Pexophagy in Hansenula polymorpha
Zutphen, Tim van; Klei, Ida J. van der; Kiel, Jan A.K.W.; Klionsky, D.J.
2009-01-01
In the yeast Hansenula polymorpha the development and turnover of peroxisomes is readily achieved by manipulation of the cultivation conditions. The organelles massively develop when the cells are incubated in the presence of methanol as the sole source of carbon and energy. However, they are
Novel genetic tools for Hansenula polymorpha
Saraya, Ruchi; Krikken, Arjen M; Kiel, Jan A K W; Baerends, Richard J S; Veenhuis, Marten; van der Klei, Ida J
Hansenula polymorpha is an important yeast in industrial biotechnology. In addition, it is extensively used in fundamental research devoted to unravel the principles of peroxisome biology and nitrate assimilation. Here we present an overview of key components of the genetic toolbox for H.
Determining a carbohydrate profile for Hansenula polymorpha
Petersen, G. R.
1985-01-01
The determination of the levels of carbohydrates in the yeast Hansenula polymorpha required the development of new analytical procedures. Existing fractionation and analytical methods were adapted to deal with the problems involved with the lysis of whole cells. Using these new procedures, the complete carbohydrate profiles of H. polymorpha and selected mutant strains were determined and shown to correlate favourably with previously published results.
Hansenula polymorpha Tup1p is important for peroxisome degradation
Leão-Helder, Adriana N; Krikken, Arjen M; Lunenborg, Marcel G J; Kiel, Jan A K W; Veenhuis, Marten; van der Klei, Ida J
2004-01-01
In the yeast Hansenula polymorpha peroxisomes are selectively degraded upon a shift of cells from methanol to glucose-containing media. We identified the H. polymorpha TUP1 gene by functional complementation of the peroxisome degradation deficient mutant pdd2-4. Tup1 proteins function in
Tools for genetic engineering of the yeast Hansenula polymorpha
Saraya, Ruchi; Gidijala, Loknath; Veenhuis, Marten; van der Klei, Ida J; Mapelli, Valeria
2014-01-01
Hansenula polymorpha is a methylotrophic yeast species that has favorable properties for heterologous protein production and metabolic engineering. It provides an attractive expression platform with the capability to secrete high levels of commercially important proteins. Over the past few years
Cloning and sequencing of the peroxisomal amine oxidase gene from Hansenula polymorpha
Bruinenberg, P. G.; Evers, M.; Waterham, H. R.; Kuipers, J.; Arnberg, A. C.; AB, G.
1989-01-01
We have cloned the AMO gene, encoding the microbody matrix enzyme amine oxidase (EC 1.4.3.6) from the yeast Hansenula polymorpha. The gene was isolated by differential screening of a cDNA library, immunoselection, and subsequent screening of a H. polymorpha genomic library. The nucleotide sequence
Adaptation of Hansenula polymorpha to methanol : A transcriptome analysis
van Zutphen, T.; Baerends, R.J S; Susanna, Kim; de Jong, Anne; Kuipers, O.P.; Veenhuis, M; van der Klei, I.J.
2010-01-01
Background: Methylotrophic yeast species (e. g. Hansenula polymorpha, Pichia pastoris) can grow on methanol as sole source of carbon and energy. These organisms are important cell factories for the production of recombinant proteins, but are also used in fundamental research as model organisms to
Stasyk, Oleh V.; Stasyk, Olena G.; Komduur, Janet; Veenhuis, Marten; Cregg, James M.; Sibirny, Andrei A.
2004-01-01
Peroxisome biogenesis and synthesis of peroxisomal enzymes in the methylotrophic yeast Hansenula polymorpha are under the strict control of glucose repression. We identified an H. polymorpha glucose catabolite repression gene (HpGCR1) that encodes a hexose transporter homologue. Deficiency in GCR1
Expression of recombinant staphylokinase in the methylotrophic yeast Hansenula polymorpha
Directory of Open Access Journals (Sweden)
Moussa Manal
2012-12-01
Full Text Available Abstract Background Currently, the two most commonly used fibrinolytic agents in thrombolytic therapy are recombinant tissue plasminogen activator (rt-PA and streptokinase (SK. Whereas SK has the advantage of substantially lower costs when compared to other agents, it is less effective than either rt-PA or related variants, has significant allergenic potential, lacks fibrin selectivity and causes transient hypotensive effects in high dosing schedules. Therefore, development of an alternative fibrinolytic agent having superior efficacy to SK, approaching that of rt-PA, together with a similar or enhanced safety profile and advantageous cost-benefit ratio, would be of substantial importance. Pre-clinical data suggest that the novel fibrinolytic recombinant staphylokinase (rSAK, or related rSAK variants, could be candidates for such development. However, since an efficient expression system for rSAK is still lacking, it has not yet been fully developed or evaluated for clinical purposes. This study’s goal was development of an efficient fermentation process for the production of a modified, non-glycosylated, biologically active rSAK, namely rSAK-2, using the well-established single cell yeast Hansenula polymorpha expression system. Results The development of an efficient large scale (80 L Hansenula polymorpha fermentation process of short duration for rSAK-2 production is described. It evolved from an initial 1mL HTP methodology by successive scale-up over almost 5 orders of magnitude and improvement steps, including the optimization of critical process parameters (e.g. temperature, pH, feeding strategy, medium composition, etc.. Potential glycosylation of rSAK-2 was successfully suppressed through amino acid substitution within its only N-acetyl glycosylation motif. Expression at high yields (≥ 1g rSAK-2/L cell culture broth of biologically active rSAK-2 of expected molecular weight was achieved. Conclusion The optimized production process
Cytochemical Localization of Catalase Activity in Methanol-Grown Hansenula polymorpha
Dijken, J.P. van; Veenhuis, M.; Vermeulen, C.A.; Harder, W.
1975-01-01
The localization of peroxidase activity in methanol-grown cells of the yeast Hansenula polymorpha has been studied by a method based on cytochemical staining with diaminobenzidine (DAB). The oxidation product of DAB occurred in microbodies, which characteristically develop during growth on methanol,
Klei, I.J. van der; Faber, K.N.; Keizer-Gunnink, I.; Gietl, C.; Harder, W.; Veenhuis, M.
1993-01-01
We have studied the fate of the watermelon (Citrullus vulgaris Schrad.) glyoxysomal enzyme, malate dehydrogenase (gMDH), after synthesis in the methylotrophic yeast, Hansenula polymorpha. The gene encoding the precursor form of gMDH (pre-gMDH) was cloned in an H. polymorpha expression vector
Veenhuis, M.; Zwart, K.B.; Harder, W.
1981-01-01
Growth of Hansenula polymorpha in shake flasks and chemostat cultures in the presence of methanol as the sole source of carbon and methylamine as the sole source of nitrogen was associated with the development of peroxisomes in the cells. The organelles were involved in the concurrent oxidation of
Location of catalase in crystalline peroxisomes of methanol-grown Hansenula polymorpha
Keizer, Ineke; Roggenkamp, Rainer; Harder, Willem; Veenhuis, Marten
1992-01-01
We have studied the intraperoxisomal location of catalase in peroxisomes of methanol-grown Hansenula polymorpha by (immuno)cytochemical means. In completely crystalline peroxisomes, in which the crystalline matrix is composed of octameric alcohol oxidase (AO) molecules, most of the catalase protein
van der Heide, M; Hollenberg, CP; van der Klei, IJ; Veenhuis, M
We have cloned the Hansenula polymorpha BIP gene from genomic DNA using a PCR-based strategy. H. polymorpha BIP encodes a protein of 665 amino acids, which shows very high homology to Saccharomyces cerevisiae KAR2p. KAR2p belongs to the Hsp70 family of molecular chaperones and resides in the
Atg21p is essential for macropexophagy and microautophagy in the yeast Hansenula polymorpha
Leão-Helder, Adriana N; Krikken, Arjen M; Gellissen, Gerd; van der Klei, Ida J; Veenhuis, Marten; Kiel, Jan A K W
2004-01-01
ATG genes are required for autophagy-related processes that transport proteins/organelles destined for proteolytic degradation to the vacuole. Here, we describe the identification and characterisation of the Hansenula polymorpha ATG21 gene. Its gene product Hp-Atg21p, fused to eGFP, had a dual
Vargas-Zapata, Rigoberto; Torres-González, Vladimira; Sepúlveda-Saavedra, Julio; Piñeyro-López, Alfredo; Rechinger, Karl B.; Keizer-Gunnink, Ineke; Kiel, Jan A.K.W.; Veenhuis, Marten
Previously we demonstrated that peroxisomicine A1 (T-514), a plant toxin isolated from Karwinskia species, has a deteriorating effect on the integrity of peroxisomes of methylotrophic yeasts. Here we describe two strains of Hansenula polymorpha, affected in the normal utilization of methanol as sole
Titorenko, Vladimir I.; Evers, Melchior E.; Diesel, Andre; Samyn, Bart; Beeumen, Josef van; Roggenkamp, Rainer; Kiel, Jan A.K.W.; Klei, Ida J. van der; Veenhuis, Marten
We have isolated two members of the Hsp70 protein family from the yeast Hansenula polymorpha using affinity chromatography. Both proteins were located in the cytoplasm. One of these, designated Hsp72, was inducible in nature (e.g. by heat shock). The second protein (designated Hsc74) was
Veenhuis, Marten; Douma, Anneke; Harder, Willem; Osumi, Masako
1983-01-01
Inactivation of peroxisomal enzymes in the yeast Hansenula polymorpha was studied following transfer of cells into cultivation media in which their activity was no longer required for growth. After transfer of methanol-grown cells into media containing glucose - a substrate that fully represses
Hiemstra, Harry; Dijkhuizen, Lubbert; Harder, Willem
1983-01-01
In the yeast Hansenula polymorpha an oxygen-requiring enzyme, alcohol oxidase, catalyzes the conversion of methanol into formaldehyde. After growth on methanol cells of the organism were harvested and entrapped in barium-alginate gels. The diffusion of oxygen towards these cells is seriously
Gietl, Christine; Faber, Klaas Nico; Klei, Ida J. van der; Veenhuis, Marten
1994-01-01
We have studied the significance of the N-terminal presequence of watermelon (Citrullus vulgaris) glyoxysomal malate dehydrogenase [gMDH; (S)-malate:NAD+ oxidoreductase; EC 1.1.1.37] in microbody targeting. The yeast Hansenula polymorpha was used as heterologous host for the in vivo expression of
Ishchuk, Olena P; Voronovsky, Andriy Y; Stasyk, Oleh V; Gayda, Galina Z; Gonchar, Mykhailo V; Abbas, Charles A; Sibirny, Andriy A
2008-11-01
Improvement of xylose fermentation is of great importance to the fuel ethanol industry. The nonconventional thermotolerant yeast Hansenula polymorpha naturally ferments xylose to ethanol at high temperatures (48-50 degrees C). Introduction of a mutation that impairs ethanol reutilization in H. polymorpha led to an increase in ethanol yield from xylose. The native and heterologous (Kluyveromyces lactis) PDC1 genes coding for pyruvate decarboxylase were expressed at high levels in H. polymorpha under the control of the strong constitutive promoter of the glyceraldehyde-3-phosphate dehydrogenase gene (GAPDH). This resulted in increased pyruvate decarboxylase activity and improved ethanol production from xylose. The introduction of multiple copies of the H. polymorpha PDC1 gene driven by the strong constitutive promoter led to a 20-fold increase in pyruvate decarboxylase activity and up to a threefold elevation of ethanol production.
Koning, W. de; Weusthuis, R.A.; Harder, W.; Dijkhuizen, L.
Various factors controlling dihydroxyacetone (DHA) and glycerol production from methanol by resting cell suspensions of a mutant of Hansenula polymorpha, blocked in DHA kinase and glycerol kinase, were investigated. The presence of methanol (250 mM) and an additional substrate (0.5%, w/v) to
Faber, Klaas Nico; Haima, Pieter; Gietl, Christine; Harder, Willem; Ab, Geert; Veenhuis, Marten
1994-01-01
Two main types of peroxisomal targeting signals have been identified that reside either at the extreme C terminus (PTS1) or the N terminus (PTS2) of the protein. In the methylotrophic yeast Hansenula polymorpha the majority of peroxisomal matrix proteins are of the PTS1 type. Thus far, for H.
Otzen, Marleen; Krikken, Arjen M; Ozimek, Paulina Z; Kurbatova, Elena; Nagotu, Shirisha; Veenhuis, Marten; van der Klei, Ida J
2006-01-01
The peroxin Pex19p is important for the formation of functional peroxisomal membranes. Here we show that Hansenula polymorpha Pex19p is also required for peroxisome inheritance. Peroxisome inheritance is partly defective when Pex19p farnesylation is blocked, whereas deletion of PEX19 resulted in a
International Nuclear Information System (INIS)
Postolache, Carmen; Postolache, Cristian; Dinu, Diana; Dinischiotu, Anca; Sahini, Victor Emanuel
2002-01-01
The post-irradiation repairing mechanisms of two Hansenula Polymorpha yeast enzymes, glucose-6-phosphate dehydrogenase and catalase, were studied. The kinetic parameters of the selected enzymes were investigated over one month since the moment of γ-irradiation with different doses in the presence of oxygen. Dose dependent decrease of initial reaction rates was noticed for both enzymes. Small variation of initial reaction rate was recorded for glucose-6-phosphate dehydrogenase over one month, with a decreasing tendency. No significant electrophoretic changes of molecular forms of this enzyme were observed after irradiation. Continuous strong decrease of catalase activity was evident for the first 20 days after irradiation. Partial recovery process of the catalytic activity was revealed by this study. (authors)
Directory of Open Access Journals (Sweden)
O. V. Blazhenko
2014-02-01
Full Text Available In a previous study we cloned GSH2 gene, encoding γ-glutamylcysteine synthetase (γGCS in the yeast Hansenula рolymorpha. In this study an analysis of molecular organisation of the H. рolymorpha GSH2 gene promoter was conducted and the potential binding sites of Yap1, Skn7, Creb/Atf1, and Cbf1 transcription factors were detected. It was established that full regulation of GSH2 gene expression in the response to cadmium and oxidative stress requires the length of GSH2 promoter to be longer than 450 bp from the start of translation initiation. To study the transcriptional regulation of H. polymorpha GSH2 gene recombinant strain, harbouring a reporter system, in which 1.832 kb regulatory region of GSH2 gene was fused to structural and terminatory regions of alcohol oxidase gene, was constructed. It was shown that maximum increase in H. polymorpha GSH2 gene transcription by 33% occurs in the rich medium under four-hour incubation with 1 μM concentration of cadmium ions. In the minimal medium the GSH2 gene expression does not correlate with the increased total cellular glutathione levels under cadmium ion treatment. We assume that the increased content of total cellular glutathione under cadmium stress in the yeast H. polymorpha probably is not controlled on the level of GSH2 gene transcription.
Directory of Open Access Journals (Sweden)
Schuhmann Wolfgang
2011-05-01
Full Text Available Abstract Background The detection and quantification of uric acid in human physiological fluids is of great importance in the diagnosis and therapy of patients suffering from a range of disorders associated with altered purine metabolism, most notably gout and hyperuricaemia. The fabrication of cheap and reliable urate-selective amperometric biosensors is a challenging task. Results A urate-selective microbial biosensor was developed using cells of the recombinant thermotolerant methylotrophic yeast Hansenula polymorpha as biorecognition element. The construction of uricase (UOX producing yeast by over-expression of the uricase gene of H. polymorpha is described. Following a preliminary screening of the transformants with increased UOX activity in permeabilized yeast cells the optimal cultivation conditions for maximal UOX yield namely a 40-fold increase in UOX activity were determined. The UOX producing cells were coupled to horseradish peroxidase and immobilized on graphite electrodes by physical entrapment behind a dialysis membrane. A high urate selectivity with a detection limit of about 8 μM was found. Conclusion A strain of H. polymorpha overproducing UOX was constructed. A cheap urate selective microbial biosensor was developed.
Directory of Open Access Journals (Sweden)
Sasi Sigawi
2014-01-01
Full Text Available Aliphatic amines, including methylamine, are air-pollutants, due to their intensive use in industry and the natural degradation of proteins, amino acids, and other nitrogen-containing compounds in biological samples. It is necessary to develop systems for removal of methylamine from the air, since airborne methylamine has a negative effect on human health. The primary amine oxidase (primary amine : oxygen oxidoreductase (deaminating or amine oxidase, AMO; EC 1.4.3.21, a copper-containing enzyme from the thermotolerant yeast Hansenula polymorpha which was overexpressed in baker’s yeast Saccharomyces cerevisiae, was tested for its ability to oxidize airborne methylamine. A continuous fluidized bed bioreactor (CFBR was designed to enable bioconversion of airborne methylamine by AMO immobilized in calcium alginate (CA beads. The results demonstrated that the bioreactor with immobilized AMO eliminates nearly 97% of the airborne methylamine. However, the enzymatic activity of AMO causes formation of formaldehyde. A two-step bioconversion process was therefore proposed. In the first step, airborne methylamine was fed into a CFBR which contained immobilized AMO. In the second step, the gas flow was passed through another CFBR, with alcohol oxidase from the yeast H. polymorpha immobilized in CA, in order to decompose the formaldehyde formed in the first step. The proposed system provided almost total elimination of the airborne methylamine and the formaldehyde.
Directory of Open Access Journals (Sweden)
Voronovsky Andriy Y
2008-07-01
Full Text Available Abstract Background The thermotolerant methylotrophic yeast Hansenula polymorpha is capable of alcoholic fermentation of xylose at elevated temperatures (45 – 48°C. Such property of this yeast defines it as a good candidate for the development of an efficient process for simultaneous saccharification and fermentation. However, to be economically viable, the main characteristics of xylose fermentation of H. polymorpha have to be improved. Results Site-specific mutagenesis of H. polymorpha XYL1 gene encoding xylose reductase was carried out to decrease affinity of this enzyme toward NADPH. The modified version of XYL1 gene under control of the strong constitutive HpGAP promoter was overexpressed on a Δxyl1 background. This resulted in significant increase in the KM for NADPH in the mutated xylose reductase (K341 → R N343 → D, while KM for NADH remained nearly unchanged. The recombinant H. polymorpha strain overexpressing the mutated enzyme together with native xylitol dehydrogenase and xylulokinase on Δxyl1 background was constructed. Xylose consumption, ethanol and xylitol production by the constructed strain were determined for high-temperature xylose fermentation at 48°C. A significant increase in ethanol productivity (up to 7.3 times was shown in this recombinant strain as compared with the wild type strain. Moreover, the xylitol production by the recombinant strain was reduced considerably to 0.9 mg × (L × h-1 as compared to 4.2 mg × (L × h-1 for the wild type strain. Conclusion Recombinant strains of H. polymorpha engineered for improved xylose utilization are described in the present work. These strains show a significant increase in ethanol productivity with simultaneous reduction in the production of xylitol during high-temperature xylose fermentation.
Kata, Iwona; Semkiv, Marta V; Ruchala, Justyna; Dmytruk, Kostyantyn V; Sibirny, Andriy A
2016-08-01
Conversion of byproduct from biodiesel production glycerol to high-value compounds is of great importance. Ethanol is considered a promising product of glycerol bioconversion. The methylotrophic thermotolerant yeast Ogataea (Hansenula) polymorpha is of great interest for this purpose as the glycerol byproduct contains methanol and heavy metals as contaminants, and this yeast utilizes methanol and is relatively resistant to heavy metals. Besides, O. polymorpha shows robust growth on glycerol and produces ethanol from various carbon sources. The thermotolerance of this yeast is an additional advantage, allowing increased fermentation temperature to 45-48 °C, leading to increased rate of the fermentation process and a fall in the cost of distillation. The wild-type strain of O. polymorpha produces insignificant amounts of ethanol from glycerol (0.8 g/l). Overexpression of PDC1 coding for pyruvate decarboxylase enhanced ethanol production up to 3.1 g/l, whereas simultaneous overexpression of PDC1 and ADH1 (coding for alcohol dehydrogenase) led to further increase in ethanol production from glycerol. Moreover, the increased temperature of fermentation up to 45 °C stimulated the production of ethanol from glycerol used as the only carbon source up to 5.0 g/l, which exceeds the data obtained by methylotrophic yeast strains reported so far. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Borrero, Juan; Kunze, Gotthard; Jiménez, Juan J; Böer, Erik; Gútiez, Loreto; Herranz, Carmen; Cintas, Luis M; Hernández, Pablo E
2012-08-01
The bacteriocin enterocin A (EntA) produced by Enterococcus faecium T136 has been successfully cloned and produced by the yeasts Pichia pastoris X-33EA, Kluyveromyces lactis GG799EA, Hansenula polymorpha KL8-1EA, and Arxula adeninivorans G1212EA. Moreover, P. pastoris X-33EA and K. lactis GG799EA produced EntA in larger amounts and with higher antimicrobial and specific antimicrobial activities than the EntA produced by E. faecium T136.
Smutok, Oleh; Broda, Daniel; Smutok, Halyna; Dmytruk, Kostyantyn; Gonchar, Mykhailo
2011-04-01
In spite of the great interest to studies of the biological roles of chromium, as well as the toxic influence of Cr(VI)-species on living organisms, the molecular mechanisms of chromate bioremediation remain vague. A reductive pathway resulting in formation of less toxic Cr(III)-species is suggested to be the most important among possible mechanisms for chromate biodetoxification. The yeast l-lactate:cytochrome c-oxidoreductase (flavocytochrome b(2), FC b(2)) has absolute specificity for l-lactate, yet is non-selective with respect to its electron acceptor. These properties allow us to consider the enzyme as a potential candidate for chromate reduction by living cells in the presence of l-lactate. A recombinant strain of thermotolerant, methylotrophic yeast Hansenula polymorpha with sixfold increased FC b(2) enzyme activity (up to 3μmolmin(-1)mg(-1) protein in cell-free extract) compared to the parental strain was used for approval our suggestion. The recombinant cells, stored in dried state, as well as living yeast cells were tested for chromate-reducing activity in vitro in the presence of l-lactate (as an electron donor for chromate reduction) and different low molecular weight, redox-active mediators facilitating electron transfer from the reduced form of the enzyme to chromate (as a final electron acceptor): dichlorophenolindophenol (DCPIP), Methylene blue, Meldola blue, and Nile blue. It was shown that the highest chromate-reducing activity of the cells was achieved in the presence of DCPIP. The ability of chromate to catch electrons from the reduced flavocytochrome b(2) was confirmed using purified enzyme immobilized on the surface of a platinum electrode. The increasing concentration of Cr(VI) resulted in a decrease of enzyme-mediated current generated on the electrode during l-lactate oxidation. The shift and drop in amplitude of the peak in the cyclic voltammogram are indicative of Cr(VI)-dependent competition between reaction of chromate with reduced FC
Directory of Open Access Journals (Sweden)
Schuhmann Wolfgang
2007-06-01
Full Text Available Abstract Background Accurate, rapid, and economic on-line analysis of ethanol is very desirable. However, available biosensors achieve saturation at very low ethanol concentrations and thus demand the time and labour consuming procedure of sample dilution. Results Hansenula polymorpha (Pichia angusta mutant strains resistant to allyl alcohol in methanol medium were selected. Such strains possessed decreased affinity of alcohol oxidase (AOX towards methanol: the KM values for AOX of wild type and mutant strains CA2 and CA4 are shown to be 0.62, 2.48 and 1.10 mM, respectively, whereas Vmax values are increased or remain unaffected. The mutant AOX alleles from H. polymorpha mutants CA2 and CA4 were isolated and sequenced. Several point mutations in the AOX gene, mostly different between the two mutant alleles, have been identified. Mutant AOX forms were isolated and purified, and some of their biochemical properties were studied. An amperometric biosensor based on the mutated form of AOX from the strain CA2 was constructed and revealed an extended linear response to the target analytes, ethanol and formaldehyde, as compared to the sensor based on the native AOX. Conclusion The described selection methodology opens up the possibility of isolating modified forms of AOX with further decreased affinity toward substrates without reduction of the maximal velocity of reaction. It can help in creation of improved ethanol biosensors with a prolonged linear response towards ethanol in real samples of wines, beers or fermentation liquids.
Silvestrini, Lucia; Rossi, Beatrice; Gallmetzer, Andreas; Mathieu, Martine; Scazzocchio, Claudio; Berardi, Enrico; Strauss, Joseph
2015-01-01
A few yeasts, including Hansenula polymorpha are able to assimilate nitrate and use it as nitrogen source. The genes necessary for nitrate assimilation are organised in this organism as a cluster comprising those encoding nitrate reductase (YNR1), nitrite reductase (YNI1), a high affinity transporter (YNT1), as well as the two pathway specific Zn(II)2Cys2 transcriptional activators (YNA1, YNA2). Yna1p and Yna2p mediate induction of the system and here we show that their functions are interdependent. Yna1p activates YNA2 as well as its own (YNA1) transcription thus forming a nitrate-dependent autoactivation loop. Using a split-YFP approach we demonstrate here that Yna1p and Yna2p form a heterodimer independently of the inducer and despite both Yna1p and Yna2p can occupy the target promoter as mono- or homodimer individually, these proteins are transcriptionally incompetent. Subsequently, the transcription factors target genes containing a conserved DNA motif (termed nitrate-UAS) determined in this work by in vitro and in vivo protein-DNA interaction studies. These events lead to a rearrangement of the chromatin landscape on the target promoters and are associated with the onset of transcription of these target genes. In contrast to other fungi and plants, in which nuclear accumulation of the pathway-specific transcription factors only occur in the presence of nitrate, Yna1p and Yna2p are constitutively nuclear in H. polymorpha. Yna2p is needed for this nuclear accumulation and Yna1p is incapable of strictly positioning in the nucleus without Yna2p. In vivo DNA footprinting and ChIP analyses revealed that the permanently nuclear Yna1p/Yna2p heterodimer only binds to the nitrate-UAS when the inducer is present. The nitrate-dependent up-regulation of one partner protein in the heterodimeric complex is functionally similar to the nitrate-dependent activation of nuclear accumulation in other systems.
The N-terminus of amine oxidase of Hansenula polymorpha contains a peroxisomal targeting signal
Faber, Klaas Nico; Keizer-Gunnink, Ineke; Pluim, Dick; Harder, Willem; AB, Geert; Veenhuis, Marten
1995-01-01
Here we describe the identification of the targeting sequence of peroxisomal amine oxidase (AMO) of H. polymorpha. Deletion analysis revealed that essential targeting information is located within the extreme N-terminal 16 amino acids. Moreover, this sequence can direct a reporter protein to the
Maekawa, Hiromi; Kaneko, Yoshinobu
2014-11-01
Yeast mating type is determined by the genotype at the mating type locus (MAT). In homothallic (self-fertile) Saccharomycotina such as Saccharomyces cerevisiae and Kluveromyces lactis, high-efficiency switching between a and α mating types enables mating. Two silent mating type cassettes, in addition to an active MAT locus, are essential components of the mating type switching mechanism. In this study, we investigated the structure and functions of mating type genes in H. polymorpha (also designated as Ogataea polymorpha). The H. polymorpha genome was found to harbor two MAT loci, MAT1 and MAT2, that are ∼18 kb apart on the same chromosome. MAT1-encoded α1 specifies α cell identity, whereas none of the mating type genes were required for a identity and mating. MAT1-encoded α2 and MAT2-encoded a1 were, however, essential for meiosis. When present in the location next to SLA2 and SUI1 genes, MAT1 or MAT2 was transcriptionally active, while the other was repressed. An inversion of the MAT intervening region was induced by nutrient limitation, resulting in the swapping of the chromosomal locations of two MAT loci, and hence switching of mating type identity. Inversion-deficient mutants exhibited severe defects only in mating with each other, suggesting that this inversion is the mechanism of mating type switching and homothallism. This chromosomal inversion-based mechanism represents a novel form of mating type switching that requires only two MAT loci.
HANSENULA WICKERHAMII SP. N., A NEW YEAST FROM FINNISH SOIL
Capriotti, Augusto
1961-01-01
Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638
DEFF Research Database (Denmark)
Viigand, Katrin; Visnapuu, Triinu; Mardo, Karin
2016-01-01
and mutation of the genes. We studied substrate specificity of the maltase protein MAL1 from an earlier diverged yeast, Ogataea polymorpha (Op), in the light of this hypothesis. MAL1 has extended substrate specificity and its properties are strikingly similar to those of resurrected ancMALS. Moreover, amino......, indicating the power of the method to predict substrate binding. Deletion of either the maltase (MAL1) or α-glucoside permease (MAL2) gene in Op abolished the growth of yeast on MAL1 substrates, confirming the requirement of both proteins for usage of these sugars....
