island and its distinctive culture have been documented by a variety of writers and are celebrated today in an interpretative centre on the mainland and in performances by Siamsa Tíre, The National Folk Theatre of Ireland. “Siamsa” developed from local initiatives in North Kerry during the early 1960s and is located today in Tralee, Co. Kerry. It aims to present Irish folklore and folk culture through the medium of theatre involving music, song, dance and mime but invariably no dialogue. In this paper, I focus on the production Oiléan, based loosely on the stories of the Blasket Islanders, which was initially devised as part of the fiftieth anniversary commemoration of the departure of the last inhabitants of the islands in 2003.
46 CFR 7.85 - St. Simons Island, GA to Little Talbot Island, FL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false St. Simons Island, GA to Little Talbot Island, FL. 7.85... BOUNDARY LINES Atlantic Coast § 7.85 St. Simons Island, GA to Little Talbot Island, FL. (a) A line drawn from latitude 31°04.1′ N. longitude 81°16.7′ W. (St. Simons Lighted Whistle Buoy “ST S”) to latitude 30...
WAVFH delegates' reports: Australia
International Nuclear Information System (INIS)
Scanlan, W.A.
1986-01-01
Radiation measuring and control before Chernobyl: Continuous measurements of fallout in different parts of Australia, including the food producing areas, have been made since the mid 1950s. Levels have decreased rapidly since the cessation of atmospheric nuclear tests in the Southern Hemisphere in 1974 and in the Northern Hemisphere in 1980. Measurements of concentrations of radionuclides arising from fallout were made for the major groups of foods affected by the radioactive contaminants, starting in the 1950s and continuing until concentrations were so low that further effort in measurement was not warranted, i.e., less than 0.1 Bq/kg or 0.1 Bq/l. Changes in the concentrations of radionuclides in foods follow the same trends as the fallout levels. Based on the low levels of fallout measured in Australia since the 1950s, and taking into account the extremely low levels during the past decade, the concentrations of radionuclides arising from fallout in foods grown and processed in Australia are extremely small. Results from the fall-out from Chernobyl. Since the Chernobyl accident, measurements of the concentrations of 137 Cs in a variety of foodstuffs grown in Australia have been made, mainly for export purposes. A summary of the results of these measurements is given in Table 111 of Attachment 2. No 134 Cs has been detected, nor is it likely to be. By taking into account these measurements, the earlier measurements of foodstuffs, predictive modelling values and the very low levels of fall-out in deposit and in air, it is concluded that the concentrations of 137 Cs in all foodstuffs grown in Australia are extremely small. Accordingly, their consumption would result in no significant risk to the health of a population. With world atmospheric conditions being as they are, it will probably be 12 to 18 months before any fallout reaches Australia. Even if some fall-out does occur, it will be minimal and should not significantly increase our very low natural levels
Adaptive radiation of island plants: Evidence from Aeonium (Crassulaceae) of the Canary Islands
DEFF Research Database (Denmark)
Jorgensen, T.H.; Olesen, J.M.
2001-01-01
evidence that such traits have been acquired through convergent evolution on islands comes from molecular phylogenies; however, direct evidence of their selective value rarely is obtained. The importance of hybridization in the evolution of island plants is also considered as part of a more general......The presence of diverse and species-rich plant lineages on oceanic islands is most often associated with adaptive radiation. Here we discuss the possible adaptive significance of some of the most prominent traits in island plants, including woodiness, monocarpy and sexual dimorphisms. Indirect...... discussion of the mechanisms governing radiations on islands. Most examples are from the Hawaiian and Canarian floras, and in particular from studies on the morphological, ecological and molecular diversification of the genus Aeonium, the largest plant radiation of the Canarian Islands....
Radioactive waste management and disposal in Australia
International Nuclear Information System (INIS)
Harries, J.R.
1997-01-01
A national near-surface repository at a remote and arid location is proposed for the disposal of solid low-level and short-lived intermediate-level radioactive wastes in Australia. The repository will be designed to isolate the radioactive waste from the human environment under controlled conditions and for a period long enough for the radioactivity to decay to low levels. Compared to countries that have nuclear power programs, the amount of waste in Australia is relatively small. Nevertheless, the need for a national disposal facility for solid low-level radioactive and short-lived intermediate-level radioactive wastes is widely recognised and the Federal Government is in the process of selecting a site for a national near-surface disposal facility for low and short-lived intermediate level wastes. Some near surface disposal facilities already exist in Australia, including tailings dams at uranium mines and the Mt Walton East Intractable Waste Disposal Facility in Western Australia which includes a near surface repository for low level wastes originating in Western Australia. 7 refs, 1 fig., 2 tabs
Directory of Open Access Journals (Sweden)
Karin Breugelmans
2012-06-01
Full Text Available In April 2009 two specimens of a terrestrial flatworm were collected from under a rock in an orchard at Ciutadella de Menorca on the easternmost Balearic island of Menorca (Spain. Their external morphology suggested that both specimens belonged to the invasive blue planarian Caenoplana coerulea, a species which is native to eastern Australia. Sequence data of a fragment of the mitochondrial cytochrome c oxidase subunit I (COI and of the entire 18S ribosomal RNA confirm its identification. This is one of the first records of the species in Europe where it has only been found in one locality in the United Kingdom, France and NE Spain.
Ford, Murray R.; Kench, Paul S.
2014-06-01
In 1905, a devastating typhoon hit Nadikdik Atoll (5°54‧ N and 172°09‧ E) in the southern Marshall Islands. Evidence suggests that large sections of reef islands on Nadikdik were overwashed and destroyed. Comparison of aerial photographs taken in 1945 and modern satellite imagery provides a unique record of the geomorphic adjustment of islands after the typhoon. Between 1945 and 2010 the vegetated area of islands on Nadikdik grew from 0.74 to 0.90 km2. Observed changes to Nadikdik reef islands manifested through a range of styles and were largely accretionary. Of note, the formation of a new island was tracked from an embryonic deposit to a fully vegetated and stable island over a 61 year period. Similarly, a number of previously discrete islands have agglomerated and formed a single larger island. These changes were rapid and indicate that reef island formation can occur quickly. Evidence suggests that despite the typhoon occurring over a century ago the geomorphic adjustment of islands is still on-going.
Energy Technology Data Exchange (ETDEWEB)
Sieglitz, Greg
2001-03-01
The Big Island site is located in the McKenzie River flood plain, containing remnant habitats of what was once more common in this area. A diverse array of flora and fauna, representing significant wildlife habitats, is present on the site. Stands of undisturbed forested wetlands, along with riparian shrub habitats and numerous streams and ponds, support a diversity of wildlife species, including neotropical migratory songbirds, raptors, mammals, reptiles, and amphibians (including two State-listed Sensitive Critical species). The project is located in eastern Springfield, Oregon (Figure 1). The project area encompasses 187 acres under several ownerships in Section 27 of Township 17S, Range 2W. Despite some invasion of non-native species, the site contains large areas of relatively undisturbed wildlife habitat. Over several site visits, a variety of wildlife and signs of wildlife were observed, including an active great blue heron rookery, red-Legged frog egg masses, signs of beaver, and a bald eagle, Wildlife habitat values resulting from the purchase of this site will contribute toward the goal of mitigating for habitat lost as outlined in the Bonneville Power Administration's (BPA) Mitigation and Enhancement Plan for the Willamette River Basin. Under this Plan, mitigation goals and objectives were developed as a result of the loss of wildlife habitat due to the construction of Federal hydroelectric facilities in the Willamette River Basin. Results of the Habitat Evaluation Procedures (HEP) will be used to: (1) determine the current habitat status of the study area and habitat enhancement potential of the site consistent with wildlife mitigation goals and objectives; and (2) develop a management plan for the area.
Climate change and wind power in Australia
International Nuclear Information System (INIS)
Millais, C.
2001-01-01
The article represents a stern criticism of Australia's attitude to climate change. Its climate change policy is described as 'Neanderthal'. The Australian government is said to be strongly opposed to ratification of the Kyoto Protocol. The Government's policy appears to be driven by vested interests in fossil fuels. A list of eight flaws in Australia's 2% renewables target is given; the target is said to be far too small for a country with so much renewables potential. However, investment in the country's enormous wind power potential is increasing and targets are given; six reasons why Australia needs to invest in wind power are given. It is suggested that by the end of this decade, 10% of Australia's electricity could come from wind power - a web site address giving further details is given
Directory of Open Access Journals (Sweden)
Gregory J Barord
Full Text Available The extant species of Nautilus and Allonautilus (Cephalopoda inhabit fore-reef slope environments across a large geographic area of the tropical western Pacific and eastern Indian Oceans. While many aspects of their biology and behavior are now well-documented, uncertainties concerning their current populations and ecological role in the deeper, fore-reef slope environments remain. Given the historical to current day presence of nautilus fisheries at various locales across the Pacific and Indian Oceans, a comparative assessment of the current state of nautilus populations is critical to determine whether conservation measures are warranted. We used baited remote underwater video systems (BRUVS to make quantitative photographic records as a means of estimating population abundance of Nautilus sp. at sites in the Philippine Islands, American Samoa, Fiji, and along an approximately 125 km transect on the fore reef slope of the Great Barrier Reef from east of Cairns to east of Lizard Island, Australia. Each site was selected based on its geography, historical abundance, and the presence (Philippines or absence (other sites of Nautilus fisheries The results from these observations indicate that there are significantly fewer nautiluses observable with this method in the Philippine Islands site. While there may be multiple possibilities for this difference, the most parsimonious is that the Philippine Islands population has been reduced due to fishing. When compared to historical trap records from the same site the data suggest there have been far more nautiluses at this site in the past. The BRUVS proved to be a valuable tool to measure Nautilus abundance in the deep sea (300-400 m while reducing our overall footprint on the environment.
Bryophytes from Simeonof Island in the Shumagin Islands, southwestern Alaska
Schofield, W.B.; Talbot, S. S.; Talbot, S.L.
2004-01-01
Simeonof Island is located south of the Alaska Peninsula in the hyperoceanic sector of the middle boreal subzone. We examined the bryoflora of Simeonof Island to determine species composition in an area where no previous collections had been reported. This field study was conducted in sites selected to represent the spectrum of environmental variation within Simeonof Island. Data were analyzed using published reports to compare bryophyte distribution patterns at three levels, the Northern Hemisphere, North America, and Alaska. A total of 271 bryophytes were identified: 202 mosses and 69 liverworts. The annotated list of species for Simeonof Island expands the known range for many species and fills distribution gaps within Hulte??n's Western Pacific Coast district. Maps and notes on the distribution of 14 significant distribution records are presented. Compared with bryophyte distribution in the Northern Hemisphere, the bryoflora of Simeonof Island primarily includes taxa of boreal (55%), temperate (20%), arctic (10%), and cosmopolitan (8%) distribution; 6% of the moss flora are western North America endemics. A description of the bryophytes present in the vegetation and habitat types is provided as is a quantitative analysis of the most frequently occurring bryophytes in crowberry heath.
On the form of species–area relationships in habitat islands and true islands
DEFF Research Database (Denmark)
Matthews, Thomas J.; Guilhaumon, François; Triantis, Kostas A.
2016-01-01
and c vary between different island types. Location: Global. Methods: We used an information theoretic approach to compare the fit of 20 ISAR models to 207 habitat island datasets. Model performance was ranked according to pre-set criteria, including metrics of generality and efficiency. We also fitted......, and was the highest ranked model overall. In general, the more complex models performed badly. Average z-values were significantly lower for habitat island datasets than for true islands, and were higher for mountaintop and urban habitat islands than for other habitat island types. Average c-values were significantly...... multimodel comparisons demonstrated the nonlinear implementation of the power model to be the best overall model and thus to be a sensible choice for general use. As the z-value of the log–log power model varied in relation to ecological and geographical properties of the study systems, caution should...
Island formation without attractive interaction
Jansen, A.P.J.
2008-01-01
We show that adsorbates on surfaces can form islands even if there are no attractive interactions. Instead, strong repulsion between adsorbates at short distances can lead to islands, because such islands increase the entropy of the adsorbates that are not part of the islands. We suggest that this
The economic consequences of carbon taxation in Australia
Energy Technology Data Exchange (ETDEWEB)
Common, M. [Australian National Univ., Canberra, ACT (Australia). Centre for Resource and Environmental Studies; Hamilton, C. [Australia Institute, Deakin, ACT (Australia)
1996-12-31
Global warming is an international problem. Multilateral actions agreed to under international treaties would be the most effective means of limiting global carbon dioxide emissions. Each country, however, would have some discretion in deciding how best to meet its obligations. In this paper, a potentially important `unilateral` action on the part of Australia, a carbon tax, is examined. When combined with a package of other measures, it may be argued that carbon taxation might be a beneficial policy measure even though actions by Australia would have only a small impact on global emissions. While the arguments may be developed in the Australian context they are relevant to industrial countries more generally. After considering Australia`s current situation with respect the emissions and international greenhouse obligations, the advantages and disadvantages of a carbon tax are reviewed. Based on some modelling work on the effects of introducing a carbon tax in Australia, including projections of impacts on carbon emissions, economic growth and employment, it is concluded that, with appropriate use of carbon tax revenues, there is a prima facie case for the unilateral introduction of carbon taxation in Australia. (author). 7 tabs., refs.
Groot, de Alma V.; Oost, Albert P.; Veeneklaas, Roos M.; Lammerts, Evert Jan; Duin, van Willem E.; Wesenbeeck, van Bregje K.
2016-01-01
The Frisian islands (Southern North Sea) have extensive island tails, i.e. the entire downdrift side of an island consisting of salt marshes, dunes, beaches and beach plains, and green beaches. Currently, large parts of these tails are ageing and losing dynamics, partly due to human influence.
Status of radionuclide monitoring stations in Australia
International Nuclear Information System (INIS)
Burns, P.A.
2001-01-01
The Australian Radiation Protection and Nuclear Safety Agency (ANSTO) first became involved in the monitoring of radionuclides in the environment in 1955 when assessing the effects on the Australian population of the radioactive releases associated with the atmospheric testing of nuclear weapons. (At that time ARPANSA was known as the Commonwealth X-ray and Radium Laboratory). The United Kingdom had tested weapons in Australia in 1952 and 1953 and in August 1954 entered into an agreement with the Australian Government to establish a test range at Maralinga in South Australia. The government established a Maralinga Safety Committee and through this Committee ARPANSA became involved in the surveillance of radioactive fallout over Australia. The primary function of this surveillance was to ensure that the nuclear trials would not adversely effect the health of the Australian population. A program was established to reliably assess the deposition of radioactive fallout over Australia so that exposure to the population could be estimated. This task was performed in conjunction with the Bureau of Meteorology and the Department of Supply. Measurements were made on daily samples of fallout dawn from 10 centres throughout Australia. A low level radiochemical facility was established in 1961 for the measurement of 90 Sr and 137 Cs in environmental samples so that the long term distribution of fallout could be tracked. In the 1960s the program was extended to measure fresh fission products reaching Australia from atmospheric testing in other countries, usually originating from test sites in the northern hemisphere. The sampling program that was established was designed so that it could be rapidly expanded when a new testing program started. At this time a permanent fallout monitoring network was established around Australia using high volume air samplers capable of sampling up to 10000 m 3 per week. Approximately six stations have been operated at any one time but the
International Nuclear Information System (INIS)
Bratic, S.; Krajacic, G.; Duic, N.; Cotar, A.; Jardas, D.
2011-01-01
In order to analyze energy self-sufficient island, example of a smaller island, connected to the power system of a bigger island with an undersea cable, was taken. Mounting substation 10/0,4 is situated on the island and for the moment it provides enough electricity using the medium voltage line. It is assumed that the island is situated on the north part of the Adriatic Sea. The most important problem that occurs on the island is the population drop that occurs for a significant number of years, therefore, life standard needs to be improved, and economic development needs to be encouraged immediately. Local authorities to stimulate sustainable development on the island through different projects, to breath in a new life to the island, open new jobs and attract new people to come live there. Because of the planned development and increase of the population, energy projects, planned as a support to sustainable development, and later achievement of the energy self-sufficiency, is described in this paper. Therefore, Rewisland methodology appliance is described taking into the account three possible scenarios of energy development. Each scenario is calculated until year 2030. Also, what is taken into the account is 100% usage of renewable sources of energy in 2030. Scenario PTV, PP, EE - This scenario includes installation of solar photovoltaic modules and solar thermal collectors on the buildings roofs, as well as well as implementation of energy efficiency on the island (replacement of the street light bulbs with LED lightning, replacement of the old windows and doors on the houses, as well as the installation of the thermal insulation). Scenario PV island - This scenario, similarly to the previous one, includes installation of solar photovoltaic modules and solar thermal collectors an the residential buildings, as well as the 2 MW photovoltaic power plant and ''Green Hotel'', a building that satisfies all of its energy needs completely from renewable energy sources
One million served: Rhode Island`s recycling facility
Energy Technology Data Exchange (ETDEWEB)
Malloy, M.G.
1997-11-01
Rhode Island`s landfill and adjacent materials recovery facility (MRF) in Johnston, both owned by the quasi-public Rhode Island Resource Recovery Corp. (RIRRC, Johnston), serve the entire state. The $12-million recycling facility was built in 1989 next to the state`s sole landfill, the Central Landfill, which accepts only in-state trash. The MRF is operated for RIRRC by New England CRInc. (Hampton, N.H.), a unit of Waste Management, Inc. (WMI, Oak Brook, Ill.). It handles a wide variety of materials, from the usual newspaper, cardboard, and mixed containers to new streams such as wood waste, scrap metal, aseptic packaging (milk and juice boxes), and even textiles. State municipalities are in the process of adding many of these new recyclable streams into their curbside collection programs, all of which feed the facility.
The crustal thickness of Australia
Clitheroe, G.; Gudmundsson, O.; Kennett, B.L.N.
2000-01-01
We investigate the crustal structure of the Australian continent using the temporary broadband stations of the Skippy and Kimba projects and permanent broadband stations. We isolate near-receiver information, in the form of crustal P-to-S conversions, using the receiver function technique. Stacked receiver functions are inverted for S velocity structure using a Genetic Algorithm approach to Receiver Function Inversion (GARFI). From the resulting velocity models we are able to determine the Moho depth and to classify the width of the crust-mantle transition for 65 broadband stations. Using these results and 51 independent estimates of crustal thickness from refraction and reflection profiles, we present a new, improved, map of Moho depth for the Australian continent. The thinnest crust (25 km) occurs in the Archean Yilgarn Craton in Western Australia; the thickest crust (61 km) occurs in Proterozoic central Australia. The average crustal thickness is 38.8 km (standard deviation 6.2 km). Interpolation error estimates are made using kriging and fall into the range 2.5-7.0 km. We find generally good agreement between the depth to the seismologically defined Moho and xenolith-derived estimates of crustal thickness beneath northeastern Australia. However, beneath the Lachlan Fold Belt the estimates are not in agreement, and it is possible that the two techniques are mapping differing parts of a broad Moho transition zone. The Archean cratons of Western Australia appear to have remained largely stable since cratonization, reflected in only slight variation of Moho depth. The largely Proterozoic center of Australia shows relatively thicker crust overall as well as major Moho offsets. We see evidence of the margin of the contact between the Precambrian craton and the Tasman Orogen, referred to as the Tasman Line. Copyright 2000 by the American Geophysical Union.
Immigrants, islandness and perceptions of quality-of-life on Prince Edward Island, Canada
Directory of Open Access Journals (Sweden)
Peter Kitchen
2014-11-01
Full Text Available This paper explores perceptions of immigrant quality-of-life (QOL and islandness in Charlottetown, Prince Edward Island, Canada, and compares these perceptions to those of Canadian-born residents of the same provincial capital. The study employed a mixed-methods approach, including a household telephone survey conducted in the summer of 2012 (n=302, focus group interviews with immigrants in late 2012 and observations on preliminary results by the staff of the PEI Association of Newcomers to Canada (PEIANC, the primary immigrant settlement service agency on the island. The analysis of the results suggests that immigrants have a high and undifferentiated assessment of their own QOL, sense of belonging and sense of place compared to Canadian-born islanders; immigrants are also critical of the quality of education and of the range of recreational and cultural events underway on the Island. While they express positive sentiments regarding life on the Island, immigrants still feel excluded from social and economic opportunities.
Directory of Open Access Journals (Sweden)
Gunthorpe Wendy
2007-11-01
Full Text Available Abstract Aboriginal and Torres Strait Islander Australians experience widespread socioeconomic disadvantage and health inequality. In an attempt to make Indigenous health research more culturally-appropriate, Aboriginal and Torres Strait Islander Australians have called for more attention to the concept of emotional and social wellbeing (ESWB. Although it has been widely recognised that ESWB is of crucial importance to the health of Aboriginal and Torres Strait Islander peoples, there is little consensus on how to measure in Indigenous populations, hampering efforts to better understand and improve the psychosocial determinants of health. This paper explores the policy and political context to this situation, and suggests ways to move forward. The second part of the paper explores how scales can be evaluated in a health research setting, including assessments of endorsement, discrimination, internal and external reliability. We then evaluate the use of a measure of stressful life events, the Negative Life Events Scale (NLES, in two samples of Aboriginal people living in remote communities in the Northern Territory of Australia. We argue that the Negative Life Events Scale is a promising assessment of psychosocial wellbeing in Aboriginal and Torres Strait Islander populations. Evaluation of the scale and its performance in other samples of Aboriginal and Torres Strait Islander populations is imperative if we hope to develop better, rather than more, scales for measuring ESWB among Indigenous Australians. Only then will it be possible to establish standardized methods of measuring ESWB and develop a body of comparable literature that can guide both a better understanding of ESWB, and evaluation of interventions designed to improve the psychosocial health of Indigenous populations and decrease health inequalities.
Pathogenicity island mobility and gene content.
Energy Technology Data Exchange (ETDEWEB)
Williams, Kelly Porter
2013-10-01
Key goals towards national biosecurity include methods for analyzing pathogens, predicting their emergence, and developing countermeasures. These goals are served by studying bacterial genes that promote pathogenicity and the pathogenicity islands that mobilize them. Cyberinfrastructure promoting an island database advances this field and enables deeper bioinformatic analysis that may identify novel pathogenicity genes. New automated methods and rich visualizations were developed for identifying pathogenicity islands, based on the principle that islands occur sporadically among closely related strains. The chromosomally-ordered pan-genome organizes all genes from a clade of strains; gaps in this visualization indicate islands, and decorations of the gene matrix facilitate exploration of island gene functions. A %E2%80%9Clearned phyloblocks%E2%80%9D method was developed for automated island identification, that trains on the phylogenetic patterns of islands identified by other methods. Learned phyloblocks better defined termini of previously identified islands in multidrug-resistant Klebsiella pneumoniae ATCC BAA-2146, and found its only antibiotic resistance island.
Directory of Open Access Journals (Sweden)
Kenji Suetsugu
2014-12-01
Full Text Available We found Gastrodia fontinalis T. P. Lin in a bamboo forest from Takeshima Island, which is the northernmost island of the Ryukyu Islands in Japan. This species is apparently rare and was previously considered to be an endemic Taiwanese species. Because there are a few minor differences between the original description and our specimens collected in Takeshima Island, here we report Gastrodia fontinalis from Takeshima Island as the first record outside of Taiwan, with a description of the specimens from Takeshima Island.
Hamilton, D G
1986-11-17
The contributions of Australian doctors to the visual arts are being described in a series of six articles. Work from doctors in New South Wales and Victoria has been covered previously. Now activities in South Australia, Tasmania, Western Australia, Queensland and the Northern Territory are presented.
Directory of Open Access Journals (Sweden)
Gibson Odette R
2012-07-01
Full Text Available Abstract Background To develop an instrument that predicts diabetes-related vascular disease severity using routinely collected data on Australian Aboriginal and Torres Strait Islander adults with type 2 diabetes, in the absence of diabetes duration. Methods A complex diabetes severity classification system was simplified and adapted for use with an Australian Aboriginal and Torres Strait Islander adult population with type 2 diabetes in north Queensland. Detailed vascular health risks and morbidities were mapped to routinely collected measures. Individual–level health screening, hospital separation and mortality data were linked and used to plot mean monthly in-patient hospital cost and percent mortality by disease severity as defined by the newly developed instrument, to test construct validity. Results The revised instrument consists of four combined diabetes-related microvascular and macrovascular stages that range from least severe (stage 1 to severe irreversible vascular impairment (stage 4. When applied to data of an Aboriginal and Torres Strait Islander Australian population the instrument showed good construct validity, predicting higher hospital cost and mortality as vascular disease severity increased. Conclusions This instrument discriminates between levels of diabetes-related vascular disease severity, displays good construct validity by predicting increased hospital cost and mortality with worsening severity and can be populated with routinely collected data. It may assist with future health service research and its use could be extended to practice settings for health care planning for diabetes management programs and monitoring vascular disease progression.
Renewable energy islands in Europe
Energy Technology Data Exchange (ETDEWEB)
Oestergaard, Iben [ed.
1998-12-31
This publication includes a compiled presentation of various aspects concerning the possible transformation of some European islands into renewable energy communities and these projects were presented by a selection of pioneer islands at the first European Seminar on Renewable Energy Islands, held on the Danish island of Samsoee, 29-30 June 1998. This issue has increased in importance with the presentation of the ambitious EU-White Paper: `Energy for the future: Renewable Sources of Energy` which was adopted in 1998. One of the key elements of the strategy for an accelerated implementation of renewable energy is to transform 100 localities within Europe into communities which are to be 100% self-sufficient with renewable energy before 2010. In line with this strategy, the Danish Government appointed the island of Samsoe towards the end of 1997 to be the first `official` Danish, renewable energy island. This is to serve as a demonstration project for other local communities, both in Denmark as well as in the rest Europe. Gothland, Madeira, Canary Islands, Cape Verde, Arki, Crete, Minorca and Orkney Islands were represented. Environmental advantages of wind, solar and wave power for distant island communities were indicated. Serious savings would be achieved by limitation of fossil fuel import and utilization of local resources. (EG)
Directory of Open Access Journals (Sweden)
Scarla J. Weeks
2015-03-01
Full Text Available Manta rays are classified as Vulnerable to Extinction on the IUCN Red List for Threatened Species. In Australia, a key aggregation site for reef manta rays is Lady Elliot Island (LEI on the Great Barrier Reef, ~7 km from the shelf edge. Here, we investigate the environmental processes that triggered the largest manta ray feeding aggregation yet observed in Australia, in early 2013. We use MODIS sea surface temperature (SST, chlorophyll-a concentration and photic depth data, together with in situ data, to show that anomalous river discharges led to high chlorophyll (anomalies: 10–15 mg∙m−3 and turbid (photic depth anomalies: −15 m river plumes extending out to LEI, and that these became entrained offshore around the periphery of an active cyclonic eddy. Eddy dynamics led to cold bottom intrusions along the shelf edge (6 °C temperature decrease, and at LEI (5 °C temperature decrease. Strongest SST gradients (>1 °C∙km−1 were at the convergent frontal zone between the shelf and eddy-influenced waters, directly overlying LEI. Here, the front intensified on the spring ebb tide to attract and shape the aggregation pattern of foraging manta rays. Future research could focus on mapping the probability and persistence of these ecologically significant frontal zones via remote sensing to aid the management and conservation of marine species.