Directory of Open Access Journals (Sweden)
Engelbrecht Christoph
2009-12-01
Full Text Available Abstract Background In the past decade, an enormous number of new bioprocesses have evolved in the biotechnology industry. These bioprocesses have to be developed fast and at a maximum productivity. Up to now, only few microbioreactors were developed to fulfill these demands and to facilitate sample processing. One predominant reaction platform is the shaken microtiter plate (MTP, which provides high-throughput at minimal expenses in time, money and work effort. By taking advantage of this simple and efficient microbioreactor array, a new online monitoring technique for biomass and fluorescence, called BioLector, has been recently developed. The combination of high-throughput and high information content makes the BioLector a very powerful tool in bioprocess development. Nevertheless, the scalabilty of results from the micro-scale to laboratory or even larger scales is very important for short development times. Therefore, engineering parameters regarding the reactor design and its operation conditions play an important role even on a micro-scale. In order to evaluate the scale-up from a microtiter plate scale (200 μL to a stirred tank fermenter scale (1.4 L, two standard microbial expression systems, Escherichia coli and Hansenula polymorpha, were fermented in parallel at both scales and compared with regard to the biomass and protein formation. Results Volumetric mass transfer coefficients (kLa ranging from 100 to 350 1/h were obtained in 96-well microtiter plates. Even with a suboptimal mass transfer condition in the microtiter plate compared to the stirred tank fermenter (kLa = 370-600 1/h, identical growth and protein expression kinetics were attained in bacteria and yeast fermentations. The bioprocess kinetics were evaluated by optical online measurements of biomass and protein concentrations exhibiting the same fermentation times and maximum signal deviations below 10% between the scales. In the experiments, the widely applied green
The moonlighting function of pyruvate carboxylase resides in the non-catalytic end of the TIM barrel
Huberts, Daphne H. E. W.; Venselaar, Hanka; Vriend, Gert; Veenhuis, Marten; van der Klei, Ida J.
Pyruvate carboxylase is a highly conserved enzyme that functions in replenishing the tricarboxylic acid cycle with oxaloacetate. In the yeast Hansenula polymorpha, the pyruvate carboxylase protein is also required for import and assembly of the peroxisomal enzyme alcohol oxidase. This additional
Methanol Metabolism in Yeasts : Regulation of the Synthesis of Catabolic Enzymes
Egli, Th.; Dijken, J.P. van; Veenhuis, M.; Harder, W.; Fiechter, A.
1980-01-01
The regulation of the synthesis of four dissimilatory enzymes involved in methanol metabolism, namely alcohol oxidase, formaldehyde dehydrogenase, formate dehydrogenase and catalase was investigated in the yeasts Hansenula polymorpha and Kloeckera sp. 2201. Enzyme profiles in cell-free extracts of
Peroxisomal catalase deficiency modulates yeast lifespan depending on growth conditions
Kawalek, Adam; Lefevre, Sophie D.; Veenhuis, Marten; van der Klei, Ida J.
We studied the role of peroxisomal catalase in chronological aging of the yeast Hansenula polymorpha in relation to various growth substrates. Catalase-deficient (cat) cells showed a similar chronological life span (CLS) relative to the wild-type control upon growth on carbon and nitrogen sources
Enzymatic halogenation and oxidation using an alcohol oxidase-vanadium chloroperoxidase cascade
But, Andrada; Noord, Van Aster; Poletto, Francesca; Sanders, Johan P.M.; Franssen, Maurice C.R.; Scott, Elinor L.
2017-01-01
The chemo-enzymatic cascade which combines alcohol oxidase from Hansenula polymorpha (AOXHp) with vanadium chloroperoxidase (VCPO), for the production of biobased nitriles from amino acids was investigated. In the first reaction H2O2 (and acetaldehyde) are generated from ethanol and oxygen by AOXHp.
Parameters affecting methanol utilization by yeasts
Energy Technology Data Exchange (ETDEWEB)
Foda, M.S.; El-Masry, H.G.
1981-01-01
Screening of 28 yeast cultures, representing 22 species of various yeasts, with respect to their capabilities to assimilate methanol, has shown that this property was mostly found in certain species of the two genera Hansenula and Candida. When methanol was used as a sole carbon source for a methanol-adapted strain of Hansenula polymorpha, a linear yield response could be obtained with increasing alcohol up to 2% concentration. The amount of inoculum proved to be the decisive factor in determining a priori the ability of the organism to grow at 6% methanol as final concentration. The optimum pH values for growth ranged between 4.5-5.5 with no growth at pH 6.5 or higher. A marked growth stimulation was obtained when the medium was supplied with phosphate up to 0.08 M as final concentration. Within the nitrogen sources tested, corn steep liquor concentrate gave the highest yield of cells. The significance of the obtained results are discussed with reference to feasibilities of application.
Nelson, Jessica M; Hauser, Duncan A; Hinson, Rosemary; Shaw, A Jonathan
2018-05-01
Fungal symbioses are ubiquitous in plants, but their effects have mostly been studied in seed plants. This study aimed to assess the diversity of fungal endophyte effects in a bryophyte and identify factors contributing to the variability of outcomes in these interactions. Fungal endophyte cultures and axenic liverwort clones were isolated from wild populations of the liverwort, Marchantia polymorpha. These collections were combined in a gnotobiotic system to test the effects of fungal isolates on the growth rates of hosts under laboratory conditions. Under the experimental conditions, fungi isolated from M. polymorpha ranged from aggressively pathogenic to strongly growth-promoting, but the majority of isolates caused no detectable change in host growth. Growth promotion by selected fungi depended on nutrient concentrations and was inhibited by coinoculation with multiple fungi. The M. polymorpha endophyte system expands the resources for this model liverwort. The experiments presented here demonstrate a wealth of diversity in fungal interactions even in a host reported to lack standard mycorrhizal symbiosis. In addition, they show that some known pathogens of vascular plants live in M. polymorpha and can confer benefits to this nonvascular host. This highlights the importance of studying endophyte effects across the plant tree of life. © 2018 The Authors. New Phytologist © 2018 New Phytologist Trust.
Kajiwara, Shota; Yamada, Ryosuke; Ogino, Hiroyasu
2018-04-10
Simple and cost-effective lipase expression host microorganisms are highly desirable. A combinatorial library strategy is used to improve the secretory expression of lipase from Bacillus thermocatenulatus (BTL2) in the culture supernatant of Saccharomyces cerevisiae. A plasmid library including expression cassettes composed of sequences encoding one of each 15 promoters, 15 secretion signals, and 15 terminators derived from yeast species, S. cerevisiae, Pichia pastoris, and Hansenula polymorpha, is constructed. The S. cerevisiae transformant YPH499/D4, comprising H. polymorpha GAP promoter, S. cerevisiae SAG1 secretion signal, and P. pastoris AOX1 terminator, is selected by high-throughput screening. This transformant expresses BTL2 extra-cellularly with a 130-fold higher than the control strain, comprising S. cerevisiae PGK1 promoter, S. cerevisiae α-factor secretion signal, and S. cerevisiae PGK1 terminator, after cultivation for 72 h. This combinatorial library strategy holds promising potential for application in the optimization of the secretory expression of proteins in yeast. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Dionisio Pires, L.M.; Jonker, R.R.; Donk, E.van; Laanbroek, H.J.
2004-01-01
1. Selective grazing of adults and larvae of the zebra mussel (Dreissena polymorpha) on phytoplankton and detritus from both laboratory cultures and natural seston was quantified using flow cytometry. 2. Mean clearance rate of adult zebra mussels was higher on a mixture of the green
Pires, L.M.D.; Jonker, R.M.; Van Donk, E.; Laanbroek, H.J.
2004-01-01
1. Selective grazing of adults and larvae of the zebra mussel (Dreissena polymorpha) on phytoplankton and detritus from both laboratory cultures and natural seston was quantified using flow cytometry. 2. Mean clearance rate of adult zebra mussels was higher on a mixture of the green alga Scenedesmus
Schäfer, S; Hamer, B; Treursić, B; Möhlenkamp, C; Spira, D; Korlević, M; Reifferscheid, G; Claus, E
2012-05-01
The zebra mussel Dreissena polymorpha is widely used as sentinel organism for the assessment of environmental contamination in freshwater environments. However, in the River Rhine (Germany), the D. polymorpha population is declining, whereas the closely related quagga mussel D. bugensis is found in high numbers at some sites. In the present laboratory study, D. polymorpha and D. bugensis were exposed to resuspended native sediments for ≤2 weeks. Wet sediments (quagga mussel can be used as alternative test organism for the zebra mussel.
Directory of Open Access Journals (Sweden)
Xin Wang
2016-03-01
Full Text Available Marchantia polymorpha L. is a representative bryophyte used as a traditional Chinese medicinal herb for scald and pneumonia. The phytochemicals in M. polymorpha L. are terpenoids and flavonoids, among which especially the flavonoids show significant human health benefits. Many researches on the gametophyte of M. polymorpha L. have been reported. However, as the reproductive organ of M. polymorpha L., the bioactivity and flavonoids profile of the archegoniophore have not been reported, so in this work the flavonoid profiles, antioxidant and acetylcholinesterase inhibition activities of the extracts from the archegoniophore and gametophyte of M. polymorpha L. were compared by radical scavenging assay methods (DPPH, ABTS, O2−, reducing power assay, acetylcholinesterase inhibition assay and LC-MS analysis. The results showed that the total flavonoids content in the archegoniophore was about 10-time higher than that of the gametophyte. Differences between the archegoniophore and gametophyte of M. polymorpha L. were observed by LC-MS analysis. The archegoniophore extracts showed stronger bio-activities than those of the gametophyte. The archegoniophore extract showed a significant acetylcholinesterase inhibition, while the gametophyte extract hardly inhibited it.
Viigand, Katrin; Visnapuu, Triinu; Mardo, Karin; Aasamets, Anneli
2016-01-01
Abstract Saccharomyces cerevisiae maltases use maltose, maltulose, turanose and maltotriose as substrates, isomaltases use isomaltose, α‐methylglucoside and palatinose and both use sucrose. These enzymes are hypothesized to have evolved from a promiscuous α‐glucosidase ancMALS through duplication and mutation of the genes. We studied substrate specificity of the maltase protein MAL1 from an earlier diverged yeast, Ogataea polymorpha (Op), in the light of this hypothesis. MAL1 has extended substrate specificity and its properties are strikingly similar to those of resurrected ancMALS. Moreover, amino acids considered to determine selective substrate binding are highly conserved between Op MAL1 and ancMALS. Op MAL1 represents an α‐glucosidase in which both maltase and isomaltase activities are well optimized in a single enzyme. Substitution of Thr200 (corresponds to Val216 in S. cerevisiae isomaltase IMA1) with Val in MAL1 drastically reduced the hydrolysis of maltose‐like substrates (α‐1,4‐glucosides), confirming the requirement of Thr at the respective position for this function. Differential scanning fluorimetry (DSF) of the catalytically inactive mutant Asp199Ala of MAL1 in the presence of its substrates and selected monosaccharides suggested that the substrate‐binding pocket of MAL1 has three subsites (–1, +1 and +2) and that binding is strongest at the –1 subsite. The DSF assay results were in good accordance with affinity (K m) and inhibition (K i) data of the enzyme for tested substrates, indicating the power of the method to predict substrate binding. Deletion of either the maltase (MAL1) or α‐glucoside permease (MAL2) gene in Op abolished the growth of yeast on MAL1 substrates, confirming the requirement of both proteins for usage of these sugars. © 2016 The Authors. Yeast published by John Wiley & Sons, Ltd. PMID:26919272
International Nuclear Information System (INIS)
Jin Xiang; Mao Peihong; Lu Jie; Ma Yuan
2010-01-01
Glycyrrhizic acid (GA) in Glycyrrhiza uralensis (G. uralensis) is physiologically active. In this study, the total DNA of wild G. uralensis was randomly transformed into Hansenula anomaly by implantation of low-energy Ar + and N + , to produce five recombinant yeast strains relating to biological synthesis of the GA or Glycyrrhetinic acid (GAs). After culturing in liquid medium for 96 h, the resultant GA, 18α-GAs and 18β-Gas were determined by reversed-phase high performance liquid chromatography (RP-HPLC), and the corresponding concentrations were 114.49, 0.56, and 0.81 mg·L -1 . After one hundred primers were analyzed with random amplified polymorphic DNA (RAPD), the seven different DNA fragments were produced by the N7059 strain of recombined yeasts, and, the polymerase chain reaction (PCR) verified that one of them came from the genome of G. uralensis, indicating a successful transfer of genetic information by ion implantation. (authors)
Biotransformation and Production from Hansenula Anomala to Natural Ethyl Phenylacetate
Directory of Open Access Journals (Sweden)
Tian Xun
2015-01-01
Full Text Available Ethyl phenylacetate can be widely applied in many industries, such as food, medicines, cosmetics and medicinal herbs. At the moment, the production of natural ethyl phenylacetate is very limited. However, the biotransformation production of natural ethyl phenylacetate has an very extensive application prospect. This paper is written by taking the phenylacetic acid tolerance and the esterifying enzyme activity as the two indexes for screening the HA14 strain of hansenula anomala mutagenic which is regarded as the microorganism of ethyl phenylacetate production through biotransformation. By optimizing the production condition of phenylacetic acid and the esterification condition of ethyl phenylacetate, the production of ethyl phenylacetate accomplished through biotransformation within 72 hours can reach 864mg/L which is 171% of that of the initial bacterial strain.
Energy Technology Data Exchange (ETDEWEB)
Jefanova, O.; Marciulioniene, D. [Nature Research Centre, Akademijos str. 2, LT-08412 Vilnius, Lietuva (Lithuania)
2014-07-01
The specific activity of {sup 137}Cs, {sup 60}Co, {sup 54}Mn, {sup 90}Sr was measured in mollusks Dreissena polymorpha samples from lake Drukshiai that is the cooling pond of the Ignalina NPP. Item the accumulation of {sup 137}Cs, {sup 90}Sr, {sup 144}Ce, {sup 106}Ru in the mollusks from water and from phytoplankton which is a part of their diet was evaluated under laboratory conditions. The data of long-term (1991-2009) studies conducted at six monitoring stations of lake Drukshiai show that in 1991 {sup 137}Cs in mollusks Dreissena polymorpha was found only in that lake's area which was influenced by the effluent that got into lake from the industrial drainage channel of Ignalina NPP. In later periods of the investigation the {sup 137}Cs specific activity was detected in mollusks samples which had been collected at other monitoring stations (the aquatory of lake Drukshiai). Meanwhile {sup 60}Co and {sup 54}Mn in Dreissena polymorpha were detected only in that lake's area which was impacted by the industrial drainage channel. The data of long-term investigation show that the major amount of radionuclides has come into lake Drukshiai through the industrial drainage system of Ignalina NPP. Albeit {sup 137}Cs, {sup 90}Sr, {sup 144}Ce, {sup 106}Ru get into the mollusks through a large amount of the water rather than from the food (phytoplankton), therefore the food can also be the main source of radionuclides in the organism of these mollusks in aquatic environment when there are low levels of specific activities of these radionuclides. (authors)
Accumulation of a low pathogenic avian influenza virus in zebra mussels (Dreissena polymorpha).
Stumpf, Petra; Failing, Klaus; Papp, Tibor; Nazir, Jawad; Böhm, Reinhard; Marschang, Rachel E
2010-12-01
In order to investigate the potential role of mussels as a vector of influenza A viruses, we exposed zebra mussels (Dreissena polymorpha) to natural lake water containing a low pathogenic H5N1 avian influenza virus. Mussels were kept in water containing virus for 48 hr, then transferred into fresh water for another 14 days. Virus detection in mussels and water samples was performed by quantitative real-time reverse transcriptase-PCR (qRRT-PCR) and egg culture methods. Virus uptake was detected in all of the mussel groups that were exposed to virus. Even after 14 days in fresh water, virus could still be detected in shellfish material by both qRRT-PCR and egg culture methods. The present study demonstrates that zebra mussels are capable of accumulating influenza A viruses from the surrounding water and that these viruses remain in the mussels over an extended period of time.
Potet, Marine; Giambérini, Laure; Pain-Devin, Sandrine; Louis, Fanny; Bertrand, Carole; Devin, Simon
2018-01-15
Differential tolerance to stress is partly responsible for the heterogeneity of biomarker responses between populations of a sentinel species. Although currently used for freshwater biomonitoring, studies concerning inter-populational variability in tolerance to contaminants for the zebra mussel (Dreissena polymorpha) are scarce. Moreover, this well-known invader is currently replaced by another, the quagga mussel (Dreissena rostriformis bugensis). To evaluate the differential tolerance between dreissenids, several populations of both species were exposed to a high concentration of nickel. A LT 50 (time when 50% of individuals were dead) was established for each population. Biomarker responses and internal nickel concentration were also measured, to link tolerance with physiological status. Results evidenced that D. polymorpha populations are more heterogeneous and more tolerant than D. r. bugensis ones. For D. polymorpha populations only, LT 50 values were positively correlated with the nickel contamination in situ, with higher anti-oxidative defences and a higher Integrated Biomarker Response value in the field. Such findings may be explained by local adaptation and invasion dynamic within each species. The significance of this differential tolerance when using biomarker responses for biomonitoring purposes is thus discussed.
Schaller, Jörg; Planer-Friedrich, Britta
2017-05-01
Organic sediments in aquatic ecosystems are well known sinks for nutrients, silicon, and metal(loid)s. Organic matter-consuming organisms like invertebrate shredders, grazers, and bioturbators significantly affect element fixation or remobilization by changing redox conditions or binding properties of organic sediments. Little is known about the effect of filter feeders, like the zebra mussel Dreissena polymorpha, an invasive organism in North American and European freshwater ecosystems. A laboratory batch experiment exposing D. polymorpha (∼1200 organisms per m 2 ) to organic sediment from a site contaminated with arsenic, copper, lead, and uranium revealed a significant uptake and accumulation of arsenic, copper, iron, and especially uranium both into the soft body tissues and the seashell. This is in line with previous observations of metal(loid) accumulation from biomonitoring studies. Regarding its environmental impact, D. polymorpha significantly contributed to mobilization of silicon, iron, phosphorus, arsenic, and copper and to immobilization of uranium (p < 0.001), probably driven by redox conditions, microbial activity within the gut system, or active control of element homeostasis. No net mobilization or immobilization was observed for zinc and lead, because of their low mobility at the prevailing pH of 7.5-8.5. The present results suggest that D. polymorpha can both ameliorate (nutrient mobilization, immobilization of toxicants mobile under oxic conditions) or aggravate negative effects (mobilization of toxicants mobile under reducing conditions) in ecosystems. Relating the results of the present study to observed population densities in natural freshwater ecosystems suggests a significant influence of D. polymorpha on element cycling and needs to be considered in future studies. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Françoise Immel
Full Text Available The zebra mussel Dreissena polymorpha is a well-established invasive model organism. Although extensively used in environmental sciences, virtually nothing is known of the molecular process of its shell calcification. By describing the microstructure, geochemistry and biochemistry/proteomics of the shell, the present study aims at promoting this species as a model organism in biomineralization studies, in order to establish a bridge with ecotoxicology, while sketching evolutionary conclusions. The shell of D. polymorpha exhibits the classical crossed-lamellar/complex crossed lamellar combination found in several heterodont bivalves, in addition to an external thin layer, the characteristics of which differ from what was described in earlier publication. We show that the shell selectively concentrates some heavy metals, in particular uranium, which predisposes D. polymorpha to local bioremediation of this pollutant. We establish the biochemical signature of the shell matrix, demonstrating that it interacts with the in vitro precipitation of calcium carbonate and inhibits calcium carbonate crystal formation, but these two properties are not strongly expressed. This matrix, although overall weakly glycosylated, contains a set of putatively calcium-binding proteins and a set of acidic sulphated proteins. 2D-gels reveal more than fifty proteins, twenty of which we identify by MS-MS analysis. We tentatively link the shell protein profile of D. polymorpha and the peculiar recent evolution of this invasive species of Ponto-Caspian origin, which has spread all across Europe in the last three centuries.
Characterization of the plasma membrane H+-ATPase in the liverwort Marchantia polymorpha.
Okumura, Masaki; Inoue, Shin-ichiro; Takahashi, Koji; Ishizaki, Kimitsune; Kohchi, Takayuki; Kinoshita, Toshinori
2012-06-01
The plasma membrane H(+)-ATPase generates an electrochemical gradient of H(+) across the plasma membrane that provides the driving force for solute transport and regulates pH homeostasis and membrane potential in plant cells. Recent studies have demonstrated that phosphorylation of the penultimate threonine in H(+)-ATPase and subsequent binding of a 14-3-3 protein is the major common activation mechanism for H(+)-ATPase in vascular plants. However, there is very little information on the plasma membrane H(+)-ATPase in nonvascular plant bryophytes. Here, we show that the liverwort Marchantia polymorpha, which is the most basal lineage of extant land plants, expresses both the penultimate threonine-containing H(+)-ATPase (pT H(+)-ATPase) and non-penultimate threonine-containing H(+)-ATPase (non-pT H(+)-ATPase) as in the green algae and that pT H(+)-ATPase is regulated by phosphorylation of its penultimate threonine. A search in the expressed sequence tag database of M. polymorpha revealed eight H(+)-ATPase genes, designated MpHA (for M. polymorpha H(+)-ATPase). Four isoforms are the pT H(+)-ATPase; the remaining isoforms are non-pT H(+)-ATPase. An apparent 95-kD protein was recognized by anti-H(+)-ATPase antibodies against an Arabidopsis (Arabidopsis thaliana) isoform and was phosphorylated on the penultimate threonine in response to the fungal toxin fusicoccin in thalli, indicating that the 95-kD protein contains pT H(+)-ATPase. Furthermore, we found that the pT H(+)-ATPase in thalli is phosphorylated in response to light, sucrose, and osmotic shock and that light-induced phosphorylation depends on photosynthesis. Our results define physiological signals for the regulation of pT H(+)-ATPase in the liverwort M. polymorpha, which is one of the earliest plants to acquire pT H(+)-ATPase.
Import of peroxisomal matrix proteins in the yeast Hansenula polymorpha
Gunkel, Katja
2005-01-01
Archaea, prokaryotes and eukaryotes form the three kingdoms of life. The smallest unit of life, which can exist independently, is a cell. Archaea and prokaryotes have a relatively very simple architecture. The cytoplasm (cellulars pace), containing all metabolites, proteins and genetic material
Decline of Ohia (Metrosideros polymorpha) in Hawaii: a review
Charles S. Hodges; Ken T. Adee; John D. Stein; Hulton B. Wood; Robert D. Doty
1986-01-01
Portions of the ohia (Metrosideros polymorpha) forests on the windward slopes of Mauna Loa and Mauna Kea on the island of Hawaii began dying in 1952. Little mortality has occurred since 1972. About 50,000 ha are affected by the decline. Individual trees exhibit several symptoms, from slow progressive dieback to rapid death. Seven types of decline...
Rajagopal, S.; Pollux, B.J.A.; Peters, J.L.; Cremers, G.; Moon- van der Staay, S.Y.; Alen, van T.; Eygensteyn, J.; Hoek, van A.H.A.M.; Palau, A.; Vaate, de A.B.; Velde, van der G.
2009-01-01
The zebra mussel, Dreissena polymorpha is an aquatic nuisance invasive species originally native to the Ponto-Caspian region where it is found in lakes and delta areas of large rivers draining into the Black and Caspian seas. The dispersal of D. polymorpha began at the end of the 18th century, at a
Decomposition of Metrosideros polymorpha leaf litter along elevational gradients in Hawaii
Paul G. Scowcroft; Douglas R. Turner; Peter M. Vitousek
2000-01-01
We examined interactions between temperature, soil development, and decomposition on three elevational gradients, the upper and lower ends of each being situated on a common lava flow or ash deposit. We used the reciprocal transplant technique to estimate decomposition rates of Metrosideros polymorpha leaf litter during a three-year period at warm...
Assimilation and depuration of microcystin–LR by the zebra mussel, Dreissena polymorpha
Pires, L.M.D.; Karlsson, K.M.; Meriluoto, J.A.O.; Kardinaal, E.A.; Visser, P.M.; Siewertsen, K.; Van Donk, E.; Ibelings, B.W.
2004-01-01
Zebra mussels (Dreissena polymorpha) are an important component of the foodweb of shallow lakes in the Netherlands, amongst others in Lake IJsselmeer, an international important wetland. Large numbers of ducks feed on these mussels in autumn and winter. The mussels are filter feeders and are exposed
Directory of Open Access Journals (Sweden)
Romualda Chuševė
2012-11-01
Full Text Available We report the first results of a parasitological study ofDreissena polymorpha (zebra mussels from the brackishCuronian Lagoon, SE Baltic Sea. Zebra mussels were collected monthlyfrom May to October 2011 from a site near the mouth of the River Nemunas.Three types of endosymbionts were found in the mantle cavity andvisceral mass of the molluscs during dissections, i.e. thecommensal ciliate Conchophthirus acuminatus and parasitic ciliateOphryoglena sp., and rarely encountered, unidentified nematodes.The abundances of C. cuminatus and Ophryoglena sp.were positively associated with host shell length and watertemperature, but no effect of water salinity was detected.As the endosymbionts are either highly host-specific to zebra mussels(C. acuminatus and Ophryoglena sp. or are probablyfree-living organisms that inadvertently infect the molluscs (nematodes,we conclude that the presence of D. polymorpha in theCuronian Lagoon does not pose any serious parasitologicalrisk to native biota. We emphasize, however, that this conclusionshould be treated with caution as it is based on a study conductedonly at a single location. Our work extends the currentlyscarce records of D. polymorpha parasites and commensals frombrackish waters, and adds to a better understanding of the ecologicalimpact this highly invasive mollusc causes in the areas it has invaded.
Tsuboyama, Shoko; Kodama, Yutaka
2014-01-01
The liverwort Marchantia polymorpha L. is being developed as an emerging model plant, and several transformation techniques were recently reported. Examples are biolistic- and Agrobacterium-mediated transformation methods. Here, we report a simplified method for Agrobacterium-mediated transformation of sporelings, and it is termed Agar-utilized Transformation with Pouring Solutions (AgarTrap). The procedure of the AgarTrap was carried out by simply exchanging appropriate solutions in a Petri dish, and completed within a week, successfully yielding sufficient numbers of independent transformants for molecular analysis (e.g. characterization of gene/protein function) in a single experiment. The AgarTrap method will promote future molecular biological study in M. polymorpha.
Modelling the effects of diving ducks on zebra mussels Dreissena polymorpha in lakes
Nes, van E.H.; Noordhuis, R.; Lammens, E.H.R.R.; Portielje, R.; Reeze, B.; Peeters, E.T.H.M.
2008-01-01
An individual-based model describing the growth of zebra mussels (Dreissena polymorpha) is presented. The model is spatially explicit and predicts length¿frequency distributions of zebra mussels. The parameters and model inputs with the strongest effect on the model outcomes were identified using a
Deans, Bianca J; Tedone, Laura; Bissember, Alex C; Smith, Jason A
2018-06-07
An investigation of the previously unexamined ancient Tasmanian clone Lomatia tasmanica W. M. Curtis (Proteaceae) and two other endemic species Lomatia tinctoria R. Br. and Lomatia polymorpha (Labill.) R. Br. was undertaken. This represents the first extensive natural products study in which individual phytochemical components have been isolated and identified from these three Lomatia species. Extraction of L. tasmanica leaves provided the naphthoquinone juglone (0.34% w/w), and n-alkanes nonacosane and heptacosane (0.30% w/w combined). L. polymorpha afforded the flavonoid glycosides dihydroquercetin 3-O-β-D-xyloside (0.22% w/w) and quercetin 3-O-β-d-glucose (0.14% w/w), as well as the naphthalene glucoside 1,4,8-trihydroxynaphthalene-1-O-β-d-glucose (0.04% w/w) and 4-O-p-coumaroyl-d-glucose (0.03% w/w). In addition, both L. polymorpha and L. tinctoria contained juglone (0.32% w/w and 0.58% w/w, respectively). L. polymorpha provided tetracosan-1-ol, hexacosan-1-ol and octacosan-1-ol (0.07% w/w combined), while L. tinctoria gave nonacosane (0.13% w/w). Analysis of three individual specimens from each of the three species demonstrated consistency in the respective phytochemical profiles of these populations and tentatively suggests limited intraspecific variation. Copyright © 2018 Elsevier Ltd. All rights reserved.
Molloy, D P; Giambérini, L; Stokes, N A; Burreson, E M; Ovcharenko, M A
2012-04-01
Extensive connective tissue lysis is a common outcome of haplosporidian infection. Although such infections in marine invertebrates are well documented, they are relatively rarely observed in freshwater invertebrates. Herein, we report a field study using a comprehensive series of methodologies (histology, dissection, electron microscopy, gene sequence analysis, and molecular phylogenetics) to investigate the morphology, taxonomy, systematics, geographical distribution, pathogenicity, and seasonal and annual prevalence of a haplosporidian observed in zebra mussels, Dreissena polymorpha. Based on its genetic sequence, morphology, and host, we describe Haplosporidium raabei n. sp. from D. polymorpha - the first haplosporidian species from a freshwater bivalve. Haplosporidium raabei is rare as we observed it in histological sections in only 0·7% of the zebra mussels collected from 43 water bodies across 11 European countries and in none that were collected from 10 water bodies in the United States. In contrast to its low prevalences, disease intensities were quite high with 79·5% of infections advanced to sporogenesis.
Energy Technology Data Exchange (ETDEWEB)
Luschuetzky, E.F. [Univ. Wien, Inst. fuer Zoologie, Abt. fuer Ultrastrukturforschung und Elektronenmikroskopie, Wien (Austria)
2005-07-01
Goal and scope. This study was undertaken to investigate the differences in heavy metal burden between the organisms and environmental compartments and to evaluate the role of Dreissena polymorpha as a bioindicator organism. Methods. The concentrations of zinc, copper, cadmium and lead in whole soft body and selected tissues of D. polymorpha at two river habitats in Austria were examined using atomic absorption spectroscopy (AAS). Concentrations in organisms were compared to those in sediment and water. Results and conclusion. Zebra mussels of the river Drau showed generally higher heavy metal concentrations as compared to mussels of the river Danube and contained elevated zinc and cadmium levels as compared to metal concentrations found in soft tissues of zebra mussels from uncontaminated sites in Germany and The Netherlands. The essential metals zinc and copper were mainly accumulated in gills, foot and byssal gland tissue of the mussel, in contrast to the non-essential metals cadmium and lead which were found predominantly in the midgut gland. The heavy metal concentrations in both, sediments and mussel tissue, were higher than in water samples. There was no correlation between the concentrations in water and in the organisms except for zinc. In contrast, correlations were found between concentrations in sediments and mussel soft tissue. Recommendation and perspective. Further investigations should include the examination of sediments and consider the mechanism of food uptake to assess the role of D. polymorpha as a bioindicator organism. (orig.)
Low cost production of perdeuterated biomass using methylotrophic yeasts
International Nuclear Information System (INIS)
Haon, S.; Auge, S.; Tropis, M.; Milon, A.; Lindley, N.D.
1993-01-01
Three strains of methylotropic yeasts, Candida boidinii, Pichia angusta (previously Hansenula polymorpha) and Pichia pastoris, were studied for their capacity to grow on methanol in deuterated media. Growth rates, determined relative to the extent of deuteration of water and/or methanol, showed that water deuteration was the major limiting factor. After adaptation to deuterium by progressive transfer through media of increasing deuteration, growth rates were diminished relative to those obtained on hydrogenated media of identical salts composition: the two Pichia species retained the highest growth rates in the full deuterated medium. Perdeuterated biomass (16 g) was obtained in a 1 liter fed-batch fermentation and the extent of deuteration of isolated ergosterol has been shown to be 97.5% by mass spectrometric analysis. (Author)
Del Piero, Stefania; Masiero, Luciano; Casellato, Sandra
2012-11-01
Fluoride toxicity and bioaccumulation tests (short- and long-term) were performed on the nonindigenous freshwater mollusk Dreissena polymorpha at two different temperatures: 17 ± 0.5°C and 22 ± 0.5°C. Concentrations that did not result in toxicity in short-term experiments (96 h) induced effects over a longer period (17 weeks), especially at the warmest temperature, highlighting the role of this parameter. Fluoride bioaccumulation increased linearly with increasing concentration and temperature, reaching 4,202 µg F(-)/g dry weight in soft tissues only after 48 h of exposure at 22°C at a concentration of 640 mg F(-)/L. Comparing tolerance to fluoride and bioaccumulation values of this species with those of other freshwater invertebrates, D. polymorpha was much more resistant and revealed its capacity to accumulate a great quantity of this xenobiotic substance. The results of the present study demonstrated that fluoride accumulation in the soft tissue of this animal was much higher (up to 1,409.6 µg F(-)/g dry wt) than that in its shell (up to 706.4 µg F(-)/g dry wt). If we consider this datum and the fact that D. polymorpha is widespread in many aquatic ecosystems around the world, representing a food source for many birds and other vertebrates, we must acknowledge the possibility that it can represent a serious danger in view of fluoride biomagnification in the aquatic environment. Copyright © 2012 SETAC.
Pires, L.M.D.; Bontes, B.M.; Van Donk, E.; Ibelings, B.W.
2005-01-01
Colony forming and toxic cyanobacteria form a problem in surface waters of shallow lakes, both for recreation and wildlife. Zebra mussels, Dreissena polymorpha, have been employed to help to restore shallow lakes in the Netherlands, dominated by cyanobacteria, to their former clear state. Zebra
Directory of Open Access Journals (Sweden)
Waldir Estela Escalante
2012-02-01
Full Text Available The fermentative behaviour of Hansenula anomala RIVE 7-1-5 was studied in order to evaluate the production of chemical compounds of sensory importance. The results demonstrated that the strain ferments very well monosaccharides and also sucrose and maltose. Its fermentative activity was inhibited at concentrations of 100 mg/L of sodium metabisulphite in the medium. Furthermore, it was able to produce 5,81±0,1% (v/v of ethanol. Agitation of the culture medium increases the production of higher alcohols (679,2 mg/L and ethyl acetate (206,0±8,0 mg/L, but on the contrary affects the production of acetic acid (196,0±7,0mg/L. Glycerol production was similar in static (without agitation and shaken cultivation. During batch cultivation carried out in biorreactor under aerated conditions the growth rate (μ reached value of 0,13 h-1 and, it was also observed production of acetic acid at levels of 4,2±0,3 g/L. The oxygen concentration in the medium affects its metabolism, thus insufficient amounts of oxygen would provoke a respirofermentative metabolism with production of ethanol, higher alcohols, esters and acetic acid. The control of aeration during fermentation is a useful tool to control the balance between the respiratory and fermentative activity and thus; synthesis of compounds of sensory importance in the production of non-traditional fermented beverages.Se ha estudiado la actividad fermentativa de Hansenula anomala RIVE 7-1-5 con el objetivo de evaluar la producción de compuestos químicos de importancia sensorial. Los resultados mostraron que fermenta bien monosacáridos y también sucrosa y maltosa. Su actividad fermentativa es inhibida a concentraciones de 100,0mg/L de metabisulfito de sodio en el medio. Además, es capaz de producir 5,81±0,1 % v/v de etanol. La agitación del medio de cultivo incrementa la producción de alcoholes superiores (679,2 mg/L y etil acetato (206,0±8,0 mg/L, por el contrario disminuye la producción de
International Nuclear Information System (INIS)
Riva, Consuelo; Binelli, Andrea; Provini, Alfredo
2008-01-01
Zebra mussel (Dreissena polymorpha) has been used for the biomonitoring of several POPs (PCBs, DDTs, HCB and HCHs) in the largest Italian subalpine great lakes (Lake Maggiore, Garda, Como, Iseo and Lugano). Samplings were carried out in April 2003 at 15 locations selected according to industrial and anthropic levels of lakes. Results have pointed out high DDT levels in D. polymorpha specimens from Lake Maggiore (700-1400 ng/g lipids, 5-9 times higher than those measured in mussels of other Italian lakes), due to a contamination from a chemical plant located on one of the main lake inlet that occurred in 1996. On the contrary, PCB levels (400-2509 ng/g lipids) highlighted an overall pollution, with some sporadic peaks of contamination. Data showed a moderate increase trend compared to those found in a previous monitoring campaign carried out in 1996. Future monitoring is needed in order to confirm this tendency. - Significant levels of DDTs and PCBs are still present in the Italian subalpine great lakes
Energy Technology Data Exchange (ETDEWEB)
Riva, Consuelo [Department of Biology, Ecology Section, University of Milan, Via Celoria 26, 20133 Milan (Italy)], E-mail: consuelo.riva@unimi.it; Binelli, Andrea; Provini, Alfredo [Department of Biology, Ecology Section, University of Milan, Via Celoria 26, 20133 Milan (Italy)
2008-02-15
Zebra mussel (Dreissena polymorpha) has been used for the biomonitoring of several POPs (PCBs, DDTs, HCB and HCHs) in the largest Italian subalpine great lakes (Lake Maggiore, Garda, Como, Iseo and Lugano). Samplings were carried out in April 2003 at 15 locations selected according to industrial and anthropic levels of lakes. Results have pointed out high DDT levels in D. polymorpha specimens from Lake Maggiore (700-1400 ng/g lipids, 5-9 times higher than those measured in mussels of other Italian lakes), due to a contamination from a chemical plant located on one of the main lake inlet that occurred in 1996. On the contrary, PCB levels (400-2509 ng/g lipids) highlighted an overall pollution, with some sporadic peaks of contamination. Data showed a moderate increase trend compared to those found in a previous monitoring campaign carried out in 1996. Future monitoring is needed in order to confirm this tendency. - Significant levels of DDTs and PCBs are still present in the Italian subalpine great lakes.
Pollux, B.J.A.; Minchin, D.; Van der Velde, G.; Van Alen, T.; Moon-Van der Staay, S.Y.; Hackstein, J.
2003-01-01
The zebra mussel (Dreissena polymorpha) is an aquatic nuisance species that invaded Ireland around 1994. We studied the invasion of the zebra mussel combining field surveys and genetic studies, to determine the origin of invasion and the vector of introduction. Field surveys showed that live zebra
Use of zebra mussel (dreissena polymorpha) to assess trace metals in river water
International Nuclear Information System (INIS)
Anzano, J.; Lasheras, R.J.; Bonilla, A.; Anwar, J.
2007-01-01
Ebro river (Spain) has been fairly contaminated by industrial effluents: The toxicity level of the river due to heavy metals has been monitored by analyzing zebra mussels (Dreissena Polymorpha) samples as bioindicator. To access the level of toxicity ten metals (AI, Cd, Cr, Cu, Fe, Ni, Pb, Se, Sn and Zn) were determined by Voltamperometry. The conditions of determination were optimized for each metal prior to determination. Aqueous solutions of metals concerned were used as standards in detenpinations. (author)
Kageyama, Akito; Ishizaki, Kimitsune; Kohchi, Takayuki; Matsuura, Hideyuki; Takahashi, Kosaku
2015-09-01
Environmental stresses are effective triggers for the biosynthesis of various secondary metabolites in plants, and phytohormones such as jasmonic acid and abscisic acid are known to mediate such responses in flowering plants. However, the detailed mechanism underlying the regulation of secondary metabolism in bryophytes remains unclear. In this study, the induction mechanism of secondary metabolites in the model liverwort Marchantia polymorpha was investigated. Abscisic acid (ABA) and ultraviolet irradiation (UV-C) were found to induce the biosynthesis of isoriccardin C, marchantin C, and riccardin F, which are categorized as bisbibenzyls, characteristic metabolites of liverworts. UV-C led to the significant accumulation of ABA. Overexpression of MpABI1, which encodes protein phosphatase 2C (PP2C) as a negative regulator of ABA signaling, suppressed accumulation of bisbibenzyls in response to ABA and UV-C irradiation and conferred susceptibility to UV-C irradiation. These data show that ABA plays a significant role in the induction of bisbibenzyl biosynthesis, which might confer tolerance against UV-C irradiation in M. polymorpha. Copyright © 2015 Elsevier Ltd. All rights reserved.
Leeuw, de J.J.
1999-01-01
The foraging skills of Tufted Duck Aythya fuligula and Scaup Aythya marila feeding on Zebra Mussels Dreissena polymorpha were studied in experiments under semi-natural diving conditions with relevance to the IJsselmeer/Markermeer area (large lakes in the centre of The Netherlands, former Zuiderzee
Modelling the Risk Posed by the Zebra Mussel Dreissena polymorpha: Italy as a Case Study.
Bosso, Luciano; De Conno, Carmelina; Russo, Danilo
2017-08-01
We generated a risk map to forecast the potential effects of the spreading of zebra mussels Dreissena polymorpha across the Italian territory. We assessed the invader's potential impact on rivers, lakes, watersheds and dams at a fine-grained scale and detected those more at risk that should be targeted with appropriate monitoring. We developed a MaxEnt model and employed weighted overlay analyses to detect the species' potential distribution and generate risk maps for Italy. D. polymorpha has a greater probability of occurring at low to medium altitudes in areas characterised by fluviatile deposits of major streams. Northern and central Italy appear more at risk. Some hydroelectric power dams are at high risk, while most dams for irrigation, drinkable water reservoirs and other dam types are at medium to low risk. The lakes and rivers reaches (representing likely expansion pathways) at medium-high or high risk mostly occur in northern and central Italy. We highlight the importance of modelling potential invasions on a country scale to achieve the sufficient resolution needed to develop appropriate monitoring plans and prevent the invader's harmful effects. Further high-resolution risk maps are needed for other regions partly or not yet colonised by the zebra mussel.
Modelling the Risk Posed by the Zebra Mussel Dreissena polymorpha: Italy as a Case Study
Bosso, Luciano; De Conno, Carmelina; Russo, Danilo
2017-08-01
We generated a risk map to forecast the potential effects of the spreading of zebra mussels Dreissena polymorpha across the Italian territory. We assessed the invader's potential impact on rivers, lakes, watersheds and dams at a fine-grained scale and detected those more at risk that should be targeted with appropriate monitoring. We developed a MaxEnt model and employed weighted overlay analyses to detect the species' potential distribution and generate risk maps for Italy. D. polymorpha has a greater probability of occurring at low to medium altitudes in areas characterised by fluviatile deposits of major streams. Northern and central Italy appear more at risk. Some hydroelectric power dams are at high risk, while most dams for irrigation, drinkable water reservoirs and other dam types are at medium to low risk. The lakes and rivers reaches (representing likely expansion pathways) at medium-high or high risk mostly occur in northern and central Italy. We highlight the importance of modelling potential invasions on a country scale to achieve the sufficient resolution needed to develop appropriate monitoring plans and prevent the invader's harmful effects. Further high-resolution risk maps are needed for other regions partly or not yet colonised by the zebra mussel.
De Leeuw, JJ
1999-01-01
The foraging skills of Tufted Duck Aythya fuligula and Scaup Aythya marila feeding on Zebra Mussels Dreissena polymorpha were studied in experiments under seminatural diving conditions with relevance to the IJssalmeer/Markermeer area (large lakes in the centre of The Netherlands, former Zuiderzee
Lewis, K.M.; Feder, J.L.; Horvath, T.G.; Lamberti, G.A.
2000-01-01
A number of studies have found positive associations between allozyme heterozygosity and fitness surrogates (e.g., body size and growth rate) for marine molluscs. We investigated whether similar relationships exist for freshwater populations of the zebra mussel, Dreissena polymorpha. Only one significant correlation between multi-locus heterozygosity and shell length was observed for a total of 22 D. polymorpha populations surveyed from midwestern U.S.A. lakes and streams, and the result was not significant on a table-wide basis. Meta-analysis revealed a significant common correlation coefficient (effect magnitude) between multi-locus heterozygosity and shell length across all 22 sites (rc = 0.052, P = 0.019, 1557 df). However, the variance in shell length explained by multi-locus heterozygosity was small (rc2 = 0.0027), implying a weak causal relationship if any. Also, we saw no relationship between heterozygosity and growth rate in a one-year field enclosure experiment. A significant heterozygosity-shell length correlation previously reported for a zebra mussel population at Put-in-Bay, Lake Erie, Ohio, may have been the product of unique population dynamics, rather than natural selection. Similar demographic considerations may contribute to inconsistencies in heterozygosity-fitness correlations seen for other molluscs.
International Nuclear Information System (INIS)
Frank, Sabrina N.; Singer, Christoph; Sures, Bernd
2008-01-01
The effects of different exposure concentrations of palladium (Pd) on relative metallothionein (MT) response and bioaccumulation were investigated in zebra mussels (Dreissena polymorpha). The mussels were exposed to 0.05, 5, 50, and 500 μg/L Pd 2+ for 10 weeks under controlled temperature and fasting conditions. Relative MT contents were assessed by a modified Ag-saturation method, which allows to discriminate between MT bound to Pd (Pd-MT) and MT bound to unidentified metals (Ag-MT). Determination of metal contents resulted from atomic absorption spectrometry following a microwave digestion. For unexposed mussels and mussels exposed to 0.05 μg/L Pd no metal accumulation could be detected. All other exposure concentrations resulted in detectable Pd accumulation in mussels with final tissue concentrations of 96 μg/g (500 μg/L), 45 μg/g (50 μg/L), and 9 μg/g (5 μg/L). Compared with initial levels Pd-MT concentrations at the end of the exposure period were 600 (500 μg/L), 160 (50 μg/L), and 27 (5 μg/L) times higher. These results show that an increase in MTs in D. polymorpha already occurs at relatively low aqueous Pd concentrations indicating that there is the need for detoxification of Pd in the mussel. Furthermore, correlations between Ag-MT and Pd accumulation indicate that higher exposure concentrations are associated with adverse effects on the mussels. Thus, harmful effects of chronic Pd exposure of organisms even in lowest concentrations cannot be excluded in the environment
Fluorescence analysis of the Hansenula polymorpha peroxisomal targeting signal-1 receptor, Pex5p
Boteva, R.; Koek, A.; Visser, N.V.; Visser, A.J.W.G.; Krieger, E.; Zlateva, T.; Veenhuis, M.; Klei, van der I.
2003-01-01
Correct sorting of newly synthesized peroxisomal matrix proteins is dependent on a peroxisomal targeting signal (PTS). So far two PTSs are known. PTS1 consists of a tripeptide that is located at the extreme C terminus of matrix proteins and is specifically recognized by the PTS1-receptor Pex5p. We
Rossatto,Davi Rodrigo; Kolb,Rosana Marta
2010-01-01
Gochnatia polymorpha (Less.) Cabrera is a widespread Asteraceae species found in different physiognomies of cerrado (Neotropical savanna) and in forest formations of southeast Brazil. This study describes some leaf anatomy characteristics of this species and quantitatively evaluates them in relation to different environments, as well as under different light conditions. We found quantitative differences in all anatomical parameters analyzed. The results demonstrate that high leaf anatomy plas...
Influence of lead tetraethyl on the growth of Funaria hygrometrica L. and Marchantia polymorpha L.
Directory of Open Access Journals (Sweden)
Irena Krupińska
2015-01-01
Full Text Available The influence of various lead tetraethyl concentrations (mixture added to petrol as antiknock agent on the growth and development of Funaria hygrometrica L. spores and of Marchantia polymorpha L. gemmulae was investigated. An inhibitory effect of the concentration applied was noted on germination and growth of spores and gemmulae development. Lead tetraethyl produces disturbances In the development of these plants, gradual degeneration of chloroplasts occurs and inhibition of growth leading to profusely branched "dwarf" forms. The disturbances are largely reversible.
Leeuw, de J.J.; Eerden, van M.R.; Visser, G.H.
1999-01-01
Diving ducks face the strongly cooling properties of aquatic environments. In experiments with Tufted Ducks Aythya fuligula feeding on zebra mussels Dreissena polymorpha in outdoor cages, we measured changes in food consumption and diving behaviour in relation to water temperature (3-22°C). Water
de Leeuw, JJ; van Eerden, MR; Visser, GH
Diving ducks face the strongly cooling properties of aquatic environments. In experiments with Tufted Ducks Aythya fuligula feeding on zebra mussels Dreissena polymorpha in outdoor cages, we measured changes in food consumption and diving behaviour in relation to water temperature (3-22 degrees C).
Conn, D B; Ricciardi, A; Babapulle, M N; Klein, K A; Rosen, D A
1996-01-01
Dreissenid mussels, Dreissena polymorpha and D. bugensis, were found to be infected by the naidid oligochaete Chaetogaster limnaei at four sites in the St. Lawrence River. This is the first report of this species infecting dreissenids anywhere in the world. Most worms inhabited the mantle cavity, where they caused erosion of the mantle and gill epithelia as determined by histopathological examination. Others penetrated various tissues; one had invaded the ovary and was feeding on oocytes and ovarian tissues. Of 606 mussels examined, 166 (27.4%) harbored at least 1 C. limnaei. The prevalence varied between 1% and 80%, depending on the collection site and date. The worms were slightly but significantly more prevalent in D. bugensis than in D. polymorpha. The intensity ranged from 1 to 18 worms per infected host. Variations in prevalence and intensity were not related to the size or sex of the host, but the data did suggest some seasonality.
Energy Technology Data Exchange (ETDEWEB)
Avakyan, Z A
1967-01-01
Polarographic study of Pb/sup 2 +/, Cd/sup 2 +/, Co/sup 2 +/, and Ni/sup 2 +/ concentration in different media has shown that at pH 6.0, Pb/sup 2 +/ is always precipitated by phosphates and cannot be determined polarographically. Cd, Co and Ni content is somewhat lower than that found in water solutions. The effect of Ag, Hg, Co, Ni, Pb, and Cd ions on the growth of 3 strains of Rhodotorula, Hansenula anomala and T. utilis, 6 strains of Serratia, 6 strains of Azotobacter, 12 strains of Pseudomonas and 2 strains of E. coli was studied. According to their toxicity for the microoganisms tested, heavy metals should be arranged in the following order: Ag>Hg>Cogreater than or equal toNi>Cd. Yeasts are the least sensitive to the action of heavy metals, cf. come serratia, Pseudomonas, Azotobacter and E. coli.
Factorial microarray analysis of zebra mussel (Dreissena polymorpha: Dreissenidae, Bivalvia adhesion
Directory of Open Access Journals (Sweden)
Faisal Mohamed
2010-05-01
Full Text Available Abstract Background The zebra mussel (Dreissena polymorpha has been well known for its expertise in attaching to substances under the water. Studies in past decades on this underwater adhesion focused on the adhesive protein isolated from the byssogenesis apparatus of the zebra mussel. However, the mechanism of the initiation, maintenance, and determination of the attachment process remains largely unknown. Results In this study, we used a zebra mussel cDNA microarray previously developed in our lab and a factorial analysis to identify the genes that were involved in response to the changes of four factors: temperature (Factor A, current velocity (Factor B, dissolved oxygen (Factor C, and byssogenesis status (Factor D. Twenty probes in the microarray were found to be modified by one of the factors. The transcription products of four selected genes, DPFP-BG20_A01, EGP-BG97/192_B06, EGP-BG13_G05, and NH-BG17_C09 were unique to the zebra mussel foot based on the results of quantitative reverse transcription PCR (qRT-PCR. The expression profiles of these four genes under the attachment and non-attachment were also confirmed by qRT-PCR and the result is accordant to that from microarray assay. The in situ hybridization with the RNA probes of two identified genes DPFP-BG20_A01 and EGP-BG97/192_B06 indicated that both of them were expressed by a type of exocrine gland cell located in the middle part of the zebra mussel foot. Conclusions The results of this study suggested that the changes of D. polymorpha byssogenesis status and the environmental factors can dramatically affect the expression profiles of the genes unique to the foot. It turns out that the factorial design and analysis of the microarray experiment is a reliable method to identify the influence of multiple factors on the expression profiles of the probesets in the microarray; therein it provides a powerful tool to reveal the mechanism of zebra mussel underwater attachment.
Xu, Wei; Faisal, Mohamed
2010-05-28
The zebra mussel (Dreissena polymorpha) has been well known for its expertise in attaching to substances under the water. Studies in past decades on this underwater adhesion focused on the adhesive protein isolated from the byssogenesis apparatus of the zebra mussel. However, the mechanism of the initiation, maintenance, and determination of the attachment process remains largely unknown. In this study, we used a zebra mussel cDNA microarray previously developed in our lab and a factorial analysis to identify the genes that were involved in response to the changes of four factors: temperature (Factor A), current velocity (Factor B), dissolved oxygen (Factor C), and byssogenesis status (Factor D). Twenty probes in the microarray were found to be modified by one of the factors. The transcription products of four selected genes, DPFP-BG20_A01, EGP-BG97/192_B06, EGP-BG13_G05, and NH-BG17_C09 were unique to the zebra mussel foot based on the results of quantitative reverse transcription PCR (qRT-PCR). The expression profiles of these four genes under the attachment and non-attachment were also confirmed by qRT-PCR and the result is accordant to that from microarray assay. The in situ hybridization with the RNA probes of two identified genes DPFP-BG20_A01 and EGP-BG97/192_B06 indicated that both of them were expressed by a type of exocrine gland cell located in the middle part of the zebra mussel foot. The results of this study suggested that the changes of D. polymorpha byssogenesis status and the environmental factors can dramatically affect the expression profiles of the genes unique to the foot. It turns out that the factorial design and analysis of the microarray experiment is a reliable method to identify the influence of multiple factors on the expression profiles of the probesets in the microarray; therein it provides a powerful tool to reveal the mechanism of zebra mussel underwater attachment.
Directory of Open Access Journals (Sweden)
Davi Rodrigo Rossatto
2010-09-01
Full Text Available Gochnatia polymorpha (Less. Cabrera is a widespread Asteraceae species found in different physiognomies of cerrado (Neotropical savanna and in forest formations of southeast Brazil. This study describes some leaf anatomy characteristics of this species and quantitatively evaluates them in relation to different environments, as well as under different light conditions. We found quantitative differences in all anatomical parameters analyzed. The results demonstrate that high leaf anatomy plasticity is an adaptive advantage that allows this species to occur in diverse cerrado conditions.Gochnatia polymorpha (Less. Cabrera é uma espécie de Asteraceae com ampla distribuição no bioma cerrado, sendo encontrada em diversas fisionomias florestais da região sudeste do Brasil. O presente estudo descreve alguns caracteres anatômicos foliares dessa espécie e os analisa quantitativamente em função de sua ocorrência nas formações florestais e também das diferenças de luminosidade. Foram encontradas diferenças quantitativas em todos os parâmetros anatômicos analisados. Os resultados demonstram que a alta plasticidade anatômica foliar nesta espécie pode ser considerada como uma vantagem adaptativa que a permite ocorrer em diversos ambientes do cerrado.
Stoyanova, Stefka; Nikolov, Galin; Velichkova, Katya; Atanasoff, Alexander; Mumun, Sevdegul
2015-01-01
Zebra mussels (Dreissena polymorpha) are bivalve mollusks approximately 1 to 5 cm long that live in freshwater lakes. They have invaded many Bulgarian freshwater ecosystems in recent decades. Because of their ability to settle on almost any substrate, zebra mussels cause severe damage to closed water systems, RAS and intensive fish farming systems. In order to assess the status of the mussel population in the lake in the area of the Forest group fish farm, the distribution, extent of coloniza...
International Nuclear Information System (INIS)
Sures, Bernd; Zimmermann, Sonja
2007-01-01
Zebra mussels (Dreissena polymorpha) were exposed to different types of water containing PGE salts (PtCl 4 , PdSO 4 , RhCl 3 ) to investigate the influence of humic substances on the aqueous solubility, uptake and bioaccumulation of noble metals. The results showed a time dependent decrease of the aqueous PGE concentrations in tank water for all groups. This could mainly be related to non-biological processes. The aqueous solubility of Pd and Rh was higher in humic water compared with non-chlorinated tap water, whereas Pt showed opposing results. Highest metal uptake rates and highest bioaccumulation plateaus were found for Pd, followed by Pt and Rh. Pd uptake and bioaccumulation was significantly hampered by humic substances, whose presence appear to increase Pt uptake and bioaccumulation. No clear trend emerged for Rh. Differences in effects of humic matter among the PGE may be explained by formation of metal complexes with different fractions of humic substances. - Precious metal accumulation in Dreissena polymorpha is affected by humic substances
REYNOLDS J. D.; DONOHOE R.
2001-01-01
The zebra mussel Dreissena polymorpha, native to the Aralo-Caspian region, has spread across Europe in the last 180 years. Although it reached England in 1820, it only arrived in Ireland in around 1995, probably attached to the hull of pleasure boats, and since then has spread through the lowland Shannon and Erne systems, which are linked by canal. While White-clawed crayfish Austropotamobius pallipes (Lereboullet) occur in these systems, Dreissena has not yet colonized sites with large crayf...
Energy Technology Data Exchange (ETDEWEB)
Al-Aasm, I.S.; Clarke, J.D.; Fryer, B.J. [Windsor Univ., ON (Canada). Dept. of Earth Sciences
1998-02-01
Dreissena polymorpha is an exotic freshwater bivalve species which was introduced into the Great Lakes system in the fall of 1985 through the release of ballast water from European freighters. Utilizing individual growth rings of the shells, the stable isotope distribution ({delta}{sup 18}O and {delta}{sup 13}C) was determined for the life history of selected samples which were collected from the western basin of Lake Erie. These bivalves deposit their shell in near equilibrium with the ambient water and thus reflect any annual variation of the system in the isotopic records held within their shells. Observed values for {delta}{sup 18}O range from -6.64 to -9.46 permille with an average value of -7.69 permille PDB, while carbon values ranged from -0.80 to -4.67 permille with an average value of -1.76 permille PDB. Dreissena polymorpha shells incorporate metals into their shells during growth. Individual shell growth increments were analyzed for Pb, Fe, Mg, Mn, Cd, Cu, and V concentrations. The shells show increased uptake of certain metals during periods of isotopic enrichment which correspond with warmer water temperatures. Since metals are incorporated into the shells, the organism may be useful as a biomonitor of metal pollution within aquatic environments. (orig.)