Barrier island habitat map and vegetation survey—Dauphin Island, Alabama, 2015
Enwright, Nicholas M.; Borchert, Sinéad M.; Day, Richard H.; Feher, Laura C.; Osland, Michael J.; Wang, Lei; Wang, Hongqing
2017-08-04
Barrier islands are dynamic environments due to their position at the land-sea interface. Storms, waves, tides, currents, and relative sea-level rise are powerful forces that shape barrier island geomorphology and habitats (for example, beach, dune, marsh, and forest). Hurricane Katrina in 2005 and the Deep Water Horizon oil spill in 2010 are two major events that have affected habitats and natural resources on Dauphin Island, Alabama. The latter event prompted a collaborative effort between the U.S. Geological Survey, the U.S. Army Corps of Engineers, and the State of Alabama funded by the National Fish and Wildlife Foundation to investigate viable, sustainable restoration options that protect and restore the natural resources of Dauphin Island, Alabama.In order to understand the feasibility and sustainability of various restoration scenarios, it is important to understand current conditions on Dauphin Island. To further this understanding, a detailed 19-class habitat map for Dauphin Island was produced from 1-foot aerial infrared photography collected on December 4, 2015, and lidar data collected in January 2015. We also conducted a ground survey of habitat types, vegetation community structure, and elevations in November and December 2015. These products provide baseline data regarding the ecological and general geomorphological attributes of the area, which can be compared with observations from other dates for tracking changes over time.
33 CFR 80.712 - Morris Island, SC to Hilton Head Island, SC.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Morris Island, SC to Hilton Head..., SC to Hilton Head Island, SC. (a) A line drawn from the easternmost tip of Folley Island to the... easternmost extremity of Hilton Head at latitude 32°13.0′ N. longitude 80°40.1′ W. [CGD 77-118a, 42 FR 35784...
Island dynamics and Minoan expansion in the Aegean: the Kythera Island Project
Directory of Open Access Journals (Sweden)
Cyprian Broodbank
1999-11-01
Full Text Available In recent years archaeologists have become increasingly interested in the investigation of island societies. At a global level, discoveries in the Pacific, Caribbean, Mediterranean and elsewhere have greatly improved our understanding of the antiquity and dynamics of island life. Now archaeologists at the Institute, together with other colleagues, have embarked on a long-term interdisciplinary study of the island of Kythera in the Aegean.
Rethinking "Commercial" Surrogacy in Australia.
Millbank, Jenni
2015-09-01
This article proposes reconsideration of laws prohibiting paid surrogacy in Australia in light of increasing transnational commercial surrogacy. The social science evidence base concerning domestic surrogacy in developed economies demonstrates that payment alone cannot be used to differentiate "good" surrogacy arrangements from "bad" ones. Compensated domestic surrogacy and the introduction of professional intermediaries and mechanisms such as advertising are proposed as a feasible harm-minimisation approach. I contend that Australia can learn from commercial surrogacy practices elsewhere, without replicating them.
Directory of Open Access Journals (Sweden)
J. P. Roux
1992-10-01
Full Text Available The physiography and climate of Inaccessible and Nightingale Islands are briefly discussed. The vegetation and the major plant associations are described. Notes are given on the ecology and distribution of each taxon. Taxa newly recorded for Inaccessible Island include Agrostis goughensis, A.holgateana, A. wacei, Calamagrostis deschampsiiformis, Carex thouarsii var. recurvata, Conyza albida, Elaphoglossum campylolepium and Uncinia meridensis. One species, C. albida, is alien to the Tristan group. Two native ferns Asplenium platybasis var. subnudum and Blechnum australe were found on Nightingale Island for the first time, and the presence of introduced Malus domestica orchards was recorded. Two unidentified taxa were found that may represent new species: Elaphoglossum sp. at Inaccessible Island and Apium sp. at both Inaccessible and Nightingale Islands. The total number of vascular plant species recorded at Inaccessible and Nightingale Islands now stands at 98 and 43, respectively, of which 26 (28% and seven (16% are introduced species. Only Airiplex plebeja and two species of Cotula occur at Nightingale Island but are absent from Inaccessible Island.
World Bank
2015-01-01
This note aims to build understanding of the existing disaster risk financing and insurance (DRFI) tools in use in The Marshall Islands and to identify gaps where potential engagement could further develop financial resilience. The likelihood that a hazardous event will have a significant impact on the Marshall Islands has risen with the increasing levels of population and assets in the urban ...
Feasibility of uranium enrichment in Australia
International Nuclear Information System (INIS)
1979-10-01
The Council considered that provided the balance between costs and markets was found to be acceptable, there was no valid reason against the Government proceeding with a study on the feasibility of, and perhaps participating in the establishment of a commercial uranium enrichment industry in Australia. Areas covered include technical expertise and industrial structure in Australia, environmental aspects and safeguards
Cheema, Birinder S; Robergs, Robert A; Askew, Christopher D
2014-07-01
Exercise can be prescribed to prevent, manage, and treat many leading non-communicable diseases (NCDs) and underlying risk factors. However, surprisingly, Australia is one of only a few countries where allied healthcare professionals with specialized university education and training in exercise prescription and delivery provide services within a government-run healthcare system (Medicare). This article presents data on Medicare-funded services provided by accredited exercise physiologists (AEPs) from the inclusion of the profession in the allied healthcare model (January, 2006) to the end of 2012. We conceptualize these data in relation to current NCD trends, and outline recommendations that can potentially help curtail the current chronic disease burden through the further integration of exercise professionals into the healthcare system in Australia, and internationally. From 2006 to 2012, the number of AEPs in Australia has increased 563 %. This rise in AEPs has been paralleled by increased delivery of services for eligible patients with a chronic medical condition (+614 %), type 2 diabetes mellitus (+211 to 230 %), and of Aboriginal and Torres Strait Islander descent (+343 %). These trends, which were developed through the "early years" of the profession, are encouraging and suggest that AEPs have taken up a vital position within the healthcare system. However, the total number of services provided by AEPs currently remains very low in relation to the prevalence of overweight-obesity and type 2 diabetes in Australia. Furthermore, services for Aboriginal Australians are very low considering the extreme burden of chronic diseases in these vulnerable populations. We provide some recommendations that may help the exercise physiology profession play a greater role in tackling the NCD burden and shift the healthcare model in a direction that is more proactive and focused on disease prevention and health, including the early identification and treatment of major
A man and his island: The island mirror in Michael Crummey’s Sweetland
Directory of Open Access Journals (Sweden)
Laurie Brinklow
2016-05-01
Full Text Available Between 1946 and 1975, dozens of islands and outports in the Canadian province of Newfoundland and Labrador were abandoned as part of a government resettlement policy. Families and communities were torn apart, and a culture and way of life that revolved around the fishery changed irrevocably. The practice, which continues to this day, has been well documented, particularly by artists and writers. Michael Crummey’s 2014 novel Sweetland is a recent iteration. The relationship between humans and place is complex: on an island, with compressed space and a very real boundary that is the ocean, emotional attachments to one’s place are often heightened and distilled. What happens when a person is displaced from his or her island; when bonds of attachment are severed and one’s mirrored double is destroyed? Sweetland offers a fictional lens through which we see an example of a mirrored relationship between an island protagonist and his island setting. Exploring themes of attachment to place, and what Barry Lopez calls a “storied” or “reciprocal” relationship with the land, this paper examines what happens to a man when confronted with leaving an island he knows as deeply as his own body and soul; and how the island reacts.
International Nuclear Information System (INIS)
Dickson, A.
1999-01-01
Australian Bureau of Agricultural and Resource Economics (ABARE)'s biennial fuel and electricity survey provides a comprehensive database with which is possible to examine recent trends and developments in Australia's energy market. Some key development are outlined in this article. While energy consumption in Australia has been increasing steadily since 1973-74, substantial changes have occurred 'behind the scenes' in terms of the states and sectors in which energy is consumed and the overall fuel mix. Historically, the south-eastern states of New South Wales and Victoria have accounted for the largest shares of total energy consumption In recent years, however, the dominance of New South Wales and Victoria (and particularly New South Wales) has come under pressure from the states of Queensland. Western Australia, and to a lesser extent, the Northern Territory. Each of these states has experienced rapid growth in energy consumption, due mainly to a number of strongly growing energy intensive industries, particularly in the mining and minerals processing sectors. High economic and population growth over this period were also important factors. An increase in the share of natural gas- and a corresponding decline in the share of crude oil - is the most evident change to have occurred in the fuel mix since 1973-1974. However, since 1993, the trend has changed, the share of coal (and particularly brown coal) increased strongly, making it the primary fuel source for thermal electricity generation. This recent shift has been driven by developments in Queensland and Victoria
Island development: Local governance under globalization
Directory of Open Access Journals (Sweden)
Huei-Min Tsai
2014-12-01
Full Text Available Issues surrounding island development have generated a growing volume of research. What does it mean to develop? How can island communities maintain control over development processes to the benefit of the local economy, rather than seeing economic flows enter and exit the island with little or a primarily negative impact? And how important is local knowledge for edifying local governance and enhancing potentials for innovation in island development? Island histories have repeatedly been forwarded as exemplars and ‘lessons’ for global learning on (unsustainability. To consider these issues, we have selected a number of papers from among the presentations given at the International Geographical Union’s Commission on Islands Conference, Island Development: Local Economy, Culture, Innovation and Sustainability, which took place in the Penghu Archipelago, Taiwan, 1–5 October 2013. These papers serve as examples of how the processes of globalization have penetrated the borders and changed the political and economic structures of islands. They also explore how island-based innovations in science, technology, culture, and formal or informal governance might contribute to sustainable island development.
Suwiti, N K; Besung, I N K; Mahardika, G N
2017-10-01
Bali cattle ( Bos javanicus ) are an Indonesian's native cattle breed that distributed in Asia to Australia. The scientific literature on these cattle is scarce. The growth hormone (GH) of Bali cattle is investigated from three separated islands, namely, Bali, Nusa Penida, and Sumbawa. Forty plasma samples were collected from each island, and the GH was measured using a commercial enzyme-linked immunosorbent assay kit. The data were analyzed based on the origin, sex, and cattle raising practices. We found that the GH level (bovine GH [BGH]) of animal kept in stall 1.72±0.70 µg/ml was higher than free-grazing animal 1.27±0.81 µg/ml. The GH level was lower in female (1.22±0.62 µg/ml) compared to male animals (1.77±0.83 µg/ml). We conclude that the level of BGH in Bali cattle was low and statistically equal from all origins. The different level was related to sex and management practices. Further validation is needed through observing the growth rate following BGH administration and discovering the inbreeding coefficient of the animal in Indonesia.
Energy Transition Initiative, Island Energy Snapshot - British Virgin Islands (Fact Sheet)
Energy Technology Data Exchange (ETDEWEB)
2015-03-01
This profile provides a snapshot of the energy landscape of the British Virgin Islands (BVI), one of three sets of the Virgin Island territories in an archipelago making up the northern portion of the Lesser Antilles.
International Nuclear Information System (INIS)
Woods, R.; Garnett, J.; Loo Teck Ng
1999-01-01
Progress in LTV/EB curing is reviewed in Australia. Generally the technology is used by those industries where curing is well developed in Europe and North America, however the scale is an order of magnitude lower due to the smaller market size. The Asian economic crisis does not appear to have affected expansion of the technology in Australia. EB continues to be successfully used in the packaging and foam fields whilst in UV, security devices, particularly banknotes are steadily expanding especially in export markets have been studied
Demographic Ageing on Croatian Islands
Directory of Open Access Journals (Sweden)
Ivo Nejašmić
2013-08-01
Full Text Available This paper analyses the changes in the population structure of the Croatian islands by age, warns of the degree of ageing, provides spatial differentiation of this process and presents perspective of ageing at the level of settlement. Typing of population ageing is based on scores and has seven types. The total island population in 2011 belongs to the type 5 – very old population. Almost a half of the settlements (out of 303 have been affected by the highest levels of ageing (types 6 and 7. It was found that a quarter of island settlements will become “dead villages” in a foreseeable future; most of them are on small islands but also in the interior of larger islands. These are villages decaying in every respect, in which the way of life, as we know it, veins and goes out. The present ageing villagers are their last residents in most cases. Eve¬rything suggests that demographic recovery of the islands is not possible with the forces in situ. It is important to strike a balance between the needs and opportunities in order to successfully organize life on the islands, both small and large ones, and the fact is that there is a continuing disparity, which is especially profound in small islands. A sensitive and selective approach is needed to overcome the unfavourable demographic trends. Therefore it is necessary to respect the particularities of indi¬vidual islands and island groups in devising development strategy. Solutions to the problems must come of the local and wider community in synergy with relevant professional and scientific institutions. However, if the solutions are not found or measures do not give results, if the islands are left to desorganisation and senilisation, a part of the islands will become a wasteland. With regard to the value of this area whose wealth are people in the first place, this would be an intolerable civilization decline.
The Island Smart Energy System and Market
DEFF Research Database (Denmark)
Ma, Zheng; Billanes, Joy Dalmacio; Jørgensen, Bo Nørregaard
2017-01-01
developing island smart energy systems with the integration of renewable energy resources can increase the energy supply and address the global island energy issues. The island smart energy system operates either in a single-island or in multi-islands. However the island characteristics and influ...
Terrestrial bird population trends on Aguiguan (Goat Island), Mariana Islands
Amidon, Fred; Camp, Richard J.; Marshall, Ann P.; Pratt, Thane K.; Williams, Laura; Radley, Paul; Cruz, Justine B.
2014-01-01
The island of Aguiguan is part of the Mariana archipelago and currently supports populations of four endemic species, including one endemic genus, Cleptornis. Bird population trends since 1982 were recently assessed on the neighbouring islands of Saipan, Tinian, and Rota indicating declines in some native species. Point-transect surveys were conducted in 2008 by the U.S. Fish and Wildlife Service to assess population densities and trends on Aguiguan. Densities for six of the nine native birds—White-throated Ground-dove Gallicolumba xanthonura, Collared Kingfisher Todiramphus chloris, Rufous Fantail Rhipidura rufifrons, Golden White-eye Cleptornis marchei, Bridled White-eye Zosterops conspicillatus and Micronesian Starling Aplonis opaca—and the non-native bird—Island Collared-dove Streptopelia bitorquata—were significantly greater in 2008 than in 1982. No differences in densities were detected among the surveys for Mariana Fruit-dove Ptilinopus roseicapilla, and Micronesian MyzomelaMyzomela rubratra. Three federally and locally listed endangered birds—Nightingale Reed-warbler Acrocephalus luscinius, Mariana Swiftlet Collocalia bartschi, and Micronesian Megapode Megapodius laperous)—were either not detected during the point-transect counts, the surveys were not appropriate for the species, or the numbers of birds detected were too small to estimate densities. The factors behind the increasing trends for some species are unknown but may be related to increased forest cover on the island since 1982. With declining trends for some native species on neighbouring islands, the increasing and stable trends on Aguiguan is good news for forest bird populations in the region, as Aguiguan populations can help support conservation efforts on other islands in the archipelago.
Surface energy exchanges over contrasting vegetation types on a subtropical sand island
Gray, Michael; McGowan, Hamish; Lowry, Andrew; Guyot, Adrien
2017-04-01
The surface energy balance of subtropical coastal vegetation communities has thus far received little attention. Here we present a multi-year observational data set using the eddy covariance method to quantify for the first time the surface energy balance over three contrasting vegetation types on a subtropical sand island in eastern Australia: a periodically inundated sedge swamp, an exotic pine plantation and a coastal heath. Maximum daily sensible heat flux varied between sites but was typically > 280 Wm-2 in the coastal heath and pine plantation but no more than 250 Wm-2 in the swamp when dry and 1. The partitioning of energy, as represented by β, is similar to a variety of Australian ecosystems, and a range of coastal vegetation types in other latitudes, but differs from other tropical or subtropical locations which have strongly seasonal rainfall patterns and therefore a switch from β > 1 before rainfall to β changes in background meteorology with the most important influences being net radiation, absolute humidity, and rainfall. The main factor differentiating the sites was soil water content, with the remnant coastal heath and swamp having ready access to water but the exotic pine plantation having much drier soils. Should the current balance between remnant vegetation and the pine plantation undergo changes there would be a corresponding shift in the surface energy balance of the island as a whole, and altered plant water use may lead to reduced water table depth, important because the groundwater of the local islands is used as part of a regional water grid. A better understanding of the response of coastal vegetation to atmospheric forcing will enable more informed decision making on land use changes, as coastal regions the world over face development pressure.
Renewable energy development and prospects in Australia
International Nuclear Information System (INIS)
Ahmad Zahedi
2000-01-01
Development of renewable energies in Australia is still in its infancy and will require active support by government, utilities and financing institutions to ensure a steady growth. Much has been done to increase the utilisation of renewable energies in the energy supply, but much still remains to be done, especially in the areas of promotion, demonstration, training and technology transfer. This process will lead to meeting the energy needs of the population in rural areas and to contributing to a suitable development of the region during the next century. Australia is endowed with a wealth of renewable energy resources that hold great promise for addressing a host of important environmental, employment and socioeconomic issues. Australia has a set of climate, geographic and other factors that provide favourable conditions for many specific renewable energy applications. The objectives of this paper is to look at the current situation of renewable energies in Australia, opportunities, constraints, current projects, available potential and future prospects. (Author)
Mendoza Vizcaino, Javier; Sumper, Andreas; Sudrià Andreu, Antoni; Ramirez, J.M.
2016-01-01
The electric generation systems on islands are based generally on fossil fuel. This fact and its supply make the electricity cost higher than in systems used in the continent. In this article, we present a review of the renewable energy generation systems on islands. To do it we analysed 77 islands from 45 different countries. This work will allow us to know how the implementation of renewable energy sources could help these islands in developing a renewable and sustainable energy sector, inc...
Population trends and survival of nesting green sea turtles Chelonia mydas on Aves Island, Venezuela
Garcia-Cruz, Marco A.; Lampo, Margarita; Peñaloza, Claudia L.; Kendall, William L.; Solé, Genaro; Rodriguez-Clark, Kathryn M.
2015-01-01
Long-term demographic data are valuable for assessing the effect of anthropogenic impacts on endangered species and evaluating recovery programs. Using a 2-state open robust design model, we analyzed mark-recapture data from green turtles Chelonia mydas sighted between 1979 and 2009 on Aves Island, Venezuela, a rookery heavily impacted by human activities before it was declared a wildlife refuge in 1972. Based on the encounter histories of 7689 nesting females, we estimated the abundance, annual survival, and remigration intervals for this population. Female survival varied from 0.14-0.91, with a mean of 0.79, which is low compared to survival of other populations from the Caribbean (mean = 0.84) and Australia (mean = 0.95), even though we partially corrected for tag loss, which is known to negatively bias survival estimates. This supports prior suggestions that Caribbean populations in general, and the Aves Island population in particular, may be more strongly impacted than populations elsewhere. It is likely that nesters from this rookery are extracted while foraging in remote feeding grounds where hunting still occurs. Despite its relatively low survival, the nesting population at Aves Island increased during the past 30 years from approx. 500 to >1000 nesting females in 2009. Thus, this population, like others in the Caribbean and the Atlantic, seems to be slowly recovering following protective management. Although these findings support the importance of long-term conservation programs aimed at protecting nesting grounds, they also highlight the need to extend management actions to foraging grounds where human activities may still impact green turtle populations.
Integrating deep Earth dynamics in paleogeographic reconstructions of Australia
Heine, Christian; Müller, R. Dietmar; Steinberger, Bernhard; DiCaprio, Lydia
2010-03-01
It is well documented that the Cenozoic progressive flooding of Australia, contemporaneous with a eustatic sea level fall, requires a downward tilting of the Australian Plate towards the SE Asian subduction system. Previously, this large-scale, mantle-convection driven dynamic topography effect has been approximated by computing the time-dependent vertical shifts and tilts of a plane, but the observed subsidence and uplift anomalies indicate a more complex interplay between time-dependent mantle convection and plate motion. We combine plate kinematics with a global mantle backward-advection model based on shear-wave mantle tomography, paleogeographic data, eustatic sea level estimates and basin stratigraphy to reconstruct the Australian flooding history for the last 70 Myrs on a continental scale. We compute time-dependent dynamic surface topography and continental inundation of a digital elevation model adjusted for sediment accumulation. Our model reveals two evolving dynamic topography lows, over which the Australian plate has progressively moved. We interpret the southern low to be caused by sinking slab material with an origin along the eastern Gondwana subduction zone in the Cretaceous, whereas the northern low, which first straddles northern Australia in the Oligocene, is mainly attributable to material subducted north and northeast of Australia. Our model accounts for the Paleogene exposure of the Gulf of Carpentaria region at a time when sea level was much higher than today, and explains anomalous Late Tertiary subsidence on Australia's northern, western and southern margins. The resolution of our model, which excludes short-wavelength mantle density anomalies and is restricted to depths larger than 220 km, is not sufficient to model the two well recorded episodes of major transgressions in South Australia in the Eocene and Miocene. However, the overall, long-wavelength spatio-temporal pattern of Australia's inundation record is well captured by combining
CRED Gridded Bathymetry near Laysan Island (100-006), Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-006b is a 60-m ASCII grid of depth data collected near Laysan Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as...
CRED Gridded Bathymetry near Lisianski Island (100-001), Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-001b is a 60-m ASCII grid of depth data collected near Lisianski Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as...
75 FR 61993 - Amendment of Class E Airspace; Kwajalein Island, Marshall Islands, RMI
2010-10-07
...This action removes the reference to the Kwajalein Tactacial Air Navigation (TACAN) System from the legal description of the Class E airspace areas for Kwajalein Island, Bucholz AAF, Marshall Islands, RMI. The U.S. Army notified the FAA that the Kwajalein TACAN was decommissioned. This action corrects the legal descriptions for the Class E airspace areas in the vicinity of the Marshall Islands.
[Study of quality control on Cuscuta chinensis and C. australia].
Lin, Hui-bin; Lin, Jian-qun; Lu, Ning; Lin, Jian-qiang
2007-11-01
To study the estimate method of C. chinensis and C. australia. HPLC was used to determine the contents of four kinds of flavones of C. chinensis and C. australia growing on different hosts. C. chinensis and C. australia growing on different hosts both had hyperoside, quercetin, kaempferol and isorhamnetin. The content range of hyperoside was 2.790-6.502 mg/g and was higher than other flavones. The content ranges of quercetin, kaempferol and isorhamnetin were 0.025-0.176 mg/g, 0.001-0.213 mg/g and 0.001-0.077 mg/g, respectively. The contents of hyperoside and quercetin are higher in C. chineasis than in C. australia. The contents of kaempferol and isorhamnetin are lower in C. chinensis than in C. australia. The hosts influence flavones content of C. chinensis and C. australia.
Returning from the Horizon: Introducing Urban Island Studies
Directory of Open Access Journals (Sweden)
Xavier Barceló Pinya
2015-12-01
Full Text Available Island studies tends to focus on peripheral, isolated, and marginal aspects of island communities, while urban studies has showed scant awareness of islandness: Although many people research cities on islands, there is little tradition of researching island cities or urban archipelagos per se. Island cities (densely populated small islands and population centres of larger islands and archipelagos nevertheless play import cultural, economic, political, and environmental roles on local, regional, and global scales. Many major cities and ports have developed on small islands, and even villages can fulfil important urban functions on lightly populated islands. Island concepts are also deployed to metaphorically describe developments in urban space. The journal Urban Island Studies explores island and urban processes around the world, taking an island approach to urban research and an urban approach to island research.
Barrier island facies models and recognition criteria
Mulhern, J.; Johnson, C. L.
2017-12-01
Barrier island outcrops record transgressive shoreline motion at geologic timescales, providing integral clues to understanding how coastlines respond to rising sea levels. However, barrier island deposits are difficult to recognize. While significant progress has been made in understanding the modern coastal morphodynamics, this insight is not fully leveraged in existing barrier island facies models. Excellent outcrop exposures of the paralic Upper Cretaceous Straight Cliffs Formation of southern Utah provide an opportunity to revise facies models and recognition criteria for barrier island deposits. Preserved barrier islands are composed of three main architectural elements (shorefaces, tidal inlets, and tidal channels) which occur independently or in combination to create larger-scale barrier island deposits. Barrier island shorefaces record progradation, while barrier island tidal inlets record lateral migration, and barrier island tidal channels record aggradation within the tidal inlet. Four facies associations are used to describe and characterize these barrier island architectural elements. Barrier islands occur in association with backarrier fill and internally contain lower and upper shoreface, high-energy upper shoreface, and tidal channel facies. Barrier islands bound lagoons or estuaries, and are distinguished from other shoreface deposits by their internal facies and geometry, association with backbarrier facies, and position within transgressive successions. Tidal processes, in particular tidal inlet migration and reworking of the upper shoreface, also distinguish barrier island deposits. Existing barrier island models highlight the short term heterogeneous and dynamic nature of barrier island systems, yet overlook processes tied to geologic time scales, such as multi-directional motion, erosion, and reworking, and their expressions in preserved barrier island strata. This study uses characteristic outcrop expressions of barrier island successions to
Directory of Open Access Journals (Sweden)
Russell Richard C
2007-06-01
Full Text Available Abstract Background The mosquito Culex annulirostris Skuse (Diptera: Culicidae is the major vector of endemic arboviruses in Australia and is also responsible for the establishment of the Japanese encephalitis virus (JEV in southern Papua New Guinea (PNG as well as its incursions into northern Australia. Papua New Guinea and mainland Australia are separated by a small stretch of water, the Torres Strait, and its islands. While there has been regular JEV activity on these islands, JEV has not established on mainland Australia despite an abundance of Cx. annulirostris and porcine amplifying hosts. Despite the public health significance of this mosquito and the fact that its adults show overlapping morphology with close relative Cx. palpalis Taylor, its evolution and genetic structure remain undetermined. We address a hypothesis that there is significant genetic diversity in Cx. annulirostris and that the identification of this diversity will shed light on the paradox that JEV can cycle on an island 70 km from mainland Australia while not establishing in Australia itself. Results We sequenced 538 bp of the mitochondrial DNA cytochrome oxidase I gene from 273 individuals collected from 43 localities in Australia and the southwest Pacific region to describe the phylogeography of Cx. annulirostris and its sister species Cx. palpalis. Maximum Likelihood and Bayesian analyses reveal supporting evidence for multiple divergent lineages that display geographic restriction. Culex palpalis contained three divergent lineages geographically restricted to southern Australia, northern Australia and Papua New Guinea (PNG. Culex annulirostris contained five geographically restricted divergent lineages, with one lineage restricted to the Solomon Islands and two identified mainly within Australia while two other lineages showed distributions in PNG and the Torres Strait Islands with a southern limit at the top of Australia's Cape York Peninsula. Conclusion The
Gridded multibeam bathymetry of Howland Island, Pacific Remote Island Areas, Central Pacific
National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry at 40m resolution surrounding Howland Island, within the Pacific Remote Island Areas - Central Pacific Ocean. Bottom coverage was achieved in...
Rehabilitation of former nuclear test sites in Australia
International Nuclear Information System (INIS)
1990-01-01
A range of options with indicative cost estimates and timescale has been defined for clean-up of the former British nuclear test sites at Maralinga and Emu in South Australia. The situation at the former test sites on the Monte Bello Islands has been reported separately. The predominant contributor to potential radiation dose at the test sites is residual plutonium contamination of soil which may be incorporated into the body through inhalation of resuspended dust. Acceptable levels of radioactive soil contamination based upon organ doses from incorporated plutonium and the associated health detriment are proposed by the Technical Assessment Group for a series of land-use options ranging from fully unrestricted habitation by Aboriginals including the case of high dependence on local plants and animals for food: to casual access by Aboriginals assuming retained or, if necessary, extended fences. The area of land affected and the quantity of soil and other material with more than the proposed limit of contamination as well as a range of remedial measures for reduction of the contamination to a level acceptable for each of the land-use options has been assessed and methods proposed for safe disposal of the contaminated materials. The associated costs of these remedial measures and disposal methods have also been estimated. 28 refs., 71 tabs., 45 figs
The discovery and development of uranium in Australia
International Nuclear Information System (INIS)
Glasson, K.R.