Directory of Open Access Journals (Sweden)
Leyli Gholamhosseini
2007-03-01
Full Text Available Zebra mussel (Dreissenidae polymorpha is capable of filtering great volumes of water due to its high population density. In this study, Nitrate and Phosphate removal capability of 3 shell masses (20, 40, and 60 gr in urban wastewater was investigated based on filtering rate measurements (using simultaneous phytoplankton, chlorella, and Scenedesmus cultures and indirect absorption of nitrate and phosphate in open and closed systems with 3 to 10 replications. Open and closed systems showed a positive correlation between shell weights and Nitrate and Phosphate filtration rates (R2 =0.99 but a negative correlation between influent Nitrate and Phosphate concentrations and their filtration rates (R2=0.97. Increasing of shell weights in the open system resulted in absorption rates of 0.08-0.2mg.l-1 of the shell dry weight for Nitrate and 0.02-0.04 mg.l-1 for Phosphate. In the closed system, these rates were 0.03-0.11 mg.l-1 of the shell dry weight for Nitrate absorption and 0.01-0.02 mg.l-1 for Phosphate. These results show that shell masses have a low nitrate and phosphate removal efficiency, especially in the case of phosphate, and they can not be, therefore, recommended for urban wastewater treatment.
Oganjan, Katarina; Lauringson, Velda; Kotta, Jonne; Rostin, Liis; Martin, Georg
2017-01-01
Species invasions are modifying ecosystems worldwide. Coexistence of invasive species of no common evolutionary history in their new ranges enables the study of ecological rules shaping novel communities at their initial stages. In oligohaline parts of the Baltic Sea, the most dominant and widespread epifaunal suspension feeders are invasive mussels Dreissena polymorpha and cirripeds Amphibalanus improvisus. This study experimentally evaluated recruitment and microhabitat use in response to environmental forcing in these two species in a eutrophic bay. Recruitment was structured by different microhabitat exploitation patterns coupled with both individual and interactive effects of several environmental gradients. Despite functional similarity, the importance of environmental gradients differed between these species: mussel recruitment was best explained by temperature while barnacle recruitment was best explained by wave exposure. Zebra mussels were more fastidious about surface orientation than barnacles. The preferred orientations also differed between species, as mussels strongly preferred horizontal surfaces, while barnacles were more abundant on vertical surfaces. Increase in one species also predicted well the abundance of the other, especially for barnacles, as mussel abundance was the best predictor of barnacle abundance over all the other factors. The extent of microhabitat segregation correlated weakly over the studied range of the most important environmental gradients. The study shows that coexistence of functionally similar non-native D. polymorpha and A. improvisus in their sympatric range is likely determined by complex interactions between these species, their different microhabitat exploitation patterns, environmental limitations and optima.
Wagner, James M; Alper, Hal S
2016-04-01
Coupling the tools of synthetic biology with traditional molecular genetic techniques can enable the rapid prototyping and optimization of yeast strains. While the era of yeast synthetic biology began in the well-characterized model organism Saccharomyces cerevisiae, it is swiftly expanding to include non-conventional yeast production systems such as Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. These yeasts already have roles in the manufacture of vaccines, therapeutic proteins, food additives, and biorenewable chemicals, but recent synthetic biology advances have the potential to greatly expand and diversify their impact on biotechnology. In this review, we summarize the development of synthetic biological tools (including promoters and terminators) and enabling molecular genetics approaches that have been applied in these four promising alternative biomanufacturing platforms. An emphasis is placed on synthetic parts and genome editing tools. Finally, we discuss examples of synthetic tools developed in other organisms that can be adapted or optimized for these hosts in the near future. Copyright © 2015 Elsevier Inc. All rights reserved.
Stokes, B. O.; Petersen, G. R.
1982-01-01
The benefits and deficiencies of various candidates for a controlled ecological life support system (CELSS) for manned spacecraft missions of at least 3-14 yr are discussed. Conventional plants are considered unacceptable due to their inefficient production of foodstuffs and overproduction of stems and leafy matter. The alternate concepts are algae and/or bacteria or chemical synthesis of food. Microorganisms are considered the most promising because of their direct use of CO2 and possible utilization of waste streams. Yeasts are cited as the most viable candidates, since a large data base and experience already exists in the commercial food industry. The addition of hydrogen bactria and solar-grown algae is recommended, together with genetic manipulation experiments to tailor the microorganisms to production of foodstuffs closer to the 70 percent carbohydrate, 20 percent protein, and 10 percent lipid optimal food currently accepted. The yeast strain, Hansenula polymorpha, has been successfully grown in methanol and encouraged to produce a 55 percent carbohydrate content.
Svenningsen, Nanna B.; Heisterkamp, Ines M.; Sigby-Clausen, Maria; Larsen, Lone H.; Nielsen, Lars Peter; Stief, Peter
2012-01-01
Nitrification in shell biofilms and denitrification in the gut of the animal accounted for N2O emission by Dreissena polymorpha (Bivalvia), as shown by gas chromatography and gene expression analysis. The mussel's ammonium excretion was sufficient to sustain N2O production and thus potentially uncouples invertebrate N2O production from environmental N concentrations. PMID:22492461
Bioaccumulation and partitioning of cadmium within the freshwater mussel Dreissena polymorpha Pallas
International Nuclear Information System (INIS)
Bias, R.; Karbe, L.
1985-01-01
Kinetics of uptake, partitioning and elimination of cadmium were investigated in experimental studies with the freshwater mussel, Dreissena polymorpha. 109 Cd and 115 Cd were used as tracers. Shells, soft parts and body fluid of the mussel exhibited considerable differences in accumulation and elimination. Accumulation factors up to more than 70,000 were calculated for the periostracum, whereas accumulation factors for the whole mussels ranging up to 3,000 were calculated. The shells bound a great deal of cadmium, but only loosely, and the metal could be readily eliminated after transfer to uncontaminated water. In contrast, no significant amounts of the cadmium incorporated in the soft parts were eliminated. The results indicate that the major portion of cadmium in the soft parts is strongly bound and cannot be eliminated by exchange processes. (author)
Biomonitoring of Inland and Inshore Waters with Use of Dreissena Polymorpha Mussels
Directory of Open Access Journals (Sweden)
Matuszak Piotr
2015-09-01
Full Text Available The pollution of water that is used for consumption and in agricultural holdings contributes to an increased mortality rate, inhibition of growth and physiological functions, changes in the DNA (genotoxicity, changes within tissues (cytotoxicity and organs of individuals who are exposed to chemical components. One of the most dangerous toxin classes which have effect on animals and humans who come into contact with contaminated water is the class of cyanobacterial toxins released by dying cyanobacteria. They contribute to very serious health conditions and also to fatalities. Toxins of this type are relatively difficult to detect on account of their seasonal changeability in blooming. One of the most effective methods of detecting water contamination automatically and continuously is biomonitoring with the use of Dreissena polymorpha mussels.
Energy Technology Data Exchange (ETDEWEB)
Sures, Bernd [Department of Applied Zoology/Hydrobiology, University of Duisburg-Essen, D-45177 Essen (Germany)]. E-mail: bernd.sures@uni-due.de; Zimmermann, Sonja [Department of Applied Zoology/Hydrobiology, University of Duisburg-Essen, D-45177 Essen (Germany)
2007-03-15
Zebra mussels (Dreissena polymorpha) were exposed to different types of water containing PGE salts (PtCl{sub 4}, PdSO{sub 4}, RhCl{sub 3}) to investigate the influence of humic substances on the aqueous solubility, uptake and bioaccumulation of noble metals. The results showed a time dependent decrease of the aqueous PGE concentrations in tank water for all groups. This could mainly be related to non-biological processes. The aqueous solubility of Pd and Rh was higher in humic water compared with non-chlorinated tap water, whereas Pt showed opposing results. Highest metal uptake rates and highest bioaccumulation plateaus were found for Pd, followed by Pt and Rh. Pd uptake and bioaccumulation was significantly hampered by humic substances, whose presence appear to increase Pt uptake and bioaccumulation. No clear trend emerged for Rh. Differences in effects of humic matter among the PGE may be explained by formation of metal complexes with different fractions of humic substances. - Precious metal accumulation in Dreissena polymorpha is affected by humic substances.
An engineered yeast efficiently secreting penicillin.
Directory of Open Access Journals (Sweden)
Loknath Gidijala
Full Text Available This study aimed at developing an alternative host for the production of penicillin (PEN. As yet, the industrial production of this beta-lactam antibiotic is confined to the filamentous fungus Penicillium chrysogenum. As such, the yeast Hansenula polymorpha, a recognized producer of pharmaceuticals, represents an attractive alternative. Introduction of the P. chrysogenum gene encoding the non-ribosomal peptide synthetase (NRPS delta-(L-alpha-aminoadipyl-L-cysteinyl-D-valine synthetase (ACVS in H. polymorpha, resulted in the production of active ACVS enzyme, when co-expressed with the Bacillus subtilis sfp gene encoding a phosphopantetheinyl transferase that activated ACVS. This represents the first example of the functional expression of a non-ribosomal peptide synthetase in yeast. Co-expression with the P. chrysogenum genes encoding the cytosolic enzyme isopenicillin N synthase as well as the two peroxisomal enzymes isopenicillin N acyl transferase (IAT and phenylacetyl CoA ligase (PCL resulted in production of biologically active PEN, which was efficiently secreted. The amount of secreted PEN was similar to that produced by the original P. chrysogenum NRRL1951 strain (approx. 1 mg/L. PEN production was decreased over two-fold in a yeast strain lacking peroxisomes, indicating that the peroxisomal localization of IAT and PCL is important for efficient PEN production. The breakthroughs of this work enable exploration of new yeast-based cell factories for the production of (novel beta-lactam antibiotics as well as other natural and semi-synthetic peptides (e.g. immunosuppressive and cytostatic agents, whose production involves NRPS's.
Yeast synthetic biology for the production of recombinant therapeutic proteins.
Kim, Hyunah; Yoo, Su Jin; Kang, Hyun Ah
2015-02-01
The production of recombinant therapeutic proteins is one of the fast-growing areas of molecular medicine and currently plays an important role in treatment of several diseases. Yeasts are unicellular eukaryotic microbial host cells that offer unique advantages in producing biopharmaceutical proteins. Yeasts are capable of robust growth on simple media, readily accommodate genetic modifications, and incorporate typical eukaryotic post-translational modifications. Saccharomyces cerevisiae is a traditional baker's yeast that has been used as a major host for the production of biopharmaceuticals; however, several nonconventional yeast species including Hansenula polymorpha, Pichia pastoris, and Yarrowia lipolytica have gained increasing attention as alternative hosts for the industrial production of recombinant proteins. In this review, we address the established and emerging genetic tools and host strains suitable for recombinant protein production in various yeast expression systems, particularly focusing on current efforts toward synthetic biology approaches in developing yeast cell factories for the production of therapeutic recombinant proteins. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permission@oup.com.
Hoy, M.S.; Kelly, K.; Rodriguez, R.J.
2010-01-01
A 3-primer PCR system was developed to discriminate invasive zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussel. The system is based on: 1) universal primers that amplifies a region of the nuclear 28s rDNA gene from both species and 2) a species-specific primer complementary to either zebra or quagga mussel. The species-specific primers bind to sequences between the binding sites for the universal primers resulting in the amplification of two products from the target species and one product from the nontarget species. Therefore, nontarget products are positive amplification controls. The 3-primer system accurately discriminated zebra and quagga mussels from seven geographically distinct populations.
Mortality of zebra mussel, Dreissena polymorpha, veligers during downstream transport
Horvath, T.G.; Lamberti, G.A.
1999-01-01
1. Streams flowing from lakes which contain zebra mussels, Dreissena polymorpha, provide apparently suitable habitats for mussel colonization and downstream range expansion, yet most such streams contain few adult mussels. We postulated that mussel veligers experience high mortality during dispersal via downstream transport. They tested this hypothesis in Christiana Creek, a lake-outlet stream in south-western Michigan, U.S.A., in which adult mussel density declined exponentially with distance downstream. 2. A staining technique using neutral red was developed and tested to distinguish quickly live and dead veligers. Live and dead veligers were distinguishable after an exposure of fresh samples to 13.3 mg L-1 of neutral red for 3 h. 3. Neutral red was used to determine the proportion of live veligers in samples taken longitudinally along Christiana Creek. The proportion of live veligers (mean ?? SE) declined from 90 ?? 3% at the lake outlet to 40 ?? 8% 18 km downstream. 4. Veligers appear to be highly susceptible to damage by physical forces (e.g. shear), and therefore, mortality in turbulent streams could be an important mechanism limiting zebra mussel dispersal to downstream reaches. Predictions of zebra mussel spread and population growth should consider lake-stream linkages and high mortality in running waters.
McLaughlan, Claire; Rose, Paul; Aldridge, David C.
2014-01-01
Invasive non-native species frequently occur in very high densities. Where such invaders present an economic or ecological nuisance this biomass is typically removed and landfill is the most common destination, which is undesirable from both an economic and ecological perspective. The zebra mussel, Dreissena polymorpha, has invaded large parts of Europe and North America, and is routinely removed from raw water systems where it creates a biofouling nuisance. We investigated the suitability...
Graczyk, Thaddeus K; Conn, David Bruce; Lucy, Frances; Minchin, Dan; Tamang, Leena; Moura, Lacy N S; DaSilva, Alexandre J
2004-08-01
Zebra mussels ( Dreissena polymorpha) from throughout the Shannon River drainage area in Ireland were tested for the anthropozoonotic waterborne parasites Cryptosporidium parvum, Giardia lamblia, Encephalitozoon intestinalis, E. hellem, and Enterocytozoon bieneusi, by the multiplexed combined direct immunofluorescent antibody and fluorescent in situ hybridization method, and PCR. Parasite transmission stages were found at 75% of sites, with the highest mean concentration of 16, nine, and eight C. parvum oocysts, G. lamblia cysts, and Encephalitozoon intestinalis spores/mussel, respectively. On average eight Enterocytozoon bieneusi spores/mussel were recovered at any selected site. Approximately 80% of all parasites were viable and thus capable of initiating human infection. The Shannon River is polluted with serious emerging human waterborne pathogens including C. parvum, against which no therapy exists. Zebra mussels can recover and concentrate environmentally derived pathogens and can be used for the sanitary assessment of water quality.
Energy Technology Data Exchange (ETDEWEB)
Couleau, Nicolas; Techer, Didier [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), CNRS UMR 7146, IUT Thionville-Yutz, Espace Cormontaigne, Yutz, F-57970 (France); Pagnout, Christophe [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), UMR 7146, Campus Bridoux, rue du General Delestraint, Metz, F-57070 (France); International Consortium for the Environmental Implications of Nanotechnology, iCEINT, http://www.i-ceint.org (France); Jomini, Stephane [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), UMR 7146, Campus Bridoux, rue du General Delestraint, Metz, F-57070 (France); Foucaud, Laurent; Laval-Gilly, Philippe; Falla, Jairo [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), CNRS UMR 7146, IUT Thionville-Yutz, Espace Cormontaigne, Yutz, F-57970 (France); Bennasroune, Amar, E-mail: amar.bennasroune@univ-metz.fr [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), CNRS UMR 7146, IUT Thionville-Yutz, Espace Cormontaigne, Yutz, F-57970 (France)
2012-11-01
The widespread use of titanium-based nanoparticles and their environmental release may pose a significant risk to aquatic organisms within freshwater ecosystems. Suspension-feeder invertebrates like bivalve molluscs represent a unique target group for nanoparticle toxicology. The aim of this work was to investigate the short-term responses of Dreissena polymorpha hemocytes after in vivo exposure to titanium dioxide nanoparticles (TiO{sub 2} NP). For this purpose, freshwater mussels were exposed to P25 TiO{sub 2} NP at the concentrations of 0.1, 1, 5 and 25 mg/L during 24 h. Viability, phagocytosis activity and mitogen activated protein kinase (MAPK) phosphorylation level of ERK 1/2 and p38 in hemocytes extracted from exposed mussels were compared to those from control specimens. Results demonstrated an inhibition of the phagocytosis activity after exposure to TiO{sub 2} NP at 0.1 and 1 mg/L. Similar trends, albeit less pronounced, were reported for higher concentrations of NP. Transmission electron microscopy showed for the first time the internalization of TiO{sub 2} NP into Dreissena polymorpha hemocytes. Besides, exposure to NP increased the ERK 1/2 phosphorylation levels in all treatments. Concerning the phosphorylation level of p38, only exposures to 5 and 25 mg/L of NP induced significant p38 activation in comparison to that of the control. Finally, these short-term effects observed at environmentally relevant concentrations highlighted the need for further studies concerning ecotoxicological evaluation of nanoparticle release into an aquatic environment. -- Highlights: Black-Right-Pointing-Pointer Phagocytosis inhibition at TiO{sub 2} NP exposure concentrations of 0.1 and 1 mg/L. Black-Right-Pointing-Pointer Internalization of TiO{sub 2} NP in freshwater mussel hemocytes. Black-Right-Pointing-Pointer Increased phosphorylation level of p38 and ERK 1/2 after in vivo exposure to TiO{sub 2} NP.
Hoy, Marshal S; Kelly, Kevin; Rodriguez, Rusty J
2010-01-01
A 3-primer PCR system was developed to discriminate invasive zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussel. The system is based on: 1) universal primers that amplifies a region of the nuclear 28s rDNA gene from both species and 2) a species-specific primer complementary to either zebra or quagga mussel. The species-specific primers bind to sequences between the binding sites for the universal primers resulting in the amplification of two products from the target species and one product from the nontarget species. Therefore, nontarget products are positive amplification controls. The 3-primer system accurately discriminated zebra and quagga mussels from seven geographically distinct populations. Published 2009. This article is a US Government work and is the public domain in the USA.
Binelli, A; Guzzella, L; Roscioli, C
2008-06-01
Several congeners of polybrominated diphenyl ethers (PBDEs) were monitored in 14 different sampling stations of Lake Maggiore, the second largest Italian lake in regard to surface, volume and average depth, using the sentinel-organism Zebra mussel (Dreissena polymorpha). Results revealed a moderate contamination with summation operatorPBDE levels (BDE-17, -28, -47, -66, -71, -85, -99, -100, -138, -153, -154, -183, -190 and -209) ranging from 40 to 447ngg(-1) lipid weight which are similar to those found in environments polluted by deposition or atmospheric transport. The general order of decreasing congener contribution to the total load was BDE-47>-99>-100>-209, which closely reflected patterns observed in mussels collected in freshwater ecosystems worldwide.
Bischoff, Paul J; Wetmore, Scott
2009-01-01
In North America, zebra mussels (Dreissena polymorpha) are notoriously known as invasive species. The abundance of naked amoebae sampled from the shells of zebra mussels was compared with abundances from rock scrapings at approximately monthly intervals for 1 year. The sites were 2 km apart along the same shoreline. No significant difference in abundance of naked amoebae (F = 1.44; P
Stasyuk, Nataliya; Smutok, Oleh; Gayda, Galina; Vus, Bohdan; Koval'chuk, Yevgen; Gonchar, Mykhailo
2012-01-01
A novel L-arginine-selective amperometric bi-enzyme biosensor based on recombinant human arginase I isolated from the gene-engineered strain of methylotrophic yeast Hansenula polymorpha and commercial urease is described. The biosensing layer was placed onto a polyaniline-Nafion composite platinum electrode and covered with a calcium alginate gel. The developed sensor revealed a good selectivity to L-arginine. The sensitivity of the biosensor was 110 ± 1.3 nA/(mM mm(2)) with the apparent Michaelis-Menten constant (K(M)(app)) derived from an L-arginine (L-Arg) calibration curve of 1.27 ± 0.29 mM. A linear concentration range was observed from 0.07 to 0.6mM, a limit of detection being 0.038 mM and a response time - 10s. The developed biosensor demonstrated good storage stability. A laboratory prototype of the proposed amperometric biosensor was applied to the samples of three commercial pharmaceuticals ("Tivortin", "Cytrarginine", "Aminoplazmal 10% E") for L-Arg testing. The obtained L-Arg-content values correlated well with those declared by producers. Copyright © 2012 Elsevier B.V. All rights reserved.
Genome and metabolic engineering in non-conventional yeasts: Current advances and applications.
Löbs, Ann-Kathrin; Schwartz, Cory; Wheeldon, Ian
2017-09-01
Microbial production of chemicals and proteins from biomass-derived and waste sugar streams is a rapidly growing area of research and development. While the model yeast Saccharomyces cerevisia e is an excellent host for the conversion of glucose to ethanol, production of other chemicals from alternative substrates often requires extensive strain engineering. To avoid complex and intensive engineering of S. cerevisiae, other yeasts are often selected as hosts for bioprocessing based on their natural capacity to produce a desired product: for example, the efficient production and secretion of proteins, lipids, and primary metabolites that have value as commodity chemicals. Even when using yeasts with beneficial native phenotypes, metabolic engineering to increase yield, titer, and production rate is essential. The non-conventional yeasts Kluyveromyces lactis, K. marxianus, Scheffersomyces stipitis, Yarrowia lipolytica, Hansenula polymorpha and Pichia pastoris have been developed as eukaryotic hosts because of their desirable phenotypes, including thermotolerance, assimilation of diverse carbon sources, and high protein secretion. However, advanced metabolic engineering in these yeasts has been limited. This review outlines the challenges of using non-conventional yeasts for strain and pathway engineering, and discusses the developed solutions to these problems and the resulting applications in industrial biotechnology.
Energy Technology Data Exchange (ETDEWEB)
Madhavan, Aravind [Biotechnology Division, National Institute for Interdisciplinary Science and Technology, Council of Scientific and Industrial Research, Trivandrum (India); Rajiv Gandhi Centre for Biotechnology, Trivandrum (India); Jose, Anju Alphonsa; Binod, Parameswaran; Sindhu, Raveendran, E-mail: sindhurgcb@gmail.com; Sukumaran, Rajeev K. [Biotechnology Division, National Institute for Interdisciplinary Science and Technology, Council of Scientific and Industrial Research, Trivandrum (India); Pandey, Ashok [Biotechnology Division, National Institute for Interdisciplinary Science and Technology, Council of Scientific and Industrial Research, Trivandrum (India); Center for Innovative and Applied Bioprocessing, Mohali, Punjab (India); Castro, Galliano Eulogio [Dpt. Ingeniería Química, Ambiental y de los Materiales Edificio, Universidad de Jaén, Jaén (Spain)
2017-04-25
The increasing fossil fuel scarcity has led to an urgent need to develop alternative fuels. Currently microorganisms have been extensively used for the production of first-generation biofuels from lignocellulosic biomass. Yeast is the efficient producer of bioethanol among all existing biofuels option. Tools of synthetic biology have revolutionized the field of microbial cell factories especially in the case of ethanol and fatty acid production. Most of the synthetic biology tools have been developed for the industrial workhorse Saccharomyces cerevisiae. The non-conventional yeast systems have several beneficial traits like ethanol tolerance, thermotolerance, inhibitor tolerance, genetic diversity, etc., and synthetic biology have the power to expand these traits. Currently, synthetic biology is slowly widening to the non-conventional yeasts like Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. Herein, we review the basic synthetic biology tools that can apply to non-conventional yeasts. Furthermore, we discuss the recent advances employed to develop efficient biofuel-producing non-conventional yeast strains by metabolic engineering and synthetic biology with recent examples. Looking forward, future synthetic engineering tools’ development and application should focus on unexplored non-conventional yeast species.
Directory of Open Access Journals (Sweden)
Smirnov Vladimir N
2002-10-01
Full Text Available Abstract Background Secretion of recombinant proteins in yeast can be affected by their improper folding in the endoplasmic reticulum and subsequent elimination of the misfolded molecules via the endoplasmic reticulum associated protein degradation pathway. Recombinant proteins can also be degraded by the vacuolar protease complex. Human urokinase type plasminogen activator (uPA is poorly secreted by yeast but the mechanisms interfering with its secretion are largely unknown. Results We show that in Hansenula polymorpha overexpression worsens uPA secretion and stimulates its intracellular aggregation. The absence of the Golgi modifications in accumulated uPA suggests that aggregation occurs within the endoplasmic reticulum. Deletion analysis has shown that the N-terminal domains were responsible for poor uPA secretion and propensity to aggregate. Mutation abolishing N-glycosylation decreased the efficiency of uPA secretion and increased its aggregation degree. Retention of uPA in the endoplasmic reticulum stimulates its aggregation. Conclusions The data obtained demonstrate that defect of uPA secretion in yeast is related to its retention in the endoplasmic reticulum. Accumulation of uPA within the endoplasmic reticulum disturbs its proper folding and leads to formation of high molecular weight aggregates.
Directory of Open Access Journals (Sweden)
Raveendran Sindhu
2017-04-01
Full Text Available The increasing fossil fuel scarcity has led to an urgent need to develop alternative fuels. Currently microorganisms have been extensively used for the production of first-generation biofuels from lignocellulosic biomass. Yeast is the efficient producer of bioethanol among all existing biofuels option. Tools of synthetic biology have revolutionized the field of microbial cell factories especially in the case of ethanol and fatty acid production. Most of the synthetic biology tools have been developed for the industrial workhorse Saccharomyces cerevisiae. The non-conventional yeast systems have several beneficial traits like ethanol tolerance, thermotolerance, inhibitor tolerance, genetic diversity, etc., and synthetic biology have the power to expand these traits. Currently, synthetic biology is slowly widening to the non-conventional yeasts like Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. Herein, we review the basic synthetic biology tools that can apply to non-conventional yeasts. Furthermore, we discuss the recent advances employed to develop efficient biofuel-producing non-conventional yeast strains by metabolic engineering and synthetic biology with recent examples. Looking forward, future synthetic engineering tools’ development and application should focus on unexplored non-conventional yeast species.
Directory of Open Access Journals (Sweden)
Sasi Sigawi
2014-02-01
Full Text Available A laboratory prototype of a microcomputer-based analyzer was developed for quantitative determination of formaldehyde in liquid samples, based on catalytic chemosensing elements. It was shown that selectivity for the target analyte could be increased by modulating the working electrode potential. Analytical parameters of three variants of the amperometric analyzer that differed in the chemical structure/configuration of the working electrode were studied. The constructed analyzer was tested on wastewater solutions that contained formaldehyde. A simple low-cost biosensor was developed for semi-quantitative detection of airborne formaldehyde in concentrations exceeding the threshold level. This biosensor is based on a change in the color of a solution that contains a mixture of alcohol oxidase from the yeast Hansenula polymorpha, horseradish peroxidase and a chromogen, following exposure to airborne formaldehyde. The solution is enclosed within a membrane device, which is permeable to formaldehyde vapors. The most efficient and sensitive biosensor for detecting formaldehyde was the one that contained alcohol oxidase with an activity of 1.2 U·mL−1. The biosensor requires no special instrumentation and enables rapid visual detection of airborne formaldehyde at concentrations, which are hazardous to human health.
International Nuclear Information System (INIS)
Madhavan, Aravind; Jose, Anju Alphonsa; Binod, Parameswaran; Sindhu, Raveendran; Sukumaran, Rajeev K.; Pandey, Ashok; Castro, Galliano Eulogio
2017-01-01
The increasing fossil fuel scarcity has led to an urgent need to develop alternative fuels. Currently microorganisms have been extensively used for the production of first-generation biofuels from lignocellulosic biomass. Yeast is the efficient producer of bioethanol among all existing biofuels option. Tools of synthetic biology have revolutionized the field of microbial cell factories especially in the case of ethanol and fatty acid production. Most of the synthetic biology tools have been developed for the industrial workhorse Saccharomyces cerevisiae. The non-conventional yeast systems have several beneficial traits like ethanol tolerance, thermotolerance, inhibitor tolerance, genetic diversity, etc., and synthetic biology have the power to expand these traits. Currently, synthetic biology is slowly widening to the non-conventional yeasts like Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. Herein, we review the basic synthetic biology tools that can apply to non-conventional yeasts. Furthermore, we discuss the recent advances employed to develop efficient biofuel-producing non-conventional yeast strains by metabolic engineering and synthetic biology with recent examples. Looking forward, future synthetic engineering tools’ development and application should focus on unexplored non-conventional yeast species.
Effects of Room-Temperature Ionic Liquids on Zebra Mussels (Dreissena polymorpha)
Costello, D. M.; Bernot, R. J.; Lamberti, G. A.