1988-01-01
The history of the discovery of Australia's uranium deposits is reviewed. The exploration can be conveniently divided into three periods - pre-1944, when the only significant discoveries were made by prospectors in South Australia at Radium Hill and Mount Painter; 1944-1960 and post-1967. The second period saw uranium discoveries in the Northern Territory and Queensland, most of which were made by prospectors using hand-held geiger counters and rewarded by the Australian Government. Since 1967 new deposits have been found in the Northern Territory, Queensland, South Australia and Western Australia by companies using maps, airborne radiometric surveys and sophisticated equipment. The step from the discovery of Mary Kathleen by prospectors to finding Roxby Downs by a combination of geophysical methods, geological concepts and deep drilling was a very big one
Dioxins levels in Australia. Key findings of studies
Energy Technology Data Exchange (ETDEWEB)
Ivory, A.; Mobbs, C. [Australian Government Department of the Environment and Heritage (Australia)
2004-09-15
The Australian Government established the National Dioxins Program (NDP) in 2001 to improve knowledge about levels of dioxins in Australia. The program aims to determine levels, assess the risks to Australians and the environment, and to consider appropriate management actions. Starting in mid 2001and completed in 2004, the studies constituted the largest survey of dioxin levels ever undertaken in Australia. The findings will contribute to debate on how to deal with dioxins in Australia, as well as helping to meet obligations under the Stockholm Convention on Persistent Organic Pollutants, which Australia ratified on 20 May 2004. These studies will also contribute to a better understanding about dioxins in the southern hemisphere. This paper provides a summary of the key findings of these studies and the risk assessments.
Energy Technology Data Exchange (ETDEWEB)
Hoke, Anderson [National Renewable Energy Lab. (NREL), Golden, CO (United States); Nelson, Austin [National Renewable Energy Lab. (NREL), Golden, CO (United States); Miller, Brian [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chakraborty, Sudipta [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bell, Frances [SolarCity, San Mateo, CA (United States); McCarty, Michael [SolarCity, San Mateo, CA (United States)
2016-07-01
As PV and other DER systems are connected to the grid at increased penetration levels, island detection may become more challenging for two reasons: 1.) In islands containing many DERs, active inverter-based anti-islanding methods may have more difficulty detecting islands because each individual inverter's efforts to detect the island may be interfered with by the other inverters in the island. 2.) The increasing numbers of DERs are leading to new requirements that DERs ride through grid disturbances and even actively try to regulate grid voltage and frequency back towards nominal operating conditions. These new grid support requirements may directly or indirectly interfere with anti-islanding controls. This report describes a series of tests designed to examine the impacts of both grid support functions and multi-inverter islands on anti-islanding effectiveness. Crucially, the multi-inverter anti-islanding tests described in this report examine scenarios with multiple inverters connected to multiple different points on the grid. While this so-called 'solar subdivision' scenario has been examined to some extent through simulation, this is the first known work to test it using hardware inverters. This was accomplished through the use of power hardware-in-the-loop (PHIL) simulation, which allows the hardware inverters to be connected to a real-time transient simulation of an electric power system that can be easily reconfigured to test various distribution circuit scenarios. The anti-islanding test design was a modified version of the unintentional islanding test in IEEE Standard 1547.1, which creates a balanced, resonant island with the intent of creating a highly challenging condition for island detection. Three common, commercially available single-phase PV inverters from three different manufacturers were tested. The first part of this work examined each inverter individually using a series of pure hardware resistive-inductive-capacitive (RLC
Gridded multibeam bathymetry of Baker Island, Pacific Remote Island Areas, Central Pacific
National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry at 40m resolution surrounding Baker Island, within the Pacific Remote Island Areas - Central Pacific Ocean. Bottom coverage was achieved in depths...
Political and economic structure and energy industry status of Australia
Energy Technology Data Exchange (ETDEWEB)
Bang, K.Y. [Korea Energy Economics Institute, Euiwang (Korea, Republic of)
1998-06-01
Looking at the composition of energy resources import of Korea per each country, Australian-made import takes up 11.8% of total energy resources import. It possesses the highest import composition of 30.5% when petroleum sector is excluded. In the order of Korea`s mineral import per each country, Australia still keep the number one position every year though Korea keep promoting the diversification of import sources. In the mean time, reflecting on the treatment aspect of import country of Australia, when Korea`s energy, the import size of resources, import intensity of Australia`s primary raw material resources and international resources situation are considered, Korea is thought to receive less treatment from Australia as the second export country of Australia than Japan who is the number one export country of Australia, relatively. Though the increase ratio of Korean tourists in Australia is the highest for the past few years and international promotion effect shows big with the IMF financial support of Korea who faces sudden economic crisis recently as a momentum, sincere evaluation through in-depth analysis between Korea and Australia is still in the initial stage. The necessity to diagnosis the general political and economic structure of Australia more in detail emerges as trade volume between two countries keep growing, esp. in the import of energy and resources sectors, the number of visits between two countries keep increasing. Therefore, the purpose of this study lies mainly in the structure of the new Australian government, general macroeconomics structure and the understanding of energy industry-related status such as energy supply and demand, development status of energy, related laws, and government`s energy agencies, etc. 6 refs., 3 figs., 22 tabs.
Vegetation assessment of forests of Pagan Island, Commonwealth of the Northern Mariana Islands
Pratt, Linda W.
2011-01-01
As part of the Marianas Expedition Wildlife Surveys-2010, the forest vegetation of the island of Pagan, Commonwealth of the Northern Mariana Islands (CNMI), was sampled with a series of systematic plots along 13 transects established for monitoring forest bird populations. Shrubland and grassland were also sampled in the northern half of the island. Data collected were woody plant density, tree diameter at breast height, woody plant density in height classes below 2 m, and ground cover measured with the point-intercept method. Coconut forests (Cocos nucifera) were generally found to have low native tree diversity, little regeneration of trees and shrubs in the forest understory, and little live ground cover. The sole exception was a coconut-dominated forest of the northeast side of the island that exhibited high native tree diversity and a large number of young native trees in the understory. Ironwood (Casuarina equisetifolia) forests on the northern half of the island were nearly monocultures with almost no trees other than ironwood in vegetation plots, few woody plants in the understory, and low ground cover dominated by native ferns. Mixed native forests of both northern and southern sections of the island had a diversity of native tree species in both the canopy and the sparse understory. Ground cover of native forests in the north had a mix of native and alien species, but that of the southern half of the island was dominated by native ferns and woody plants.
Island biogeography of marine organisms
Pinheiro, Hudson T.; Bernardi, Giacomo; Simon, Thiony; Joyeux, Jean-Christophe; Macieira, Raphael M.; Gasparini, João Luiz; Rocha, Claudia; Rocha, Luiz A.
2017-09-01
Studies on the distribution and evolution of organisms on oceanic islands have advanced towards a dynamic perspective, where terrestrial endemicity results from island geographical aspects and geological history intertwined with sea-level fluctuations. Diversification on these islands may follow neutral models, decreasing over time as niches are filled, or disequilibrium states and progression rules, where richness and endemism rise with the age of the archipelago owing to the splitting of ancestral lineages (cladogenesis). However, marine organisms have received comparatively little scientific attention. Therefore, island and seamount evolutionary processes in the aquatic environment remain unclear. Here we analyse the evolutionary history of reef fishes that are endemic to a volcanic ridge of seamounts and islands to understand their relations to island evolution and sea-level fluctuations. We also test how this evolutionary history fits island biogeography theory. We found that most endemic species have evolved recently (Pleistocene epoch), during a period of recurrent sea-level changes and intermittent connectivity caused by repeated aerial exposure of seamounts, a finding that is consistent with an ephemeral ecological speciation process. Similar to findings for terrestrial biodiversity, our data suggest that the marine speciation rate on islands is negatively correlated with immigration rate. However, because marine species disperse better than terrestrial species, most niches are filled by immigration: speciation increases with the random accumulation of species with low dispersal ability, with few opportunities for in situ cladogenesis and adaptive radiation. Moreover, we confirm that sea-level fluctuations and seamount location play a critical role in marine evolution, mainly by intermittently providing stepping stones for island colonization.
Cescon, Anna Lisa; Cooper, J. Andrew G.; Jackson, Derek W. T.
2014-05-01
In a changing climate context coastal areas will be affected by more frequent extreme events. Understanding the relationship between extreme events and coastal geomorphic response is critical to future adaptation plans. Beach ridge landforms commonly identified as hurricane deposits along tropical coasts in Australia and in the Caribbean Sea. However their formative processes in such environments are still not well understood. In particular, the role of different extreme wave events (storm waves, tsunami waves and extreme swell), in generating beach ridges is critical to their use as palaeotempestology archives. Anegada Island is a carbonate platform situated in the British Virgin Island between the Atlantic Ocean and the Caribbean Sea. Pleistocene in age, Anegada is surrounded by the Horseshoe fringing coral reef. Two Holocene sandy beach ridge plains are present on the western part of the island. The north beach ridge plain is Atlantic facing and has at least 30 ridges; the south beach ridge plain is Caribbean Sea facing and contains 10 ridges. Historical aerial photos enabled the shoreline evolution from 1953 to 2012 to be studied. Three different coastal domains are associate with the beach ridge plains: strong east-west longshore transport affects the north coastline, the south-west coastline from West End to Pomato Point represents an export corridor for these sediments and finally, along the southern coastline, from Pomato Point to Settling Point the area presents a depositional zone with little to no change in the last 70 years. The link between the extreme wave events that have affected Anegada Island in the last 70 years and beach ridge creation is discussed. Hurricane Donna crossed over Anegada Island in 1960: its geomorphological signature is tracked in the shoreline change analysis and its implication in beach ridge formation is discussed. Anegada Island has also been impacted by tsunami waves (Atwater et al., 2012) and a comparative discussion of the
Interaction of bootstrap-current-driven magnetic islands
International Nuclear Information System (INIS)
Hegna, C.C.; Callen, J.D.
1991-10-01
The formation and interaction of fluctuating neoclassical pressure gradient driven magnetic islands is examined. The interaction of magnetic islands produces a stochastic region around the separatrices of the islands. This interaction causes the island pressure profile to be broadened, reducing the island bootstrap current and drive for the magnetic island. A model is presented that describes the magnetic topology as a bath of interacting magnetic islands with low to medium poloidal mode number (m congruent 3-30). The islands grow by the bootstrap current effect and damp due to the flattening of the pressure profile near the island separatrix caused by the interaction of the magnetic islands. The effect of this sporadic growth and decay of the islands (''magnetic bubbling'') is not normally addressed in theories of plasma transport due to magnetic fluctuations. The nature of the transport differs from statistical approaches to magnetic turbulence since the radial step size of the plasma transport is now given by the characteristic island width. This model suggests that tokamak experiments have relatively short-lived, coherent, long wavelength magnetic oscillations present in the steep pressure-gradient regions of the plasma. 42 refs
Energy Technology Data Exchange (ETDEWEB)
Bowman, D M.J.S.; Panton, W J [Parks and Wildlife Commission of the Northern Territory, Darwin, NT (Australia); Head, J [Australian National Univ, Canberra, ACT (Australia). Quaternary Dating Research Centre
1998-12-31
The late Holocene history of monsoon rainforest retreat was explored by radiocarbon dating abandoned Orange-footed Scrubfowl (Megapodius reinwardt Gaimard) nests in coastal savannas in the Northern Territory of Australia. Previous work has demonstrated that in savanna environments this rainforest bird can not build nor maintain the large heaps of soil and leaf litter that it uses for nests. Excavations of two earthen mounds in a savanna habitat verified that they were abandoned Scrubfowl nests, and not Aboriginal middens, given their lack of stratigraphy, non-sequential dating of charcoal in a vertical profile, and absence of archaeological material. Radiocarbon dates of material taken from the surface of abandoned nests were determined for three sites on the coast of the Northern Territory. These analyses revealed that for all three sites, rainforests have contracted within the last 1800 years BP. On Elcho Island an abandoned nest was found to contain the land snail Xanthomelon spheroidea Le Guillou (known to prefer rainforest habitat) with a modern radiocarbon age, suggesting recent contraction of rainforest. The results of this study further weaken the theory that Aboriginal burning was a major cause of rain forest fragmentation in the monsoon tropics, and possibly elsewhere in Australia.
Energy Technology Data Exchange (ETDEWEB)
Bowman, D.M.J.S.; Panton, W.J. [Parks and Wildlife Commission of the Northern Territory, Darwin, NT (Australia); Head, J. [Australian National Univ, Canberra, ACT (Australia). Quaternary Dating Research Centre
1997-12-31
The late Holocene history of monsoon rainforest retreat was explored by radiocarbon dating abandoned Orange-footed Scrubfowl (Megapodius reinwardt Gaimard) nests in coastal savannas in the Northern Territory of Australia. Previous work has demonstrated that in savanna environments this rainforest bird can not build nor maintain the large heaps of soil and leaf litter that it uses for nests. Excavations of two earthen mounds in a savanna habitat verified that they were abandoned Scrubfowl nests, and not Aboriginal middens, given their lack of stratigraphy, non-sequential dating of charcoal in a vertical profile, and absence of archaeological material. Radiocarbon dates of material taken from the surface of abandoned nests were determined for three sites on the coast of the Northern Territory. These analyses revealed that for all three sites, rainforests have contracted within the last 1800 years BP. On Elcho Island an abandoned nest was found to contain the land snail Xanthomelon spheroidea Le Guillou (known to prefer rainforest habitat) with a modern radiocarbon age, suggesting recent contraction of rainforest. The results of this study further weaken the theory that Aboriginal burning was a major cause of rain forest fragmentation in the monsoon tropics, and possibly elsewhere in Australia.
Some data on the avifauna of the Island of Roti, Lesser Sunda Islands, Indonesia
Verheijen, J.A.J.
1976-01-01
INTRODUCTION For several years I had been looking for an opportunity to visit the island of Roti (Rotti, Roté, Loté). Junge (1954) mentions that only once an ornithological collection was made in the island, namely by Dr. H. F. C. ten Kate, an ethnologist who visited the island in 1891. Büttikofer
Synchrotron radiation in Australia
International Nuclear Information System (INIS)
Garrett, R.F.
2002-01-01
Full text: Synchrotron radiation research in Australia is entering a new era with the commencement of the Australian synchrotron project, which will construct a 3 GeV third generation synchrotron facility at Monash University in Victoria. To date Australian scientists have used overseas facilities, primarily those managed by the Australian Synchrotron Research Program in Japan and the USA. A fast developing and maturing Australian synchrotron user program has developed around these overseas facilities. The field of synchrotron radiation and its importance to a wide range of research will be introduced and Australia's current involvement and facilities will be described. The current status and technical specifications of the Australian synchrotron will be presented. Copyright (2002) Australian X-ray Analytical Association Inc
Braithwaite, J; Hindle, D; Phelan, P D; Hanson, R
1998-06-01
Casemix funding for hospitals with the use of diagnosis-related groups (DRGs), which organise patients' conditions into similar clinical categories with similar costs, was introduced in Australia five years ago. It has been applied in different ways and to a greater or lesser extent in different Australian States. Only Victoria and South Australia have implemented casemix funding across all healthcare services. Attempts have been made to formally evaluate its impact, but they have not met the required scientific standards in controlling for confounding factors. Casemix funding remains a much-discussed issue. In this Debate, Braithwaite and Hindle take a contrary position, largely to stimulate policy debate; Phelan defends the casemix concept and advocates retaining its best features; and Hanson adds a plea for consumer input.
Islanded operation of distribution networks
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
This report summarises the results of a study assessing the benefits and risks to distribution network of generator islanding and examining the technical, commercial and regulatory changes required to facilitate the operation of islanding. The background to the study is traced, and details are given of a literature review, the technical criteria for operating sections of the network in islanding mode, and the impact of islanding on trading. Case studies and a detailed implementation plan, data acquisition, and commercial incentives are discussed.
Islanded operation of distribution networks
International Nuclear Information System (INIS)
2005-01-01
This report summarises the results of a study assessing the benefits and risks to distribution network of generator islanding and examining the technical, commercial and regulatory changes required to facilitate the operation of islanding. The background to the study is traced, and details are given of a literature review, the technical criteria for operating sections of the network in islanding mode, and the impact of islanding on trading. Case studies and a detailed implementation plan, data acquisition, and commercial incentives are discussed
HYDROGEOLOGICAL RELATIONS ON KARSTIFIED ISLANDS - VIS ISLAND CASE STUDY
Directory of Open Access Journals (Sweden)
Josip Terzić
2004-12-01
Full Text Available An approach to the hydrogeological investigations on Adriatic islands is presented on the Island of Vis case study. Infiltration, accumulation and discharge of the groundwater occur in karstified rock mass. Hydrogeological relations are mostly a consequence of the geological setting, because of the complete hydrogeologic barrier in Komiža bay, and relative barrier in the area of karst poljes. Significant research was performed in the 1999 – 2000 period aimed of better understanding of hydrogeological relations. These investigations, as well as reinterpretation of some previously known data, included structural geology, hydrogeology, hydrology and hydrochemistry. Approximate rock mass hydraulic conductivity calculation is also shown, as well as level of its usability in such terrain. Based on all these methods, it is possible to conclude that on the Island of Vis there is no saline water present underneath the entire island. There is only a saline water wedge which is formed on the top of relatively impermeable base rock, some few tens of meters under recent sea level. With such a model, and taking in account the hydrological balance, it is possible to conclude that there is possibility of higher amount of groundwater exploitation then it is today (the paper is published in Croatian.
Modelling the Balassa-Samuelson Effect in Australia
Directory of Open Access Journals (Sweden)
Khorshed Chowdhury
2011-03-01
Full Text Available This paper examines the Balassa-Samuelson hypothesis in Australia using the ARDL cointegrationframework. Evidence was found of a significant long-run relationship between real exchange rate andAustralia-US productivity differential during the period of 1950-2003. The results indicate that a one per centincrease in labour productivity in Australia relative to the US will lead to 5.6 per cent appreciation in the realexchange rate of Australia. The estimated coefficient for the error correction term is -0.1983 and is highlysignificant, indicating that the deviation from the long term real exchange rate equilibrium path is correctedby nearly 20 per cent over the following year. The Author suspects that the elasticity coefficient is “overestimated”due to the exclusion of relevant explanatory variables in the analytical model. The real exchangerate movements are affected by real fundamentals and policy-induced shifts in its real fundamentals. Thefundamentals include the terms of trade, government expenditure, real interest rate differentials, net foreignliabilities among others along with labour productivity differential.
Energy Technology Data Exchange (ETDEWEB)
Polido, Alexandra, E-mail: a.polido@campus.fct.unl.pt [CENSE, Center for Environmental and Sustainability Research, Departamento de Ciências e Engenharia do Ambiente, Faculdade de Ciências e Tecnologia, Universidade NOVA de Lisboa, Campus da Caparica, 2829-516 Caparica (Portugal); João, Elsa, E-mail: elsa.joao@strath.ac.uk [Department of Civil and Environmental Engineering, University of Strathclyde, Level 5, James Weir Building, 75 Montrose Street, Glasgow G1 1XJ, Scotland (United Kingdom); Ramos, Tomás B., E-mail: tabr@fct.unl.pt [CENSE, Center for Environmental and Sustainability Research, Departamento de Ciências e Engenharia do Ambiente, Faculdade de Ciências e Tecnologia, Universidade NOVA de Lisboa, Campus da Caparica, 2829-516 Caparica (Portugal)
2016-02-15
The literature concerning Strategic Environmental Assessment (SEA) often refers to the importance of context-specific approaches. However, there is a lack of systematised and consistent studies that enhance tailor-made SEA practices and procedures. Small islands are bounded units of study which may help explore SEA theory and practice in special territories. Small islands present particular features and unique values, such as, small size and population, geographic isolation, limited resources and vulnerable ecosystems. Hence, the main goal of this research was to profile SEA practices and procedures in European small islands and provide a background for future research aiming to improve context-specific SEA applications. To achieve this goal, an exploratory case study was developed using Azores (Portugal) and Orkney (Scotland) archipelagos. An analysis of the corresponding mainland was also carried out to contextualise both case studies. The data collection was achieved through a qualitative content analysis of 43 Environmental Reports. The research found that there is not an SEA context-specific approach used within these European small islands, including guidelines, assessment topics, assessment techniques, follow-up and stakeholders engagement. The debate concerning specific approaches to small islands must be re-focused on the enhancement of SEA capacity-building amongst different stakeholders (including decision-makers), on the development and implementation of collaborative approaches, and on the exchange of knowledge and experiences between small islands networks. - Highlights: • Reviewed the differences between the Portuguese and Scottish SEA system • Showed a low integration of SEA specific features in reports of European small islands • Provides background for future SEA research for small islands approaches.
International Nuclear Information System (INIS)
Polido, Alexandra; João, Elsa; Ramos, Tomás B.
2016-01-01
The literature concerning Strategic Environmental Assessment (SEA) often refers to the importance of context-specific approaches. However, there is a lack of systematised and consistent studies that enhance tailor-made SEA practices and procedures. Small islands are bounded units of study which may help explore SEA theory and practice in special territories. Small islands present particular features and unique values, such as, small size and population, geographic isolation, limited resources and vulnerable ecosystems. Hence, the main goal of this research was to profile SEA practices and procedures in European small islands and provide a background for future research aiming to improve context-specific SEA applications. To achieve this goal, an exploratory case study was developed using Azores (Portugal) and Orkney (Scotland) archipelagos. An analysis of the corresponding mainland was also carried out to contextualise both case studies. The data collection was achieved through a qualitative content analysis of 43 Environmental Reports. The research found that there is not an SEA context-specific approach used within these European small islands, including guidelines, assessment topics, assessment techniques, follow-up and stakeholders engagement. The debate concerning specific approaches to small islands must be re-focused on the enhancement of SEA capacity-building amongst different stakeholders (including decision-makers), on the development and implementation of collaborative approaches, and on the exchange of knowledge and experiences between small islands networks. - Highlights: • Reviewed the differences between the Portuguese and Scottish SEA system • Showed a low integration of SEA specific features in reports of European small islands • Provides background for future SEA research for small islands approaches
Australia's mandatory renewable energy target (MRET): an assessment
International Nuclear Information System (INIS)
Kent, Anthony; Mercer, David
2006-01-01
In June 2004, the Prime Minister of Australia, John Howard, released the long-awaited government blueprint for the favoured policy direction for the country's energy sector, Securing Australia's Energy Future. In part this document was a response to a review of the operation of Australia's mandatory renewable energy target (MRET), a regime that started in April 2001. MRET was put under detailed scrutiny from March 2003 onwards by a four-person panel (the Tambling Committee), appointed by the Howard coalition (conservative) government, that received 248 detailed submissions and finally released its findings to the public in January 2004. This paper presents an overview of (i) the range of opinions on MRET presented to the Tambling Inquiry; (ii) the recommendations of that Committee; (iii) the final judgement on MRET enunciated in Securing Australia's Energy Future; and (iv) the response of the States
Australia's uranium policy: an examination
International Nuclear Information System (INIS)
Crook, K.A.W.; Derborough, M.A.; Diesendorf, M.; Inall, E.K.; Peaslee, D.C.; Taylor, S.R.
1974-12-01
The mining and export of Australian Uranium poses problems for the safety of the world that any responsible government is bound to consider. The following note lists the major problems, attempts to assess their importance, and to suggest what lines may be relevant to Australia for their solution. These problems were examined because of the concern about the appropriateness of attempting to fulfill projected world energy needs by any means; and their fulfillment, by using nuclear fuels carries special problems of biological, social and political hazards. Any development of Australia's uranium resources should be considered in this light. (author)
Late Quaternary climate change shapes island biodiversity.
Weigelt, Patrick; Steinbauer, Manuel Jonas; Cabral, Juliano Sarmento; Kreft, Holger
2016-04-07
Island biogeographical models consider islands either as geologically static with biodiversity resulting from ecologically neutral immigration-extinction dynamics, or as geologically dynamic with biodiversity resulting from immigration-speciation-extinction dynamics influenced by changes in island characteristics over millions of years. Present climate and spatial arrangement of islands, however, are rather exceptional compared to most of the Late Quaternary, which is characterized by recurrent cooler and drier glacial periods. These climatic oscillations over short geological timescales strongly affected sea levels and caused massive changes in island area, isolation and connectivity, orders of magnitude faster than the geological processes of island formation, subsidence and erosion considered in island theory. Consequences of these oscillations for present biodiversity remain unassessed. Here we analyse the effects of present and Last Glacial Maximum (LGM) island area, isolation, elevation and climate on key components of angiosperm diversity on islands worldwide. We find that post-LGM changes in island characteristics, especially in area, have left a strong imprint on present diversity of endemic species. Specifically, the number and proportion of endemic species today is significantly higher on islands that were larger during the LGM. Native species richness, in turn, is mostly determined by present island characteristics. We conclude that an appreciation of Late Quaternary environmental change is essential to understand patterns of island endemism and its underlying evolutionary dynamics.
Radioimmunoassay for the detection of Australia-SH antigen
Energy Technology Data Exchange (ETDEWEB)
Gerhardt, H [Giessen Univ. (Germany, F.R.). Zentrum fuer Innere Medizin
1974-06-01
Among infectious diseases, hepatitis presents a great problem in all countries with a high medical standard. The number of Australia antigen-positive cases rises from year to year, due to the increase in drug-fixer hepatitis and blood transfusions. Highly sensitive and at the same time practicable methods are therefore required for the identification of Australia antigen carriers and their elimination as blood donors. The most sensitive of all currently used tests for the detection of Australia antigen is the 'solid phase' radioimmunoassay since it permits an objective and quantitative measurement of the antigen.
McAllen, I.; Borgo, E.; Violani, C.
2005-01-01
An attempt is made to reconstruct the trail of a collection of birds from the Solomon Islands to museums in Genoa (Museo Civico di Storia Naturale “G. Doria”, Genova), Turin (Museo Regionale di Scienze Naturali, Torino) and Milan (Museo Civico di Storia Naturale, Milano), Italy, with the aid of
Virtually Impossible: Deleuze and Derrida on the Political Problem of Islands (and Island Studies
Directory of Open Access Journals (Sweden)
Stewart Williams
2012-11-01
Full Text Available It is commonplace to think of an island as a discreetly bounded unit. Selected writings on islands by the poststructuralist philosophers Gilles Deleuze and Jacques Derrida reveal the island variously to be both real and imaginary, mythological and scientific, but as most problematic when constituted in political terms as an indivisible, sovereign entity. These two thinkers’ more broadly developed concepts of the virtual and the impossible, respectively, are seen to disrupt any assumptions about the fixity and closure of the island polity. Instead they emphasize its actualization through processual relations that can be difficult yet dynamic and decisive in effecting the move from being to becoming-other. As the possibilities for instituting more ethical as well as different political relations open up, the question of island studies remaining in its currently coherent, familiar form is raised for consideration.
How should Australia regulate voluntary euthanasia and assisted suicide?