2005-05-01
Zebra mussels (Dreissena polymorpha) are exotic bivalves that are widely distributed in eastern North America. We propose that this nuisance organism could serve as a model species for studies of aquatic toxicology. We tested zebra mussels response to room-temperature ionic liquids (ILs), which are being synthesized as environmentally friendly alternatives to volatile organic solvents. Volatile organic solvents contribute to atmospheric pollution and ozone depletion, whereas ILs are non-volatile and less harmful to the atmosphere. Although ILs would contribute significantly less to air pollution, little is known about their potential effects on aquatic ecosystems. In 72-hour toxicity tests, we determined the acute effects of three imidazolium-based ILs (1-butyl-3-methylimidazolium bromide (bmimBr), 1-hexyl-3-methylimidazolium bromide (hmimBr), and 1-octyl-3-methylimidazolium bromide (omimBr)) on the survival of zebra mussels. As alkyl chain length decreased, median lethal concentration (LC50) decreased from 1291 mg L-1 for bmimBr, to 105 mg L-1 for hmimBr, and 21.2 mg L-1 for omimBr. For bivalve mussels, the toxicities of these ILs are comparable to the toxicities of commonly used industrial solvents (e.g., toluene, benzene). This study presents a foundation for using zebra mussels in toxicity studies as well as possible models for less common Unionid mussels.
Directory of Open Access Journals (Sweden)
Daniele Franco Martins Machado
2015-02-01
Full Text Available Neste trabalho, o objetivo foi avaliar o efeito de isolados de Trichoderma spp. na emergência de plântulas e no crescimento de mudas de cambará (Gochnatia polymorpha. Utilizou-se, em casa de vegetação, substrato esterilizado e não esterilizado, sendo avaliados os efeitos de quatro isolados de trichoderma: TSM1 e TSM2 de Trichoderma viride, 2B2 e 2B22 de Trichoderma harzianum mais um mix preparado com a mistura desses quatro isolados, além de dois produtos comerciais à base de trichoderma. A análise dos dados permitiu concluir que os isolados de trichoderma testados não interferem na emergência das plântulas, mas os isolados 2B2 e 2B22 de T. harzianum apresentam potenciais como promotores de crescimento de mudas de cambará.
Predation of the zebra mussel (Dreissena polymorpha) by freshwater drum in western Lake Erie
French, John R. P.; Bur, Michael T.; Nalepa, Thomas F.; Schloesser, Donald W.
1992-01-01
Environmental and economic problems associated with the colonization of zebra mussels (Dreissena polymorpha) in western Lake Erie created a need to investigate control mechanisms. Predation by fishes is one potential means of control, but predation on zebra mussels by native fishes in Lake Erie is unknown. The freshwater drum (Aplodinotus grunniens) is the most likely fish predator since it is the only fish with pharyngeal teeth capable of crushing mollusk shells. In 1990, freshwater drum were collected in western Lake Erie from 9 sites near rocky reefs and 13 sites with silt or sand bottoms, and gut contents were examined. Predation on zebra mussels increased as drum size increased. Small drum (200-249 mm in length) fed mainly on dipterans, amphipods, and small fish; small zebra mussels (375 mm in length) fed almost exclusively on zebra mussels (seasons and locations combined). The smallest drum capable of crushing zebra mussel shells was 265 mm. Since freshwater drum over 375 mm feed heavily on zebra mussels, they may become a possible biological control mechanism for mussels in portions of North America.
Nagotu, Shirisha; Krikken, Arjen M; Otzen, Marleen; Kiel, Jan A K W; Veenhuis, Marten; van der Klei, Ida J
We show that Mdv1 and Caf4, two components of the mitochondrial fission machinery in Saccharomyces cerevisiae, also function in peroxisome proliferation. Deletion of MDV1, CAF4 or both, however, had only a minor effect on peroxisome numbers at peroxisome-inducing growth conditions, most likely
Riva, Consuelo; Binelli, Andrea; Rusconi, Francesco; Colombo, Graziano; Pedriali, Alessandra; Zippel, Renata; Provini, Alfredo
2011-07-01
It has recently been established that the use of proteomics can be a useful tool in the field of ecotoxicology. Despite the fact that the mussel Dreissena polymorpha is a valuable bioindicator for freshwater ecosystems, the application of a proteomic approach with this organism has not been deeply investigated. To this end, several zebra mussel specimens were subjected to a 7-day exposure of two different concentrations (0.1 and 2 μg L⁻¹) of the model pollutant benzo[α]pyrene (B[α]P). Changes in protein expression profiles were investigated in gill cytosolic fractions from control/exposed male and female mussels using 2-DE electrophoresis. B[α]P bioaccumulation in mussel soft tissue was also assessed to validate exposure to the selected chemical. We evaluated overall changes in expression profiles for 28 proteins in exposed mussels, 16 and 12 of which were, respectively, over- and under-expressed. Surprisingly, the comparative analysis of protein data sets showed no proteins that varied commonly between the two different B[α]P concentrations. Spots of interest were manually excised and analysed by MALDI-TOF/TOF mass spectrometry. The most significant proteins that were identified as altered were related to oxidative stress, signal transduction, cellular structure and metabolism. This preliminary study indicates the feasibility of a proteomic approach with the freshwater mussel D. polymorpha and provides a starting point for similar investigations. Our results confirm the need to increase the number of invertebrate proteomic studies in order to increase the following: their representation in databases and the successful identification of their most relevant proteins. Finally, additional studies investigating the role of gender and protein modulation are warranted. Copyright © 2011 Elsevier B.V. All rights reserved.
Ivanković, Dusica; Pavicić, Jasenka; Beatović, Vanja; Klobucar, Roberta Sauerborn; Klobucar, Göran Igor Vinko
2010-04-01
Freshwater mussels Dreissena polymorpha (Pallas, 1771) were exposed to the elevated concentrations of Cd (10, 50, 100, and 500 microg/L), Cu (10, 30, 50, and 80 microg/L), and an organochlorinated pesticide, pentachlorophenol (PCP) (1, 10, and 100 microg/L). Induced synthesis of biomarker metallothionein (MT) and changes in concentrations of cytosolic Cd, Cu, and Zn in the whole soft tissue of mussels were monitored after a 7-day laboratory exposure to the contaminants. A clear dose-dependent elevation in the MT concentration was observed after exposure to Cd at doses of 10-100 microg/L, and this increase of MT content was accompanied with a linear increase of cytosolic Cd. Cd concentration of 500 microg/L caused no additional increase of MT and Cd in mussel cytosol, suggesting possible toxic effects due to exceeding cellular inducible/defense capacity. Cu exposure resulted with variable changes in MT concentrations, with no clear linear relationship between MT and Cu concentrations in water, although a progressive dose-dependent accumulation of Cu in the soluble fraction of mussel tissues was recorded. A decrease of cytosolic Zn was evident at higher exposure concentrations of both metals used. PCP in concentrations applied was unable to induce MT synthesis, but the higher concentrations of PCP influenced the cytosolic metal concentrations. In conclusion, the results obtained confirm the specificity of MT induction in D. polymorpha as an biological response on metal stimulation, especially by cadmium, being more closely correlated to MT than copper within the ecologically relevant concentration range. The strong induction potential of cadmium as well as an absence of MT induction following exposure to PCP as an organic chemical contaminant are supporting evidences for usage of zebra mussel MT as a specific biomarker of Cd exposure in biomonitoring programs.
Energy Technology Data Exchange (ETDEWEB)
Binelli, A. [Department of Biology, Via Celoria 26, University of Milan, 20133 Milan (Italy)], E-mail: andrea.binelli@unimi.it; Guzzella, L.; Roscioli, C. [IRSA-CNR, 20047 Brugherio (Milan) (Italy)
2008-06-15
Several congeners of polybrominated diphenyl ethers (PBDEs) were monitored in 14 different sampling stations of Lake Maggiore, the second largest Italian lake in regard to surface, volume and average depth, using the sentinel-organism Zebra mussel (Dreissena polymorpha). Results revealed a moderate contamination with {sigma}PBDE levels (BDE-17, -28, -47, -66, -71, -85, -99, -100, -138, -153, -154, -183, -190 and -209) ranging from 40 to 447 ng g{sup -1} lipid weight which are similar to those found in environments polluted by deposition or atmospheric transport. The general order of decreasing congener contribution to the total load was BDE-47 > -99 > -100 > -209, which closely reflected patterns observed in mussels collected in freshwater ecosystems worldwide. - This study shows the first data of PBDE contamination in freshwater invertebrates from Mediterranean basin.
International Nuclear Information System (INIS)
Binelli, A.; Guzzella, L.; Roscioli, C.
2008-01-01
Several congeners of polybrominated diphenyl ethers (PBDEs) were monitored in 14 different sampling stations of Lake Maggiore, the second largest Italian lake in regard to surface, volume and average depth, using the sentinel-organism Zebra mussel (Dreissena polymorpha). Results revealed a moderate contamination with ΣPBDE levels (BDE-17, -28, -47, -66, -71, -85, -99, -100, -138, -153, -154, -183, -190 and -209) ranging from 40 to 447 ng g -1 lipid weight which are similar to those found in environments polluted by deposition or atmospheric transport. The general order of decreasing congener contribution to the total load was BDE-47 > -99 > -100 > -209, which closely reflected patterns observed in mussels collected in freshwater ecosystems worldwide. - This study shows the first data of PBDE contamination in freshwater invertebrates from Mediterranean basin
Walker, G.K.; Black, M.G.; Edwards, C.A.
1996-01-01
Adult zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussels were induced to release large quantities of live spermatozoa by the administration of 5-hydroxytryptamine (serotonin). Sperm were photographed alive using phase-contrast microscopy and were fixed subsequently with glutaraldehyde followed by osmium tetroxide for eventual examination by transmission or scanning electron microscopy. The sperm of both genera are of the ect-aquasperm type. Their overall dimensions and shape allow for easy discrimination at the light and scanning electron microscopy level. Transmission electron microscopy of the cells reveals a barrel-shaped nucleus in zebra mussel sperm and an elongated nucleus in quagga mussel sperm. In both species, an acrosome is cradled in a nuclear fossa. The ultrastructure of the acrosome and axial body, however, is distinctive for each species. The structures of the midpiece are shown, including a unique mitochondrial "skirt" that includes densely packed parallel cristae and extends in a narrow sheet from the mitochondria.
International Nuclear Information System (INIS)
Giamberini, Laure; Cajaraville, Miren P.
2005-01-01
In order to examine the possible use of lysosomal response as a biomarker of freshwater quality, structural changes of lysosomes were measured by image analysis in the digestive gland of the zebra mussel, Dreissena polymorpha, exposed in laboratory conditions to cadmium. Mussels were exposed to the metal (10 and 200 μg/L) for 3 weeks and randomly collected after 7 and 21 days. At each treatment day, digestive tissues were excised and β-glucuronidase activity was revealed in cryotome sections. Four stereological parameters were calculated: lysosomal volume density, lysosomal surface density, lysosomal surface to volume ratio, and lysosomal numerical density. The changes observed in this study reflected a general activation of the lysosomal system, including an increase in both the number and the size of lysosomes in the digestive gland cells of mussels exposed to cadmium. The digestive lysosomal response in zebra mussels was related to exposure time and to metal concentration, demonstrating the potential of this biomarker in freshwater biomonitoring
Energy Technology Data Exchange (ETDEWEB)
Garaud, M. [Université de Lorraine, CNRS UMR 7360, Laboratoire Interdisciplinaire des Environnements Continentaux (LIEC), Campus Bridoux, Rue du Général Delestraint, 57070 Metz (France); International Consortium for the Environmental Implications of Nanotechnology (iCEINT), Aix en Provence (France); Trapp, J.; Devin, S.; Cossu-Leguille, C.; Pain-Devin, S.; Felten, V. [Université de Lorraine, CNRS UMR 7360, Laboratoire Interdisciplinaire des Environnements Continentaux (LIEC), Campus Bridoux, Rue du Général Delestraint, 57070 Metz (France); Giamberini, L., E-mail: laure.giamberini@univ-lorraine.fr [Université de Lorraine, CNRS UMR 7360, Laboratoire Interdisciplinaire des Environnements Continentaux (LIEC), Campus Bridoux, Rue du Général Delestraint, 57070 Metz (France); International Consortium for the Environmental Implications of Nanotechnology (iCEINT), Aix en Provence (France)
2015-01-15
Highlights: • Gammarids and mussels both accumulated significant amount of waterborne nCeO{sub 2}. • nCeO{sub 2} decreased catalase, lysosomal system size and lipoperoxidation in mussels. • nCeO{sub 2} could exert antioxidant protecting activity in mussels. • In contrast with mussels, no effects of nCeO{sub 2} were observed on Gammarids. - Abstract: Cerium nanoparticles (nCeO{sub 2}) are widely used in everyday products, as fuel and paint additives. Meanwhile, very few studies on nCeO{sub 2} sublethal effects on aquatic organisms are available. We tried to fill this knowledge gap by investigating short-term effects of nCeO{sub 2} at environmentally realistic concentrations on two freshwater invertebrates; the amphipod Gammarus roeseli and the bivalve Dreissena polymorpha, using an integrated multibiomarker approach to detect early adverse effects of nCeO{sub 2} on organism biology. Differences in the behaviour of the organisms and of nanoparticles in the water column led to differential nCeO{sub 2} bioaccumulations, G. roeseli accumulating more cerium than D. polymorpha. Exposure to nCeO{sub 2} led to decreases in the size of the lysosomal system, catalase activity and lipoperoxidation in mussel digestive glands that could result from nCeO{sub 2} antioxidant properties, but also negatively impacted haemolymph ion concentrations. At the same time, no strong adverse effects of nCeO{sub 2} could be observed on G. roeseli. Further experiments will be necessary to confirm the absence of severe nCeO{sub 2} adverse effects in long-term environmentally realistic conditions.
Efficacy of candidate chemicals for preventing attachment of zebra mussels (Dreissena polymorpha)
Cope, W.G.; Bartsch, M.R.; Marking, L.L.
1997-01-01
Forty-seven chemicals having potential for preventing the attachment of zebra mussels Dreissena polymorpha were identified and tested. For each chemical, 15 zebra mussels (5-8-mm shell length) in each of two replicates and six treatments were exposed for 48 h followed by a 48-h postexposure period in untreated water. Eleven of the chemicals inhibited the reattachment of zebra mussels after the 48-h exposure; eight had EC50 values ranging from 0.4 to 5.4 mg /L, and three had EC50 values ranging from 19.4 to 29.0 mg/L. Based on an analysis of chemical cost, solubility in water, anticipated treatment concentrations, and potential hazards to humans or the environment, three of the most promising chemicals, all antioxidants (butylated hydroxyanisole [BHA], tert-butylhydroquinone, and tannic acid) were tested on nontarget fish (bluegill, Lepomis macrochirus; channel catfish, Ictalurus punctatus; and rainbow trout, Oncorhynchus mykiss). These chemicals were not selectively toxic to zebra mussels; only the tests with bluegill and BHA and with channel catfish and tannic acid had 48-h LC50 values greater than the concentrations effective for preventing the reattachment of zebra mussels. Although the attachment of zebra mussels can be prevented with selected antioxidants, an alternative formulation should be investigated to minimize effects on nontarget organisms, such as fish.
Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie
International Nuclear Information System (INIS)
Klerks, P.L.; Fraleigh, P.C.; Lawniczak, J.E.
1997-01-01
This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%·day -1 of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn·m -2 ·day -1 ) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)
Smolders, Roel; Bervoets, Lieven; Blust, Ronny
2002-09-01
For over 20 years, mussels have been recommended as one of the most suitable biomonitoring organisms for aquatic ecosystems. Though the common mussel (Mytilus edulis) is frequently used for biomonitoring estuarine and marine ecosystems, no freshwater species is promoted for similar monitoring networks. Recently, however, the zebra mussel (Dreissena polymorpha) has been proposed as a suitable monitoring organism in freshwater ecosystems. The aim of this study was to explore the usefulness of transplanted zebra mussels as active biomonitors in an effluent-dominated stream. Results showed that for these purposes, an exposure period of at least a few weeks is required to detect any significant changes in condition status or scope for growth. Wet-tissue-weight:dry-tissue-weight ratio was the most sensitive measure to quantify effects of field exposure on physiological fitness. In case of scope for growth (SfG), energy intake was the factor determining the overall energy budget of the mussels. Based on the dilution rates of the two different effluents present, effluent 2 had the most important effect on the condition status of the exposed organisms. Overall, we conclude that the use of transplanted mussels is a sensitive and easily applicable active biomonitor that can be used to assess water quality, pollution, and subsequent recovery through self-purification in field situations.
Evariste, Lauris; David, Elise; Cloutier, Pierre-Luc; Brousseau, Pauline; Auffret, Michel; Desrosiers, Mélanie; Groleau, Paule Emilie; Fournier, Michel; Betoulle, Stéphane
2018-04-02
The zebra mussel, Dreissena polymorpha constitutes an extensively used sentinel species for biomonitoring in European and North American freshwater systems. However, this invasive species is gradually replaced in freshwater ecosystem by Dreissena bugensis, a closely related dreissenid species that shares common morphological characteristics but possess some physiological differences. However, few are known about differences on more integrated physiological processes that are generally used as biomarkers in biological monitoring studies. Declining of zebra mussel populations raises the question of the sustainability of using one or both species indifferently to maintain the quality of environmental pollution monitoring data. In our study, we performed a field comparative study measuring immune-related markers and bioaccumulation of PCBs, PAHs and PBDEs in sympatrically occurring mussel populations from three sites of the St. Lawrence River. For tested organisms, species were identified using RFLP analysis. Measurement of bioaccumulated organic compounds indicated a higher accumulation of PCBs and PBDEs in D. bugensis soft tissues compared to D. polymorpha while no differences were noticed for PAHs. Results of hemocytic parameters highlighted that differences of hemocyte distributions were associated to modulations of phagocytic activities. Moreover, marked differences occurred in measurement of hemocytic oxidative activity, indicating divergences between the two species for ROS regulation strategies. This physiological characteristic may deeply influence species responses facing environmental or pollution related stress and induce bias if the two species are not differentiated in further biomarker or bioaccumulation measurement-based studies. Copyright © 2018 Elsevier Ltd. All rights reserved.
Sarnelle, Orlando; White, Jeffrey D; Horst, Geoffrey P; Hamilton, Stephen K
2012-07-01
We tested the hypothesis that zebra mussels (Dreissena polymorpha) have positive effects on the toxin-producing cyanobacterium, Microcystis aeruginosa, at low phosphorus (P) concentrations, but negative effects on M. aeruginosa at high P, with a large-scale enclosure experiment in an oligotrophic lake. After three weeks, mussels had a significantly positive effect on M. aeruginosa at ambient P (total phosphorus, TP ∼10 μg L⁻¹), and a significantly negative effect at high P (simulating a TP of ∼40 μg L⁻¹ in lakes). Positive and negative effects were strong and very similar in magnitude. Thus, we were able to ameliorate a negative effect of Dreissena invasion on water quality (i.e., promotion of Microcystis) by adding P to water from an oligotrophic lake. Our results are congruent with many field observations of Microcystis response to Dreissena invasion across ecosystems of varying P availability. Copyright © 2012 Elsevier Ltd. All rights reserved.
Zaiko, Anastasija; Daunys, Darius; Olenin, Sergej
2009-03-01
Habitat engineering role of the invasive zebra mussel Dreissena polymorpha (Pallas) was studied in the Curonian lagoon, a shallow water body in the SE Baltic. Impacts of live zebra mussel clumps and its shell deposits on benthic biodiversity were differentiated and referred to unmodified (bare) sediments. Zebra mussel bed was distinguished from other habitat types by higher benthic invertebrate biomass, abundance, and species richness. The impact of live mussels on biodiversity was more pronounced than the effect of shell deposits. The structure of macrofaunal community in the habitats with >103 g/m2 of shell deposits devoid of live mussels was similar to that found within the zebra mussel bed. There was a continuous shift in species composition and abundance along the gradient ‘bare sediments—shell deposits—zebra mussel bed’. The engineering impact of zebra mussel on the benthic community became apparent both in individual patches and landscape-level analyses.
Directory of Open Access Journals (Sweden)
Kensy Frank
2009-06-01
Full Text Available Abstract Background An advanced version of a recently reported high-throughput fermentation system with online measurement, called BioLector, and its validation is presented. The technology combines high-throughput screening and high-information content by applying online monitoring of scattered light and fluorescence intensities in continuously shaken microtiter plates. Various examples in calibration of the optical measurements, clone and media screening and promoter characterization are given. Results Bacterial and yeast biomass concentrations of up to 50 g/L cell dry weight could be linearly correlated to scattered light intensities. In media screening, the BioLector could clearly demonstrate its potential for detecting different biomass and product yields and deducing specific growth rates for quantitatively evaluating media and nutrients. Growth inhibition due to inappropriate buffer conditions could be detected by reduced growth rates and a temporary increase in NADH fluorescence. GFP served very well as reporter protein for investigating the promoter regulation under different carbon sources in yeast strains. A clone screening of 90 different GFP-expressing Hansenula polymorpha clones depicted the broad distribution of growth behavior and an even stronger distribution in GFP expression. The importance of mass transfer conditions could be demonstrated by varying filling volumes of an E. coli culture in 96 well MTP. The different filling volumes cause a deviation in the culture growth and acidification both monitored via scattered light intensities and the fluorescence of a pH indicator, respectively. Conclusion The BioLector technology is a very useful tool to perform quantitative microfermentations under engineered reaction conditions. With this technique, specific yields and rates can be directly deduced from online biomass and product concentrations, which is superior to existing technologies such as microplate readers or optode
Eggleton, M.A.; Miranda, L.E.; Kirk, J.P.
2004-01-01
Rates of annual food consumption and biomass were modeled for several fish species across representative rivers and lakes in eastern North America. Results were combined to assess the relative potential of fish predation to impact zebra mussels (Dreissena polymorpha). Predicted annual food consumption by fishes in southern waters was over 100% greater than that in northern systems because of warmer annual water temperatures and presumed increases in metabolic demand. Although generally increasing with latitude, biomasses of several key zebra mussel fish predators did not change significantly across latitudes. Biomasses of some less abundant fish predators did increase significantly with latitude, but increases were not of the magnitude to offset predicted decreases in food consumption. Our results generally support the premise that fishes in rivers and lakes of the southern United States (U.S.) have inherently greater potential to impact zebra mussels by predation. Our simulations may provide a partial explanation of why zebra mussel invasions have not been as rapid and widespread in southern U.S. waters compared to the Great Lakes region. ?? Blackwell Munksgaard, 2004.
Genome and metabolic engineering in non-conventional yeasts: Current advances and applications
Directory of Open Access Journals (Sweden)
Ann-Kathrin Löbs
2017-09-01
Full Text Available Microbial production of chemicals and proteins from biomass-derived and waste sugar streams is a rapidly growing area of research and development. While the model yeast Saccharomyces cerevisiae is an excellent host for the conversion of glucose to ethanol, production of other chemicals from alternative substrates often requires extensive strain engineering. To avoid complex and intensive engineering of S. cerevisiae, other yeasts are often selected as hosts for bioprocessing based on their natural capacity to produce a desired product: for example, the efficient production and secretion of proteins, lipids, and primary metabolites that have value as commodity chemicals. Even when using yeasts with beneficial native phenotypes, metabolic engineering to increase yield, titer, and production rate is essential. The non-conventional yeasts Kluyveromyces lactis, K. marxianus, Scheffersomyces stipitis, Yarrowia lipolytica, Hansenula polymorpha and Pichia pastoris have been developed as eukaryotic hosts because of their desirable phenotypes, including thermotolerance, assimilation of diverse carbon sources, and high protein secretion. However, advanced metabolic engineering in these yeasts has been limited. This review outlines the challenges of using non-conventional yeasts for strain and pathway engineering, and discusses the developed solutions to these problems and the resulting applications in industrial biotechnology.
Energy Technology Data Exchange (ETDEWEB)
Contardo-Jara, Valeska, E-mail: contardo@igb-berlin.d [Dpt. Ecophysiology and Aquaculture, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Pflugmacher, Stephan, E-mail: pflugmacher@igb-berlin.d [Dpt. Ecophysiology and Aquaculture, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Nuetzmann, Gunnar, E-mail: nuetzmann@igb-berlin.d [Dpt. Ecohydrology, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Kloas, Werner, E-mail: werner.kloas@igb-berlin.d [Dpt. Ecophysiology and Aquaculture, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Wiegand, Claudia, E-mail: wiegand@biology.sdu.d [University of Southern Denmark Institute of Biology, Campusvej 55, 5230 Odense M (Denmark)
2010-06-15
Due to increasing amounts of pharmaceutically active compounds (PhACs) in the aquatic environment, their largely unknown effects to non-target organisms need to be assessed. This study examined physiological changes in the freshwater mussel Dreissena polymorpha exposed to increasing concentrations (0.534, 5.34, 53.4 and 534 mug L{sup -1}) of the beta-blocker metoprolol in a flow-through system for seven days. The two lower concentrations represent the environmentally relevant range. Surprisingly, metallothionein mRNA was immediately up-regulated in all treatments. For the two higher concentrations mRNA up-regulation in gills was found for P-glycoprotein after one day, and after four days for pi class glutathione S-transferase, demonstrating elimination and biotransformation processes, respectively. Additionally, catalase and superoxide dismutase were up-regulated in the digestive gland indicating oxidative stress. In all treated mussels a significant up-regulation of heat shock protein mRNA was observed in gills after four days, which suggests protein damage and the requirement for repair processes. Metoprolol was 20-fold bioaccumulated for environmentally relevant concentrations. - Evidence for significant physiological changes in an aquatic mollusc due to exposure to a pharmaceutically active compound detected by real-time PCR.
Palos Ladeiro, M; Aubert, D; Villena, I; Geffard, A; Bigot, A
2014-01-01
Cryptosporidium parvum, Giardia duodenalis and Toxoplasma gondii are ubiquitous pathogens, which waterborne transmission has been largely demonstrated. Since they can be found in various watercourses, interactions with aquatic organisms are possible. Protozoan detection for watercourses biomonitoring is currently based on large water filtration. The zebra mussel, Dreissena polymorpha, is a choice biological model in ecotoxicological studies which are already in use to detect chemical contaminations in watercourses. In the present study, the zebra mussel was tested as a new tool for detecting water contamination by protozoa. In vivo exposures were conducted in laboratory experiments. Zebra mussel was exposed to various protozoan concentrations for one week. Detection of protozoa was realized by Taqman real time qPCR. Our experiments evidenced C. parvum, G. duodenalis and T. gondii oocyst bioaccumulation by mussels proportionally to ambient contamination, and significant T. gondii prevalence was observed in muscle tissue. To our knowledge, this is the first study that demonstrates T. gondii oocyst accumulation by zebra mussel. The results from this study highlight the capacity of zebra mussels to reveal ambient biological contamination, and thus to be used as a new effective tool in sanitary biomonitoring of water bodies. Copyright © 2013 Elsevier Ltd. All rights reserved.
Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie
Energy Technology Data Exchange (ETDEWEB)
Klerks, P.L. [Univ. of Southwestern Louisiana, Dept. of Biology, Lafayette, Louisiana (United States)]. E-mail: klerks@usl.edu; Fraleigh, P.C.; Lawniczak, J.E. [Univ. of Toledo, Dept. of Biology, Toledo, Ohio (United States)
1997-07-15
This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%{center_dot}day{sup -1} of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn{center_dot}m{sup -2}{center_dot}day{sup -1}) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)
International Nuclear Information System (INIS)
Zuykov, M.; Pelletier, E.; Rouleau, C.; Popov, L.; Fowler, S.W.; Orlova, M.