White, Ben; Willmott, Lindy
2012-12-01
This article invites consideration of how Australia should regulate voluntary euthanasia and assisted suicide. It attempts to pose this question as neutrally as possible, acknowledging that both prohibition and legalisation of such conduct involve decisions about regulation. It begins by charting the wider field of law at the end of life, before considering the repeated, but ultimately unsuccessful, attempts at law reform in Australia. The situation in Australia is contrasted with permissive jurisdictions overseas where voluntary euthanasia and/or assisted suicide are lawful. The authors consider the arguments for and against legalisation of such conduct along with the available empirical evidence as to what happens in practice both in Australia and overseas. The article concludes by outlining a framework for deliberating on how Australia should regulate voluntary euthanasia and assisted suicide. It asks a threshold question of whether such conduct should be criminal acts (as they presently are), the answer to which then leads to a range of possible regulatory options.
Bamboo Diversity in Sumba Island
Directory of Open Access Journals (Sweden)
KARSONO
2005-04-01
Full Text Available Bamboo is one of the economic plant which grow widely in the villages and have been used by the local people in the villages. Indonesia has about 10% of the world bamboo, 50% among them was endemic to Indonesia. According Widjaja (2001 Lesser Sunda Island which consists of Lombok, Sumbawa, Flores, Timor, Sumba and other small island eastern of Flores has 14 bamboo species, however, the information from the Sumba Island was lacking because of lacking data from this area except one species which was proposed by S. Soenarko in 1977 where the type specimens was collected by Iboet 443 in 1925. To fullfill data from the Sumba Island, an exploration to this area has been conducted on July 2003. The observation was done in West Sumba and East Sumba District, especially in two natioal parks at both districts. According to this inventory study in the Sumba Island, there were 10 bamboo species in Sumba Island, 1 species among them (Dinochloa sp. was a new species which has not been collected before, whereas the other species (Dinochloa kostermansiana has a new addition record from this area. The bamboo species in Sumba Island were Bambusa blumeana, Bambusa vulgaris, Dendocalamus asper, Dinochloa kostermansiana, Dinochloa sp., Gigantochloa atter, Nastus reholtumianus, Phyllostachys aurea, Schisotachyum brachycladum and Schizostachyum lima. From 10 recorded species, the genera Dinochloa and Nastus grow wild in the forest, whereas another species grow widly or cultivated in the garden. Furthermore, the genus Dinochloa was the only genus grow climbing. The endemic species found in Sumba Island was Nastus reholttumianus, whereas Dinochloa kostermansiana was also found in Flores Island.
Ambae Island, Vanuatu (South Pacific)
2005-01-01
The recently active volcano Mt. Manaro is the dominant feature in this shaded relief image of Ambae Island, part of the Vanuatu archipelago located 1400 miles northeast of Sydney, Australia. About 5000 inhabitants, half the island's population, were evacuated in early December from the path of a possible lahar, or mud flow, when the volcano started spewing clouds of steam and toxic gases 10,000 feet into the atmosphere. Last active in 1996, the 1496 meter (4908 ft.) high Hawaiian-style basaltic shield volcano features two lakes within its summit caldera, or crater. The ash and gas plume is actually emerging from a vent at the center of Lake Voui (at left), which was formed approximately 425 years ago after an explosive eruption. Two visualization methods were combined to produce the image: shading and color coding of topographic height. The shade image was derived by computing topographic slope in the northwest-southeast direction, so that northwest slopes appear bright and southeast slopes appear dark. Color coding is directly related to topographic height, with green at the lower elevations, rising through yellow and tan, to white at the highest elevations. Elevation data used in this image were acquired by the Shuttle Radar Topography Mission aboard the Space Shuttle Endeavour, launched on Feb. 11, 2000. SRTM used the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) that flew twice on the Space Shuttle Endeavour in 1994. SRTM was designed to collect 3-D measurements of the Earth's surface. To collect the 3-D data, engineers added a 60-meter (approximately 200-foot) mast, installed additional C-band and X-band antennas, and improved tracking and navigation devices. The mission is a cooperative project between NASA, the National Geospatial-Intelligence Agency (NGA) of the U.S. Department of Defense and the German and Italian space agencies. It is managed by NASA's Jet Propulsion Laboratory, Pasadena
Implications of climate change for tourism in Australia
Amelung, B.; Nicholls, S.
2014-01-01
This study assesses the impacts of projected climate change on Australia's tourism industry. Based on application of the Tourism Climatic Index, it investigates potential changes in climatic attractiveness for Australia's major destinations, and discusses implications for tourist flows and tourism
Optometry Australia Entry-level Competency Standards for Optometry 2014.
Kiely, Patricia M; Slater, Jared
2015-01-01
Competency standards for entry-level to the profession of optometry in Australia were first developed in 1993, revised in 1997 and 2000, and again in 2008, when therapeutic competency standards were introduced but differentiated from the entry-level competencies. Therapeutic competencies were an additional requirement for the purpose of endorsing optometric registration to allow prescription of medicines for conditions of the eye. Recent changes to educational and registration requirements mean that therapeutic competencies are now required at entry-level. To address this and to ensure the standards reflect current best practice, a full revision of the standards was undertaken. A steering committee oversaw the review of the standards, which involved a literature review, workshops with optometrists and broad consultation with stakeholders, including the Optometry Board of Australia, individual optometrists and employers of optometrists, to identify changes needed. Representatives of the profession from Australia and New Zealand and from academia in Australia were involved. A modified document based on the feedback received was circulated to the State Divisions and the National Board of the then Optometrists Association Australia. The updated standards reflect the state of entry to the optometric profession in 2014; competencies for prescribing of scheduled medicines are included, new material has been added, other areas have been modified. The updated entry-level competency standards were adopted on behalf of the profession by the National Board of the then Optometrists Association Australia in March 2014. Competency standards have been updated so that they continue to be current and useful for the profession, individual optometrists and Australian and New Zealand registration authorities for the purposes of accreditation of optometric programs and assessment of overseas-trained optometrists. This paper details the revision process and presents the 2014 version of
Live Coral Cover Index Testing and Application with Hyperspectral Airborne Image Data
Directory of Open Access Journals (Sweden)
Karen E. Joyce
2013-11-01
Full Text Available Coral reefs are complex, heterogeneous environments where it is common for the features of interest to be smaller than the spatial dimensions of imaging sensors. While the coverage of live coral at any point in time is a critical environmental management issue, image pixels may represent mixed proportions of coverage. In order to address this, we describe the development, application, and testing of a spectral index for mapping live coral cover using CASI-2 airborne hyperspectral high spatial resolution imagery of Heron Reef, Australia. Field surveys were conducted in areas of varying depth to quantify live coral cover. Image statistics were extracted from co-registered imagery in the form of reflectance, derivatives, and band ratios. Each of the spectral transforms was assessed for their correlation with live coral cover, determining that the second derivative around 564 nm was the most sensitive to live coral cover variations(r2 = 0.63. Extensive field survey was used to transform relative to absolute coral cover, which was then applied to produce a live coral cover map of Heron Reef. We present the live coral cover index as a simple and viable means to estimate the amount of live coral over potentially thousands of km2 and in clear-water reefs.
Dermatology training and practice in Australia.
Sebaratnam, Deshan F; Murrell, Dédée F
2014-10-01
Dermatology is a relatively young discipline in Australia compared to other specialities within the medical fraternity. From its humble beginnings, the profession has evolved significantly over the decades and is now represented by the Australasian College of Dermatologists which is charged with training the next generation of dermatologists and advocating for and advancing the profession. The authors reviewed and describe the history of dermatology training and practice in Australia. Despite the progress in education, there are only 415 dermatologists serving a population of 23.3 million (1 per 58 000) and yet it has the highest incidence and prevalence of skin cancer in the world. The scope of clinical practice is wide in Australia, with clinicians well versed in medical and procedural dermatology. It is hoped that Australian dermatology will continue to bolster the dermatology profession globally. © 2014 The International Society of Dermatology.
Sex Education in South Australia: The Past and the Present
Talukdar, Joy; Aspland, Tania; Datta, Poulomee
2013-01-01
In South Australia, sex education has been controversial since its inception. The Australasian White Cross league and the Family Planning Association of South Australia were the pioneers of sex education in South Australia. The framing of a national framework and the implementation of the SHARE (Sexual Health and Relationships Education) project…
Big News: The Indian Media and Student Attacks in Australia
Directory of Open Access Journals (Sweden)
Matt Wade
2016-05-01
Full Text Available By any measure, 2009 was a big year for news in India. And yet the safety of Indian students in Australia ranked among the major news events in India that year. The India-Australia Poll 2013 found 65 per cent of respondents believed the Indian media had accurately reported the problems faced by Indian students in Australia in 2009-10. That implies two-thirds of Indians accepted the Indian media’s mostly negative depictions of Australia. Those who believed the media reporting about Australia had been accurate were more likely to be from large cities, be tertiary educated and have relatively high-incomes. The poll found 62 per cent of respondents thought Australia was a dangerous place for Indian students and that 61 per cent believed attacks on Indian students were motivated by racism. The results suggest negative perceptions about Australia created by the media’s portrayal of the student attacks linger in the Indian community. The timing of the initial attacks, and the imagery associated with them, helped attract and sustain media attention on the issue. The diplomatic tensions created by the crisis highlighted the growing influence of the broadcast media on India’s foreign relations. But the episode also exposed a deep lack of understanding about India in Australia. Governments were slow to comprehend how much damage media coverage of student attacks could do to Australia’s reputation in India.
Biological invasions on oceanic islands: Implications for island ecosystems and avifauna
Dean E. Pearson
2009-01-01
Biological invasions present a global threat to biodiversity, but oceanic islands are the systems hardest hit by invasions. Islands are generally depauperate in species richness, trophic complexity, and functional diversity relative to comparable mainland ecosystems. This situation results in low biotic resistance to invasion and many empty niches for invaders to...
Oak restoration trials: Santa Catalina Island
Lisa Stratton
2002-01-01
Two restoration trials involving four oak species have been implemented as part of a larger restoration program for Catalina Island. In 1997 the Catalina Island Conservancy began an active program of restoration after 50 years of ranching and farming activities on the island. The restoration program includes removing feral goats and pigs island-wide and converting 80...
The Honeymoon project: Australia`s first in situ leach uranium project
Energy Technology Data Exchange (ETDEWEB)
Ackland, M.C. [Southern Cross Resources Inc. Toowond, QLD (Australia)
1997-12-31
The Honeymoon uranium deposit is one of several roll front uranium deposits in South Australia. It was discovered in 1971, the project developed in the 1970`s, and was ready for demonstration of the In Situ Leaching (ISL) production techniques by January 1983, when the project was stopped, despite it having met the environmental approvals to proceed, due to the Australian Labour Party`s `three mines policy`. From 1983 until March 1996 the project was mothballed. In late 1996 Southern Cross Resources Inc. (SCRI) reached agreement with Mount Isa Mining (MIM) to purchase its uranium interests in Honeymoon, Goulds Dam and EL 2310 whilst simultaneously acquiring Sedimentary Holdings NL`s interests in EL 2310. By April 1997 these interests were consolidated in SCRI`s wholly owned subsidiary, Southern Cross Resources Australia Ply Ltd which is the operating company. Activities are presently underway to rehabilitate the existing treatment plant and continue the program that was outlined in the approved 1981 Honeymoon Environmental Impact Statement. 2 tabs., 3 figs.
Australia's uranium resources and production in the world context
International Nuclear Information System (INIS)
McKay, A.; Lambert, I.; Miezitis, Y.
2001-01-01
Australia has 654 000 tonnes uranium (U) in Reasonably Assured Resources (RAR) recoverable at ≤US$40/kg U, which is the largest of all national resource estimates reported in this category. Australia also has the world's largest resources in RAR recoverable at ≤US$80/kg U, with 29% of world resources in this category. Other countries that have large resources in this category include Kazakhstan (19%), Canada (14%), South Africa (10%), Brazil (7%), Namibia (6%), Russian Federation (6%), and United States (5%). In 2000, the main developments in Australia's uranium mining industry were that production reached a record level of 8937 t U 3 O 8 (7579 t U), and commercial operations commenced at the new in situ leach operation at Beverley during November. Australia's total production for 2000 was 27% higher than for 1999. Uranium oxide was produced at the Olympic Dam (4500 t U 3 O 8 ), Ranger (4437 t U 3 O 8 ) and Beverley operations, although production from Beverley for the year was not reported. Australia's share of the world's annual uranium production has increased steadily from about 10.8% (3,712 tonnes U) in 1995 to 21.9% in 2000. Throughout this period Australia has maintained its position as the world's second-largest producer of uranium, behind Canada
Sargis, Eric J.; Woodman, Neal; Morningstar, Natalie C.; Reese, Aspen T.; Olson, Link E.
2014-01-01
The Mentawai and Batu Island groups off the west coast of Sumatra have a complicated geological and biogeographical history. The Batu Islands have shared a connection with the Sumatran ‘mainland’ during periods of lowered sea level, whereas the Mentawai Islands, despite being a similar distance from Sumatra, have remained isolated from Sumatra, and probably from the Batu Islands as well. These contrasting historical relationships to Sumatra have influenced the compositions of the respective mammalian faunas of these island groups. Treeshrews (Scandentia, Tupaiidae) from these islands have, at various times in their history, been recognized as geographically circumscribed populations of a broadly distributed Tupaia glis, subspecies, or distinct species. We used multivariate analyses of measurements from the skull and hands to compare the island populations from Siberut (Mentawai Islands) and Tanahbala (Batu Islands) with the geographically adjacent species from the southern Mentawai Islands (T. chrysogaster) and Sumatra (T. ferruginea). Results from both the skull and manus of the Siberut population show that it is most similar to T. chrysogaster, whereas the Tanahbala population is more similar to T. ferruginea, confirming predictions based on island history. These results are further corroborated by mammae counts. Based on these lines of evidence, we include the Siberut population in T. chrysogaster and the Tanahbala population in T. ferruginea. Our conclusions expand the known distributions of both the Mentawai and Sumatran species. The larger geographical range of the endangered T. chrysogaster has conservation implications for this Mentawai endemic, so populations and habitat should be re-evaluated on each of the islands it inhabits. However, until such a re-evaluation is conducted, we recommend that the IUCN Red List status of this species be changed from ‘Endangered’ to ‘Data Deficient’.
Howard, Marion G; McDonald, William J F; Forster, Paul I; Kress, W John; Erickson, David; Faith, Daniel P; Shapcott, Alison
2016-01-01
Australia's Great Sandy Region is of international significance containing two World Heritage areas and patches of rainforest growing on white sand. Previous broad-scale analysis found the Great Sandy biogeographic subregion contained a significantly more phylogenetically even subset of species than expected by chance contrasting with rainforest on white sand in Peru. This study aimed to test the patterns of rainforest diversity and relatedness at a finer scale and to investigate why we may find different patterns of phylogenetic evenness compared with rainforests on white sands in other parts of the world. This study focussed on rainforest sites within the Great Sandy and surrounding areas in South East Queensland (SEQ), Australia. We undertook field collections, expanded our three-marker DNA barcode library of SEQ rainforest plants and updated the phylogeny to 95% of the SEQ rainforest flora. We sampled species composition of rainforest in fixed area plots from 100 sites. We calculated phylogenetic diversity (PD) measures as well as species richness (SR) for each rainforest community. These combined with site variables such as geology, were used to evaluate patterns and relatedness. We found that many rainforest communities in the Great Sandy area were significantly phylogenetically even at the individual site level consistent with a broader subregion analysis. Sites from adjacent areas were either not significant or were significantly phylogenetically clustered. Some results in the neighbouring areas were consistent with historic range expansions. In contrast with expectations, sites located on the oldest substrates had significantly lower phylogenetic diversity (PD). Fraser Island was once connected to mainland Australia, our results are consistent with a region geologically old enough to have continuously supported rainforest in refugia. The interface of tropical and temperate floras in part also explains the significant phylogenetic evenness and higher than
Directory of Open Access Journals (Sweden)
Marion G Howard
Full Text Available Australia's Great Sandy Region is of international significance containing two World Heritage areas and patches of rainforest growing on white sand. Previous broad-scale analysis found the Great Sandy biogeographic subregion contained a significantly more phylogenetically even subset of species than expected by chance contrasting with rainforest on white sand in Peru. This study aimed to test the patterns of rainforest diversity and relatedness at a finer scale and to investigate why we may find different patterns of phylogenetic evenness compared with rainforests on white sands in other parts of the world. This study focussed on rainforest sites within the Great Sandy and surrounding areas in South East Queensland (SEQ, Australia. We undertook field collections, expanded our three-marker DNA barcode library of SEQ rainforest plants and updated the phylogeny to 95% of the SEQ rainforest flora. We sampled species composition of rainforest in fixed area plots from 100 sites. We calculated phylogenetic diversity (PD measures as well as species richness (SR for each rainforest community. These combined with site variables such as geology, were used to evaluate patterns and relatedness. We found that many rainforest communities in the Great Sandy area were significantly phylogenetically even at the individual site level consistent with a broader subregion analysis. Sites from adjacent areas were either not significant or were significantly phylogenetically clustered. Some results in the neighbouring areas were consistent with historic range expansions. In contrast with expectations, sites located on the oldest substrates had significantly lower phylogenetic diversity (PD. Fraser Island was once connected to mainland Australia, our results are consistent with a region geologically old enough to have continuously supported rainforest in refugia. The interface of tropical and temperate floras in part also explains the significant phylogenetic evenness
Sable Island: A heritage to preserve
Energy Technology Data Exchange (ETDEWEB)
Villeneuve, C.
1997-09-01
Sable Island is strategically located on the edge of the teeming fisheries of the Newfoundland Grand Banks and near one of the main sea routes between North America and Europe. It has been the bane of navigators from 1583 onward, with 250 ships running aground, the latest in 1947. Marine productivity around Sable Island is very high owing to the temperature differences between the currents and the adjacent underwater topography. Dolphins and whales abound in the area known as the `Gully`, and there are no fewer than 36 fish species present in the waters surrounding the Island. Approximately 35 per cent of the Island is covered by vegetation which is limited to species adapted to sandy soil containing little organic matter and few nutrients. Some plants, such as the American beachgrass, grow in dense colonies and help to stabilize the dunes. Bird diversity is limited to species adapted to open areas, ponds and the littoral. Some 324 species have been recorded on the Island, but only 25 are known to nest there. The Island is one of world`s most important breeding sites for grey seals where they can be observed in great numbers during mating, whelping and moulting season. Among the many introduced animals only the legendary horses of Sable Island remain to this day. Despite its remoteness and isolation, the Island faces many threats, one of the most worrysome being the erosion of the eastern extremity of the Island during severe winter storms. The Island benefits from its status as a Migratory Bird Sanctuary, and is legally protected under Sable Island Regulations of the Navigation Act.
Directory of Open Access Journals (Sweden)
Laura V. Alston
2016-08-01
primary and secondary intervention strategies. Two interventions were focussed exclusively on Aboriginal and Torres Strait Islander (Australian Indigenous populations. Conclusions Few interventions were identified that exclusively focussed on IHD prevention in rural communities, despite these populations being at increased risk of IHD in Australia, and this is consistent with comparable countries, internationally. Although limited, available evidence shows that primary and secondary interventions targeted at IHD and related risk factors can be effective in a rural setting.
International Nuclear Information System (INIS)
Anon.
1980-01-01
Known uranium deposits and the companies involved in uranium mining and exploration in Australia are listed. The status of the development of the deposits is outlined and reasons for delays to mining are given
Gender differences among regular injecting drug users in Sydney, Australia, 1996-2003.
Breen, Courtney; Roxburgh, Amanda; Degenhardt, Louisa
2005-07-01
Previous research has found that female injecting drug users (IDU) are younger and more likely to be involved in risky behaviours such as needle sharing and sex work than male IDU. Aboriginal female drug users, in particular, are over-represented in IDU and prison populations. These factors place female IDU at increased risk of health problems and complicate issues such as homelessness, unemployment and poverty. Although a substantial body of research exists, little trend analysis has been done in Australia and much of the previous literature has focused on treatment populations. Cross-sectional data from 1996 to 2003 from regular IDU in Sydney interviewed as part of Australia's drug monitoring system, the Illicit Drug Reporting System (IDRS) were examined for trends over time. The demographic characteristics, drug use patterns and self-reported risk behaviours of the most recent sample (2003) were analysed for gender differences. Female IDU were younger in all sample years. Female IDU were more likely to identify as Aboriginal or Torres Strait Islander (ATSI) and engage in sex work. There has been a steady increase in these proportions over time. Female IDU were less likely to have a prison history, although there has been an increase among both male and female IDU over time. There were no gender differences in drug use patterns or frequency of drug use. Larger proportions of females report lending needles. Reports of lending and borrowing needles have decreased over time among both male and female IDU. Female IDU may place themselves at greater risk than male IDU by being more likely to share injecting equipment and engage in sex work. Treatment and other measures to reduce harm may need to be targeted specifically at women and, in particular, indigenous women.
DEFF Research Database (Denmark)
McLisky, Claire Louise; Carey, Jane
Vedtagelsen af White Australien som regeringens politik i 1901 viser, at hvidheden var afgørende for den måde, hvorpå den nye nation i Australien blev konstitueret. Og alligevel har historikere i vid udstrækning overset hvidhed i deres studier af Australiens race fortid. 'Creating White Australia...
Islanded operation of distributed networks
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
This report summarises the findings of a study to investigate the regulatory, commercial and technical risks and benefits associated with the operation of distributed generation to power an islanded section of distributed network. A review of published literature was carried out, and UK generators were identified who could operate as part of an island network under the existing technical, regulatory, and safety framework. Agreement on case studies for consideration with distributed network operators (DNOs) is discussed as well as the quantification of the risks, benefits and costs of islanding, and the production of a case implementation plan for each case study. Technical issues associated with operating sections of network in islanded mode are described, and impacts of islanding on trading and settlement, and technical and commercial modelling are explored.
Islanded operation of distributed networks
International Nuclear Information System (INIS)
2005-01-01
This report summarises the findings of a study to investigate the regulatory, commercial and technical risks and benefits associated with the operation of distributed generation to power an islanded section of distributed network. A review of published literature was carried out, and UK generators were identified who could operate as part of an island network under the existing technical, regulatory, and safety framework. Agreement on case studies for consideration with distributed network operators (DNOs) is discussed as well as the quantification of the risks, benefits and costs of islanding, and the production of a case implementation plan for each case study. Technical issues associated with operating sections of network in islanded mode are described, and impacts of islanding on trading and settlement, and technical and commercial modelling are explored
Oberle, Ferdinand K. J.; Swarzenski, Peter W.; Storlazzi, Curt
2017-04-01
Atoll islands, most of which only average 1-2 meters above today's sea level, provide a tremendous natural laboratory in which to study and better understand the intensifying impacts of high rates of sea-level rise on tropical reef-lined islands globally due to their unique geologic structure and limited water supply. Groundwater resources of atolls are typically minimal due to the low elevation and small surface area of the islands and are also subject to recurring droughts, and more frequent, storm-driven seawater overwash events. Although groundwater is the principal means of freshwater storage on atoll islands and is a major factor in determining the overall sustainability of island communities, hydrological data on how an aquifer will response to changes in sea-level rise or storm-driven overwash remain limited. We here present high-resolution time series hydrogeological and geochemical data to determine the role of the atoll's carbonate geology, land use, and atmospheric and oceanographic forcing in driving coastal groundwater exchange on the island of Roi Namur on Kwajalein Atoll in the Republic of the Marshall Islands. This information can provide new estimates on the recovery and resilience of coastal groundwater resources on such islands to expected climate change-driven perturbations.
The coastline remote sensing survey for Zhao Shu Island in Xisha Islands based on WorldView-2
Li, Li; Zhong, Chang; Kong, Fanping
2014-11-01
Due to diastrophism, tide action and human activities, the coastline is always in flux. There are lots of coral islands in the south sea of China. Remote sensing survey for the coastline not only can reassert the necessity and importance of coral protection, but also can provide basic data and scientific basis for island ecologic protection, reasonable utilization of land resources. The study area named Zhao Shu Island lies in Jintong Islands of Xisha. It is a coral island which has people inhabited. Using WorldView-2 satellite remote sensing images as data sources we carry out three phases of coastline investigation and monitoring. The satellite data phases are 2002, 2010 and 2013. Firstly, affirm the bands valuable for color composition on the basis of spectral and correlation analysis. Then extract the coastline by a series of image process, such as image correction, fusion, waterline extraction and coastline revision. Finally determine the coastline types and length by artificial interpretation. The results show that the island length is gradually smaller, which means the island area is reducing. The beach bedrock coast in northern island was eroded seriously especially during the period between 2010 and 2013. In addition, the shoal head shape in the western island changed a lot.
Australia/Japan thermal coal settlements
International Nuclear Information System (INIS)
McLean, A.
2000-01-01
After prolonged negotiations, Australian suppliers and Japanese buyers have reached agreement on the benchmark thermal coal prices for the Japanese financial year 2000 (April 1, 2000 to March 31, 2001). The benchmark price as negotiated with the Chubu and Tohoku power utilities is about US$1.20 down on last year's price of $29.95. The actual price change to each supplier varies slightly depending on the calorific value of each product as calculated against a benchmark value of 6700kcal/kg on a gross air-dried basis. It is strange, but the Australians and Japanese both have some reason to crow about the outcome of the negotiation. In US dollar terms, compared with April 1, 1999, the suppliers have secured a price rise from A$45.39 to A$47.97; while the Japanese can point to having achieved a price reduction from Y3551/t to Y3162/t. The joys of exchange rate fluctuations. The result can only be seen as a good one for Australia, especially as it is alleged that one of the Australian suppliers opened negotiations by putting a US$1 price reduction on the table. It is worth noting that the significance of the benchmark coal price is waning, with the annual negotiations in Japan covering only 14Mt of a total seaborne trade of some 450Mt. Consequently, few tonnes are marketed at the benchmark price and Australia finds itself in fierce competition with suppliers from Indonesia, China and Russia for huge, short-term tenders at FOB prices. Recent winning Australian bids have been barely over US$20/t FOBT ex east coast Australia-nearly 30% below the new US$28.75 benchmark price. Finally, on the negotiating table will come the settlements for the semi coking coals. This is where Australia should hold the trump card. Japan simply cannot replace, from other countries, the near 30Mt of high quality coal it purchases each year from Australia. But already the whiff of a US$1.45-US$1.50 price reduction hangs in the air. Copyright (2000) Australian Journal of Mining
Late Quaternary climate change shapes island biodiversity
DEFF Research Database (Denmark)
Weigelt, Patrick; Steinbauer, Manuel; Cabral, Juliano
2016-01-01
Island biogeographical models consider islands either as geologically static with biodiversity resulting from ecologically neutral immigration–extinction dynamics1, or as geologically dynamic with biodiversity resulting from immigration–speciation–extinction dynamics influenced by changes in island...... sea levels3, 4 and caused massive changes in island area, isolation and connectivity5, orders of magnitude faster than the geological processes of island formation, subsidence and erosion considered in island theory2, 6. Consequences of these oscillations for present biodiversity remain unassessed5, 7...
Country Report on Building Energy Codes in Australia
Energy Technology Data Exchange (ETDEWEB)
Shui, Bin; Evans, Meredydd; Somasundaram, Sriram
2009-04-02
This report is part of a series of reports on building energy efficiency codes in countries associated with the Asian Pacific Partnership (APP) - Australia, South Korea, Japan, China, India, and the United States of America (U.S.). This reports gives an overview of the development of building energy codes in Australia, including national energy policies related to building energy codes, history of building energy codes, recent national projects and activities to promote building energy codes. The report also provides a review of current building energy codes (such as building envelope, HVAC, and lighting) for commercial and residential buildings in Australia.