2009-01-01
Autoradiography was used to identify α-track distributions in a series of shell sections from live mussels Dreissena polymorpha Pallas and dissected shells of dead mussels obtained from laboratory experiments using relatively high concentrations of 241 Am in the exposure media, a required condition for successful use of this autoradiographic technique. A comparable distribution of α-tracks was recorded on autoradiographs from both live and dead shells suggesting that metabolism does not lead to any sizable changes in the process of 241 Am adsorption (present in the extrapallial fluid) onto the inner surface of shell. Autoradiographs showed a preferential accumulation of 241 Am in the organic periostracum, whereas the outer and inner shell layers were characterized by a relatively low α-tracks density. No α-tracks were observed in the central part of the shell in any of the samples. These observations will be useful for the development of a general model to explain bioaccumulation and biosorption processes of radionuclides into mollusk shells. (author)
Dieterich, Axel; Mörtl, Martin; Eckmann, Reiner
2004-07-01
Complex habitat structures can influence the foraging success of fish. Competition for food between fish species can therefore depend on the competitors' abilities to cope with structural complexity. In laboratory experiments, we comparatively assessed effects of zebra mussels (Dreissena polymorpha Pall.) on the foraging success of Eurasian perch (Perca fluviatilis L.) and ruffe (Gymnocephalus cernuus (L.)). In single-species and mixed-species experiments, the fish were fed caddisfly larvae (Tinodes waeneri (L.)) over complex (mussel-covered stones) and less-complex (bare stones) substrates. With intraspecific competition, food consumption by perch and ruffe decreased significantly when the complex substrate was used. With interspecific competition, food consumption by perch and ruffe did not change with substrate complexity, but perch clearly out-competed ruffe on both substrates. Zebra mussel beds provide a refuge for macrozoobenthos against predation by ruffe and probably also by perch. (
Fernández-Sanjuan, María; Faria, Melissa; Lacorte, Silvia; Barata, Carlos
2013-04-01
Perfluorinated chemicals (PFCs) have been used for many years in numerous industrial products and are known to accumulate in organisms. A recent survey showed that tissue levels of PFCs in aquatic organisms varied among compounds and species being undetected in freshwater zebra mussels Dreissena polymorpha. Here we studied the bioaccumulation kinetics and effects of two major PFCs, perfluorooctane sulfonic acid compound (PFOS) and perfluorooctanoic acid (PFOA), in multixenobiotic transporter activity (MXR) and filtration and oxygen consumption rates in zebra mussel exposed to a range of concentrations of a PCF mixture (1-1,000 μg/L) during 10 days. Results indicate a low potential of the studied PFCs to bioaccumulate in zebra mussel tissues. PFCs altered mussel MXR transporter activity being inhibited at day 1 but not at day 10. Bioaccumulation kinetics of PFCs were inversely related with MXR transporter activity above 9 ng/g wet weight and unrelated at tissue concentration lower than 2 ng/g wet weight suggesting that at high tissue concentrations, these type of compounds may be effluxed out by MXR transporters and as a result have a low potential to be bioaccumulated in zebra mussels. Oxygen consumption rates but not filtering rates were increased in all exposure levels and periods indicating that at environmental relevant concentrations of 1 μg/L, the studied PFCs enhanced oxidative metabolism of mussels. Overall, the results obtained in this study confirm previous findings in the field indicating that an important fraction of PFC accumulated in mussel tissues is eliminated actively by MXR transporters or other processes that are metabolically costly.
Directory of Open Access Journals (Sweden)
Nataliya Petryk
Full Text Available The transcriptional regulator HAP4, induced by respiratory substrates, is involved in the balance between fermentation and respiration in S. cerevisiae. We identified putative orthologues of the Hap4 protein in all ascomycetes, based only on a conserved sixteen amino acid-long motif. In addition to this motif, some of these proteins contain a DNA-binding motif of the bZIP type, while being nonetheless globally highly divergent. The genome of the yeast Hansenula polymorpha contains two HAP4-like genes encoding the protein HpHap4-A which, like ScHap4, is devoid of a bZIP motif, and HpHap4-B which contains it. This species has been chosen for a detailed examination of their respective properties. Based mostly on global gene expression studies performed in the S. cerevisiae HAP4 disruption mutant (ScΔhap4, we show here that HpHap4-A is functionally equivalent to ScHap4, whereas HpHap4-B is not. Moreover HpHAP4-B is able to complement the H2O2 hypersensitivity of the ScYap1 deletant, YAP1 being, in S. cerevisiae, the main regulator of oxidative stress. Finally, a transcriptomic analysis performed in the ScΔyap1 strain overexpressing HpHAP4-B shows that HpHap4-B acts both on oxidative stress response and carbohydrate metabolism in a manner different from both ScYap1 and ScHap4. Deletion of these two genes in their natural host, H. polymorpha, confirms that HpHAP4-A participates in the control of the fermentation/respiration balance, while HpHAP4-B is involved in oxidative stress since its deletion leads to hypersensitivity to H2O2. These data, placed in an evolutionary context, raise new questions concerning the evolution of the HAP4 transcriptional regulation function and suggest that Yap1 and Hap4 have diverged from a unique regulatory protein in the fungal ancestor.
Thomas, R; Jebin, N; Saha, R; Sarma, D K
2016-01-01
Pork nuggets with 'very good' acceptability was processed by incorporating kordoi (Averrhoa carambola) fruit juice and bamboo (Bambusa polymorpha) shoot extract, and their physical, chemical, microbiological and sensorial characteristics were evaluated during 35 days storage under refrigeration. Addition of kordoi fruit juice (4%) and bamboo shoot extract (6%) had a significant effect on the pH, moisture, protein, fat, fiber, instrumental color values and texture profiles of nuggets. Nuggets with juice and extract had significantly lower TBARS values towards the end of the storage period compared to the control. Microbial and sensory qualities of nuggets were significantly improved by the addition of juice and extract. Incorporation of juice and extract at 4% and 6% levels, respectively, increased the storage life of pork nuggets by at least two weeks, i.e. from 21 days to 35 days at 4 ± 1 °C compared to the control. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Contardo-Jara, Valeska; Lorenz, Claudia; Pflugmacher, Stephan; Nuetzmann, Gunnar; Kloas, Werner; Wiegand, Claudia
2011-01-01
Bioaccumulation and effects of the contraceptive hormone levonorgestrel were examined in the non-target organism Dreissena polymorpha. Molecular biomarkers of biotransformation, elimination, antioxidant defence and protein damage were analyzed after exposure to increasing concentrations of levonorgestrel in a flow-through system. The lowest concentration (0.312 μg L -1 ) was 100-fold bioconcentrated within four days. A decrease of the bioconcentration factor was observed within one week for the highest test concentrations (3.12 and 6.24 μg L -1 ) suggesting enhanced excretory processes. The immediate mRNA up-regulation of pi class glutathione S-transferase proved that phase II biotransformation processes were induced. Disturbance of fundamental cell functions was assumed since the aryl hydrocarbon receptor has been permanently down-regulated. mRNA up-regulation of P-glycoprotein, superoxide dismutase and metallothioneine suggested enhanced elimination processes and ongoing oxidative stress. mRNA up-regulation of heat shock protein 70 in mussels exposed to the two highest concentrations clearly indicated impacts on protein damage. - Fundamental cell processes as biotransformation, elimination and prevention from oxidative stress are influenced by exposure of the contraceptive levonorgestrel in non-target organisms. - Research highlights: → Bioaccumulation of levonorgestrel in mussels is higher than expected based on its lipophilicity. → Exposure to levonorgestrel causes oxidative stress and enhanced elimination processes. → Glutathione S-transferase (pi class) mRNA induction after one day hint on phase II biotransformation. → mRNA induction of heat shock protein 70 after one week prove protein damage.
Energy Technology Data Exchange (ETDEWEB)
Bias, R.; Karbe, L. (Hamburg Univ. (Germany, F.R.))
1985-01-01
Kinetics of uptake, partitioning and elimination of cadmium were investigated in experimental studies with the freshwater mussel, Dreissena polymorpha. /sup 109/Cd and /sup 115/Cd were used as tracers. Shells, soft parts and body fluid of the mussel exhibited considerable differences in accumulation and elimination. Accumulation factors up to more than 70,000 were calculated for the periostracum, whereas accumulation factors for the whole mussels ranging up to 3,000 were calculated. The shells bound a great deal of cadmium, but only loosely, and the metal could be readily eliminated after transfer to uncontaminated water. In contrast, no significant amounts of the cadmium incorporated in the soft parts were eliminated. The results indicate that the major portion of cadmium in the soft parts is strongly bound and cannot be eliminated by exchange processes.
Energy Technology Data Exchange (ETDEWEB)
Kraak, M.H.S.; Wijnands, P.; Govers, H.A.J.; Admiraal, W.; Voogt, P. de [Univ. of Amsterdam (Netherlands)
1997-10-01
Effects of four benzoquinoline isomers on the filtration rate of the zebra mussel (Dreissena polymorpha) were analyzed, to study the effect of minor differences in chemical structure on adverse biological effects. Filtration rates were measured after 48 h of exposure to different concentrations of acridine, phenanthridine, benzo[f]quinoline, and benzo[h]quinoline in the water. The 50% effective concentration (EC50) values for filtration rate of the four isomers differed significantly. Effects increased in the order benzo[f], -[h], -[b], and -[c]quinoline, and the difference between the most toxic isomer and the least toxic isomer amounted to a factor of 30. Attempts were made to relate these differences in toxicity to the structure of the isomers. Size- or topology-related molecular descriptors provided insufficient resolution to distinguish between the benzoquinoline isomers, and none of the electronic descriptors separately provided a significant correlation with the observed effects. In an alternative approach, molecular shape, accessibility, and minimum agent-macromolecule distance were used to represent repulsive and attractive forces between the benzoquinoline isomers and biological membranes. This approach could tentatively explain the observed effects and is supported by a high correlation between the EC50 data and the reversed-phase C18-HPLC behavior of the benzoquinolines (k{sub 0}), which is likely to be governed by similar processes.
Energy Technology Data Exchange (ETDEWEB)
Cope, W.G.; Bartsch, M.R.; Rada, R.G.; Balogh, S.J.; Rupprecht, J.E.; Young, R.D.; Johnson, D.K.
1999-12-15
Zebra mussels (Dreissena polymorpha) were sampled from artificial substrates deployed from May 30 to October 19, 1995, at 19 locks and dams from Minneapolis, MN, to Muscatine, IA. Analyses of composite tissue samples of zebra mussels revealed accumulation of mercury (Hg), cadmium (Cd), and polychlorinated biphenyls (PCBs) during a 143-d exposure period. Concentrations of total Hg ranged from 2.6 to 6.1 ng/g wet weight and methylmercury (CH{sub 3}Hg) from 1.0 to 3.3 ng/g wet weight. About 50% of the mean total Hg in zebra mussels was CH{sub 3}Hg. Cadmium ranged from 76 to 213 ng/g wet weight. Concentrations of total PCBs in zebra mussels varied longitudinally, but the composition of PCB congeners was similar throughout the river. Chlordane and dieldrin were the only two pesticides detected of the 15 analyzed. Zebra mussels are sentinels of contaminant bioavailability in the Upper Mississippi River and may be an important link in the trophic transfer of contaminants in the river because of their increasing importance in the diets of certain fish and waterfowl.
Cumulative effects of ibuprofen and air emersion in zebra mussels Dreissena polymorpha.
André, C; Gagné, F
2017-10-01
Municipal effluents are major source of pharmaceutical products in the environment. The purpose of this study was to examine the toxicity of a largely used drug, ibuprofen (Ibu), in Dresseina polymorpha mussels and its impact on air survival time. The mussels were exposed to increasing concentration of Ibu (0, 1, 10 and 100μg/L) for 96 at 15°C and a sub-group of mussels was maintain in air for another 96h. Post-exposure mussels (Ibu and Ibu+Air) were analyzed for weight loss, total triglycerides, neutral lipids, lipid peroxidation (LPO), arachidonate-dependent cyclooxygenase (COX) and glutathione S-transferase activity. Lipid extracts of mussel tissues were also analyzed by 1 H-nuclear resonance spectroscopy. The data revealed that mussels exposed to Ibu had increased signs of lipid oxidation, neutral lipids and decreased triglycerides, LPO and GST activity. COX activity was significantly reduced by Ibu in keeping with mode of action of the drug. Following exposure to air, increased weight loss, neutral lipids (lipid degradation), were observed in mussels exposed to Ibu but no changes in COX activity were observed. Air stress limited the decrease in triglycerides and the increase in GST in mussels exposed to 100μg/L Ibu indicating decreased anti-oxidant response/phase II biotransformation and limited lipid metabolism. In conclusion, exposure to Ibu has some anti-inflammatory effects to mussels based on COX activity but resulted in increased oxidative damage and lipid catabolism. Exposure to air stress could enhance some of these responses and contribute to decreased resistance to air exposures. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Mitchell, M.J.; Mills, E.L.; Idrisi, N.; Michener, R.
1996-01-01
The carbon and nitrogen concentrations and the stable isotopic compositions (δ 13 C and δ 15 N) of major abiotic and biotic constituents were determined in Oneida Lake, New York. This lake was invaded by the zebra mussel (Dreissena polymorpha) in 1990 and there have been concomitant changes in various biotic and abiotic lake properties. The C (46-49%) and N (12%) concentrations and C:N ratios (3.9-4) of zebra mussel flesh were similar to those reported for other lakes. Trophic positions were reflected in the δ 15 N values for which walleye > gizzard shad and yellow perch > Daphnia spp. and zebra mussel flesh > seston and sediment. There was an average increase of 3.6% 0 15 N per trophic transfer. Results from the δ 13 C analysis suggest that Daphnia spp. were using a distinct source of organic carbon whereas zebra mussel were using the entire seston resource. Only yellow perch showed a significant shift in δ 13 C values (1.1% 0 ), possibly reflecting a shift in a food source and diet from 1992 to 1993. (author). 48 refs., 2 tabs., 2 figs
Directory of Open Access Journals (Sweden)
REYNOLDS J. D.
2001-04-01
Full Text Available The zebra mussel Dreissena polymorpha, native to the Aralo-Caspian region, has spread across Europe in the last 180 years. Although it reached England in 1820, it only arrived in Ireland in around 1995, probably attached to the hull of pleasure boats, and since then has spread through the lowland Shannon and Erne systems, which are linked by canal. While White-clawed crayfish Austropotamobius pallipes (Lereboullet occur in these systems, Dreissena has not yet colonized sites with large crayfish populations. In laboratory experiments crayfish of both sexes ranging in size from 32-48 mm carapace length (CL were offered zebra mussels in 7 size classes spanning a range from 3-17 mm total length. Crayfish fed most on small mussels, although there was some correlation between size of crayfish and largest mussels attacked. When eaten mussels were not replaced, crayfish shifted to larger sizes. In the presence of alternative prey, experienced crayfish ate mussels and alternative foods in similar amounts while those who had never encountered zebra mussels nearly always chose the alternative foods first. The possibility of crayfish exerting significant controlling impacts on expanding mussel populations is discussed.
NRT2.4 and NRT2.5 Are Two Half-Size Transporters from the Chlamydomonas NRT2 Family
Directory of Open Access Journals (Sweden)
Jose Javier Higuera
2016-03-01
Full Text Available The NRT2 transporters mediate High Affinity Nitrate/NitriteTransport (HAN/NiT, which are essential for nitrogen acquisition from these inorganic forms. The NRT2 proteins are encoded by a multigene family in plants, and contain 12 transmembrane-spanning domains. Chlamydomonas reinhardtii has six NRT2, two of which (NRT2.5 and NRT2.4 are located in Chromosome III, in tandem head to tail. cDNAs for these genes were isolated and their sequence revealed that they correspond to half-size NRT2 transporters each containing six transmembrane domains. NRT2.5 has long N- and C- termini sequences without known homology. NRT2.4 also contains long termini sequences but smaller than NRT2.5. Expression of both studied genes occurred at a very low level, slightly in darkness, and was not modified by the N or C source. Silencing of NRT2.4 by specific artificial miRNA resulted in the inhibition of nitrite transport in the absence of other HANNiT (NRT2.1/NAR2 in the cell genetic background. Nitrite transport activity in the Hansenula polymorpha Δynt::URA3 Leu2 mutant was restored by expressing CrNRT2.4. These results indicate that half-size NRT2 transporters are present in photosynthetic organisms and that NRT2.4 is a HANiT.
Porter, Stephanie S; Faber-Hammond, Joshua J; Friesen, Maren L
2018-01-01
Exotic, invasive plants and animals can wreak havoc on ecosystems by displacing natives and altering environmental conditions. However, much less is known about the identities or evolutionary dynamics of the symbiotic microbes that accompany invasive species. Most leguminous plants rely upon symbiotic rhizobium bacteria to fix nitrogen and are incapable of colonizing areas devoid of compatible rhizobia. We compare the genomes of symbiotic rhizobia in a portion of the legume's invaded range with those of the rhizobium symbionts from across the legume's native range. We show that in an area of California the legume Medicago polymorpha has invaded, its Ensifer medicae symbionts: (i) exhibit genome-wide patterns of relatedness that together with historical evidence support host-symbiont co-invasion from Europe into California, (ii) exhibit population genomic patterns consistent with the introduction of the majority of deep diversity from the native range, rather than a genetic bottleneck during colonization of California and (iii) harbor a large set of accessory genes uniquely enriched in binding functions, which could play a role in habitat invasion. Examining microbial symbiont genome dynamics during biological invasions is critical for assessing host-symbiont co-invasions whereby microbial symbiont range expansion underlies plant and animal invasions. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Bruesewitz, Denise A.; Tank, Jennifer L.; Bernot, Melody J.; Richardson, William B.; Strauss, Eric A.
2006-01-01
Zebra mussels (Dreissena polymorpha) have altered the structure of invaded ecosystems and exhibit characteristics that suggest they may influence ecosystem processes such as nitrogen (N) cycling. We measured denitrification rates seasonally on sediments underlying zebra mussel beds collected from the impounded zone of Navigation Pool 8 of the Upper Mississippi River. Denitrification assays were amended with nutrients to characterize variation in nutrient limitation of denitrification in the presence or absence of zebra mussels. Denitrification rates at zebra mussel sites were high relative to sites without zebra mussels in February 2004 (repeated measures analysis of variance (RM ANOVA), p = 0.005), potentially because of high NO3-N variability from nitrification of high NH4+ zebra mussel waste. Denitrification rates were highest in June 2003 (RM ANOVA, p 3-N concentrations during the study (linear regression, R2 = 0.72, p p ≤ 0.01). Examining how zebra mussels influence denitrification rates will aid in developing a more complete understanding of the impact of zebra mussels and more effective management strategies of eutrophic waters.
Gatlin, Michael R.; Shoup, Daniel E.; Long, James M.
2013-01-01
The introduction and spread of invasive species is of great concern to natural resource managers in the United States. To effectively control the spread of these species, managers must be aware of the multitude of dispersal methods used by the organisms. We investigated the potential for survival through the gut of a migrating fish (blue catfish, Ictalurus furcatus) as a dispersal mechanism for two invasive bivalves: zebra mussel (Driessena polymorpha) and Asian clam (Corbicula fluminea). Blue catfish (N = 62) were sampled over several months from Sooner Lake, Oklahoma, transported to a laboratory and held in individual tanks for 48 h. All fecal material was collected and inspected for live mussels. Survival was significantly related to water temperature in the lake at the time of collection, with no mussels surviving above 21.1 C°, whereas 12 % of zebra mussels (N = 939) and 39 % of Asian clams (N = 408) consumed in cooler water survived gut passage. This research demonstrates the potential for blue catfish to serve as a dispersal vector for invasive bivalves at low water temperatures.
Shcherbina, G. Kh; Buckler, D.R.
2006-01-01
This paper presents data on contemporary distribution patterns of two species of Dreissenidae, the zebra mussel (Dreissena polymorpha) and the Quagga mussel (Dreissena bugensis), and their role in ecosystem processes in the Ivan'kovo, Uglich, Rybinsk, and Gorky Reservoirs of the Upper Volga River basin. The role of zebra mussel was also studied in experimental mesocosms of 15 m3. Maximum abundance and species diversity of macroinvertebrates, especially of leeches, polychaetes, crustaceans, and heterotopic insects, were attained in the portions of reservoirs where Dreissenidae were present and in experimental mesocosms where zebra mussel biomass was the highest. In the mesocosm studies, the presence of zebra mussel druses (colonies) provided shelter for macroinvertebrates, reducing their vulnerability to predation by perch (Perca fluviatills) larvae and yearlings, thereby increasing macroinvertebrate species diversity. It was shown that in addition to its role in aquatic biocenosis (ecological community) formation and water purification, Dreissenidae are important food objects for benthophagous fishes, especially roach (Rutilus rutilus). Examination of intestines of benthophagous fishes showed that the length of Dreissenidae ranged from 5 to 20 mm in roach; from 4 to 14 mm in silver bream (Blicca bjoerkna), and from 2 to 10 mm in bream (Abramis brama). The largest mussels consumed were Quagga mussels up to 30 mm, noted in the predatory cyprinid, ide (Leuciscus idus). Copyright ?? 2006 by ASTM International.
Directory of Open Access Journals (Sweden)
Silvia Regina de Lima
2010-08-01
Full Text Available In this study, the main chemical components of Moquinia polymorpha (LESS. DC. (candeia or cambará wood were investigated. This wood is native in the Southern region of Minas Gerais - Brazil. The chemical composition was: 47.5% of α-cellulose, 25.4% of A and B hemicelluloses, 24.0% of lignin, 73.2% of holocellulose, 3.82% of ethanol:cyclohexane (1:1, v v-1 extractives, 3.21% of ethanol extractives and 4.04% of hot water extractives. The volatile composition was mainly: α-curcumene, α-dihydroturmerone, β-dihydroturmerone, cedranol, 1-cyclopentyl-3-[2,4-dimethylphenyl]propane. The total phenols analysis was carried out on methanol:water (MW and acetone:water (AW extracts. The last one presented better yield. The total phenols were determined by Folin-Ciocalteau and the modified Prussian blue assays. Folin-Ciocalteau yielded 0.93 mg g-1 of wood for MW extract and 1.56 for AW extract; modified Prussian blue yielded 2.74 mg g-1 of wood for MW extract and 4.42 for AW extract. Proanthocyanidins were determined by n-buthanol-acid and vanillin assays. The n-buthanol acid yielded 0.012 mg g-1 of wood for MW extract and 0.017 for AW extract; vanillin: 0.29 mg g-1 of wood for MW extract and 0.58 for AW extract. 3-deoxy-proanthocyanidins were not detected.
Farsad, Nikrooz; Sone, Eli D
2012-03-01
The freshwater zebra mussel (Dreissena polymorpha) owes a large part of its success as an invasive species to its ability to attach to a wide variety of substrates. As in marine mussels, this attachment is achieved by a proteinaceous byssus, a series of threads joined at a stem that connect the mussel to adhesive plaques secreted onto the substrate. Although the zebra mussel byssus is superficially similar to marine mussels, significant structural and compositional differences suggest that further investigation of the adhesion mechanisms in this freshwater species is warranted. Here we present an ultrastructural examination of the zebra mussel byssus, with emphasis on interfaces that are critical to its adhesive function. By examining the attached plaques, we show that adhesion is mediated by a uniform electron dense layer on the underside of the plaque. This layer is only 10-20 nm thick and makes direct and continuous contact with the substrate. The plaque itself is fibrous, and curiously can exhibit either a dense or porous morphology. In zebra mussels, a graded interface between the animal and the substrate mussels is achieved by interdigitation of uniform threads with the stem, in contrast to marine mussels, where the threads themselves are non-uniform. Our observations of several novel aspects of zebra mussel byssal ultrastructure may have important implications not only for preventing biofouling by the zebra mussel, but for the development of new bioadhesives as well. Copyright © 2012 Elsevier Inc. All rights reserved.
Bervoets, Lieven; Voets, Judith; Chu, Shaogang; Covaci, Adrian; Schepens, Paul; Blust, Ronny
2004-08-01
Zebra mussels (Dreissena polymorpha) were exposed at 12 canals and lakes situated in Flanders (Belgium), in cages for six weeks during the summer of 2002. Accumulation of polychlorinated biphenyls (PCBs), polybrominated diphenyl ethers (PBDEs), hexachlorobenzene, and trace metals were measured in the transplanted mussels and levels compared to levels in indigenous mussels. Additionally, zebra mussels were exposed at a small lake in the vicinity of Antwerp (Belgium), and accumulation of contaminants was followed for an extended period from December 2001 to April 2002. Analysis of the pollutants in the indigenous mussels showed that the selected sites displayed a wide range of pollution from near to background to very high levels of metals and/or organic contaminants when compared to the literature. For organic contaminants and for most metals, comparison of levels between caged and resident mussels revealed no significant differences. Only for cadmium and nickel, significant differences were observed, with levels being either higher (cadmium) or lower (nickel) in caged mussels. For organic contaminants, significant correlations between levels in caged and resident mussels were found with r2 values up to 0.98. For some metals, no or poor correlations were found. At most sites, concentrations of those metals were of the same order of magnitude and comparable to levels in mussels from unpolluted sites. This might explain the absence of significant correlations. When mussels were exposed for an extended period, the concentration of some pollutants increased, whereas others decreased with time. Only in the case of certain metals did levels differ significantly because of the slow depuration of metals already present in the transplanted mussels. This is an additional indication that measured concentrations in transplanted mussels indeed reflected the local situation. With this study, we were able to prove the applicability of transplanted mussels as a biomonitoring tool
Body size-dependent Cd accumulation in the zebra mussel Dreissena polymorpha from different routes.
Tang, Wen-Li; Evans, Douglas; Kraemer, Lisa; Zhong, Huan
2017-02-01
Understanding body size-dependent metal accumulation in aquatic organisms (i.e., metal allometry) is critical in interpreting biomonitoring data. While growth has received the most attention, little is known about controls of metal exposure routes on metal allometry. Here, size-dependent Cd accumulation in zebra mussels (Dreissena polymorpha) from different routes were investigated by exposing mussels to A.( 111 Cd spiked algae+ 113 Cd spiked river water) or B.( 111 Cd spiked sediments+ 113 Cd spiked river water). After exposure, 111 Cd or 113 Cd levels in mussel tissue were found to be negatively correlated with tissue weight, while Cd allometry coefficients (b values) were dependent on Cd exposure routes: -0.664 for algae, -0.241 for sediments and -0.379 for river water, compared to -0.582 in un-exposed mussels. By comparing different Cd exposure routes, we found that size-dependent Cd bioaccumulation from algae or river water could be more responsible for the overall size-dependent Cd accumulation in mussels, and the relative importance of the two sources was dependent on mussel size ranges: Cadmium obtained from algae (algae-Cd) was more important in size-dependent Cd accumulation in smaller mussels (tissue dry weight 5 mg). In contrast, sediment-Cd contributed only a small amount to Cd accumulation in zebra mussels and may have little effect on size-dependent Cd bioaccumulation. Our results suggest that size-dependent Cd accumulation in mussels could be largely affected by exposure routes, which should be considered when trying to interpret Cd biomonitoring data of zebra mussels. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Sures, B.; Steiner, W.; Rydlo, M.; Taraschewski, H.
1999-11-01
Concentrations of the elements Al, Ag, Ba, ca, Cd, Co, Cr, cu, Fe, Ga, Mg, Mn, Ni, Pb, Sr, Tl, and Zn were analyzed by inductively coupled plasma mass spectrometry in the acanthocephalan Acanthocephalus lucii (Mueller); in its host, Perca fluviatilis (L.), and in the soft tissue of the zebra mussel, Dreissena polymorpha (Pallas). All animals were collected from the same sampling site in a subalpine lake, Mondsee, in Austria. Most of the elements were found at significantly higher concentrations in the acanthocephalan than in different tissues (muscle, liver, and intestinal wall) of its perch host. Only Co was concentrated in the liver of perch to a level that was significantly higher than that found in the parasite. Most of the analyzed elements were also present at significantly higher concentrations in A. lucii than in D. polymorpha. Barium and Cr were the only elements recorded at higher concentrations in the mussel compared with the acanthocephalan. Thus, when comparing the accumulation of elements, the acanthocephalans appear to be even more suitable than the zebra mussels in terms of their use in the detection of metal contamination within aquatic biotopes. Spearman correlation analysis revealed that the concentrations of several elements within the parasites decreased with increasing infrapopulation. Furthermore, the levels of some elements in the perch liver were negatively correlated with the weight of A. lucii in the intestine. Thus, it emerged that not only is there competition for elements between acanthocephalans inside the gut but there is also competition for these elements between the host and the parasites. The elevated element concentrations demonstrated here in the parasitic worm A. lucii provide support for further investigations of these common helminthes and of their accumulation properties.
Binelli, A; Ricciardi, F; Riva, C; Provini, A
2006-01-01
One of the useful biological tools for environmental management is the measurement of biomarkers whose changes are related to the exposure to chemicals or environmental stress. Since these responses might vary with different contaminants or depending on the pollutant concentration reached in the organism, the support of bioaccumulation data is needed to prevent false conclusions. In this study, several persistent organic pollutants -- 23 polychlorinated biphenyl (PCB) congeners, 11 polycyclic aromatic hydrocarbons (PAHs), six dichlorodiphenyltricholroethane (DDT) relatives, hexachlorobenzene (HCB), chlorpyrifos and its oxidized metabolite -- and some herbicides (lindane and the isomers alpha, beta, delta; terbutilazine; alachlor; metolachlor) were measured in the soft tissues of the freshwater mollusc Zebra mussel (Dreissena polymorpha) from 25 sampling sites in the Italian portions of the sub-alpine great lakes along with the measure of ethoxyresorufin dealkylation (EROD) and acetylcholinesterase (AChE) activity. The linkage between bioaccumulation and biomarker data allowed us to create site-specific environmental quality indexes towards man-made chemicals. This classification highlighted three different degrees of xenobiotic contamination of the Italian sub-alpine great lakes: a high water quality in Lake Lugano with negligible pollutant levels and no effects on enzyme activities, an homogeneous poor quality for Lakes Garda, Iseo and Como, and the presence of some xenobiotic point-sources in Lake Maggiore, whose ecological status could be jeopardized, also due to the heavy DDT contamination revealed since 1996.
Shoults-Wilson, W Aaron; Elsayed, Norhan; Leckrone, Kristen; Unrine, Jason
2015-02-01
The invasive zebra mussel (Dreissena polymorpha) has become an accepted biomonitor organism for trace elements, but it has yet to be studied along the Lake Michigan shoreline. Likewise, the relationships between tissue concentrations of elements, organism size, and sediment concentrations of elements have not been fully explained. The present study found that a variety of allometric variables such as length, dry tissue mass, shell mass, organism condition indices, and shell thickness index were useful in explaining intrasite variability in elemental concentrations. The flesh condition index (grams of tissue dry mass per gram of shell mass) explained variability at the most sites for most elements. Once allometric intrasite variability was taken into account, additional significant differences were found between sites, although the net effect was small. Significant positive relationships between sediment and tissue concentrations were found for Pb and Zn, with a significant negative relationship for Cd. It was also found that Cu and Zn concentrations in tissues increased significantly along the shoreline in the southeasterly direction, whereas Hg increased in a northwesterly direction. Opportunistic sampling found that zebra mussels accumulate significantly higher concentrations of nearly all elements analyzed compared to Asian clams (Corbicula fluminea) at the same site. The present study demonstrates the need to fully explain natural sources of variability before using biomonitors to explain spatial distributions of trace elements. © 2014 SETAC.
Molloy, Daniel P; Lynn, Denis H; Giamberini, Laure
2005-07-18
Ophryoglena hemophaga n. sp. is described from a freshwater Dreissena polymorpha population in the Rhine delta of the Netherlands. This is the first ophryoglenine species (order Hymenostomatida, suborder Ophryoglenina) recorded as a molluscan parasite. As is typical of ciliates in the suborder Ophryoglenina, O. hemophaga exhibits a polymorphic life history with cystment and reproduction by palintomy. Trophonts were observed within digestive gland lumina, and zebra mussel hemocytes were present in some of their digestive vacuoles. The presence of a single, longitudinal tract of multiple contractile vacuoles represents its most unique feature and distinguishes it from all other described Ophryoglena spp. The number of somatic kineties of O. hemophaga (range 100 to 124) is also distinguishing as it is one of the lowest for [corrected] an Ophryoglena sp. Other characteristics of this species include: ovoid to elongate trophonts 96 to 288 microm in length, with an elongate macronucleus 41 to 65 microm in length; tomonts 50 to 150 microm in diameter producing a clear mucous cyst envelope, whose thickness is approximately half of the tomont diameter; elongated theronts 96 to 131 microm in length which emerge after 1 to 3 cell divisions taking 36 to 48 h at 20 +/- 3 degrees C. Protomonts and theronts are, respectively, negatively and positively phototactic--characteristics that likely aid in maintenance of infection in zebra mussel populations.
Châtel, Amélie; Faucet-Marquis, Virginie; Gourlay-Francé, Catherine; Pfohl-Leszkowicz, Annie; Vincent-Hubert, Françoise
2015-04-01
The aim of the present study was to confirm the relevance of studying DNA adduct formation in a field study. In that context, freshwater mussels Dreissena polymorpha, collected in a reference station, were transplanted in different sites with a pollution gradient. After one and two months, mussels were collected and DNA adduct formation was analyzed using the (32)P post labelling technique on both gills and digestive glands. In addition, the expression of genes involved in the detoxification system (catalase (CAT), superoxide dismutase (SOD), glutathione S-transferase (GST), HSP70, aryl hydrocarbon receptor (AHR), P glycoprotein (PgP), metallothionein (MT)) was assessed by RT-PCR. DNA adducts were observed at amount comparable to data from literature. Increase of DNA adducts after two months of transplantation could be correlated with strong modulation of gene expression implicated in detoxification processes. Indeed, PgP and HSP70 gene expressions were similarly induced in gills and digestive glands while SOD and CAT expressions were down regulated in both tissues. AHR, GST and MT genes were differently regulated depending upon the tissue studied and the level of contamination in the different sites. We demonstrated that mussels transplanted in the different stations with pollution gradient were able to biotransform PAHs, assessed by DNA adduct formation and the high decrease of detoxification genes. Specific DNA adducts pattern obtained after one and two month mussel transplantations demonstrated the relevance of DNA adduct as biomarker of environmental pollution. Copyright © 2014 Elsevier Inc. All rights reserved.
Palais, F; Dedourge-Geffard, O; Beaudon, A; Pain-Devin, S; Trapp, J; Geffard, O; Noury, P; Gourlay-Francé, C; Uher, E; Mouneyrac, C; Biagianti-Risbourg, S; Geffard, A
2012-04-01
A 12-month active biomonitoring study was performed in 2008-2009 on the Vesle river basin (Champagne-Ardenne, France) using the freshwater mussel Dreissena polymorpha as a sentinel species; allochthonous mussels originating from a reference site (Commercy) were exposed at four sites (Bouy, Sept-Saulx, Fismes, Ardre) within the Vesle river basin. Selected core biomarkers (acetylcholinesterase (AChE) activity, glutathione-S transferase (GST) activity, metallothionein concentration), along with digestive enzyme activities (amylase, endocellulase) and energy reserve concentrations (glycogen, lipids), were monitored throughout the study in exposed mussels. At the Fismes and Ardre sites (downstream basin), metallic and organic contamination levels were low but still high enough to elicit AChE and GST activity induction in exposed mussels (chemical stress); besides, chemical pollutants had no apparent deleterious effects on mussel condition. At the Bouy and Sept-Saulx sites (upstream basin), mussels obviously suffered from adverse food conditions which seriously impaired individual physiological state and survival (nutritional stress); food scarcity had however no apparent effects on core biomarker responses. Digestive enzyme activities responded to both chemical and nutritional stresses, the increase in energy outputs (general adaptation syndrome-downstream sites) or the decrease in energy inputs (food scarcity-upstream sites) leading to mid- or long-term induction of digestive carbohydrase activities in exposed mussels (energy optimizing strategy). Complex regulation patterns of these activities require nevertheless the use of a multi-marker approach to allow data interpretation. Besides, their sensitivity to natural confounding environmental factors remains to be precised.
Uptake of dissolved organic carbon and trace elements by zebra mussels
Roditi, Hudson A.; Fisher, Nicholas S.; Sañudo-Wilhelmy, Sergio A.
2000-09-01
Zebra mussels (Dreissena polymorpha) are widespread and abundant in major freshwater ecosystems in North America, even though the phytoplankton food resources in some of these systems seem to be too low to sustain them. Because phytoplankton biomass is greatly depleted in ecosystems with large D. polymorpha populations and bacteria do not seem to be an important food source for this species, exploitation of alternative carbon sources may explain the unexpected success of D. polymorpha in such environments. Here we examine the possibility that absorption of dissolved organic carbon (DOC) from water could provide a nutritional supplement to zebra mussels. We find that mussels absorb 14C-labelled DOC produced by cultured diatoms with an efficiency of 0.23%; this indicates that DOC in natural waters could contribute up to 50% of the carbon demand of zebra mussels. We also find that zebra mussels absorb some dissolved metals that have been complexed by the DOM; although absorption of dissolved selenium was unaffected by DOC, absorption of dissolved cadmium, silver and mercury by the mussels increased 32-, 8.7- and 3.6-fold, respectively, in the presence of high-molecular-weight DOC.
Cope, W.G.; Newton, T.J.; Gatenby, C.M.
2003-01-01
Because of the declines in diversity and abundance of native freshwater mussels (superfamily Unionoidea), and the potential decimation of populations of native mussels resulting from the rapid spread of the exotic zebra mussel Dreissena polymorpha, management options to eliminate or reduce the threat of the zebra mussel are needed. Relocating native mussels to refugia (artificial and natural) has been proposed to mitigate the threat of zebra mussels to native species. Relocation of native mussels to refugia such as fish hatchery facilities or natural habitats within their historic range. Which are unlikely to be infested by zebra mussels, necessitates that protocols be developed to prevent the inadvertent introduction of zebra mussels. Several recent studies have developed Such protocols, and have assessed their effectiveness on the health and survival of native mussels during subsequent relocation to various refugia. The purpose of this project is to synthesize and evaluate the current protocols and to develop a set of procedures that resource managers and researchers should consider before conducting conservation activities in zebra mussel infested waters. We found that the existing protocols have many common points of concern, such as facility modification and suitability, zebra mussel risk assessment and management procedures, and health and disease management procedures. These conservation protocols may have broad applicability to other situations and locations. A summary and evaluation of the information in these main areas, along with recommended guidelines, are presented in this article.
Directory of Open Access Journals (Sweden)
Périne Doyen
2015-04-01
Full Text Available Glutathione S-transferases (GST, glutathione peroxidases (GPx and metallothioneins (MT are essential components of cellular detoxication systems. We studied the expression of pi-GST, Se-GPx, and MT transcripts in the digestive gland of Dreissena polymorpha exposed to organic and metallic pollutants. Mussels from a control site were transplanted during 3, 15 and 30 days into the Moselle River, upstream and downstream to the confluence with the Fensch River, a tributary highly polluted by polycyclic aromatic hydrocarbons and heavy metals. Se-GPx and pi-GST mRNA expression increased in mussels transplanted into the upstream site, Se-GPx response being the earliest. These genes were also induced after 3-days exposure at the downstream site. These inductions suggest an adaptative response to an alteration of the environment. Moreover, at this site, a significant decrease of the expression of MT, pi-GST and Se-GPx transcripts was observed after 30 days which could correspond to an inefficiency of detoxification mecanisms. The results are in correlation with the levels of pollutants in the sediments and their bioaccumulation in mussels, they confirm the environmental deleterious impact of the pollutants carried by the Fensch River.
Digestive physiology comparisons of aquatic invertebrates in the Upper Mississippi River Basin
Sauey, Blake W.; Amberg, Jon J.; Cooper, Scott T.; Grunwald, Sandra K.; Haro, Roger J.; Gaikowski, Mark
2016-01-01
Limited information is available on the composition of digestive enzymes present in unionid mussels and the zebra mussel, Dreissena polymorpha. Available information is nearly exclusive to species used for culture purposes. A commercially available enzyme assay kit was used to examine the effect of habitat within an ecosystem, season, and species on the activities of several digestive enzymes. We used Amblema plicata to represent native unionids, D. polymorpha, and also Hydropsyche orris as an outgroup to compare differences between mussels and other macroinvertebrates. The data indicated that neither location nor time affect the activities of the digestive enzymes tested; species was the only factor to affect the activity. Differences were found mostly between four enzymes: naphthol-AS-BI-phosphohydrolase, acid phosphatase, alkaline phosphatase, and β-galactosidase.
Directory of Open Access Journals (Sweden)
Luciana Francisco Fleuri
2010-06-01
Full Text Available O presente trabalho visou a aplicação da β-1,3 glucanase lítica, obtida do microrganismo Cellulosimicrobium cellulans 191, na produção de protoplastos e na lise da parede celular de leveduras. A preparação bruta da enzima foi capaz de lisar as leveduras Kluyveromyces lodderi, Saccharomyces cerevisiae (Fleischmann e Itaiquara, S. cerevisiae KL-88, S. diastaticus NCYC 713, S. cerevisiae NCYC 1001, Candida glabrata NCYC 388, Kluyveromyces marxianus NCYC 587 e Hansenula mrakii NCYC 500. A β-1,3 glucanase purificada foi capaz de lisar as leveduras Saccharomyces cerevisiae KL-88, Saccharomyces capensis, Debaromyces vanriji, Pachysolen tannophillus, Kluyveromyces drosophilarum, Candida glabrata, Hansenula mrakii e Pichia membranaefaciens e formar protoplastos de Saccharomyces cerevisiae KL-88.The aim of this work was the application of lytic β-1,3 glucanase obtained from Cellulosimicrobium cellulans strain 191 in the production of protoplasts and lysis of yeast cell walls. The crude extract demonstrated lysis activity against the yeasts Kluyveromyces lodderi, Saccharomyces cerevisiae (Fleischmann and Itaiquara, S. cerevisiae KL-88, S. diastaticus NCYC 713, S. cerevisiae NCYC 1001, Candida glabrata NCYC 388, Kluyveromyces marxianus NCYC 587, and Hansenula mrakii NCYC 500. The purified β-1,3 glucanase demonstrated lysis activity against the yeasts Saccharomyces cerevisiae KL-88, Saccharomyces capensis, Debaromyces vanriji, Pachysolen tannophillus, Kluyveromyces drosophilarum, Candida glabrata, Hansenula mrakii, and Pichia membranaefaciens, and it was able to produce Saccharomyces cerevisiae KL-88 protoplasts.
Regoli, L; Chan, H M; de Lafontaine, Y; Mikaelian, I
2001-07-01
Toxic antifouling agents such as tributyltin (TBT) and triphenyltin (TPT) have been released in aquatic ecosystems through the use of antifouling paint applied to ship hulls, pleasure crafts and fish nets and these compounds can bioaccumulate in aquatic organisms. The purpose of this study was 1) to assess the extent of the distribution of organotins from a contaminated marina to the St. Lawrence River system by measuring organotin concentrations in zebra mussels (Dreissena polymorpha) and in sediments collected from 9 sites along the St. Lawrence River near Quebec City in July 1998, and 2) to examine the histopathological condition of zebra mussel tissues from these sites. TBT concentrations in zebra mussels were between 37 and 1078 ng Sn g(-1) wet weight, with the highest value found in the Bassin Louise marina. Elevated concentrations were also found in two other marinas. The concentrations decreased sharply to background levels just outside the marinas. All butyltins were detected in all sediments analysed, with highest values found in the Bassin Louise marina. Phenyltins were detected in three of the nine sites in low concentrations (zebra mussels. There was a significant correlation between TBT in sediments and mussels. Gonadal development of zebra mussels varied largely between sites, and was negatively associated to TBT levels in mussel tissue. This study shows that TBT contamination remains a problem in localised freshwater sectors of the St. Lawrence River.
Avaliação da atividade antimicrobiana e citotóxica de extratos de Gochnatia polymorpha ssp floccosa
Directory of Open Access Journals (Sweden)
Maria Élida A. Stefanello
Full Text Available Neste estudo procedeu-se a avaliação da atividade antimicrobiana e citotóxica de extratos de Gochnatia polymorpha ssp floccosa, espécie empregada na medicina popular contra doenças respiratórias. Folhas, cascas do tronco e ramos foram extraídos com hexano, diclorometano e etanol, sucessivamente, sendo obtidos os respectivos extratos brutos. A atividade antimicrobiana foi determinada pelo método de difusão em ágar utilizando-se bactérias Gram-positivas, Gram-negativas e fungos. A avaliação da citotoxicidade foi realizada empregando-se o ensaio de letalidade contra Artemia salina. Nenhum dos extratos mostrou atividade citotóxica. Os extratos das folhas apresentaram uma fraca atividade antimicrobiana frente a algumas cepas de Staphylococcus aureus e Streptococcus mutans, enquanto o extrato em diclorometano dos ramos e o extrato em etanol das cascas foram ativos contra Micrococcus luteus, Staphylococcus aureus e S. epidermidis. A maior atividade antimicrobiana foi observada para o extrato em diclorometano das cascas, que inibiu o crescimento de Micrococcus luteus, Staphylococcus aureus, S. epidermidis, Streptococcus mutans, Enterococcus faecalis e Candida albicans. Esta atividade parece estar relacionada à presença de diterpenos no extrato. Nenhum dos extratos estudados (a 5,0 mg/mL mostrou atividade frente a cepas de bactérias Gram-negativas. Esses resultados demonstram o potencial dessa planta como fonte de compostos antibacterianos e justificam, parcialmente, seu uso popular.
Hanson, Sara J; Byrne, Kevin P; Wolfe, Kenneth H
2014-11-11
Saccharomyces cerevisiae has a complex system for switching the mating type of haploid cells, requiring the genome to have three mating-type (MAT)-like loci and a mechanism for silencing two of them. How this system originated is unknown, because the three-locus system is present throughout the family Saccharomycetaceae, whereas species in the sister Candida clade have only one locus and do not switch. Here we show that yeasts in a third clade, the methylotrophs, have a simpler two-locus switching system based on reversible inversion of a section of chromosome with MATa genes at one end and MATalpha genes at the other end. In Hansenula polymorpha the 19-kb invertible region lies beside a centromere so that, depending on the orientation, either MATa or MATalpha is silenced by centromeric chromatin. In Pichia pastoris, the orientation of a 138-kb invertible region puts either MATa or MATalpha beside a telomere and represses transcription of MATa2 or MATalpha2. Both species are homothallic, and inversion of their MAT regions can be induced by crossing two strains of the same mating type. The three-locus system of S. cerevisiae, which uses a nonconservative mechanism to replace DNA at MAT, likely evolved from a conservative two-locus system that swapped genes between expression and nonexpression sites by inversion. The increasing complexity of the switching apparatus, with three loci, donor bias, and cell lineage tracking, can be explained by continuous selection to increase sporulation ability in young colonies. Our results provide an evolutionary context for the diversity of switching and silencing mechanisms.
Karkovska, Maria; Smutok, Oleh; Stasyuk, Nataliya; Gonchar, Mykhailo
2015-11-01
In the recent years, nanotechnology is the most developing branch due to a wide variety of potential applications in biomedical, biotechnological and agriculture fields. The binding nanoparticles with various biological molecules makes them attractive candidates for using in sensor technologies. The particularly actual is obtaining the bionanomembranes based on biocatalytic elements with improved sensing characteristics. The aim of this investigation is to study the properties of microbial L-lactate-selective sensor based on using the recombinant Hansenula polymorpha yeast cells overproducing flavocytochrome b2 (FC b2), as well as additionally enriched by the enzyme bound with gold nanoparticles (FC b2-nAu). Although, the high permeability of the living cells to nanoparticles is being intensively studied (mostly for delivery of drugs), the idea of using both recombinant technology and nanotechnology to increase the amount of the target enzyme in the biosensing layer is really novel. The FC b2-nAu-enriched living and permeabilized yeast cells were used for construction of a bioselective membrane of microbial L-lactate-selective amperometric biosensor. Phenazine methosulphate was served as a free defusing electron transfer mediator which provides effective electron transfer from the reduced enzyme to the electrode surface. It was shown that the output to L-lactate of FC b2-nAu-enriched permeabilized yeast cells is 2.5-fold higher when compared to the control cells. The obtained results confirm that additional enrichment of the recombinant yeast cell by the enzyme bound with nanoparticles improves the analytical parameters of microbial sensor. Copyright © 2015 Elsevier B.V. All rights reserved.
Jost, Jennifer A; Keshwani, Sarah S; Abou-Hanna, Jacob J
2015-04-01
Global climate change is affecting ectothermic species, and a variety of studies are needed on thermal tolerances, especially from cellular and physiological perspectives. This study utilized AMP-activated protein kinase (AMPK), a key regulator of cellular energy levels, to examine the effects of high water temperatures on zebra mussel (Dreissena polymorpha) physiology. During heating, AMPK activity increased as water temperature increased to a point, and maximum AMPK activity was detected at high, but sublethal, water temperatures. This pattern varied with season, suggesting that cellular mechanisms of seasonal thermal acclimatization affect basic metabolic processes during sublethal heat stress. There was a greater seasonal variation in the water temperature at which maximum AMPK activity was measured than in lethal water temperature. Furthermore, baseline AMPK activity varied significantly across seasons, most likely reflecting altered metabolic states during times of growth and reproduction. In addition, when summer-collected mussels were lab-acclimated to winter and spring water temperatures, patterns of heat stress mirrored those of field-collected animals. These data suggest that water temperature is the main driver of the seasonal variation in physiology. This study concluded that AMPK activity, which reflects changes in energy supply and demand during heat stress, can serve as a sensitive and early indicator of temperature stress in mussels. Copyright © 2014 Elsevier Inc. All rights reserved.
Lepoutre, Alexandra; Milliote, Nadia; Bonnard, Marc; Palos-Ladeiro, Mélissa; Rioult, Damien; Bonnard, Isabelle; Bastien, Fanny; Faassen, Elisabeth; Geffard, Alain; Lance, Emilie
2018-03-01
The environmental neurotoxin β- N -Methylamino-l-alanine (BMAA) has been pointed out to be involved in human neurodegenerative diseases. This molecule is known to be bioaccumulated by bivalves. However, little data about its toxic effects on freshwater mussels is available, particularly on the hemolymphatic compartment and its hemocyte cells involved in various physiological processes such as immune defenses, digestion and excretion, tissue repair, and shell production. Here we exposed Dreissena polymorpha to dissolved BMAA, at the environmental concentration of 7.5 µg of /mussel/3 days, during 21 days followed by 14 days of depuration in clear water, with the objective of assessing the BMAA presence in the hemolymphatic compartment, as well as the impact of the hemocyte cells in terms of potential cytotoxicity, immunotoxicity, and genotoxiciy. Data showed that hemocytes were in contact with BMAA. The presence of BMAA in hemolymph did not induce significant effect on hemocytes phagocytosis activity. However, significant DNA damage on hemocytes occurred during the first week (days 3 and 8) of BMAA exposure, followed by an increase of hemocyte mortality after 2 weeks of exposure. Those effects might be an indirect consequence of the BMAA-induced oxidative stress in cells. However, DNA strand breaks and mortality did not persist during the entire exposure, despite the BMAA persistence in the hemolymph, suggesting potential induction of some DNA-repair mechanisms.
Zhong, Huan; Kraemer, Lisa; Evans, Douglas
2013-10-15
Size of organisms is critical in controlling metal bioavailability and bioaccumulation, while mechanisms of size-related metal bioaccumulation are not fully understood. To investigate the influences of different sources of particle-associated Cu on body size-related Cu bioavailability and bioaccumulation, zebra mussels (Dreissena polymorpha) of different sizes were exposed to stable Cu isotope ((65)Cu) spiked algae (Chlorella vulgaris) or sediments in the laboratory and the Cu tissue concentration-size relationships were compared with that in unexposed mussels. Copper tissue concentrations decreased with mussel size (tissue or shell dry weight) in both unexposed and algal-exposed mussels with similar decreasing patterns, but were independent of size in sediment-exposed mussels. Furthermore, the relative contribution of Cu uptake from algae (65-91%) to Cu bioaccumulation is always higher than that from sediments (9-35%), possibly due to the higher bioavailability of algal-Cu. Therefore, the size-related ingestion of algae could be more important in influencing the size-related variations in Cu bioaccumulation. However, the relative contribution of sediment-Cu to Cu bioaccumulation increased with body size and thus sediment ingestion may also affect the size-related Cu variations in larger mussels (tissue weight >7.5mg). This study highlights the importance of considering exposure pathways in normalization of metal concentration variation when using bivalves as biomonitors. Copyright © 2013 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Alexandra Lepoutre
2018-03-01
Full Text Available The environmental neurotoxin β-N-Methylamino-l-alanine (BMAA has been pointed out to be involved in human neurodegenerative diseases. This molecule is known to be bioaccumulated by bivalves. However, little data about its toxic effects on freshwater mussels is available, particularly on the hemolymphatic compartment and its hemocyte cells involved in various physiological processes such as immune defenses, digestion and excretion, tissue repair, and shell production. Here we exposed Dreissena polymorpha to dissolved BMAA, at the environmental concentration of 7.5 µg of /mussel/3 days, during 21 days followed by 14 days of depuration in clear water, with the objective of assessing the BMAA presence in the hemolymphatic compartment, as well as the impact of the hemocyte cells in terms of potential cytotoxicity, immunotoxicity, and genotoxiciy. Data showed that hemocytes were in contact with BMAA. The presence of BMAA in hemolymph did not induce significant effect on hemocytes phagocytosis activity. However, significant DNA damage on hemocytes occurred during the first week (days 3 and 8 of BMAA exposure, followed by an increase of hemocyte mortality after 2 weeks of exposure. Those effects might be an indirect consequence of the BMAA-induced oxidative stress in cells. However, DNA strand breaks and mortality did not persist during the entire exposure, despite the BMAA persistence in the hemolymph, suggesting potential induction of some DNA-repair mechanisms.
Directory of Open Access Journals (Sweden)
Marc Bonnard
2015-06-01
Full Text Available The measure of DNA integrity by the single cell gel electrophoresis (SCGE or comet assay is especially recommended for its sensitivity and its capacity for detecting different types of damages. Therefore, it has been applied in environmental genotoxicity in a variety of organisms. It appears today necessary to define both reference and threshold levels of DNA damage, for their application in in situ biomonitoring. However, little is known about the influence of both biological (sex, reproduction status or external (temperature… confounding factors on the measure of DNA damage by the comet assay. These variables need to be taken into account if the robustness of the assay is to be established (Jha, 2008. In the zebra mussel Dreissena polymorpha (recommended as a sentinel species in the evaluation of freshwater quality the measure of DNA damage by the comet assay is mainly performed on hemocytes, which are circulating cells involved in key physiological functions such as immunity, homeostasis, detoxication…. This communication will present and discuss results from an innovative study about the variability of the baseline level of DNA damage in hemocytes of mussels encaged for one year in the canal de l’Aisne à la Marne (Reims, according to their sex and their reproductive status. The sensitivity and the suitability of hemocytes in the evaluation of environmental genotoxicity will also be discussed, referring to observations during a 6 month-exposure of mussels in mesocosms to environmentally realistic concentrations of carbamazepine.
Watanabe, Miki; Meyer, Kathryn A; Jackson, Tyler M; Schock, Tracey B; Johnson, W Edward; Bearden, Daniel W
Zebra mussel, Dreissena polymorpha , in the Great Lakes is being monitored as a bio-indicator organism for environmental health effects by the National Oceanic and Atmospheric Administration's Mussel Watch program. In order to monitor the environmental effects of industrial pollution on the ecosystem, invasive zebra mussels were collected from four stations-three inner harbor sites (LMMB4, LMMB1, and LMMB) in Milwaukee Estuary, and one reference site (LMMB5) in Lake Michigan, Wisconsin. Nuclear magnetic resonance (NMR)-based metabolomics was used to evaluate the metabolic profiles of the mussels from these four sites. The objective was to observe whether there were differences in metabolite profiles between impacted sites and the reference site; and if there were metabolic profile differences among the impacted sites. Principal component analyses indicated there was no significant difference between two impacted sites: north Milwaukee harbor (LMMB and LMMB4) and the LMMB5 reference site. However, significant metabolic differences were observed between the impacted site on the south Milwaukee harbor (LMMB1) and the LMMB5 reference site, a finding that correlates with preliminary sediment toxicity results. A total of 26 altered metabolites (including two unidentified peaks) were successfully identified in a comparison of zebra mussels from the LMMB1 site and LMMB5 reference site. The application of both uni- and multivariate analysis not only confirmed the variability of altered metabolites but also ensured that these metabolites were identified via unbiased analysis. This study has demonstrated the feasibility of the NMR-based metabolomics approach to assess whole-body metabolomics of zebra mussels to study the physiological impact of toxicant exposure at field sites.
Nichols, S. Jerrine; Black, M.G.
1994-01-01
There are presently four freshwater bivalves in the United States that produce larvae or veligers commonly found in the water column: two forms of Asian clams and two species of dreissenids. Portions of the geographic range of three of these bivalves, one species of Asian clam (Corbicula fluminea), zebra mussels (Dreissena polymorpha), and quagga mussels (Dreissena rosteriformis bugensis), overlap, causing problems with larval identification. To determine which characteristics can be used to separate larval forms, adult Asian clams, quaggas, and zebra mussels were brought into the laboratory and induced to spawn, and the resulting larvae were reared. Hybrids between quaggas and zebra mussels were also produced, but not reared to maturity. Characteristics allowing for the most rapid and accurate separation of larvae were hinge length, shell length/height, shell shape, shell size, and the presence or absence of a foot and velum. These characteristics were observed in laboratory-reared larvae of known parentage and field-caught larvae of unknown parentage. In most cases, larvae of the Asian clam can be readily separated from those produced by either type of dreissenid on the basis of shell size and presence of a foot. Separating the gametes and embryos of the two types of dreissenids is not possible, but after shell formation, most of the larval stages can be distinguished. Hinge length, shell length/height, and the similarity in size of the shell valves can be used to separate straight-hinged, umbonal, pediveliger, and plantigrade larvae. Quagga × zebra mussel hybrids show characteristics of both parents and are difficult to identify.