Australia: Approaching an energy crossroads
International Nuclear Information System (INIS)
Falk, Jim; Settle, Domenica
2011-01-01
This paper considers energy policy in Australia in the context of its considerable energy resources, climate change and a recent change in government. It examines the possible paths that future energy use and policy in Australia could take, including published projections based largely on a 'business as usual' approach and projections based on a dramatic shift towards more efficient use of energy and renewable energy technologies. It also considers the various factors affecting future policy direction, including energy security, the advocacy in Australia for establishing nuclear electricity generation and other parts of the nuclear fuel-cycle, responses to climate change, and carbon sequestration. It concludes that while the Australian Government is currently reluctant to move away from a dependence on coal, and unlikely to adopt nuclear energy generation, a low-emissions future without waiting for the deployment of carbon capture and storage and without resorting to nuclear power is within reach. However, in the face of strong pressure from interest groups associated with energy intensive industry, making the necessary innovations will require further growth of community concern about climate change, and the development of greater understanding of the feasibility of employing low carbon-emissions options.
Factors influencing warfarin control in Australia and Singapore.
Bernaitis, Nijole; Ching, Chi Keong; Teo, Siew Chong; Chen, Liping; Badrick, Tony; Davey, Andrew K; Crilly, Julia; Anoopkumar-Dukie, Shailendra
2017-09-01
Warfarin is widely used for patients with non-valvular atrial fibrillation (NVAF). Variations in warfarin control, as measured by time in therapeutic range (TTR), have been reported across different regions and ethnicities, particularly between Western and Asian countries. However, there is limited data on comparative factors influencing warfarin control in Caucasian and Asian patients. Therefore, the aim of this study was to determine warfarin control and potential factors influencing this in patients with NVAF in Australia and Singapore. Retrospective data was collected for patients receiving warfarin for January to June 2014 in Australia and Singapore. TTR was calculated for individuals with mean patient TTR used for analysis. Possible influential factors on TTR were analysed including age, gender, concurrent co-morbidities, and concurrent medication. The mean TTR was significantly higher in Australia (82%) than Singapore (58%). At both sites, chronic kidney disease significantly lowered this TTR. Further factors influencing control were anaemia and ageWarfarin control was significantly higher in Australia compared to Singapore, however chronic kidney disease reduced control at both sites. The different levels of control in these two countries, together with patient factors further reducing control may impact on anticoagulant choice in these countries with better outcomes from warfarin in Australia compared to Singapore. Copyright © 2017 Elsevier Ltd. All rights reserved.
Autumn monitoring of resident avifauna on Guana Island, British Virgin Islands
C.W. Boal; J.M. Wunderle Jr.; W.J. Arendt
2013-01-01
Although the Caribbean region is considered a biodiversity hotspot and a priority for ecological conservation efforts, little information exists on population trends of West Indian landbirds. We combined avian survey data collected from three studies spanning a 16-year period on a small island with a minimal human presence in the British Virgin Islands. Although...
The pacific island health care project.
Person, Donald Ames
2014-01-01
US Associated/Affiliated Pacific Islands (USAPI) include three freely associated states: Marshall Islands, Federated States of Micronesia, Palau, and three Territories: American Samoa, Guam, and Commonwealth of the Northern Mariana Islands. The Pacific Island Health Care Project (PIHCP) provides humanitarian medical referral/consultation/care to >500,000 indigenous people of these remote islands. In the mid-1990s, we developed a simple store-and-forward program to link the USAPI with Tripler Army Medical Center. This application allowed image attachment to email consultations. More than 8000 Pacific Islanders have benefited from the program. Three thousand Pacific Islanders prior to telemedicine (1990-1997) and since store-and-forward telemedicine (1997-present), the PIHCP has helped an additional 5000. Records post dynamically and are stored in an archival database. The PIHCP is the longest running telemedicine program in the world delivering humanitarian medical care. It has bridged the Developing World of the remote Pacific Islands with advanced medical and surgical care available at a major US military teaching hospital. (The opinions expressed here are those of the author and not that of the Army, Department of Defense, or the US Government.).
The Pacific Island Health Care Project
Directory of Open Access Journals (Sweden)
Donald Ames Person
2014-10-01
Full Text Available Introduction/BackgroundUS Associated/Affiliated Pacific Islands (USAPI include 3 Freely Associated States: Marshall Islands, Federated States of Micronesia, Palau and 3 Territories: American Samoa, Guam, and Commonwealth of the Northern Mariana Islands. ObjectiveThe Pacific Island Health Care Project (PIHCP provides humanitarian medical referral/consultation/care to >500,000 indigenous people of these remote islands. Methods In the mid-1990s, we developed a simple store-and-forward program to link the USAPI with Tripler Army Medical Center (TAMC. This application allowed image attachment to email consultations. ResultsMore than 8000 Pacific Islanders have benefited from the program. 3000 Pacific Islanders prior to telemedicine (1990-1997 and since store-and-forward telemedicine (1997-present, the PIHCP has helped an additional 5000. Records post dynamically and are stored in an archival database. Conclusion The PIHCP is the longest running telemedicine program in the world delivering humanitarian medical care. It has bridged the Developing World of the remote Pacific islands with advanced medical and surgical care available at a major US military teaching hospital.(The opinions expressed here are those of the author and not that of the Army, Department of Defense, or the US Government.
Directory of Open Access Journals (Sweden)
Lucas J. Siegfried
2014-12-01
Full Text Available doi: http://dx.doi.org/10.15447/sfews.2014v12iss4art2Water use estimation is central to managing most water problems. To better understand water use in California’s Sacramento–San Joaquin Delta, a collaborative, integrated approach was used to predict Delta island diversion, consumption, and return of water on a more detailed temporal and spatial resolution. Fabian Tract and Staten Island were selected for this pilot study based on available data and island accessibility. Historical diversion and return location data, water rights claims, LiDAR digital elevation model data, and Google Earth were used to predict island diversion and return locations, which were tested and improved through ground-truthing. Soil and land-use characteristics as well as weather data were incorporated with the Integrated Water Flow Model Demand Calculator to estimate water use and runoff returns from input agricultural lands. For modeling, the islands were divided into grid cells forming subregions, representing fields, levees, ditches, and roads. The subregions were joined hydrographically to form diversion and return watersheds related to return and diversion locations. Diversions and returns were limited by physical capacities. Differences between initial model and measured results point to the importance of seepage into deeply subsided islands. The capabilities of the models presented far exceeded current knowledge of agricultural practices within the Delta, demonstrating the need for more data collection to enable improvements upon current Delta Island Consumptive Use estimates.
Directory of Open Access Journals (Sweden)
Leonardo Barros Ribeiro
2012-03-01
Full Text Available Leucism in birds is a genetic disorder characterized by the total absence of melanin in some or all feathers, but unlike albinism, the other body parts, such as eyes, beak, and tarsi remain with the typical color of the species. The House Sparrow Passer domesticus is a bird native from Europe, Asia, and North Africa. It has been introduced in North America, South America, South Africa, Australia, and New Zealand. Currently, it is the bird species with the largest geographical range. Here, we report the record of a leucistic specimen of Passer domesticus from Rodeadouro island, São Francisco river, northeastern Brazil.
A genomic history of Aboriginal Australia.
Malaspinas, Anna-Sapfo; Westaway, Michael C; Muller, Craig; Sousa, Vitor C; Lao, Oscar; Alves, Isabel; Bergström, Anders; Athanasiadis, Georgios; Cheng, Jade Y; Crawford, Jacob E; Heupink, Tim H; Macholdt, Enrico; Peischl, Stephan; Rasmussen, Simon; Schiffels, Stephan; Subramanian, Sankar; Wright, Joanne L; Albrechtsen, Anders; Barbieri, Chiara; Dupanloup, Isabelle; Eriksson, Anders; Margaryan, Ashot; Moltke, Ida; Pugach, Irina; Korneliussen, Thorfinn S; Levkivskyi, Ivan P; Moreno-Mayar, J Víctor; Ni, Shengyu; Racimo, Fernando; Sikora, Martin; Xue, Yali; Aghakhanian, Farhang A; Brucato, Nicolas; Brunak, Søren; Campos, Paula F; Clark, Warren; Ellingvåg, Sturla; Fourmile, Gudjugudju; Gerbault, Pascale; Injie, Darren; Koki, George; Leavesley, Matthew; Logan, Betty; Lynch, Aubrey; Matisoo-Smith, Elizabeth A; McAllister, Peter J; Mentzer, Alexander J; Metspalu, Mait; Migliano, Andrea B; Murgha, Les; Phipps, Maude E; Pomat, William; Reynolds, Doc; Ricaut, Francois-Xavier; Siba, Peter; Thomas, Mark G; Wales, Thomas; Wall, Colleen Ma'run; Oppenheimer, Stephen J; Tyler-Smith, Chris; Durbin, Richard; Dortch, Joe; Manica, Andrea; Schierup, Mikkel H; Foley, Robert A; Lahr, Marta Mirazón; Bowern, Claire; Wall, Jeffrey D; Mailund, Thomas; Stoneking, Mark; Nielsen, Rasmus; Sandhu, Manjinder S; Excoffier, Laurent; Lambert, David M; Willerslev, Eske
2016-10-13
The population history of Aboriginal Australians remains largely uncharacterized. Here we generate high-coverage genomes for 83 Aboriginal Australians (speakers of Pama-Nyungan languages) and 25 Papuans from the New Guinea Highlands. We find that Papuan and Aboriginal Australian ancestors diversified 25-40 thousand years ago (kya), suggesting pre-Holocene population structure in the ancient continent of Sahul (Australia, New Guinea and Tasmania). However, all of the studied Aboriginal Australians descend from a single founding population that differentiated ~10-32 kya. We infer a population expansion in northeast Australia during the Holocene epoch (past 10,000 years) associated with limited gene flow from this region to the rest of Australia, consistent with the spread of the Pama-Nyungan languages. We estimate that Aboriginal Australians and Papuans diverged from Eurasians 51-72 kya, following a single out-of-Africa dispersal, and subsequently admixed with archaic populations. Finally, we report evidence of selection in Aboriginal Australians potentially associated with living in the desert.
Radiation doses from computed tomography in Australia
International Nuclear Information System (INIS)
Thomson, J.E.M.; Tingey, D.R.C.
1997-11-01
Recent surveys in various countries have shown that computed tomography (CT) is a significant and growing contributor to the radiation dose from diagnostic radiology. Australia, with 332 CT scanners (18 per million people), is well endowed with CT equipment compared to European countries (6 to 13 per million people). Only Japan, with 8500 units (78 per million people), has a significantly higher proportion of CT scanners. In view of this, a survey of CT facilities, frequency of examinations, techniques and patient doses has been performed in Australia. It is estimated that there are 1 million CT examinations in Australia each year, resulting in a collective effective dose of 7000 Sv and a per caput dose of 0.39 mSv. This per caput dose is much larger than found in earlier studies in the UK and New Zealand but is less than 0.48 mSv in Japan. Using the ICRP risk factors, radiation doses from CT could be inducing about 280 fatal cancers per year in Australia. CT is therefore a significant, if not the major, single contributor to radiation doses and possible risk from diagnostic radiology. (authors)
The origin of platyrrhines: An evaluation of the Antarctic scenario and the floating island model.
Houle, A
1999-08-01
This paper evaluates whether 1) protoplatyrrhines could have migrated to South America via Antarctica, and 2) the floating island model is a plausible transoceanic mode of dispersal for land vertebrates like protoplatyrrhines. Results show that Eocene Antarctica and Australia supported large and dense forests, and that the Antarctic fauna was comprised of many species of vertebrates, including placental and marsupial land mammals. However, no primate remains have ever been reported from these continents. Antarctica and South America were connected until the Middle Eocene (i.e., after the oldest Asian anthropoids), but two major water barriers existed between Antarctica and Asia since the Early Eocene. The Eocene and Oligocene water gap separating Africa and Antarctica was excessively large. Thus, all scenarios involving an Antarctic route have been rejected. The African scenario is difficult to falsify because only one water barrier existed, both paleowinds and paleocurrents were favorable, and Paleogene African anthropoids show phylogenetic affinities to platyrrhines. I tested whether a journey on a hypothetical floating island over the Paleogene Atlantic Ocean exceeds the survival limit of a genetically viable group of animals such as protoplatyrrhines. Studies of water deprivation suggest that they could have been able, with a body weight averaging 1 kg, to survive without water for at least 13 days. I have used the present Atlantic Ocean as a model for the velocity of Paleogene paleowinds and paleocurrents. Considering winds as the key accelerating force of floating islands, the Paleogene Atlantic water barrier could have been crossed, in the most conservative scenario, in 8 days at 50 Mya, 11 days at 40 Mya, and 15 days at 30 Mya. In order to survive a transoceanic journey, however, protoplatyrrhines had to be preadapted to strong seasonal variations in water availability in their original (African) environment. Once on the sea, their brains would have
Dunn, Michael J; Jackson, Jennifer A; Adlard, Stacey; Lynnes, Amanda S; Briggs, Dirk R; Fox, Derren; Waluda, Claire M
2016-01-01
We report long-term changes in population size of three species of sympatrically breeding pygoscelid penguins: Adélie (Pygoscelis adeliae), chinstrap (Pygoscelis antarctica) and gentoo (Pygoscelis papua ellsworthii) over a 38 year period at Signy Island, South Orkney Islands, based on annual counts from selected colonies and decadal all-island systematic counts of occupied nests. Comparing total numbers of breeding pairs over the whole island from 1978/79 to 2015/16 revealed varying fortunes: gentoo penguin pairs increased by 255%, (3.5% per annum), chinstrap penguins declined by 68% (-3.6% per annum) and Adélie penguins declined by 42% (-1.5% per annum). The chinstrap population has declined steadily over the last four decades. In contrast, Adélie and gentoo penguins have experienced phases of population increase and decline. Annual surveys of selected chinstrap and Adélie colonies produced similar trends from those revealed by island-wide surveys, allowing total island population trends to be inferred relatively well. However, while the annual colony counts of chinstrap and Adélie penguins showed a trend consistent in direction with the results from all-island surveys, the magnitude of estimated population change was markedly different between colony wide and all island counts. Annual population patterns suggest that pair numbers in the study areas partly reflect immigration and emigration of nesting birds between different parts of the island. Breeding success for all three species remained broadly stable over time in the annually monitored colonies. Breeding success rates in gentoo and chinstrap penguins were strongly correlated, despite the differing trends in population size. This study shows the importance of effective, standardised monitoring to accurately determine long-term population trajectories. Our results indicate significant declines in the Adélie and chinstrap penguin populations at Signy Island over the last five decades, and a gradual
DEFF Research Database (Denmark)
Patino, Jairo; Whittaker, Robert J.; Borges, Paulo A.V.
2017-01-01
Aims: The 50th anniversary of the publication of the seminal book, The Theory of Island Biogeography, by Robert H. MacArthur and Edward O. Wilson, is a timely moment to review and identify key research foci that could advance island biology. Here, we take a collaborative horizon-scanning approach...... to identify 50 fundamental questions for the continued development of the field. Location: Worldwide. Methods: We adapted a well-established methodology of horizon scanning to identify priority research questions in island biology, and initiated it during the Island Biology 2016 conference held in the Azores......); global change (5); conservation and management policies (5); and invasive alien species (4). Main conclusions: Collectively, this cross-disciplinary set of topics covering the 50 fundamental questions has the potential to stimulate and guide future research in island biology. By covering fields ranging...
Browne, Jennifer; Adams, Karen; Atkinson, Petah; Gleeson, Deborah; Hayes, Rick
2017-09-19
Objective To provide an overview of previous reviews of programs that aimed to improve nutritional status or diet-related health outcomes for Aboriginal and Torres Strait Islander peoples, in order to determine what programs are effective and why. Methods A systematic search of databases and relevant websites was undertaken to identify reviews of nutrition interventions for Aboriginal and Torres Strait Islander Australians. Pairs of reviewers undertook study selection and data extraction and performed quality assessment using a validated tool. Results Twelve papers reporting 11 reviews were identified. Two reviews were rated high quality, three were rated medium and six were rated low quality. The reviews demonstrated that a positive effect on nutrition and chronic disease indicators can be a result of: 1) incorporating nutrition and breastfeeding advice into maternal and child health care services; and 2) multifaceted community nutrition programs. The evidence suggests that the most important factor determining the success of Aboriginal and Torres Strait Islander food and nutrition programs is community involvement in (and, ideally, control of) program development and implementation. Conclusions Community-directed food and nutrition programs, especially those with multiple components that address the underlying causes of nutrition issues, can be effective in improving nutrition-related outcomes. What is known about the topic? More effective action is urgently required in order to reduce the unacceptable health inequalities between Aboriginal and Torres Strait Islander peoples and non-Indigenous Australians. Food insecurity and nutrition-related chronic conditions are responsible for a large proportion of the ill health experienced by Australia's First Peoples. What does this paper add? This narrative overview of 11 reviews published between 2005 and 2015 provides a synthesis of the current evidence for improving Aboriginal and Torres Strait Islander nutrition
Pediatrics in the Marshall Islands
International Nuclear Information System (INIS)
Dungy, C.I.; Morgan, B.C.; Adams, W.H.
1984-01-01
The delivery of health care to children living on isolated island communities presents unique challenges to health professionals. An evolved method of providing longitudinal services to infants and children residing on islands of the Marshall Island chain - a central Pacific portion of the Micronesian archipelago - is presented. The difficulties associated with provision of comprehensive health care in a vast ocean area are discussed
Directory of Open Access Journals (Sweden)
Mario Fernández-Mazuecos
Full Text Available BACKGROUND: Population genetic theory holds that oceanic island populations are expected to have lower levels of genetic variation than their mainland counterparts, due to founder effect after island colonization from the continent. Cistus monspeliensis (Cistaceae is distributed in both the Canary Islands and the Mediterranean region. Numerous phylogenetic results obtained in the last years allow performing further phylogeographic analyses in Cistus. METHODOLOGY/PRINCIPAL FINDINGS: We analyzed sequences from multiple plastid DNA regions in 47 populations of Cistus monspeliensis from the Canary Islands (21 populations and the Mediterranean basin (26 populations. The time-calibrated phylogeny and phylogeographic analyses yielded the following results: (1 a single, ancestral haplotype is distributed across the Mediterranean, whereas 10 haplotypes in the Canary Islands; (2 four haplotype lineages are present in the Canarian Islands; (3 multiple colonization events across the archipelago are inferred; (4 the earliest split of intraspecific lineages occurred in the Early to Middle Pleistocene (<930,000 years BP. CONCLUSIONS/SIGNIFICANCE: The contrasting pattern of cpDNA variation is best explained by genetic bottlenecks in the Mediterranean during Quaternary glaciations, while the Canarian archipelago acted as a refugium of high levels of genetic diversity. Active colonization across the Canarian islands is supported not only by the distribution of C. monspeliensis in five of the seven islands, but also by our phylogeographic reconstruction in which unrelated haplotypes are present on the same island. Widespread distribution of thermophilous habitats on every island, as those found throughout the Mediterranean, has likely been responsible for the successful colonization of C. monspeliensis, despite the absence of a long-distance dispersal mechanism. This is the first example of a plant species with higher genetic variation among oceanic island
Sandhill cranes browse for food near VAB
2000-01-01
A family of sandhill cranes searches for food on the grounds near the Vehicle Assembly Building. The cranes have been a constant sight in the Launch Complex 39 area during the month of May. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.
Sandhill cranes hunting food at KSC
2000-01-01
A pair of Sandhill Cranes searches for food with their still- fluffy fledgling close by. The trio have been seen wandering the grassy areas in the KSC Launch Complex 39 area. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.
A New Era for Research Education in Australia?
Marsh, Helene; Smith, Bradley; King, Max; Evans, Terry
2012-01-01
Use of the Australian research assessment exercise, Excellence in Research for Australia (ERA) to influence the policy and practice of research education in Australia will undoubtedly have many consequences, some of them unintended and potentially deleterious. ERA is a retrospective measure of research quality; research education is prospective.…
Issues and Tensions in Island Heritage Management: A Case Study of Motuihe Island, New Zealand
Directory of Open Access Journals (Sweden)
David Bade
2010-05-01
Full Text Available This paper draws on a New Zealand case study, Motuihe Island, to examine the challenges of conserving cultural heritage in places renowned for natural heritage values. In keeping with the broader trend toward the ecological restoration of islands close to Auckland, Motuihe Island is undergoing conversion into an ecosystem of native flora and fauna. Issues and tensions relating to the management of natural and cultural heritage will be discussed and influencing aspects investigated: the nature/culture dualism, the effect of New Zealand’s history and identity, and the influence of islandness on heritage management.
Australia's atomic conspiracy theory
International Nuclear Information System (INIS)
Binnie, A.
2001-01-01
The author questions claims by the Newcastle University historian Wayne Reynolds in his book 'Australia's Bid for the Bomb', that the impetus behind the Snowy Mountains Scheme was to provide a secure source of power for the enrichment of uranium and production of heavy water so that Australia could produce its own atomic bombs. Reynolds also argued that the Australian Atomic Energy Commission (AAEC) was set up so that Australia had a trained scientific workforce to produce plutonium for the bomb. While the book is well researched, Reynolds does not seem to understand the principles of basic science and engineering. After the Second World War, a manufacturing and industrial base with a skilled and trained workforce was needed so it could be converted to war or defence manufacturing when the need arose. This new manufacturing community would require electrical power to sustain it. Hydroelectricity and atomic energy could help provide these needs. Even though war was still raging, Prime Minister John Curtin looked ahead and set up a Department of Post-War Reconstruction. It was through this department that the Snowy Mountains Scheme would be established. Curtin did not live to see this. He died in 1945 but his successor, Ben Chifley, continued the vision. The author believes, an understanding of the science behind these developments and an appreciation of how how humans interact with each others when it comes to getting something they want is likely to give a more balanced view of the past
Fellers, Gary M.; Drost, Charles A.; Murphey, Thomas G.
2008-01-01
More than 900 individually marked island night lizards (Xantusia riversiana) were captured on San Nicolas Island, California, between 1984 and 2007 as part of an ongoing study to monitor the status of this threatened species. Our data suggest that at least a few lizards are probably more than 20 years old, and one lizard would be 31.5 years old if it grew at an average rate for the population. Ages of 20 and 30 years seem reasonable given the remarkably slow growth during capture intervals of more than a decade for five of the lizards which we estimated to be 20 or more years old. Like other lizards, island night lizard growth rates vary by size, with larger lizards growing more slowly. In general, growth rates were somewhat greater on San Nicolas Island (compared with Santa Barbara Island), and this increase was sustained through all of the intermediate size classes. The higher growth rate may account for the somewhat larger lizards present on San Nicolas Island, although we cannot discount the possibility that night lizards on San Nicolas are merely living longer. The high percentage of small lizards in the Eucalyptus habitat might seem to reflect a healthy population in that habitat, but the high proportion of small lizards appears to be caused by good reproduction in the 1900s and substantially poorer reproduction in subsequent years. The Eucalyptus habitat has dried quite a bit in recent years. Night lizards in the Haplopappus/Grassland habitat have shown an increase in the proportion of larger lizards since 2000. There has also been an increase in the proportion of large lizards in the Rock Cobble habitat at Redeye Beach. However, there are has been some change in habitat with more elephant seals occupying the same area just above the high tide as do the night lizards. Southern alligator lizards and side-blotched lizards are both non-native on San Nicolas Island. Neither lizard causes obvious harm to island night lizards, and management time and effort should
International Nuclear Information System (INIS)
Parbo, S.A.
1982-01-01
The paper reviews the history and growth of the mineral industry in Australia and its significance to the nation's economic growth and overseas trade, particularly over the last twenty years during which time production of coal, iron ore, manganese and mineral sands has increased greatly and new discoveries of petroleum, bauxite and nickel have given rise to major new industries. Australia ranks fourteenths in the value of world trade and is among the world's largest exporters of alumina, iron ore, mineral sands, coal, lead, zinc and nickel. Some details of production, processing and exports of the major minerals are given. Comment is made on the policies and roles of the six State Governments and the Federal Government in respect of ownership and control of the mining, processing and exporting of both energy and non-energy minerals. (orig.) [de
Summer spawning of Porites lutea from north-western Australia
Stoddart, C. W.; Stoddart, J. A.; Blakeway, D. R.
2012-09-01
Most coral species off Australia's west coast spawn in the austral autumn (March-April), with a few species also spawning in the southern spring or early summer (November-December). This is the reverse timing to spawning recorded off Australia's east coast. Porites lutea, a gonochoric broadcast spawner that is common on Australia's west coast, is shown here to spawn in the months of November or December, as it does on Australia's east coast. Spawning occurred between 2 and 5 nights after full moon, with the majority of spawning activity on night 3. Gametes developed over three to four months with rapid development in the last two weeks before spawning. Zooxanthellae were typically observed in mature oocytes, only a week before spawning so their presence may provide a useful indicator of imminent spawning.
Uranium mining in Canada and Australia
International Nuclear Information System (INIS)
Mackenzie, B.W.; Whillans, R.T.; Williams, R.M.; Doggett, M.D.
1991-01-01
This study compared the impact of taxation on the economic viability and competitive position of uranium mining in Canada and Australia. The evaluation is based on four types of uranium deposit and four hypothetical project models. The deposits are assumed to have been discovered and delineated, and are awaiting a mine development decision. The models, initially appraised on a before-tax basis, are then subjected to taxation in each of six jurisdictions. Several taxation criteria are assessed in each case, including after-tax measures of investment incentive, discounted tax revenues, effective tax rates, intergovernmental tax shares, and comparative tax levels. The impact of taxation is shown to be both high and variable. The taxation systems in Saskatchewan and Australia's Northern Territory generate the most government revenue and provide the lowest incentive for investment. Canada's Northwest Territories and Ontario provide the best investment incentive and collect the least amount of taxes. South Australia and Western Australia tend to be positioned between these extremes. The study demonstrates that only the very best uranium mining projects have a chance of being developed under current market conditions, and even these can be rendered uneconomic by excessive taxation regimes. It follows that exceptionally good quality targets will have to be identified to provide the economic justification for uranium exploration. These realities will likely restrict uranium exploration and development activities for some time, not an unexpected response to a market situation where low prices have been caused largely by excess supply. (L.L.)
Medical e-commerce for regional Australia.
Kumar, D K; Mikelaitis, P
2001-12-01
The residents of rural and regional Australia have less access to health care services than in capital cities. There is a reluctance of General Practitioners to practice in the country. New information technology and government initiatives are now addressing this problem. High bandwidth videoconferencing is now being routinely used to provide psychiatric consultations to areas without this service. But this (like many other implementations of telecommunication technologies to health) has resulted in loss of revenue to regional Australia while benefiting capital cities. Thus, the current implementation of telecommunication technology to health has resulted in loss of revenue of the regions while increasing the bias towards the cities. Further, the system is not economically viable and requires the Government to inject funds for the smooth operation of the system. This paper proposes the use of telecommunication technology for enabling the communities of regional Australia to access health facilities via physical and virtual clinics. The proposed technique is self supporting and is based in the country with the intent to prevent the drain of resources from regional Australia. The technique attempts to eradicate the problem at the root level by providing a business opportunity that is based in and to cater for the needs of the remote communities. The proposed system would provide health services by physical and virtual clinics and while serving the communities would be profit centres- and thus attracting doctors and other resources to the remote communities.
Kwak, Mackenzie L
2018-03-01
Historically, several tick taxonomists have reported Hyalomma aegyptium within Australia due to misidentifications. This has resulted in confusion relating to the occurrence of the genus Hyalomma within Australia. Based on the recent discovery of museum specimens of Hyalomma dromedarii, misidentified as H. aegyptium, the historical occurrence of H. dromedarii is reported for the first time within Australia, along with its apparent subsequent extinction. The introduction and naturalisation of foreign tick species into Australia is also reviewed.
Directory of Open Access Journals (Sweden)
Fery Kurniawan
2016-04-01
Full Text Available The Indonesian government is currently directing its focus of development on the optimum uses of marine and coastal ecosystem services including the marine and coastal tourism. One of the main locus of coastal and marine tourism is the small islands tourism such as Gili Matra Islands among others. Small islands tourism is one of the favourite touristic activities because the destination provides beauty, exotism, aesthetic and a diversity of natural habitats including the warm, clear and attractive water. Tourism is being considered as a development instrument in order to boost a country’s economy and has become part of the global industry. However, tourism is also one of the actors that is responsible for environmental depletion, due to the constructions of buildings and tourism activities. This paper aims to study the level of vulnerability in small islands to tourism as a basis of integrated small islands management in Indonesian conservation area. The group of islands in this study consists of three islands namely Gili Ayer Island, Gili Meno Island and Gili Trawangan Island (known as Gili Matra Islands that were observed using Small Islands Vulnerability Index (SIVI. The results indicate that Gili Matra Islands have a vulnerability status from low into moderate, ranging from 2.25 to 2.75. Gili Ayer Island has the highest vulnerability with SIVI of 2.75 (Moderate, followed by Gili Meno Island with SIVI of 2.50 (Low and Gili Trawangan Island with SIVI of 2.25 (Low. The driving factor of vulnerability is the intensive utilization of marine tourism activities. Tourism is the sole stress to Gili Matra Island’s ecosystem due to its direct damaging impact and reducing its environmental quality. The vulnerability index which was built from the coastline, coral reef, live coral reef, and development area was applicable to assess the small island’s vulnerability in Indonesia, especially for coral island.
Dendrochronology of Strain-Relaxed Islands
International Nuclear Information System (INIS)
Merdzhanova, T.; Kiravittaya, S.; Rastelli, A.; Stoffel, M.; Denker, U.; Schmidt, O.G.
2006-01-01
We report on the observation and study of tree-ring structures below dislocated SiGe islands (superdomes) grown on Si(001) substrates. Analogous to the study of tree rings (dendrochronology), these footprints enable us to gain unambiguous information on the growth and evolution of superdomes and their neighboring islands. The temperature dependence of the critical volume for dislocation introduction is measured and related to the composition of the islands. We show clearly that island coalescence is the dominant pathway towards dislocation nucleation at low temperatures, while at higher temperatures anomalous coarsening is effective and leads to the formation of a depletion region around superdomes
Dendrochronology of strain-relaxed islands.
Merdzhanova, T; Kiravittaya, S; Rastelli, A; Stoffel, M; Denker, U; Schmidt, O G
2006-06-09
We report on the observation and study of tree-ring structures below dislocated SiGe islands (superdomes) grown on Si(001) substrates. Analogous to the study of tree rings (dendrochronology), these footprints enable us to gain unambiguous information on the growth and evolution of superdomes and their neighboring islands. The temperature dependence of the critical volume for dislocation introduction is measured and related to the composition of the islands. We show clearly that island coalescence is the dominant pathway towards dislocation nucleation at low temperatures, while at higher temperatures anomalous coarsening is effective and leads to the formation of a depletion region around superdomes.
The Limacidae of the Canary Islands
Regteren Altena, van C.O.
1950-01-01
CONTENTS Introduction............... 3 Systematic survey of the Limacidae of the central and western Canary Islands 5 Biogeographical notes on the Limacidae of the Canary Islands . . . . 21 Alphabetical list of the persons who collected or observed Limacidae in the Canary Islands.............. 31
International Nuclear Information System (INIS)
Marinova, D.
1997-01-01
With the temporary storage of nuclear waste, constituted by HIFAR spent fuel, at Lucas Heights reaching full capacity by 1998, there is an urgent need for a technical, social and political solution. Some of the fundamental uncertainties in relation to nuclear waste disposal and hence the operation of a nuclear research reactor in Australia are presented
Pioneering developments of marine renewable energy in Australia
Directory of Open Access Journals (Sweden)
Richard Manasseh
2017-04-01
Full Text Available The history of ocean renewable energy developments in Australia is reviewed. A layperson’s description of the physical operating principle is given for the main classes of technology that have been tested in Australian waters. The Australian marine domain possesses among the world’s most energetic wave-energy resources, driven by powerful mid-latitude westerly winds. The northern coast of Western Australia has tidal ranges significant on a global scale, and some geographical features around the continent have local tidal resonances. The East Australian Current, one of the world’s major western boundary currents, runs along the eastern Australian seaboard, offering potential for ocean-current energy. Sea-water temperatures in the tropical north-east of Australia may permit ocean thermal energy conversion. While this abundance of resources makes Australia an ideal location for technology development, the population is highly concentrated in a few large cities, and transmission infrastructure has developed over a century to supply cities from traditional power plants. Several wave-power developments have resulted in demonstration of deployments in Australian waters, three of which have been grid connected. Trials of tidal devices have also occurred, while other classes of ocean renewable energy have not yet been trialled. The prospects for marine renewable energy in Australia are discussed including non-traditional applications such as coastal protection and energy export.
Global nuclear waste repository proposal highlights Australia`s nuclear energy vacuum
Energy Technology Data Exchange (ETDEWEB)
Anon.
1999-06-01
The Pangea proposal is disscused and considered relevant to Australia. A five-year research program by the company has identified Australia and Argentina as having the appropriate geological, economic and democratic credentials for such a deep repository, with Australia being favoured. A deep repository would be located where the geology has been stable for several hundred million years, so that there need not be total reliance on a robust engineered barrier system to keep the waste securely isolated for thousands of years. It would be a commercial undertaking and would have dedicated port and rail infrastructure. It would take spent fuel and other wastes from commercial reactors, and possibly also waste from weapons disposal programs. Clearly, while the primary ethical and legal principle is that each country is entirely responsible for its own waste, including nuclear waste (polluter pays etc), the big question is whether the concept of an international waste repository is acceptable ethically. Political and economic questions are secondary to this. By taking a fresh look at the reasons for the difficulties which have faced most national repository programs, and discarding the preconception that each country must develop its own disposal facilities, it is possible to define a class of simple, superior high isolation sites which may provide a multi-national basis for solving the nuclear waste disposal problem. The relatively small volumes of high-level wastes or spent fuel which arise from nuclear power production make shared repositories a feasible proposition. For small countries, the economies of scale which can be achieved make the concept attractive. For all countries, objective consideration of the relative merits of national and multi-national solutions is a prudent part of planning the management of long-lived radioactive wastes
76 FR 17617 - Changes to Treatments for Citrus Fruit From Australia
2011-03-30
... Inspection Service [Docket No. APHIS-2008-0140] Changes to Treatments for Citrus Fruit From Australia AGENCY... Australia into the United States. These new treatments will continue to prevent the introduction or... from Australia into the United States. We also proposed to establish an approved irradiation dose for...
Genomic island excisions in Bordetella petrii
Directory of Open Access Journals (Sweden)
Levillain Erwan
2009-07-01
Full Text Available Abstract Background Among the members of the genus Bordetella B. petrii is unique, since it is the only species isolated from the environment, while the pathogenic Bordetellae are obligately associated with host organisms. Another feature distinguishing B. petrii from the other sequenced Bordetellae is the presence of a large number of mobile genetic elements including several large genomic regions with typical characteristics of genomic islands collectively known as integrative and conjugative elements (ICEs. These elements mainly encode accessory metabolic factors enabling this bacterium to grow on a large repertoire of aromatic compounds. Results During in vitro culture of Bordetella petrii colony variants appear frequently. We show that this variability can be attributed to the presence of a large number of metastable mobile genetic elements on its chromosome. In fact, the genome sequence of B. petrii revealed the presence of at least seven large genomic islands mostly encoding accessory metabolic functions involved in the degradation of aromatic compounds and detoxification of heavy metals. Four of these islands (termed GI1 to GI3 and GI6 are highly related to ICEclc of Pseudomonas knackmussii sp. strain B13. Here we present first data about the molecular characterization of these islands. We defined the exact borders of each island and we show that during standard culture of the bacteria these islands get excised from the chromosome. For all but one of these islands (GI5 we could detect circular intermediates. For the clc-like elements GI1 to GI3 of B. petrii we provide evidence that tandem insertion of these islands which all encode highly related integrases and attachment sites may also lead to incorporation of genomic DNA which originally was not part of the island and to the formation of huge composite islands. By integration of a tetracycline resistance cassette into GI3 we found this island to be rather unstable and to be lost from
CRED Gridded Bathymetry of Necker Island (100-021) in the Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-021b is a 60-m ASCII grid of depth data collected near Necker Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as...
Distribution models for koalas in South Australia using citizen science-collected data.
Sequeira, Ana M M; Roetman, Philip E J; Daniels, Christopher B; Baker, Andrew K; Bradshaw, Corey J A
2014-06-01
The koala (Phascolarctos cinereus) occurs in the eucalypt forests of eastern and southern Australia and is currently threatened by habitat fragmentation, climate change, sexually transmitted diseases, and low genetic variability throughout most of its range. Using data collected during the Great Koala Count (a 1-day citizen science project in the state of South Australia), we developed generalized linear mixed-effects models to predict habitat suitability across South Australia accounting for potential errors associated with the dataset. We derived spatial environmental predictors for vegetation (based on dominant species of Eucalyptus or other vegetation), topographic water features, rain, elevation, and temperature range. We also included predictors accounting for human disturbance based on transport infrastructure (sealed and unsealed roads). We generated random pseudo-absences to account for the high prevalence bias typical of citizen-collected data. We accounted for biased sampling effort along sealed and unsealed roads by including an offset for distance to transport infrastructures. The model with the highest statistical support (wAIC c ∼ 1) included all variables except rain, which was highly correlated with elevation. The same model also explained the highest deviance (61.6%), resulted in high R (2)(m) (76.4) and R (2)(c) (81.0), and had a good performance according to Cohen's κ (0.46). Cross-validation error was low (∼ 0.1). Temperature range, elevation, and rain were the best predictors of koala occurrence. Our models predict high habitat suitability in Kangaroo Island, along the Mount Lofty Ranges, and at the tips of the Eyre, Yorke and Fleurieu Peninsulas. In the highest-density region (5576 km(2)) of the Adelaide-Mount Lofty Ranges, a density-suitability relationship predicts a population of 113,704 (95% confidence interval: 27,685-199,723; average density = 5.0-35.8 km(-2)). We demonstrate the power of citizen science data for predicting species
Distribution models for koalas in South Australia using citizen science-collected data
Sequeira, Ana M M; Roetman, Philip E J; Daniels, Christopher B; Baker, Andrew K; Bradshaw, Corey J A
2014-01-01
The koala (Phascolarctos cinereus) occurs in the eucalypt forests of eastern and southern Australia and is currently threatened by habitat fragmentation, climate change, sexually transmitted diseases, and low genetic variability throughout most of its range. Using data collected during the Great Koala Count (a 1-day citizen science project in the state of South Australia), we developed generalized linear mixed-effects models to predict habitat suitability across South Australia accounting for potential errors associated with the dataset. We derived spatial environmental predictors for vegetation (based on dominant species of Eucalyptus or other vegetation), topographic water features, rain, elevation, and temperature range. We also included predictors accounting for human disturbance based on transport infrastructure (sealed and unsealed roads). We generated random pseudo-absences to account for the high prevalence bias typical of citizen-collected data. We accounted for biased sampling effort along sealed and unsealed roads by including an offset for distance to transport infrastructures. The model with the highest statistical support (wAICc ∼ 1) included all variables except rain, which was highly correlated with elevation. The same model also explained the highest deviance (61.6%), resulted in high R2(m) (76.4) and R2(c) (81.0), and had a good performance according to Cohen's κ (0.46). Cross-validation error was low (∼ 0.1). Temperature range, elevation, and rain were the best predictors of koala occurrence. Our models predict high habitat suitability in Kangaroo Island, along the Mount Lofty Ranges, and at the tips of the Eyre, Yorke and Fleurieu Peninsulas. In the highest-density region (5576 km2) of the Adelaide–Mount Lofty Ranges, a density–suitability relationship predicts a population of 113,704 (95% confidence interval: 27,685–199,723; average density = 5.0–35.8 km−2). We demonstrate the power of citizen science data for predicting species
Graham, Simon; Smith, Lucy Watchirs; Fairley, Christopher K; Hocking, Jane
2016-04-01
Higher notification rates of sexually transmissible infections (STIs) are reported among Aboriginal and Torres Strait Islander (Aboriginal) compared with non-Aboriginal people in Australia. The aim of this study is to estimate the pooled prevalence of chlamydia, gonorrhoea, syphilis and trichomonas among Aboriginal people in Australia by sex, age-group, setting (clinic vs population/community-based) and population group [adults, pregnant females, young people (12-29 years) and prisoners]. The databases Medline, PubMed and Web of Science were searched in May 2015. A meta-analysis was conducted to estimate the pooled prevalence of the four STIs in Aboriginal people and if possible, by gender, age-group, setting and population group. A total of 46 studies were included. The pooled prevalence was 11.2% (95%CI: 9.4-13.0%) for chlamydia (36 studies), 12.5% (95%CI: 10.5-14.6%) for gonorrhoea (28 studies), 16.8% (95%CI: 11.0-22.6%) for syphilis (13 studies) and 22.6% (95%CI: 18.5-26.7%) for trichomonas (11 studies); however, there was significant heterogeneity between studies (I(2) Aboriginal people through community-based programs that target asymptomatic young people.
Pricing the urban cooling benefits of solar panel deployment in Sydney, Australia.
Ma, S; Goldstein, M; Pitman, A J; Haghdadi, N; MacGill, I
2017-03-06
Cities import energy, which in combination with their typically high solar absorption and low moisture availability generates the urban heat island effect (UHI). The UHI, combined with human-induced warming, makes our densely populated cities particularly vulnerable to climate change. We examine the utility of solar photovoltaic (PV) system deployment on urban rooftops to reduce the UHI, and we price one potential value of this impact. The installation of PV systems over Sydney, Australia reduces summer maximum temperatures by up to 1 °C because the need to import energy is offset by local generation. This offset has a direct environmental benefit, cooling local maximum temperatures, but also a direct economic value in the energy generated. The indirect benefit associated with the temperature changes is between net AUD$230,000 and $3,380,000 depending on the intensity of PV systems deployment. Therefore, even very large PV installations will not offset global warming, but could generate enough energy to negate the need to import energy, and thereby reduce air temperatures. The energy produced, and the benefits of cooling beyond local PV installation sites, would reduce the vulnerability of urban populations and infrastructure to temperature extremes.
Pricing the urban cooling benefits of solar panel deployment in Sydney, Australia
Ma, S.; Goldstein, M.; Pitman, A. J.; Haghdadi, N.; MacGill, I.
2017-01-01
Cities import energy, which in combination with their typically high solar absorption and low moisture availability generates the urban heat island effect (UHI). The UHI, combined with human-induced warming, makes our densely populated cities particularly vulnerable to climate change. We examine the utility of solar photovoltaic (PV) system deployment on urban rooftops to reduce the UHI, and we price one potential value of this impact. The installation of PV systems over Sydney, Australia reduces summer maximum temperatures by up to 1 °C because the need to import energy is offset by local generation. This offset has a direct environmental benefit, cooling local maximum temperatures, but also a direct economic value in the energy generated. The indirect benefit associated with the temperature changes is between net AUD$230,000 and $3,380,000 depending on the intensity of PV systems deployment. Therefore, even very large PV installations will not offset global warming, but could generate enough energy to negate the need to import energy, and thereby reduce air temperatures. The energy produced, and the benefits of cooling beyond local PV installation sites, would reduce the vulnerability of urban populations and infrastructure to temperature extremes. PMID:28262843
The geology of the Falkland Islands
Aldiss, D.T.; Edwards, E.J.
1999-01-01
This report is complementary to the 1:250 000 scale geological map of the Falkland Islands compiled in 1998. The report and map are products of the Falkland Islands Geological Mapping Project (1996-1998). Geological observation and research in the Islands date from 1764. The Islands were visited during two pioneering scientific cruises in the 19th century. Subsequently, many scientists visited en route to the Antarctic or Patagonia. Geological affinities to other parts of the sout...
The Solomon Islands tsunami of 6 February 2013 field survey in the Santa Cruz Islands
Fritz, H. M.; Papantoniou, A.; Biukoto, L.; Albert, G.
2013-12-01
On February 6, 2013 at 01:12:27 UTC (local time: UTC+11), a magnitude Mw 8.0 earthquake occurred 70 km to the west of Ndendo Island (Santa Cruz Island) in the Solomon Islands. The under-thrusting earthquake near a 90° bend, where the Australian plate subducts beneath the Pacific plate generated a locally focused tsunami in the Coral Sea and the South Pacific Ocean. The tsunami claimed the lives of 10 people and injured 15, destroyed 588 houses and partially damaged 478 houses, affecting 4,509 people in 1,066 households corresponding to an estimated 37% of the population of Santa Cruz Island. A multi-disciplinary international tsunami survey team (ITST) was deployed within days of the event to document flow depths, runup heights, inundation distances, sediment and coral boulder depositions, land level changes, damage patterns at various scales, performance of the man-made infrastructure and impact on the natural environment. The 19 to 23 February 2013 ITST covered 30 locations on 4 Islands: Ndendo (Santa Cruz), Tomotu Noi (Lord Howe), Nea Tomotu (Trevanion, Malo) and Tinakula. The reconnaissance completely circling Ndendo and Tinakula logged 240 km by small boat and additionally covered 20 km of Ndendo's hard hit western coastline by vehicle. The collected survey data includes more than 80 tsunami runup and flow depth measurements. The tsunami impact peaked at Manoputi on Ndendo's densely populated west coast with maximum tsunami height exceeding 11 m and local flow depths above ground exceeding 7 m. A fast tide-like positive amplitude of 1 m was recorded at Lata wharf inside Graciosa Bay on Ndendo Island and misleadingly reported in the media as representative tsunami height. The stark contrast between the field observations on exposed coastlines and the Lata tide gauge recording highlights the importance of rapid tsunami reconnaissance surveys. Inundation distance and damage more than 500 m inland were recorded at Lata airport on Ndendo Island. Landslides were
Australia's Uranium and thorium resources and their global significance
International Nuclear Information System (INIS)
Lambert, I.B.; McKay, A.; Miezitis, Y.
2006-01-01
Full text: Full text: Australia's world-leading uranium endowment appears to result from the emplacement of uranium enriched felsic igneous rocks in three major periods during the geological evolution of the continent. Australia has over 27% of the world's total reasonably assured uranium resources (RAR) recoverable at < US$80/kgU (which approximates recent uranium spot prices). Olympic Dam is the largest known uranium deposit, containing approximately 19% of global RAR (and over 40% of global inferred resources) recoverable at < US$80/kg U; the uranium is present at low concentrations and the viability of its recovery is underpinned by co-production of copper and gold. Most of Australia's other identified resources are within Ranger, Jabiluka, Koongarra, Kintyre and Yeelirrie, the last four of which are not currently accessible for mining. In 2004, Australia's three operating uranium mines - Ranger, Olympic Dam, and Beverley -produced 22% of global production. Canada was the only country to produce more uranium (29%) and Kazakhstan (9%) ranked third. Considerably increased uranium production has been recently foreshadowed from Australia (through developing a large open pit at Olympic Dam), Canada (mainly through opening of the Cigar Lake mine), and Kazakhstan (developing several new in situ leach mines). These increases should go a long way towards satisfying demand from about 2010. Olympic Dam has sufficient resources to sustain such increased production over many decades. Thorium is expected to be used in some future generations of nuclear reactors. Australia also has major (but incompletely quantified) resources of this commodity, mainly in heavy mineral sands deposits and associated with alkaline igneous rocks. It is inevitable that the international community will be looking increasingly to Australia to sustain its vital role in providing fuels for future nuclear power generation, given its world-leading identified resources, considerable potential for new
Matsumura, Yuko; Miyoshi, Emako
2018-01-01
Japan, one of the most famous islander nations in the world, has promoted the development of its remote islands for over 60 years after the Second World War. The target islands and projects for fostering development have been steadily expanded. However, the country is facing serious socio-economic challenges such as aging and recession, resulting in less available funding for preferential treatment to remote islands. Thus, the framework for boosting island development should be reconsidered, ...
Achelia shepherdi n. sp. and other Pycnogonida from Australia
Stock, Jan H.
1973-01-01
Records of 10 species of shallow water Pycnogonida from Western Australia, Victoria, Tasmania, and New South Wales, including Achelia shepherdi n. sp., Parapallene avida Stock, 1973 (♀ new to science), and Anoplodactylus pulcher Carpenter, 1907 (new to Australia).
Directory of Open Access Journals (Sweden)
Michael J Dunn
Full Text Available We report long-term changes in population size of three species of sympatrically breeding pygoscelid penguins: Adélie (Pygoscelis adeliae, chinstrap (Pygoscelis antarctica and gentoo (Pygoscelis papua ellsworthii over a 38 year period at Signy Island, South Orkney Islands, based on annual counts from selected colonies and decadal all-island systematic counts of occupied nests. Comparing total numbers of breeding pairs over the whole island from 1978/79 to 2015/16 revealed varying fortunes: gentoo penguin pairs increased by 255%, (3.5% per annum, chinstrap penguins declined by 68% (-3.6% per annum and Adélie penguins declined by 42% (-1.5% per annum. The chinstrap population has declined steadily over the last four decades. In contrast, Adélie and gentoo penguins have experienced phases of population increase and decline. Annual surveys of selected chinstrap and Adélie colonies produced similar trends from those revealed by island-wide surveys, allowing total island population trends to be inferred relatively well. However, while the annual colony counts of chinstrap and Adélie penguins showed a trend consistent in direction with the results from all-island surveys, the magnitude of estimated population change was markedly different between colony wide and all island counts. Annual population patterns suggest that pair numbers in the study areas partly reflect immigration and emigration of nesting birds between different parts of the island. Breeding success for all three species remained broadly stable over time in the annually monitored colonies. Breeding success rates in gentoo and chinstrap penguins were strongly correlated, despite the differing trends in population size. This study shows the importance of effective, standardised monitoring to accurately determine long-term population trajectories. Our results indicate significant declines in the Adélie and chinstrap penguin populations at Signy Island over the last five decades, and a
CpG island mapping by epigenome prediction.
Directory of Open Access Journals (Sweden)
Christoph Bock
2007-06-01
Full Text Available CpG islands were originally identified by epigenetic and functional properties, namely, absence of DNA methylation and frequent promoter association. However, this concept was quickly replaced by simple DNA sequence criteria, which allowed for genome-wide annotation of CpG islands in the absence of large-scale epigenetic datasets. Although widely used, the current CpG island criteria incur significant disadvantages: (1 reliance on arbitrary threshold parameters that bear little biological justification, (2 failure to account for widespread heterogeneity among CpG islands, and (3 apparent lack of specificity when applied to the human genome. This study is driven by the idea that a quantitative score of "CpG island strength" that incorporates epigenetic and functional aspects can help resolve these issues. We construct an epigenome prediction pipeline that links the DNA sequence of CpG islands to their epigenetic states, including DNA methylation, histone modifications, and chromatin accessibility. By training support vector machines on epigenetic data for CpG islands on human Chromosomes 21 and 22, we identify informative DNA attributes that correlate with open versus compact chromatin structures. These DNA attributes are used to predict the epigenetic states of all CpG islands genome-wide. Combining predictions for multiple epigenetic features, we estimate the inherent CpG island strength for each CpG island in the human genome, i.e., its inherent tendency to exhibit an open and transcriptionally competent chromatin structure. We extensively validate our results on independent datasets, showing that the CpG island strength predictions are applicable and informative across different tissues and cell types, and we derive improved maps of predicted "bona fide" CpG islands. The mapping of CpG islands by epigenome prediction is conceptually superior to identifying CpG islands by widely used sequence criteria since it links CpG island detection to
CpG island mapping by epigenome prediction.
Bock, Christoph; Walter, Jörn; Paulsen, Martina; Lengauer, Thomas
2007-06-01
CpG islands were originally identified by epigenetic and functional properties, namely, absence of DNA methylation and frequent promoter association. However, this concept was quickly replaced by simple DNA sequence criteria, which allowed for genome-wide annotation of CpG islands in the absence of large-scale epigenetic datasets. Although widely used, the current CpG island criteria incur significant disadvantages: (1) reliance on arbitrary threshold parameters that bear little biological justification, (2) failure to account for widespread heterogeneity among CpG islands, and (3) apparent lack of specificity when applied to the human genome. This study is driven by the idea that a quantitative score of "CpG island strength" that incorporates epigenetic and functional aspects can help resolve these issues. We construct an epigenome prediction pipeline that links the DNA sequence of CpG islands to their epigenetic states, including DNA methylation, histone modifications, and chromatin accessibility. By training support vector machines on epigenetic data for CpG islands on human Chromosomes 21 and 22, we identify informative DNA attributes that correlate with open versus compact chromatin structures. These DNA attributes are used to predict the epigenetic states of all CpG islands genome-wide. Combining predictions for multiple epigenetic features, we estimate the inherent CpG island strength for each CpG island in the human genome, i.e., its inherent tendency to exhibit an open and transcriptionally competent chromatin structure. We extensively validate our results on independent datasets, showing that the CpG island strength predictions are applicable and informative across different tissues and cell types, and we derive improved maps of predicted "bona fide" CpG islands. The mapping of CpG islands by epigenome prediction is conceptually superior to identifying CpG islands by widely used sequence criteria since it links CpG island detection to their characteristic
CRED Gridded Bathymetry of Nihoa Island (100-025) in the Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-025b is a 60-m ASCII grid of depth data collected near Nihoa Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as part...
Equilibrium theory of island biogeography: A review
Angela D. Yu; Simon A. Lei
2001-01-01
The topography, climatic pattern, location, and origin of islands generate unique patterns of species distribution. The equilibrium theory of island biogeography creates a general framework in which the study of taxon distribution and broad island trends may be conducted. Critical components of the equilibrium theory include the species-area relationship, island-...
Acupuncture in Australia: regulation, education, practice, and research
Directory of Open Access Journals (Sweden)
Zhen Zheng
2014-09-01
Full Text Available Acupuncture was introduced to Australia as early as in the 1880s, and is a form of complementary and alternative medicine in this country. In the past 2 decades since the 1990s, acupuncture has experienced a rapid growth. Today, nearly 4000 acupuncturists are registered with the Chinese Medicine Board of Australia. “Acupuncturist,” “Oriental medicine practitioner,” and “Chinese medicine practitioners” are protected titles for registered acupuncturists. A bachelor's degree of 4 years in related fields is the minimal requirement for registration in Australia. Three public universities and three major private colleges offer nine undergraduate and three postgraduate programs that are approved by the Chinese Medicine Board of Australia. Those three universities also offer Master-degree and Doctor of Philosophy programs. Acupuncture is well accepted by the Australians, with 10% having received this treatment and 80% general medical practitioners referring their patients to acupuncture service. All private health insurance schemes provide rebates to patients receiving acupuncture treatment, and third-party payment is also available in six of eight Australian states and territories. Research output in acupuncture has increased greatly since 2000. A majority of research focuses on acupuncture and Tai Chi as treatment modalities, and mainly investigates their mechanism of action, associated pain, and gynecological and respiratory conditions. The future direction of acupuncture in Australia is to introduce this medicine in hospitals and gain access to the medical benefit scheme so that acupuncture can be accessed by a wider community, in particular those who come from a disadvantaged background. In conclusion, improved education, regulation, and research of acupuncture in Australia put this country in a leading position among Western countries with respect to acupuncture services.
DeWitt, Nancy T.; Stalk, Chelsea A.; Fredericks, Jake J.; Flocks, James G.; Kelso, Kyle W.; Farmer, Andrew S.; Tuten, Thomas M.; Buster, Noreen A.
2018-04-13
The U.S. Geological Survey (USGS) St. Petersburg Coastal and Marine Science Center, in cooperation with the U.S. Army Corps of Engineers, Mobile District, conducted bathymetric surveys of the nearshore waters surrounding Ship and Horn Islands, Gulf Islands National Seashore, Mississippi. The objective of this study was to establish base-level elevation conditions around West Ship, East Ship, and Horn Islands and their associated active littoral system prior to restoration activities. These activities include the closure of Camille Cut and the placement of sediment in the littoral zone of East Ship Island. These surveys can be compared with future surveys to monitor sediment migration patterns post-restoration and can also be measured against historic bathymetric datasets to further our understanding of island evolution.The USGS collected 667 line-kilometers (km) of single-beam bathymetry data and 844 line-km of interferometric swath bathymetry data in July 2016 under Field Activity Number 2016-347-FA. Data are provided in three datums: (1) the International Terrestrial Reference Frame of 2000 (ellipsoid height); (2) the North American Datum of 1983 (NAD83) CORS96 realization and the North American Vertical Datum of 1988 with respect to the GEOID12B model (orthometric height); and (3) NAD83 (CORS96) and Mean Lower Low Water (tidal datum). Data products, including x,y,zpoint datasets, trackline shapefiles, digital and handwritten Field Activity Collection Systems logs, 50-meter digital elevation model, and formal Federal Geographic Data Committee metadata, are available for download.
Nuclear regulation in Australia - future possibilities
International Nuclear Information System (INIS)
Carlson, J.; Bardsley, J.
1997-01-01
Australia's current nuclear regulatory arrangements reflect two major factors: that we are a federation, with a constitutional division of powers between the Commonwealth and the States, and that we have no nuclear industry, other than uranium mining. Australia's only nuclear facilities are operated by a Commonwealth instrumentality, ANSTO. Current Commonwealth regulatory arrangements are a response to international treaty commitments -principally the NPT (Treaty on the Non-Proliferation of Nuclear Weapons) -and to the commencement of commercial uranium mining and export in the late 1970's. Although at present no nuclear industry activities, other than mining, are in prospect, this might not always be the case, and with the establishment of ARPANSA (the Australian Radiation Protection and Nuclear Safety Agency) it is timely to give some thought to regulatory arrangements which might be appropriate to Australia's future circumstances. This paper will discuss the regulation activities relating to the nuclear fuel cycle , i e activities involved with the production and use of nuclear materials (uranium, thorium and plutonium) for the generation of energy through nuclear fission
A genomic history of Aboriginal Australia
Malaspinas, Anna-Sapfo; Westaway, Michael C.; Muller, Craig; Sousa, Vitor C.; Lao, Oscar; Alves, Isabel; Bergströ m, Anders; Athanasiadis, Georgios; Cheng, Jade Y.; Crawford, Jacob E.; Heupink, Tim H.; Macholdt, Enrico; Peischl, Stephan; Rasmussen, Simon; Schiffels, Stephan; Subramanian, Sankar; Wright, Joanne L.; Albrechtsen, Anders; Barbieri, Chiara; Dupanloup, Isabelle; Eriksson, Anders; Margaryan, Ashot; Moltke, Ida; Pugach, Irina; Korneliussen, Thorfinn S.; Levkivskyi, Ivan P.; Moreno-Mayar, J. Ví ctor; Ni, Shengyu; Racimo, Fernando; Sikora, Martin; Xue, Yali; Aghakhanian, Farhang A.; Brucato, Nicolas; Brunak, Sø ren; Campos, Paula F.; Clark, Warren; Ellingvå g, Sturla; Fourmile, Gudjugudju; Gerbault, Pascale; Injie, Darren; Koki, George; Leavesley, Matthew; Logan, Betty; Lynch, Aubrey; Matisoo-Smith, Elizabeth A.; McAllister, Peter J.; Mentzer, Alexander J.; Metspalu, Mait; Migliano, Andrea B.; Murgha, Les; Phipps, Maude E.; Pomat, William; Reynolds, Doc; Ricaut, Francois-Xavier; Siba, Peter; Thomas, Mark G.; Wales, Thomas; Wall, Colleen Ma’ run; Oppenheimer, Stephen J.; Tyler-Smith, Chris; Durbin, Richard; Dortch, Joe; Manica, Andrea; Schierup, Mikkel H.; Foley, Robert A.; Lahr, Marta Mirazó n; Bowern, Claire; Wall, Jeffrey D.; Mailund, Thomas; Stoneking, Mark; Nielsen, Rasmus; Sandhu, Manjinder S.; Excoffier, Laurent; Lambert, David M.; Willerslev, Eske
2016-01-01
The population history of Aboriginal Australians remains largely uncharacterized. Here we generate high-coverage genomes for 83 Aboriginal Australians (speakers of Pama-Nyungan languages) and 25 Papuans from the New Guinea Highlands. We find that Papuan and Aboriginal Australian ancestors diversified 25-40 thousand years ago (kya), suggesting pre-Holocene population structure in the ancient continent of Sahul (Australia, New Guinea and Tasmania). However, all of the studied Aboriginal Australians descend from a single founding population that differentiated ∼10-32 kya. We infer a population expansion in northeast Australia during the Holocene epoch (past 10,000 years) associated with limited gene flow from this region to the rest of Australia, consistent with the spread of the Pama-Nyungan languages. We estimate that Aboriginal Australians and Papuans diverged from Eurasians 51-72 kya, following a single out-of-Africa dispersal, and subsequently admixed with archaic populations. Finally, we report evidence of selection in Aboriginal Australians potentially associated with living in the desert. © 2016 Macmillan Publishers Limited, part of Springer Nature. All rights reserved
A genomic history of Aboriginal Australia
Malaspinas, Anna-Sapfo
2016-09-20
The population history of Aboriginal Australians remains largely uncharacterized. Here we generate high-coverage genomes for 83 Aboriginal Australians (speakers of Pama-Nyungan languages) and 25 Papuans from the New Guinea Highlands. We find that Papuan and Aboriginal Australian ancestors diversified 25-40 thousand years ago (kya), suggesting pre-Holocene population structure in the ancient continent of Sahul (Australia, New Guinea and Tasmania). However, all of the studied Aboriginal Australians descend from a single founding population that differentiated ∼10-32 kya. We infer a population expansion in northeast Australia during the Holocene epoch (past 10,000 years) associated with limited gene flow from this region to the rest of Australia, consistent with the spread of the Pama-Nyungan languages. We estimate that Aboriginal Australians and Papuans diverged from Eurasians 51-72 kya, following a single out-of-Africa dispersal, and subsequently admixed with archaic populations. Finally, we report evidence of selection in Aboriginal Australians potentially associated with living in the desert. © 2016 Macmillan Publishers Limited, part of Springer Nature. All rights reserved
Kuriiwa, Kaoru; Arihara, Hisashi; Chiba, Satoru; Kato, Shoichi; Senou, Hiroshi; Matsuura, Keiichi
2014-01-01
The Zunan Islands are located 360–650 km south of Tokyo, and consist of four uninhabited volcanoes: the Bayonnaise Rocks, the Smith Rocks, Torishima Island and the Sofugan Rock. Although all of the elements of the Zunan Islands are tiny islets and rocks, they form a series of stepping stones for shallow water fishes between the Izu Islands in the north and the Ogasawara (Bonin) Islands in the south. We report here the first comprehensive survey of marine fishes in the Zunan Islands. A total o...
Ecology and Evolution: Islands of Change.
Benz, Richard
This book was designed for middle and junior high school science classes and focuses on island biogeography, ecology, and evolution. Sections include: (1) "Galapagos: Frame of Reference"; (2) "Ecology and Islands"; and (3) "Evolution." Nineteen standards-based activities use the Galapagos Islands as a running theme…
Directory of Open Access Journals (Sweden)
Isabel Banos-González
2016-05-01
Full Text Available An integral dynamic model, in combination with other methods (indicators, policy and scenario analysis, is presented as a tool for sustainability assessment in island socio-ecological systems (SES. The Fuerteventura sustainability model (FSM, tested for the 1996-2011, allows a better understanding of the dynamic interactions between sustainability indicators and other factors of this island. The FSM was first applied to analyse the vulnerability of this island to climate change for the 2012-2025 period; results point to the need for urgent measures to mitigate its effects on some of the analysed indicators. A set of policy measures was then assessed from the behaviour of nine indicators and their sustainability thresholds. Finally, the FSM facilitated the development of a dynamic model of the island of El Hierro, extrapolating the features common to both SES. We propose this to be a useful tool for the quantitative sustainability assessment and the management of real island socio-ecological systems
The Idea of the Archipelago: Contemplating Island Relations
Directory of Open Access Journals (Sweden)
Elaine Stratford
2013-05-01
Full Text Available Creative, innovative, and timely research on islands and island futures is warranted and pressing, not least because island(ers are poorly served by established tropes of them as subordinate to continents or mainlands. Opportunities exist to provide a more thoroughgoing account of island life and island relations, and the seven papers in this special issue address that task. In works that consider islands in the Timor Sea, the Caribbean, the Pacific, Atlantic and Southern Oceans, and that span several different disciplinary frames—archival-historical, critical theoretical, literary, cultural, geopolitical, sociological and artistic—these papers evidence both the diversity of approach to thinking with the archipelago, and numerous points in common. Among the latter is an understanding that island relations are built on connection, assemblage, mobility, and multiplicity, and a commitment to critically examine the ways in which these entanglements affect and give effect to island life. The models of island relationality brought to light by this collective focus on the archipelago reveal new and diverse connections of island peoples with their physical and cultural environments, and with the world beyond; create spaces for growing resilience, association and engagement; and invite further study.
seal Arctocephaius tropicaiis at Gough Island
African Journals Online (AJOL)
Population increase in the Amsterdam Island fur seal Arctocephaius tropicaiis at Gough Island. M.N. Bester. Mammal Research Institute, University of Pretoria, Pretoria. Population size of Arctocephalus tropicalis on Gough Island was determined by direct censuses of parts of the coast duro ing the summers of 1974 - 1976 ...
Simple method for calculating island widths
International Nuclear Information System (INIS)
Cary, J.R.; Hanson, J.D.; Carreras, B.A.; Lynch, V.E.
1989-01-01
A simple method for calculating magnetic island widths has been developed. This method uses only information obtained from integrating along the closed field line at the island center. Thus, this method is computationally less intensive than the usual method of producing surfaces of section of sufficient detail to locate and resolve the island separatrix. This method has been implemented numerically and used to analyze the buss work islands of ATF. In this case the method proves to be accurate to at least within 30%. 7 refs
Williams, S. Jeffress; Foley, Mary K.
2007-01-01
The U.S Army Corps of Engineers, New York District is developing engineering plans, including economic costs and benefits, for storm damage reduction along an 83 mile stretch of the coastal barrier islands and beaches on the south shore of Long Island, NY from Fire Island Inlet east to the Montauk Point headland. The plan, expected to include various alternatives for storm protection and erosion mitigation, is referred to as the Fire Island to Montauk Point Reformulation Plan (FIMP). These plans are expected to follow the Corps of Engineers’ Environmental Operating Principles striving for long term environmental sustainability and balance between environmental protection and protection of human health and property. Fire Island National Seashore (FIIS), a 19,579 acre unit of the National Park System includes a 32 mile long coastal barrier island located within the FIMP project area. A seven-mile section of the park, Otis Pike Fire Island High Dune Wilderness Area, is also a designated Federal Wilderness Area. The FIIS includes not only the barrier island and sand dunes, but also several islands, sand flats and wetlands landward of the barrier, submerged parts of Great South Bay shoreface, extending approximately 4,000 feet into the bay with the inner shelf region extending approximately 1,000 feet seaward of the Fire Island shoreline. The Fire Island barrier islands, a sand-starved system dominated by highly dynamic processes, are struggling to maintain their integrity in the face of sea-level rise and storms. Adding to the dilemma is that development on the barriers and the mainland has increased greatly during the past 50 years. As such, managers and decision makers in federal agencies, state agencies and local governments are challenged to balance tradeoffs between protection of lives and property, public access and long term conservation of natural habitats and processes and the plants and animals that depend on these habitats. National Park Service (NPS
Mosquito Surveys Carried out On Green Island, Orchid Island, and Penghu Island, Taiwan, in 2003
Directory of Open Access Journals (Sweden)
Hwa-Jen Teng
2005-02-01
Full Text Available Field surveys of mosquitoes were carried out on Green, Orchid, and Penghu Islands in 2003 to ascertain the status of mosquito vectors. Eighteen species of mosquitoes were collected, including three species of Anopheles, four species of Aedes, eight species of Culex, two species of Armigeres, and one species of Malaya. Seventeen previously recorded species were not collected in this study but 11 species collected had not previously been recorded. Ten newly recorded species, An. maculatus, An. takasagoensis, Ae. alcasidi, Ae. lineatopennis, Ae. vexans vexans, Ar. omissus, Cx. vishnui, Cx. halifaxii, Cx. hayashii, and Cx. neomimulus, were collected on Green Island and one previously unrecorded species, Ar. subalbatus, was collected on Orchid Island. Potential vectors An. maculatus and An. sinensis, malaria vectors in Korea and Mainland China, Ae. albopictus, a vector of dengue in Taiwan and West Nile virus in the USA, Cx. vishnui and Cx. tritaeniorhynchus, Japanese encephalitis vectors in Taiwan, Ae. vexans vexans, an eastern equine encephalitis vector in the USA, and Cx. quinquefasciatus, a vector of filariasis in Taiwan and West Nile virus in the USA, were among the mosquito species collected.
Mathematical Sciences in Australia
Thomas, Jan; Muchatuta, Michelle; Wood, Leigh
2009-01-01
This article investigates enrolment trends in mathematical sciences in Australian universities. Data has been difficult to extract and the coding for mathematical disciplines has made investigation challenging. We show that the number of mathematics major undergraduates in Australia is steadily declining though the number studying…
Setoguchi, H; Watanabe, I
2000-06-01
Hybridization and introgression play important roles in plant evolution, and their occurrence on the oceanic islands provides good examples of plant speciation and diversification. Restriction fragment length polymorphisms (RFLPs) and trnL (UAA) 3'exon-trnF (GAA) intergenic spacer (IGS) sequences of chloroplast DNA (cpDNA), and the sequences of internal transcribed spacer (ITS) of nuclear ribosomal DNA were examined to investigate the occurrence of gene transfer in Ilex species on the Bonin Islands and the Ryukyu Islands in Japan. A gene phylogeny for the plastid genome is in agreement with the morphologically based taxonomy, whereas the nuclear genome phylogeny clusters putatively unrelated endemics both on the Bonin and the Ryukyu Islands. Intersectional hybridization and nuclear gene flow were independently observed in insular endemics of Ilex on both sets of islands without evidence of plastid introgression. Gene flow observed in these island systems can be explained by ecological features of insular endemics, i.e., limits of distribution range or sympatric distribution in a small land area.
Seed islands driven by turbulence and NTM dynamics
Muraglia, M.; Agullo, O.; Poye, A.; Benkadda, S.; Horton, W.; Dubuit, N.; Garbet, X.; Sen, A.
2014-10-01
Magnetic reconnection is an issue for tokamak plasmas. Growing magnetic islands expel energetic particles from the plasma core leading to high energy fluxes in the SOL and may cause damage to the plasma facing components. The islands grow from seeds from the bootstrap current effects that oppose the negative delta-prime producing nonlinear island growth. Experimentally, the onset of NTM is quantified in terms of the beta parameter and the sawtooth period. Indeed, in experiments, (3;2) NTM magnetic islands are often triggered by sawtooth precursors. However (2;1) magnetic islands can appear without noticeable MHD event and the seed islands origin for the NTM growth is still an open question. Macroscale MHD instabilities (magnetic islands) coexist with micro-scale turbulent fluctuations and zonal flows which impact island dynamics. Nonlinear simulations show that the nonlinear beating of the fastest growing small-scale ballooning interchange modes on a low order rational surface drive a magnetic islands located on the same surface. The island size is found to be controlled by the turbulence level and modifies the NTM threshold and dynamics.
Introduced mammals on Western Indian Ocean islands
Directory of Open Access Journals (Sweden)
James C. Russell
2016-04-01
Full Text Available The diversity of introduced mammals and their introduction history varies greatly across the Western Indian Ocean (WIO islands, from ancient introductions in the past millennia on islands off the East coast of Africa where extant terrestrial native mammal communities exist, to very recent invasions in the past decades on islands in the Mascarene archipelago. We compile the distribution of 16 introduced mammal taxa on 28 island groups comprising almost 2000 islands. Through an exhaustive literature review and expert consultation process we recorded all mammal eradications, and species recoveries which could be attributed to introduced mammal eradication or control. All island groups have been invaded by mammals, and invasive cats and rats in particular are ubiquitous, but cultural contingency has also led to regional invasions by other mammals such as lemurs, civets and tenrecs. Mammal eradications have been attempted on 45 islands in the WIO, the majority in the Seychelles and Mauritius, and where successful have resulted in spectacular recovery of species and ecosystems. Invasive mammalian predator eradication or control in association with habitat management has led to improved conservation prospects for at least 24 species, and IUCN red-list down-listing of eight species, in the Mascarene Islands. Future island conservation prioritisation in the region will need to take account of global climate change and predicted sea-level rises and coastal inundation. Greater investment and prioritisation in island conservation in the region is warranted, given its high biodiversity values and the extent of invasions.
Reengineering in Australia: factors affecting success
Directory of Open Access Journals (Sweden)
Felicity Murphy
1998-11-01
Full Text Available Business process reengineering (BPR is being used in many organisations worldwide to realign operations. Most of the research undertaken has been focused on North American or European practices. The study reported here replicates a US reengineering study in an Australian context by surveying large public and private sector Australian organisations. The study makes three main contributions by: (1 presenting a picture of BPR practices in Australia, (2 clarifying factors critical to the success of reengineering projects in Australia, and (3 providing a comparison of factors leading to success in Australian BPR projects with those found in the US.
International Nuclear Information System (INIS)
Jemain, A.
2005-01-01
Australia is re-launching its ambitions in liquefied natural gas (LNG) with the Greater Gorgon project of offshore exploitation of the natural gas reserves of the continental shelf of NW Australia. These reserves would represent 200 million tons of LNG which will be exported towards China and USA. The project will cost 11 billion dollars and will yield 2 billion dollars per year. It is managed by a consortium which groups together Chevron Corp. (50%), Shell (25%) and ExxonMobil (25%). Technip company is partner of the project. The China National Offshore Oil Corp (CNOOC) has announced its intention to become also partner of the project, and maybe Japan, South Korea and Taiwan will wish too. Short paper. (J.S.)
International Nuclear Information System (INIS)
Des Brisay, C.
2005-01-01
Terasen Gas is pursuing alternatives for the supply of additional natural gas capacity to Vancouver Island. Its subsidiary, Terasen Gas (Vancouver Island) Inc. (TGVI), is responding to the need for delivery of increased gas supply and, is supporting plans for new gas-fired power generation on Vancouver Island. TGVI's proposal for new natural gas capacity involves a combination of compression and pipeline loops as well as the addition of a storage facility for liquefied natural gas (LNG) at Mt. Hayes to help manage price volatility. This presentation outlined the objectives and components of the resource planning process, including demand forecast scenarios and the preferred infrastructure options. tabs., figs
Uranium mining in Australia: dreams--and reality
International Nuclear Information System (INIS)
Anon.
1977-01-01
By the early 1980's if the current mining projects described are allowed to go on stream, Australia will be able to produce at least 10 900 tons of U$sub 3$O$sub 8$ annually from ores whose grade ranges from a low of 0.150% to a high of 2.300%. The Jabiluka Project of uranium mining is described, and plans for other mines are discussed in Queensland, South and Western Australia. 2 refs
Prospects for the uranium industry in Australia
International Nuclear Information System (INIS)
1976-02-01
The report covers the basic issues of the coming uranium era discussing the world supply and demand situation, the trend in uranium prices and the continuing move to nuclear power as the world's primary source of electrical energy. In Australia, unknowns such as future contract prices and quantities, production start dates, royalties and the outcome of the environmental inquiry create the speculative image of the uranium stocks. The first section of the report discusses the technical aspects of the nuclear industry but is necessarily brief because the real story is the world trend to nuclear power for economic and political reasons and the old story of supply and demand (discussed in section two). Within Australia some companies are better placed than others to benefit from the uranium era. Section three looks at prices and section four reviews the individual companies involved in the uranium industry in Australia. (author)
Prospects for the uranium industry in Australia
Energy Technology Data Exchange (ETDEWEB)
1976-02-01
The report covers the basic issues of the coming uranium era discussing the world supply and demand situation, the trend in uranium prices and the continuing move to nuclear power as the world's primary source of electrical energy. In Australia, unknowns such as future contract prices and quantities, production start dates, royalties and the outcome of the environmental inquiry create the speculative image of the uranium stocks. The first section of the report discusses the technical aspects of the nuclear industry but is necessarily brief because the real story is the world trend to nuclear power for economic and political reasons and the old story of supply and demand (discussed in section two). Within Australia some companies are better placed than others to benefit from the uranium era. Section three looks at prices and section four reviews the individual companies involved in the uranium industry in Australia.
Sexual and reproductive health and philanthropic funding in Australia.
Gill-Atkinson, Liz; Vaughan, Cathy; Williams, Hennie
2014-09-01
Background Australia's philanthropic sector is growing and could support efforts to improve sexual and reproductive health (SRH). However, philanthropy is often misunderstood in Australia and there is limited evidence of philanthropic support for SRH initiatives. We aimed to understand the barriers and facilitators to philanthropic funding of SRH initiatives in Australia. A qualitative approach was used and involved 13 in-depth interviews with professionals from the philanthropic sector, and from organisations and services involved in SRH. Barriers to organisations in seeking philanthropic funding for SRH activities included insufficient resources for writing grant applications and the small financial value of philanthropic grants. Facilitators to seeking philanthropic funding for SRH included a perception that government funding is shrinking and that philanthropic research grants are less competitive than government grants. Philanthropic participants identified that barriers to funding SRH include the sensitive nature of SRH and the perceived conservative nature of philanthropy. Facilitators identified by these participants in supporting SRH initiatives included networking and relationships between grant-makers and grant-seekers. All participants agreed that philanthropy does and could have a role in funding SRH in Australia. The findings of this research suggest that barriers to philanthropic funding for SRH in Australia exist for organisations attempting to access philanthropic funding. Philanthropic organisations could provide more financial support to Australian SRH service providers, as happens in countries such as the United States and United Kingdom. Addressing these barriers and promoting the facilitators could lead to increased awareness of SRH by Australia's philanthropic sector.
International Nuclear Information System (INIS)
Kamaruzzaman Sopian
2000-01-01
Wind data collected at three east coast islands of Peninsular Malaysia namely Tioman, Redang and Perhentian Island were analyzed for the wind energy potential. The results were presented as Weibull distribution and preliminary analysis indicate that the site at Redang Island have the greatest potential with a mean power density of 85.1 w/m 2 at 10 meters above sea level. (Author)
Carroll, A.; McNamara, D.; Schupp, C.
2009-12-01
Assateague Island National Seashore comprises a long barrier island located off the coasts of Maryland and Virginia. Geological evidence suggests that over recent centuries Assateague Island has steadily transgressed up the continental shelf in response to rising sea level. More recently, the natural barrier island dynamics governing Assateague’s evolution have been altered by human activity in three ways: the construction of a jetty and the subsequent interruption of alongshore sediment transport on the north end of Assateague and both the ongoing and abandoned maintenance of a continuous dune system along portions of Assateague with the concomitant modification to overwash dynamics. It is unclear how these varied human alterations to the natural barrier island dynamics will influence the response of Assateague to climate change induced shifts in forcing such as increased rates of sea level rise and changing storm patterns. We use LIDAR detected morphological data of Assateague Island as initial conditions in an alongshore extended model for barrier island dynamics including beach erosion, island overwash and inlet cutting during storms, and beach accretion, tidal delta growth and dune and vegetation growth between storms to explore the response of the various human altered segments of Assateague Island to forcing changes. Traditional models exploring barrier island evolution contain only cross-shore dynamics therefore lacking important alongshore-spatial dynamics in aeolian and surf zone sediment transport. Results show that including alongshore dynamics alter the steady state of Assateague relative to simulations that only include cross-shore dynamics. Results will also be presented exploring the potential for regime shifts in steady state behavior under various scenarios for the rate of sea level rise and storm climate and varying management strategies.
Volcanism, Iron, and Phytoplankton in the Heard and McDonald Islands Region, Southern Indian Ocean
Coffin, M. F.; Arculus, R. J.; Bowie, A. R.; Chase, Z.; Robertson, R.; Trull, T. W.; Heobi in2016 v01 Shipboard Party, T.
2016-12-01
Phytoplankton supply approximately half of the oxygen in Earth's atmosphere, and iron supply limits the growth of phytoplankton in the anemic Southern Ocean. Situated entirely within the Indian Ocean sector of the Southern Ocean are Australia's only active subaerial volcanoes, Heard and McDonald islands (HIMI) on the central Kerguelen Plateau, a large igneous province. Widespread fields of submarine volcanoes, some of which may be active, extend for distances of up to several hundred kilometers from the islands. The predominantly eastward-flowing Antarctic Circumpolar Current sweeps across the central Kerguelen Plateau, and extensive blooms of phytoplankton are observed on the Plateau down-current of HIMI. The goal of RV Investigator voyage IN2016_V01, conducted in January/February 2016, is to test the hypothesis that hydrothermal fluids, which cool active submarine volcanoes in the HIMI region, ascend from the seafloor and fertilise surface waters with iron, thereby enhancing biological productivity beginning with phytoplankton. Significant initial shipboard results include: Documentation, for the first time, of the role of active HIMI and nearby submarine volcanoes in supplying iron to the Southern Ocean. Nearshore waters had elevated dissolved iron levels. Although biomass was not correspondingly elevated, fluorescence induction data indicated highly productive resident phytoplankton. Discovery of >200 acoustic plumes emanating from the seafloor and ascending up to tens of meters into the water column near HIMI. Deep tow camera footage shows bubbles rising from the seafloor in an acoustic plume field north of Heard Island. Mapping 1,000 km2 of uncharted seafloor around HIMI. Submarine volcanic edifices punctuate the adjacent seafloor, and yielded iron-rich rocks similar to those found on HIMI, respectively. Acoustic plumes emanating from some of these features suggest active seafloor hydrothermal systems.
Terrestrial radiation measurements in Marshall Islands
International Nuclear Information System (INIS)
Gudiksen, P.H.
1978-01-01
With the prospect of habitation in the near future, radiological surveys were undertaken of Enewetak and Bikini Atolls to provide a basis for determining whether or not the atolls can be safely reinhabited. The surveys included all of the forty islands within Enewetak Atoll, but only the two principal islands, Bikini and Eneu Islands, of Bikini Atoll. These atolls were former U.S. nuclear weapons test sites in the Pacific. Integral parts of the surveys were the measurements of the distributions of radioactivity in the soil and the resulting gamma ray exposure rates for external dose estimation. Numerous soil samples were collected from both atolls for analysis by Ge (Li) gamma spectrometry and by wet chemistry techniques. At Enewetak Atoll the gamma exposure rates were measured by TLDs and a helicopter-borne array of Nal detectors, while at Bikini Atoll portable Nal detectors, pressurized ion-chambers, and TLDs were utilized. The predominant species measured in the soil samples collected from both atolls were 90 Sr, 239,240 Pu, 137 Cs and 60 Co with the latter two nuclides being the primary contributors to the gamma-ray exposure rates. The geographical distribution of the exposure rates measured on both atolls, was highly variable ranging from less than 1 μR/h on islands that had not been impacted radiologically by the testing program, to over 100 μR/h near weapon detonation sites. Thus, within Enewetak Atoll, the highest soil activities and gamma-ray exposure rates were measured on the northern islands, where the weapons testing had been most intense. Bikini Island exhibited contamination levels that were considerably higher than those on Eneu Island. Generally, the highest activity levels were observed within the island interiors or in proximity to ground zero sites, and could usually be related to the surrounding vegetation density. The island of Yvonne, within Enewetak Atoll, is the most severely contaminated land area. Particles containing as much as several
The oldest brachiopods from the lower cambrian of South Australia
DEFF Research Database (Denmark)
Topper, Timothy Paul; Holmer, Lars E.; Skovsted, Christian B.
2013-01-01
The morphology and organophosphatic shell structure of the paterinate brachiopod Askepasma is documented using new and previously collected specimens from the lower Cambrian of South Australia. Lack of adequately preserved material has seen the majority of paterinate specimens previously reported...... from South Australia referred to the genus Askepasma and treated under open nomenclature. Large collections of paterinates from the lower Cambrian Wilkawillina, Ajax, and Wirrapowie limestones in the Arrowie Basin, South Australia have prompted redescription of the type species Askepasma toddense...... and the erection of a new species, Askepasma saproconcha sp. nov. Askepasma saproconcha sp. nov. currently represents the oldest known brachiopod from the lower Cambrian successions in South Australia with a FAD in pre-trilobitic (Terreneuvian, Cambrian Stage 2, lower Atdabanian) strata in the basal part...
Globally threatened vertebrates on islands with invasive species.
Spatz, Dena R; Zilliacus, Kelly M; Holmes, Nick D; Butchart, Stuart H M; Genovesi, Piero; Ceballos, Gerardo; Tershy, Bernie R; Croll, Donald A
2017-10-01
Global biodiversity loss is disproportionately rapid on islands, where invasive species are a major driver of extinctions. To inform conservation planning aimed at preventing extinctions, we identify the distribution and biogeographic patterns of highly threatened terrestrial vertebrates (classified by the International Union for Conservation of Nature) and invasive vertebrates on ~465,000 islands worldwide by conducting a comprehensive literature review and interviews with more than 500 experts. We found that 1189 highly threatened vertebrate species (319 amphibians, 282 reptiles, 296 birds, and 292 mammals) breed on 1288 islands. These taxa represent only 5% of Earth's terrestrial vertebrates and 41% of all highly threatened terrestrial vertebrates, which occur in vertebrates was available for 1030 islands (80% of islands with highly threatened vertebrates). Invasive vertebrates were absent from 24% of these islands, where biosecurity to prevent invasions is a critical management tool. On the 76% of islands where invasive vertebrates were present, management could benefit 39% of Earth's highly threatened vertebrates. Invasive mammals occurred in 97% of these islands, with Rattus sp. as the most common invasive vertebrate (78%; 609 islands). Our results provide an important baseline for identifying islands for invasive species eradication and other island conservation actions that reduce biodiversity loss.
North Aegean island landscapes as ecomuseums: the case of Lesvos Island
Directory of Open Access Journals (Sweden)
Evangelos Pavlis
2017-05-01
Full Text Available The main advantage of the Aegean islands, in generating national, regional, or international competitiveness, compared to the areas on the continental mainland, is their natural and cultural assets, their cultural landscapes. Consequently, the organized utilization of cultural heritage, rich biodiversity, and the unique Aegean landscape, could make the islands attractive as places to live or work and help them fulfill their sustainability goals. Ecomuseums are ‘in situ’ museums, aimed at local communities and managed by them, aiming at the interpretation, protection, utilization, and promotion of natural and cultural assets of a place, and at the economic revival of marginal regions through the combinational development of small-scale tourism, local manufacturing, and primary production sectors. They could function as laboratories of sustainable development. The island of Lesvos has been selected as a case study for such a potential ecomuseum.
Directory of Open Access Journals (Sweden)
Raoni Rebouças
Full Text Available Island Rule postulated that individuals on islands tend to dwarfism when individuals from mainland populations are large and to gigantism when mainland populations present small individuals. There has been much discussion about this rule, but only few studies were carried out aiming to reveal this pattern for anurans. Our study focused on measuring the size of individuals on islands and to find a possible pattern of size modification for insular anurans. Individuals were collected on continental islands, measured and compared to mainland populations. We selected four species with different natural history aspects during these analyses. Island parameters were compared to size of individuals in order to find an explanation to size modification. Three of the four species presented size shifting on islands. Ololygon trapicheiroi and Adenomera marmorata showed dwarfism, Boana albomarginata showed gigantism and in Thoropa miliaris there was no evident size modification. Allometric analysis also revealed differential modification, which might be a result of different selective pressures on islands in respect of mainland populations. Regression model explained most of the size modification in B. albomarginata, but not for the other species. Our results indicate that previous assumptions, usually proposed for mammals from older islands, do not fit to the anurans studied here. We support the assumption that size modification on islands are population-specific. Hence, in B. albomarginata some factor associated to competition, living area and isolation time might likely be responsible for gigantism on islands.
Harmonising and Matching IPR Holders at IP Australia
T’Mir D. Julius; Gaétan de Rassenfosse
2014-01-01
This document describes the methodology developed by the Melbourne Institute to: (i) harmonise holders of intellectual property rights (IPRs) at IP Australia (applications for patent, designs, trademarks and plant breeder’s rights); (ii) match Australian IPRs holders to the Australian business register; (iii) identify the ultimate owners within Australia; and (iv) identify which holders are small and medium size enterprises.
Ford, M.; Becker, J. M.; Merrifield, M. A.
2012-12-01
Atoll islands are highly vulnerable to a range of inundation hazards. The impacts of such hazards are expected to be magnified as a result of continued sea-level rise. Both recent and historic inundation events provide unique insights into the requisite conditions necessary to initiate island inundation. A number of recent and historic inundation events are presented in order to examine the oceanographic and meteorological conditions driving inundation of a densely populated, urbanized atoll in the central Pacific. Analysis of inundation events suggests that a number of key drivers contribute to the spatial and temporal extent of island inundation, with unique degrees of predictability and resultant impact signatures apparent on island geomorphology and local anthropogenic activities. Results indicate three distinct drivers of inundation hazards exist. Firstly, tropical storms and typhoons elevate sea level through inverse barometric setup, wind setup and a range of wave driven processes and have caused considerable impact on atolls within the Marshall Islands. Secondly, super-elevated sea level conditions resulting from the combination of seasonal high tides and quasi-cyclical La Nina conditions drive inundation of low-lying lagoon facing coastal areas. Thirdly, long period swell conditions, typically generated by distant storms, can elevate reef-flat water levels through wave setup and infragravity wave oscillations. Such wave conditions can over wash the ocean-facing island ridge, often inundating large sections of the island. Reef-flat wave conditions are tidally modulated, with inundation events typically occurring around high tide. However, the two most recent destructive swell-driven inundation events have occurred while tide levels were significantly lower than spring tide levels, suggesting high water levels are not a necessary prerequisite for wave-driven inundation. The different modes of inundation are discussed and grounded within recent and historic
Chronic Liver Disease and Asian Americans/Pacific Islanders
... Cancer Asian/Pacific Islander Women Non-Hispanic White Women Asian/Pacific Islander/ Non-Hispanic White Ratio All Sites ... Cancer Asian/Pacific Islander Women Non-Hispanic White Women Asian/Pacific Islander/ Non-Hispanic White Ratio Liver & IBD* ...
Internet advertising of artificial tanning in Australia.
Team, Victoria; Markovic, Milica
2006-08-01
Artificial tanning, defined as deliberate exposure to ultraviolet rays produced by artificial tanning devices, is a new and emerging public health issue in Australia and globally. Epidemiological research suggests that artificial tanning may contribute to the incidence of melanoma, nonmelanoma skin cancer as well as other health problems. Given that Australia has a high incidence of skin cancer, we have undertaken a study to explore how artificial tanning has been promoted to its users. The aim was to analyze the completeness and accuracy of information about artificial tanning. A content analysis of web sites of tanning salons and distributors of tanning equipment in Australia was conducted. A total of 22 web sites were analyzed. None of the solarium operators or distributors of equipment provided full information about the risks of artificial tanning. Fifty-nine percent of web advertisements had no information and 41% provided only partial information regarding the risks of artificial tanning. Pictures with the image of bronze-tanned bodies, predominantly women, were used by all web advertisers. In light of the success of sun-safety campaigns in Australia, the findings of future epidemiological research on the prevalence of artificial tanning and sociological and anthropological research on why people utilize artificial tanning should be a basis for developing effective targeted health promotion on the elimination of artificial tanning in the country.
Ireland, Lynette; McKelvie, Helen
2003-01-01
The legal structure for the regulation of tissue banking has existed for many years. In Australia, the donation of human tissue is regulated by legislation in each of the eight States and Territories. These substantially uniform Acts were passed in the late 1970's and early 1980's, based on model legislation and underpinned by the concept of consensual giving. However, it was not until the early 1990's that tissue banking came under the notice of regulatory authorities. Since then the Australian Government has moved quickly to oversee the tissue banking sector in Australia. Banked human tissue has been deemed to be a therapeutic good under the Therapeutic Goods Act 1989, and tissue banks are required to be licensed by the Therapeutic Goods Administration and are audited for compliance with the Code of Good Manufacturing Practice- Human Blood and Tissues. In addition, tissue banks must comply with a myriad of other standards, guidelines and recommendations.
Pleistocene Paleoart of Australia
Directory of Open Access Journals (Sweden)
Robert G. Bednarik
2014-02-01
Full Text Available Pleistocene rock art is abundant in Australia, but has so far received only limited attention. Instead there has been a trend, begun over a century ago, to search for presumed depictions of extinct megafauna and the tracks of such species. All these notions have been discredited, however, and the current evidence suggests that figurative depiction was introduced only during the Holocene, never reaching Tasmania. Nevertheless, some Australian rock art has been attributed to the Pleistocene by direct dating methods, and its nature implies that a significant portion of the surviving corpus of rock art may also be of such age. In particular much of Australian cave art is of the Ice Age, or appears to be so, and any heavily weathered or patinated petroglyphs on particularly hard rocks are good candidates for Pleistocene antiquity. On the other hand, there is very limited evidence of mobiliary paleoart of such age in Australia.
Solid waste management on small islands. The case of Green Island, Taiwan
Energy Technology Data Exchange (ETDEWEB)
Chen, M.C.; Ruijs, A.; Wesseler, J. [Environmental Economics and Natural Resources Group, Wageningen University, P.O. Box 8130, 6700 EW Wageningen (Netherlands)
2005-09-01
Municipalities of small islands have limited capacities for waste disposal. In the case of Green Island, Taiwan, continuing with business as usual would only allow the disposal of waste on the island for another 8 years. Three alternatives for solid waste management (SWM) are compared. The cost-effective solution is the one, which is the most expensive in the short run: continuing business as usual and introducing an incineration plant in the year 2010. The results indicate furthermore that deviations from optimal timing of investment only slightly change average annual costs. In the long run, the municipality can hardly avoid transporting waste to the mainland. By investing in an incineration plant, they can buy additional time to investigate alternative SWM strategies.
Lai, Foon Yin; Bruno, Raimondo; Hall, Wayne; Gartner, Coral; Ort, Christoph; Kirkbride, Paul; Prichard, Jeremy; Thai, Phong K; Carter, Steve; Mueller, Jochen F
2013-03-01
To examine changes in illicit drug consumption between peak holiday season (23 December-3 January) in Australia and a control period two months later in a coastal urban area, an inland semi-rural area and an island populated predominantly by vacationers during holidays. Analysis of representative daily composite wastewater samples collected from the inlet of the major wastewater treatment plant in each area. Three wastewater treatment plants. Wastewater treatment plants serviced approximately 350, 000 persons in the urban area, 120,000 in the semi-rural area and 1100-2400 on the island. Drug residues were analysed using liquid chromatography coupled to a tandem mass spectrometer. Per capita drug consumption was estimated. Changes in drug use were quantified using Hedges' g. During the holidays, cannabis consumption in the semi-rural area declined (g = -2.8) as did methamphetamine (-0.8), whereas cocaine (+1.5) and ecstasy (+1.6) use increased. In the urban area, consumption of all drugs increased during holidays (cannabis +1.6, cocaine +1.2, ecstasy +0.8 and methamphetamine +0.3). In the vacation area, methamphetamine (+0.7), ecstasy (+0.7) and cocaine (+1.1) use increased, but cannabis (-0.5) use decreased during holiday periods. While the peak holiday season in Australia is perceived as a period of increased drug use, this is not uniform across all drugs and areas. Substantial declines in drug use in the semi-rural area contrasted with substantial increases in urban and vacation areas. Per capita drug consumption in the vacation area was equivalent to that in the urban area, implying that these locations merit particular attention for drug use monitoring and harm minimisation measures. © 2012 The Authors, Addiction © 2012 Society for the Study of Addiction.
Unequal Bargaining? Australia's Aviation Trade Relations with the United States
Solomon, Russell
2001-01-01
International aviation trade bargaining is distinguished by its use of a formal process of bilateral bargaining based on the reciprocal exchange of rights by states. Australia-United States aviation trade relations are currently without rancour, but this has not always been the case and in the late 1980s and early 1990s, their formal bilateral aviation negotiations were a forum for a bitter conflict between two competing international aviation policies. In seeking to explain the bilateral aviation outcomes between Australia and the United States and how Australia has sought to improve upon these, analytical frameworks derived from international political economy were considered, along with the bilateral bargaining process itself. The paper adopts a modified neorealist model and concludes that to understand how Australia has sought to improve upon these aviation outcomes, neorealist assumptions that relative power capabilities determine outcomes must be qualified by reference to the formal bilateral bargaining process. In particular, Australia's use of this process and its application of certain bargaining tactics within that process remain critical to understanding bilateral outcomes.
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-002b is a 60-m ASCII grid of depth data collected near Lisianski Island and Pioneer Bank in the Northwestern Hawaiian Islands as of May 2003. This grid has...
Revisiting the Metaphor of the Island: Challenging "World Culture" from an Island Misunderstood
Rappleye, Jeremy
2015-01-01
This article revisits the newly "discovered" island that world culture theorists have repeatedly utilised to explain their theoretical stance, conceptual preferences and methodological approach. Yet, it seeks to (re)connect world culture with the real world by replacing their imagined atoll with a real one--the island-nation of Japan. In…
Fisher, Robert N; Niukula, Jone; Watling, Dick; Harlow, Peter S
2017-06-06
The south Pacific iguanas (Brachylophus) currently have three recognized living species in Fiji. Recent surveys have uncovered more specific variation (morphological and genetic) within the genus and have better defined the geographic ranges of the named species. One of these recent discoveries is a strikingly different iguana from all other island populations in Fiji which is restricted to Gau Island of the Lomaiviti Province. Gau is the fifth largest island in Fiji and maintains excellent upland forests in the higher elevations. We describe this population from Gau Island as a new species, Brachylophus gau sp. nov., in recognition of its type locality.
Fisher, Robert N.; Niukula, Jone; Watling, Dick; Harlow, Peter S.
2017-01-01
The south Pacific iguanas (Brachylophus) currently have three recognized living species in Fiji. Recent surveys have uncovered more specific variation (morphological and genetic) within the genus and have better defined the geographic ranges of the named species. One of these recent discoveries is a strikingly different iguana from all other island populations in Fiji which is restricted to Gau Island of the Lomaiviti Province. Gau is the fifth largest island in Fiji and maintains excellent upland forests in the higher elevations. We describe this population from Gau Island as a new species, Brachylophus gau sp. nov., in recognition of its type locality.
Island forming processes in the Okavango Delta, Botswana
McCarthy, T. S.; Humphries, M. S.; Mahomed, I.; Le Roux, P.; Verhagen, B. Th.
2012-12-01
The Okavango Delta in Botswana is a large (40,000 km2) alluvial fan that is characterised by the presence of numerous tree-covered islands. Thought to originate from the mound-building activities of termites or through fluvial processes associated with development of scroll bars and inverted channels, islands have been shown to play an important role in the structure and functioning of the Delta through the creation of habitat diversity, focusing of nutrients, and disposal of toxic salts. This study investigates the processes responsible for the maintenance and growth of two such islands in the seasonal swamps. Transpiration by vegetation is shown to result in substantial increases in groundwater salinity beneath the islands, contributing to their growth through chemical precipitation. Detailed chemical analyses revealed that the precipitation of magnesian calcite and silica within the island soils contributes 30-40% of the total island volume. Isotopic analyses of carbonate samples show that vegetation plays an important role in providing carbon for carbonate precipitation. Variations in δ13C carbonate values appear to reflect the relative proportion of C3 to C4 plants on the island, with C4 species becoming more dominant toward island centres in response to increases in groundwater salinity. The study suggests that continued island growth is also related to the deposition of aerosols and the accumulation of dust preferentially on islands and possibly to ongoing termite activity. Tall trees that characterise the island margins trap dust carried from the floodplains, resulting particularly in the lateral growth of islands. Islands in the Okavango are considered to be the product of long-term aggradation processes, with the two islands studied estimated to be in the order of tens of thousands of years old.
Schwarzhans, Werner; Mörs, Thomas; Engelbrecht, Andrea; Reguero, Marcelo; Kriwet, Jürgen
2017-01-01
The first record of fossil teleostean otoliths from Antarctica is reported. The fossils were obtained from late Early Eocene shell beds of the La Meseta Formation, Seymour Island that represent the last temperate marine climate phase in Antarctica prior to the onset of cooling and subsequent glaciation during the late Eocene. A total of 17 otolith-based teleost taxa are recognized, with 10 being identifiable to species level containing nine new species and one new genus: Argentina antarctica sp. nov., Diaphus? marambionis sp. nov., Macruronus eastmani sp. nov., Coelorinchus balushkini sp. nov., Coelorinchus nordenskjoeldi sp. nov., Palimphemus seymourensis sp. nov., Hoplobrotula? antipoda sp. nov., Notoberyx cionei gen. et sp. nov. and Cepola anderssoni sp. nov. Macruronus eastmani sp. nov. is also known from the late Eocene of Southern Australia, and Tripterophycis immutatus Schwarzhans, widespread in the southern oceans during the Eocene, has been recorded from New Zealand, southern Australia, and now Antarctica. The otolith assemblage shows a typical composition of temperate fishes dominated by gadiforms, very similar at genus and family levels to associations known from middle Eocene strata of New Zealand and the late Eocene of southern Australia, but also to the temperate Northern Hemisphere associations from the Paleocene of Denmark. The Seymour Island fauna bridges a gap in the record of global temperate marine teleost faunas during the early Eocene climate maximum. The dominant gadiforms are interpreted as the main temperate faunal component, as in the Paleocene of Denmark. Here they are represented by the families Moridae, Merlucciidae (Macruroninae), Macrouridae and Gadidae. Nowadays Gadidae are a chiefly Northern Hemisphere temperate family. Moridae, Macruroninae and Macrouridae live today on the lower shelf to deep-water or mesopelagically with Macruroninae being restricted to the Southern Ocean. The extant endemic Antarctic gadiform family
Elastic energies of coherent germanium islands on silicon
International Nuclear Information System (INIS)
Vanderbilt, D.; Wickham, L.K.
1991-01-01
Motivated by recent observations of coherent Ge island formation during growth of Ge on Si (100), the authors of this paper have carried out a theoretical study of the elastic energies associated with the evolution of a uniform strained overlayer as it segregates into coherent islands. In the context of a two-dimensional model, the authors have explored the conditions under which coherent islands may be energetically favored over both uniform epitaxial films and dislocated islands. The authors find that if the interface energy (for dislocated islands) is more than about 15% of the surface energy, then there is a range of island sizes for which the coherent island structure is preferred
Financial Worldwide Crisis: The Anti-Counter Cycle of Australia
Directory of Open Access Journals (Sweden)
Joao NEGREIROS
2013-12-01
Full Text Available If Australia has been subject to major influences by the United States and European countries, why is its economy healthier than their counter partners? What are the economic foundations that underline this anti-counter cycle of financial worldwide crisis from Australia? What are some of the lessons that countries from Europe that have not fared during the current financial worldwide crisis should learn from Australia? The purpose of this paper is to review the present Australian management system. Four changes are identified including embracement of corporate governance, a shift to adopt more R&D activities, a shift to adopt environmental sustainability practices and emerging corporate social responsibility. On the conclusions settings, a recap and recommendation on how Portugal, a member of the PIGS (Portugal, Italy, Greece and Spain Southern European Countries club forgot to embrace directives that have been applied in Australia, to avoid the actual financial and identity crisis.
Overcoming barriers to wind project finance in Australia
International Nuclear Information System (INIS)
Kann, Shayle
2009-01-01
The wind power industry in Australia is expected to grow rapidly over the next decade, primarily due to a forthcoming expanded national renewable energy target (RET) which will mandate that renewable sources provide approximately 20% of Australia's electricity production by 2020. However, development of new wind generation in Australia has stalled as a result of several barriers to project finance, the mechanism through which most wind farms have been developed historically. This paper provides an overview of wind power financing in Australia in light of recent political and financial trends. Drawing upon existing literature and a series of stakeholder interviews, it identifies three primary barriers to project finance: regulatory risk surrounding legislation of the RET, semi-privatization of electricity retailers in New South Wales, and limited capital availability resulting from the recent global credit crisis. The paper concludes that the confluence of these barriers limits the availability of long-term contracts that provide revenue certainty for pre-construction wind projects, while simultaneously making these contracts a necessity in order to obtain project finance. In an attempt to mitigate these effects, this paper identifies four alternative development strategies that can be pursued.
A Review of Roof Harvested Rainwater in Australia
Directory of Open Access Journals (Sweden)
Chirhakarhula E. Chubaka
2018-01-01
Full Text Available To address concern regarding water sustainability, the Australian Federal Government and many state governments have implemented regulatory mechanisms and incentives to support households to purchase and install rainwater harvesting systems. This has led to an increase in rainwater harvesting in regional and urban Australia. This review examines the implementation of the regulatory mechanisms across Australia. In addition, the literature investigating the potential health consequences of rainwater consumption in Australia was explored. Studies demonstrated that although trace metals such as arsenic, cadmium, chromium, lead, and iron were present in Australian rainwater, these metallic elements were generally found below the health limit guideline, except in high industrial areas. In addition, pathogenic or indicator microorganisms that include, but are not limited to, Escherichia coli, total and faecal coliforms, Campylobacter, Salmonella, Legionella, Pseudomonas, Cryptosporidium, Enterococci, Giardia, Aeromonas, and Mycobacterium avium Complex (MAC have been detected in rainwater collected in Australia. However, epidemiological evidence suggests that drinking rainwater does not increase the risk of gastrointestinal disease. It was also identified that there is a need for further research investigating the potential for rainwater to be a source of infection for opportunistic pathogens.
Shape and coarsening dynamics of strained islands
DEFF Research Database (Denmark)
Schifani, Guido; Frisch, Thomas; Argentina, Mederic
2016-01-01
and numerically the formation of an equilibrium island using a two-dimensional continuous model. We have found that these equilibrium island-like solutions have a maximum height h_{0} and they sit on top of a flat wetting layer with a thickness h_{w}. We then consider two islands, and we report that they undergo...... and leads to the shrinkage of the smallest island. Once its height becomes smaller than a minimal equilibrium height h_{0}^{*}, its mass spreads over the entire system. Our results pave the way for a future analysis of coarsening of an assembly of islands....
Review of islanding detection methods for distributed generation
DEFF Research Database (Denmark)
Chen, Zhe; Mahat, Pukar; Bak-Jensen, Birgitte
2008-01-01
This paper presents an overview of power system islanding and islanding detection techniques. Islanding detection techniques, for a distribution system with distributed generation (DG), can broadly be divided into remote and local techniques. A remote islanding detection technique is associated...
Radiological terrorism and Australia's response
International Nuclear Information System (INIS)
Patterson, D.
2003-01-01
A terrorist attack in Australia involving dispersal of radioactive material is different from conventional terrorist attacks involving explosives. The trauma experienced by victims during an explosive incident includes cuts, broken limbs, burns and shock. When an explosive device involving radioactive materials is involved, there are a number of additional characteristics including the contamination of victims and the surrounding area and the potential requirement for ongoing monitoring and decontamination. Response actions may require additional complex emergency response measures including immediate protective actions to protect those potentially exposed to contamination, mass casualty care, and public and mental health. There are concerns that terrorist organizations are showing increasing interest in acquiring radiological material that could be used with explosive. A dirty bomb or technically known as a radiological dispersal device (RDD) is a device designed to spread radioactive contamination over a wide area and pose a health and safety threat to those within the contaminated area. The radioactive material could be in the form of a large chunk of material, fine powder, a liquid mist, or a gas. The material may also be spread in other ways, such as by simply emptying a container over the desired area. As RDD's do not require large amounts of explosives, there is unlikely to be a large numbers of casualties, however the areas contaminated by the radiological material may cause immediate and long term health risks to those exposed. An RDD is a weapon of Mass Disruption rather than destruction. While the likelihood of RDD's being employed by terrorist in Australia is still considered remote, Australia's emergency response organizations are developing plans to ensure a rapid and comprehensive response occurs should such an event occur in this country, The presentation will outline Australia's response arrangements at the local/state level and the type of federal
International Nuclear Information System (INIS)
Ding, Haitao; Shao, Jinyou; Ding, Yucheng; Liu, Weiyu; Li, Xiangming; Tian, Hongmiao; Zhou, Yaopei
2015-01-01
Highlights: • Conductive island shape influences the dynamic process occurring in DEP assembly of 10 nm gold nanoparticles in a conductive-island-based microelectrode system. • The DEP-assembled nanoparticle wires form a straighter conduction path with the increase in the geometric angle of conductive island tip. • The different island shapes distort the DEP force distribution and increase the local electrothermally induced fluid flow to different extents, which is important for the morphology and electrical conductance quality of the DEP-assembled metal nanoparticle chains. - Abstract: The electrical conduction quality of an electric circuit connection formed by dielectrophoretic (DEP)-assembled metal nanoparticle wires between small conductive elements plays a significant role in electronic devices. One of the major challenges for improving the electrical conductance of nanowires is optimizing their geometric morphology. So far, the electrical conduction quality has been enhanced by optimizing the AC frequency and conductivity of nanoparticle suspensions. Herein, the effect of the conductive island shapes on the dynamic process occurring in a DEP assembly of 10 nm gold nanoparticles was investigated in a conductive-island-based microelectrode system. The nanoparticle wires between the microelectrodes were assembled in situ from colloidal suspensions. The wires were grown in a much straighter route by increasing the geometric angle of the conductive-island tip. To validate the experiments, the effects of mutual DEP interactions and electrothermally induced fluid flow on the dynamic behavior of particle motion for different island geometric configurations in the conductive-island-based microelectrode system were determined by numerical simulations. The simulation results are consistent with those of experiments. This indicates that different conductive island shapes change the distribution of DEP force and increase the electrothermally induced fluid flow to