Kiel, JAKW; Veenhuis, M
2000-01-01
In the past decade, much progress has been made in understanding the mechanisms that govern sorting of proteins to the peroxisomal lumen. This article summarizes the principal features of how peroxisomal matrix enzymes are thought to reach the peroxisome. In addition, it describes recent data that
Ram, Jeffrey L.; Fong, Peter; Croll, Roger P.; Nichols, Susan J.; Wall, Darcie
1992-01-01
The zebra mussel (Dreissena polymorpha) has spread rapidly in temperate fresh waters of North America since its introduction into the Great Lakes in 1985 or 1986. It attaches to hard substrates, forming layers, occluding water intakes, encrusting and killing native mussels, filtering algae in competition with other planktivores, and possibly interfering with fish spawning. It reproduces prolifically, suggesting that an approach to its control may be by controlling its reproduction. Previous literature suggests that spawning in bivalves is regulated by both environmental and internal chemical cues. A suggested sequence is that phytoplankton chemicals initially trigger spawning; chemicals associated with gametes provide a species-specific pheromonal positive feedback for spawning; and the response to environmental chemicals is mediated internally by serotonin (5-HT). The role of 5-HT in zebra mussels is under investigation. Both males and females can be induced to spawn by either injection or external application of 5-HT. The response can also be activated by 8-hydroxy-2-(di-n-propylamino)-tetralin, an agonist at 5-HT1A receptors. HPLC analysis has detected 5-HT as the major biogenic amine in both male and female gonads. 5-HT immunocytochemistry demonstrates nerves containing serotonergic fibers innervating gonads of both males and females, with prominent varicosities surrounding the follicles in both sexes. A role of 5-HT in mediating spawning responses in zebra mussels is thus strongly supported. These studies have shown that reproductive behavior of zebra mussels can be modified by outside chemicals, a property that may be exploited for purposes of control.
Montanini, Barbara; Viscomi, Arturo R.; Bolchi, Angelo; Martin, Yusé; Siverio, José M.; Balestrini, Raffaella; Bonfante, Paola; Ottonello, Simone
2005-01-01
Nitrogen assimilation by plant symbiotic fungi plays a central role in the mutualistic interaction established by these organisms, as well as in nitrogen flux in a variety of soils. In the present study, we report on the functional properties, structural organization and distinctive mode of regulation of TbNrt2 (Tuber borchii NRT2 family transporter), the nitrate transporter of the mycorrhizal ascomycete T. borchii. As revealed by experiments conducted in a nitrate-uptake-defective mutant of the yeast Hansenula polymorpha, TbNrt2 is a high-affinity transporter (Km=4.7 μM nitrate) that is bispecific for nitrate and nitrite. It is expressed in free-living mycelia and in mycorrhizae, where it preferentially accumulates in the plasma membrane of root-contacting hyphae. The TbNrt2 mRNA, which is transcribed from a single-copy gene clustered with the nitrate reductase gene in the T. borchii genome, was specifically up-regulated following transfer of mycelia to nitrate- (or nitrite)-containing medium. However, at variance with the strict nitrate-dependent induction commonly observed in other organisms, TbNrt2 was also up-regulated (at both the mRNA and the protein level) following transfer to a nitrogen-free medium. This unusual mode of regulation differs from that of the adjacent nitrate reductase gene, which was expressed at basal levels under nitrogen deprivation conditions and required nitrate for induction. The functional and expression properties, described in the present study, delineate TbNrt2 as a versatile transporter that may be especially suited to cope with the fluctuating (and often low) mineral nitrogen concentrations found in most natural, especially forest, soils. PMID:16201972
New approaches for improving the production of the 1st and 2nd generation ethanol by yeast.
Kurylenko, Olena; Semkiv, Marta; Ruchala, Justyna; Hryniv, Orest; Kshanovska, Barbara; Abbas, Charles; Dmytruk, Kostyantyn; Sibirny, Andriy
2016-01-01
Increase in the production of 1st generation ethanol from glucose is possible by the reduction in the production of ethanol co-products, especially biomass. We have developed a method to reduce biomass accumulation of Saccharomyces cerevisiae by the manipulation of the intracellular ATP level due to overexpression of genes of alkaline phosphatase, apyrase or enzymes involved in futile cycles. The strains constructed accumulated up to 10% more ethanol on a cornmeal hydrolysate medium. Similar increase in ethanol accumulation was observed in the mutants resistant to the toxic inhibitors of glycolysis like 3-bromopyruvate and others. Substantial increase in fuel ethanol production will be obtained by the development of new strains of yeasts that ferment sugars of the abundant lignocellulosic feedstocks, especially xylose, a pentose sugar. We have found that xylose can be fermented under elevated temperatures by the thermotolerant yeast, Hansenula polymorpha. We combined protein engineering of the gene coding for xylose reductase (XYL1) along with overexpression of the other two genes responsible for xylose metabolism in yeast (XYL2, XYL3) and the deletion of the global transcriptional activator CAT8, with the selection of mutants defective in utilizing ethanol as a carbon source using the anticancer drug, 3-bromopyruvate. Resulted strains accumulated 20-25 times more ethanol from xylose at the elevated temperature of 45°C with up to 12.5 g L(-1) produced. Increase in ethanol yield and productivity from xylose was also achieved by overexpression of genes coding for the peroxisomal enzymes: transketolase (DAS1) and transaldolase (TAL2), and deletion of the ATG13 gene.
ORF Sequence: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SSQ-3, hansenula mrakii killer toxin-resistant protein 1 like (22.4 kD) (ssq-3) [Caenorhabditis elegans] MTAVGGAPRGASTM...TAVGGAPVGGSSTMTAVGGAPSGASTMTAIGGAPRGASTMTAVGGAPMGGGSTMTAVGGAPSGASTMTAVGGAPSGASTMTAIGGAPRGASTMTAV...GGAPMGGSSTMTAVGGAPIGGSSTMTAVGGAPRGVSTMTAVGGAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGGGGGGIPGQSVYMGAGGGGGGGGGATSAYFAPR
Kerambrun, E; Rioult, D; Delahaut, L; Evariste, L; Pain-Devin, S; Auffret, M; Geffard, A; David, E
2016-12-01
The present study was performed to validate the suitability of using gene expression in zebra mussels, Dreissena polymorpha, for biomonitoring of freshwater environment. Mussels were collected in four French rivers (Meuse, Moselle, Oise and Vilaine) in spring and autumn. Relative gene expression of 9 candidate genes involved in cellular metabolic activities (Cytochrome-c-oxidase - cox, and ATP synthase - atp), detoxification process (Metallothionein - mt and Glutathion-S-Transferase - gst), oxidative stress (Catalase - cat, Superoxyde Dismutase - sod and Glutathion peroxidase - gpx) and digestive functions (Amylase - amy and Cellulase - ghf) were measured in digestive gland. Metal bioaccumulation in tissues and morphometric parameters were also analyzed to interpret molecular responses. All our results are consistent with different physiological reactions to environmental condition between zebra mussel populations. In spring, the levels of mt, sod, gpx, cat, atp, amy and ghf relative expression were significantly higher in mussels with the lowest metal bioaccumulation (the Meuse) compared to at least one of the other sites. In autumn, this higher expression levels in Meuse River were still observed for gpx, cat, atp and amy. This study has also pointed out different sources of variability in gene expression (individual size, season, trophic resources and origin of mussels) which are inevitable in natural fluctuant environment. This underlines the importance to take them into account in field study to propose a correct interpretation of biomarker responses. Copyright © 2016 Elsevier Inc. All rights reserved.
Kraemer, Lisa D; Evans, Douglas; Dillon, Peter J
2013-05-01
Zebra mussels (Dreissena polymorpha) are filter feeders located near the base of the foodweb and these animals are able to utilize a variety of carbon sources that may also vary seasonally. We conducted both a spatial and a temporal study in order to test the hypotheses: (1) dissolved organic carbon (DOC) concentrations influence Hg accumulation in zebra mussels sampled from a series of lakes and (2) seasonal variations in diet influence Hg accumulation. In the spatial study, we found a significant negative relationship between Hg concentrations and DOC concentrations, suggesting an influence of DOC on Hg bioaccumulation. In the temporal study, we used stable isotope ratios of nitrogen (δ(15)N) and carbon (δ(13)C) as ecological tools to provide a temporally integrated description of the feeding ecology of zebra mussels. Both δ(15)N and δ(13)C varied seasonally in a similar manner: more depleted values occurred in the summer and more enriched values occurred in the fall. Mercury concentrations also varied significantly over the year, with highest concentrations occurring in the summer, followed by a progressive decrease in concentrations into the fall. The C/N ratio of zebra mussels also varied significantly over the year with the lowest values occurring mid-summer and then values increased in the fall and winter, suggesting that there was significant variation in lipid stores. These results indicate that in addition to any effect of seasonal dietary changes, seasonal variation in energy stores also appeared to be related to Hg levels in the zebra mussels. Collectively results from this study suggest that DOC concentrations, seasonal variation in diet and seasonal depletion of energy stores are all important variables to consider when understanding Hg accumulation in zebra mussels. Copyright © 2013 Elsevier Inc. All rights reserved.
Magni, Stefano; Gagné, François; André, Chantale; Della Torre, Camilla; Auclair, Joëlle; Hanana, Houda; Parenti, Camilla Carla; Bonasoro, Francesco; Binelli, Andrea
2018-08-01
Microplastics (MPs), plastic debris smaller than 5mm, are widely found in both marine and freshwater ecosystems. However, few studies regarding their hazardous effects on inland water organisms, have been conducted. For this reason, the aim of our research was the evaluation of uptake and chronic toxicity of two mixtures (MIXs) of virgin polystyrene microbeads (PMs) of 10μm and 1μm in size (MIX 1, with 5×10 5 of 1μmsizePMs/L and 5×10 5 of 10μmsizePMs/L, and MIX 2 with 2×10 6 of 1μmsizePMs/L and 2×10 6 of 10μmsizePMs/L) on freshwater zebra mussel Dreissena polymorpha (Mollusca: Bivalvia) during 6 exposure days. The PM uptake in the mussel body and hemolymph was assessed using confocal microscopy, while the chronic toxicity of PMs was evaluated on exposed mussels using a comprehensive battery of biomarkers of cellular stress, oxidative damage and neuro- genotoxicity. Confocal microscopy analyses showed that MPs concentrated in the gut lumen of exposed mussels, absorbed and transferred firstly in the tissues and then in the hemolymph. The results revealed that PMs do not produce oxidative stress and genetic damage, with the exception of a significant modulation of catalase and glutathione peroxidase activities in mussels exposed to MIX 1. Regarding neurotoxicity, we observed only a significant increase of dopamine concentration in mussels exposed to both MIXs, suggesting a possible implication of this neurotransmitter in an elimination process of accumulated PMs. This research represents a first study about the evaluation of virgin MP toxicity in zebra mussel and more research is warranted concerning the long term neurological effects of virgin MPs. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.
Le, T T Yen; Leuven, Rob S E W; Hendriks, A Jan
2011-12-01
The metal-specific covalent index and the species-specific size-based filtration rate were integrated into a biokinetic model estimating metal bioaccumulation in mussels from the dissolved phase and phytoplankton. The model was validated for zebra (Dreissena polymorpha) and quagga (Dreissena rostriformis bugensis) mussels in the rivers Rhine and Meuse, the Netherlands. The model performed well in predicting tissue concentrations in different-sized zebra mussels from various sampling sites for (55) Mn, (56) Fe, (59) Co, (60) Ni, (82) Se, (111) Cd, (118) Sn, and (208) Pb (r(2) =0.71-0.99). Performance for (52) Cr, (63) Cu, (66) Zn, (68) Zn, and (112) Cd was moderate (r(2) quagga mussels, approximately 73 to 94% of the variability in concentrations of (82) Se, (111) Cd, (112) Cd, and (208) Pb was explained by the model (r(2) =0.73-0.94), followed by (52) Cr, (55) Mn, (56) Fe, (60) Ni, and (63) Cu (r(2) =0.48-0.61). Additionally, in both zebra and quagga mussels, average modeled concentrations were within approximately one order of magnitude of the measured values. In particular, in zebra mussels, estimations of (60) Ni and (82) Se concentrations were equal to 51 and 76% of the measurements, respectively. Higher deviations were observed for (52) Cr, (59) Co, (55) Mn, (56) Fe, (111) Cd, (63) Cu, and (112) Cd (underestimation), and (66) Zn, (68) Zn, (208) Pb, and (118) Sn (overestimation). For quagga mussels, modeled concentrations of (66) Zn and (68) Zn differed approximately 14% from the measured levels. Differences between predictions and measurements were higher for other metals. Copyright © 2011 SETAC.
Cope, W.G.; Bartsch, M.R.; Hightower, J.E.
2006-01-01
The aim of this study was to document and model the population dynamics of zebra mussels Dreissena polymorpha (Pallas, 1771) in Pool 8 of the Upper Mississippi River (UMR), USA, for five consecutive years (1992-1996) following their initial discovery in September 1991. Artificial substrates (concrete blocks, 0.49 m2 surface area) were deployed on or around the first of May at two sites within each of two habitat types (main channel border and contiguous backwater). Blocks were removed monthly (30 ?? 10 d) from the end of May to the end of October to obtain density and growth information. Some blocks deployed in May 1995 were retrieved in April 1996 to obtain information about overwinter growth and survival. The annual density of zebra mussels in Pool 8 of the UMR increased from 3.5/m2 in 1992 to 14,956/m 2 in 1996. The average May-October growth rate of newly recruited individuals, based on a von Bertalanffy growth model fitted to monthly shell-length composition data, was 0.11 mm/d. Model estimates of the average survival rate varied from 21 to 100% per month. Estimated recruitment varied substantially among months, with highest levels occurring in September-October of 1994 and 1996, and in July of 1995. Recruitment and density in both habitat types increased by two orders of magnitude in 1996. Follow-up studies will be necessary to assess the long-term stability of zebra mussel populations in the UMR; this study provides the critical baseline information needed for those future comparisons. ?? Published by Oxford University Press on behalf of The Malacological Society of London 2006.
Activity-guided isolation of cytotoxic bis-bibenzyl constituents from Dumortiera hirsuta.
Toyota, Masao; Ikeda, Risa; Kenmoku, Hiromichi; Asakawa, Yoshinori
2013-01-01
Activity-guided fractionation of the ether extract of Dumortiera hirsute (Japanese liverwort), using cytotoxicity testing with cultured HL 60 and KB cells, resulted in the isolation of a new cytotoxic bis-bibenzyl compound, along with the two known bis-bibenzyls: isomarchantin C and isoriccardin C. The structural determination of the new bis-bibenzyl through extensive NMR spectral data indicated a derivative of marchantin A, which has been isolated from the liverwort Marchantia polymorpha. The cytotoxicity of the bis-bibenzyls was evaluated by the MTT (3-(4,5-di-methylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) assay using cultured HL 60 and KB cells.
Production of Fungal Mycelial Protein in Submerged Culture of Soybean Whey
Falanghe, Helcio; Smith, A. K.; Rackis, J. J.
1964-01-01
Various soybean whey media were tested as substrate for seven species of fungi in submerged culture. Very little mycelial growth was obtained with Morchella hybrida, Collybia velutipes, Cantharellus cibarius, and Xylaria polymorpha. Agaricus campestris failed to grow. Tricholoma nudum and Boletus indecisus showed the greatest rate of growth and production of mycelial protein and the best utilization of soybean whey solids, with much shorter incubation times compared with those of the other species. T. nudum developed as spheres having diameters of about 5 to 8 mm, instead of the usual slurry or yeastlike form, in the presence of added ammonium acetate. B. indecisus always developed as spheres. Mycelial yields and production of protein by T. nudum greatly decreased with the addition of more than 1% glucose to soybean whey, whereas with B. indecisus the yield of protein almost doubled when up to 3% glucose was added. The effect of minerals on mycelial growth was determined. With soybean whey concentrated to 50%, the rate of mycelial growth of T. nudum was nearly doubled, but protein content of mycelia was greatly reduced. Mycelial growth and yield of protein of B. indecisus grown in concentrated whey were increased greatly. About 4 to 6 g of mycelial protein per liter can be obtained from fermentation in soybean whey, depending upon the medium used. Utilization of soybean whey by fungal fermentation may have economic value in whey disposal and in the production of products of high protein content. PMID:14199023
PRODUCTION OF FUNGAL MYCELIAL PROTEIN IN SUBMERGED CULTURE OF SOYBEAN WHEY.
FALANGHE, H; SMITH, A K; RACKIS, J J
1964-07-01
Various soybean whey media were tested as substrate for seven species of fungi in submerged culture. Very little mycelial growth was obtained with Morchella hybrida, Collybia velutipes, Cantharellus cibarius, and Xylaria polymorpha. Agaricus campestris failed to grow. Tricholoma nudum and Boletus indecisus showed the greatest rate of growth and production of mycelial protein and the best utilization of soybean whey solids, with much shorter incubation times compared with those of the other species. T. nudum developed as spheres having diameters of about 5 to 8 mm, instead of the usual slurry or yeastlike form, in the presence of added ammonium acetate. B. indecisus always developed as spheres. Mycelial yields and production of protein by T. nudum greatly decreased with the addition of more than 1% glucose to soybean whey, whereas with B. indecisus the yield of protein almost doubled when up to 3% glucose was added. The effect of minerals on mycelial growth was determined. With soybean whey concentrated to 50%, the rate of mycelial growth of T. nudum was nearly doubled, but protein content of mycelia was greatly reduced. Mycelial growth and yield of protein of B. indecisus grown in concentrated whey were increased greatly. About 4 to 6 g of mycelial protein per liter can be obtained from fermentation in soybean whey, depending upon the medium used. Utilization of soybean whey by fungal fermentation may have economic value in whey disposal and in the production of products of high protein content.
Directory of Open Access Journals (Sweden)
Altair A. Zebral
1971-01-01
Full Text Available No presente trabalho, os autores estudaram as propriedades morfo-bioquímicas e a sinsibilidade aos antibióticos de 19 amostras de bactérias dos gêneros Mima e Herellea isoladas de material clínico e identificadas como Mima polymorpha variedade oxidans, Mima polymorpha e Herellea vaginicola. No estudo bioquímico observou-se que Herellea vaginicola foi oxidase negativa e em meio complexo nitrogenado, consistentemente ataca a glicose, galactose, manose, arabinose, xilose, lactose a 10% e irregularmente ataca a ramnose e a celobiose; em base sintética nitrogenada, além das atividades citadas, consistentemente produziu ácido a partir da lactose. Mima polymopha foi oxidase negativa, não apresentando atividade glicidolítica, quer em meio complexo nitrogenado, quer em base sintética nitrogenada. Mima polymorpha var. oxidans, foi oxidase positiva, não revelando nenhuma atividade glicidolítica. Herellea vaginicola e Mima polymorpha mostraram grande sensibilidade à gabromicina, knamicina, neomicina, colistin, sendo que a última também foi muito sensível ao cloranfenicol e rovamicina. Mima polymorpha var. oxidans, apresentou grande sensibilidade à knamicina, neomicina, colistin, cloranfenicol e wintomylon. A sensibilidade das amostras a 1 a 0,1 unidade de penicilina/ml, nas condições ensaiadas no presente trabalho, não foi absoluta, como a observada por Baumann, Doudoroff & Stanier (1968a que permitisse uma separação entre amostras oxidase positiva e negativa ou uma diferenciação dentro do grupo das bactérias oxidase positiva.The authors studied the morpho-biochemical characteristics and antibiotic sensitivity of 19 strains of bacteria isolated from clinical specimens and identifyed as Mima polymorpha var. oxidans, Mima polymorpha and Herellea vaginicola. The biochemical study indicated Herellea vaginicola to be oxidase negative and in complex nitrogenous media effetively utilize glucose, galactose, manose, arabinose, xylose, 10
Screening studies of yeasts capable of utilizing petroleum fractions
Energy Technology Data Exchange (ETDEWEB)
El-Masry, H.G.; Foda, M.S.
1979-01-01
In these studies 23 yeasts cultures belonging to 10 genera of ascosporogenous, ballistosporogenous, and asporogenous yeasts, were screened with respect to their abilities of hydrocarbon utilization in synthetic media. Thus, kerosene, n-hexadecane, and wax distillate were compared as sole carbon sources in 2% final concentration. Kerosene exhibited marked inhibition on the growth of the majority of the strains, whereas active growth was observed with Debaryomyces vanrijii and many species of the genus Candida in media with n-hexadecane or wax distillate as sole source of carbon. In addition, some cultures belonging to the genera Sporobolomyces, Hansenula, Cryptococcus, and Trigonopsis could utilize some of these substrates, but to a lesser extent. Highest yield of cells and protein was obtained with Candida lipolytica NRRL 1094 in n-hexadecane medium, supplied with 0.03% yeast extract and trace element solutions. The results are discussed with respect to the possibilities of using new yeast genera, with special reference to the genus Debaryomyces, in microbial protein production.
Nowicki, Carly J; Kashian, Donna R
2018-02-14
Dreissenid mussels Dreissena bugensis (quagga mussel) and Dreissena polymorpha (zebra mussel) are prolific invasive species to the freshwaters of the United States and Western Europe. In the Great Lakes, D. polymorpha has initially dominated the system since its invasion in the mid-1980s; however, recently D. bugensis has displaced D. polymorpha as the dominant species. Dreissena bugensis has several competitive advantages over D. polymorpha, including greater tolerances to deeper and colder waters and lower respiration rates. Nevertheless, physiological differences between the species remain largely unknown. The oxidative stress response is a mechanism used by all organisms to mitigate environmental stress by reducing oxygen radicals in the body, and comparing this mechanism between similar species can be useful for understanding how different species compete in aquatic environments. We compared oxidative stress biomarkers (lipid peroxidation [LPO] and catalase [CAT] activity) in mussels after exposure to 4 stressors (i.e., high densities, temperature, hypoxia, and polychlorinated biphenyls [PCBs]) independently and in combinations of 2 stressors. Overall, D. bugensis had lower LPO and CAT activity than D. polymorpha when exposed to single stressors; however, in multiple stressor treatments D. bugensis had increased LPO, especially with high temperatures and PCBs. The lower lipid damage in D. bugensis compared with D. polymorpha under single stressor conditions may come at the cost of the ability to respond to multiple stressors. Environ Toxicol Chem 2018;9999:1-12. © 2018 SETAC. © 2018 SETAC.
Directory of Open Access Journals (Sweden)
Claudia Fieira
2013-02-01
Full Text Available Penicillium expansum is the causative agent of apple blue mold. The inhibitory effects of the capsaicin derived from Capsicum spp. fruits and yeast Hansenula wingei against P. expansum were evaluated in an in vitro and in in vivo assay using Fuji apples. The minimum inhibitory concentration of capsaicin determined using the broth micro-dilution method was 122.16 µg mL-1. Capsaicin did not reduce blue mold incidence in apples. However, it was able to delay fungal growth in the first 14 days of the in vivo assay. The in vivo effect of the yeast Hansenula wingei AM2(-2, alone and combined with thiabendazole at low dosage (40 µg mL-1, on the incidence of apple diseases caused by P. expansum was also described. H. wingei AM2(-2 combined with a low fungicide dosage (10% of the dosage recommended by the manufacturer showed the best efficacy (100% up to 7 days of storage at 21 ºC, later showing a non-statistically different decrease (p > 0.05 after 14 (80.45% and 21 days (72.13%, respectively. These results contribute providing new options for using antifungal agents against Penicillium expansum.Penicillium expansum é o agente causador da doença em maçã conhecida como mofo azul. O efeito inibitório da capsaicina derivada dos frutos Capsicum spp. e da levedura Hansenula wingei foi avaliado através de ensaios in vitro e in vivo em maçã. A concentração inibitória mínima da capsaicina de 122,16 µg mL-1 foi determinada usando microdiluição. A capsaicina não mostrou capacidade em reduzir a incidência do mofo azul na maçã. Entretanto, um retardo no crescimento do fungo foi observado nos 14 primeiros dias dos ensaios in vivo. Também descrevemos o efeito da levedura Hansenula wingei AM2(-2 isolada e em combinação com tiabendazol em baixa dosagem (40 µg mL-1 no controle da doença de maçãs por P. expansum.Hansenula wingei AM2(-2, em combinação com baixa dosagem de tiabendazol (10% da recomendada pelo fabricante, apresentou 100% de
Energy Technology Data Exchange (ETDEWEB)
Zhong, Huan, E-mail: huanzhong1982@hotmail.com [Environmental and Resource Studies Program, Trent University, Peterborough, Ontario (Canada); Nanjing University, School of Environment, State Key Laboratory of Pollution Control and Resource Reuse, Nanjing, Jiangsu Province (China); Kraemer, Lisa; Evans, Douglas [Environmental and Resource Studies Program, Trent University, Peterborough, Ontario (Canada)
2013-10-15
Highlights: • Mussels exposed to algal/sediment-Cu have different size-related Cu accumulation. • Size-related Cu accumulation in mussels could be more dependant on algal-Cu uptake. • Importance of algal/sediment-Cu to Cu bioaccumulation varies with mussel body size. • Cu sources (algae and sediments) should be considered in “mussel watch” programs. • Cu stable isotope offers many advantages in Cu bioaccumulation studies. -- Abstract: Size of organisms is critical in controlling metal bioavailability and bioaccumulation, while mechanisms of size-related metal bioaccumulation are not fully understood. To investigate the influences of different sources of particle-associated Cu on body size-related Cu bioavailability and bioaccumulation, zebra mussels (Dreissena polymorpha) of different sizes were exposed to stable Cu isotope ({sup 65}Cu) spiked algae (Chlorella vulgaris) or sediments in the laboratory and the Cu tissue concentration-size relationships were compared with that in unexposed mussels. Copper tissue concentrations decreased with mussel size (tissue or shell dry weight) in both unexposed and algal-exposed mussels with similar decreasing patterns, but were independent of size in sediment-exposed mussels. Furthermore, the relative contribution of Cu uptake from algae (65–91%) to Cu bioaccumulation is always higher than that from sediments (9–35%), possibly due to the higher bioavailability of algal-Cu. Therefore, the size-related ingestion of algae could be more important in influencing the size-related variations in Cu bioaccumulation. However, the relative contribution of sediment-Cu to Cu bioaccumulation increased with body size and thus sediment ingestion may also affect the size-related Cu variations in larger mussels (tissue weight >7.5 mg). This study highlights the importance of considering exposure pathways in normalization of metal concentration variation when using bivalves as biomonitors.
Rich nutrition from the poorest - Cereal fermentations in Africa and Asia
Nout, M.J.R.
2009-01-01
Cereal fermentations in Africa and Asia involve mainly the processing of maize, rice, sorghum and the millets. Lactic acid bacteria (Lactobacillus, Pediococcus), Enterobacter spp., yeasts (Candida, Debaryomyces, Endomycopsis, Hansenula, Pichia, Saccharomyces and Trichosporon spp.) and filamentous
McLaughlan, Claire; Rose, Paul; Aldridge, David C.
2014-11-01
Invasive non-native species frequently occur in very high densities. When such invaders present an economic or ecological nuisance, this biomass is typically removed and landfill is the most common destination, which is undesirable from both an economic and ecological perspective. The zebra mussel, Dreissena polymorpha, has invaded large parts of Europe and North America, and is routinely removed from raw water systems where it creates a biofouling nuisance. We investigated the suitability of dried, whole zebra mussels as a supplement to poultry feed, thus providing a more attractive end-use than disposal to landfill. Measurable outcomes were nutrient and energy composition analyses of the feeds and production parameters of the birds over a 14 day period. Zebra mussels were a palatable feed supplement for chickens. The mussel meal contained high levels of calcium (344.9 g kg-1), essential for egg shell formation, which was absorbed and retained easily by the birds. Compared with standard feed, a mussel-supplemented diet caused no significant effects on production parameters such as egg weight and feed conversion ratio during the study period. However, protein and energy levels in the zebra mussel feed were much lower than expected from the literature. In order for zebra mussels to be a viable long-term feed supplement for poultry, flesh would need to be separated from the shells in an economically viable way. If zebra mussels were to be used with the shells remaining, it seems that the resultant mussel meal would be more suitable as a calcium supplement.
Competitive impacts of an invasive nectar thief on plant-pollinator mutualisms
Hanna, Cause; Foote, David; Kremen, Claire
2014-01-01
Plant–pollinator mutualisms are disrupted by a variety of competitive interactions between introduced and native floral visitors. The invasive western yellowjacket wasp, Vespula pensylvanica, is an aggressive nectar thief of the dominant endemic Hawaiian tree species, Metrosideros polymorpha. We conducted a large-scale, multiyear manipulative experiment to investigate the impacts of V. pensylvanica on the structure and behavior of the M. polymorpha pollinator community, including competitive mechanisms related to resource availability. Our results demonstrate that V. pensylvanica, through both superior exploitative and interference competition, influences resource partitioning and displaces native and nonnative M. polymorpha pollinators. Furthermore, the restructuring of the pollinator community due to V. pensylvanica competition and predation results in a significant decrease in the overall pollinator effectiveness and fruit set of M. polymorpha. This research highlights both the competitive mechanisms and contrasting effects of social insect invaders on plant–pollinator mutualisms and the role of competition in pollinator community structure.
McLaughlan, C; Aldridge, D C
2013-09-01
Algal and cyanobacterial blooms in reservoirs are driven by nutrient enrichment and may present economic and conservation challenges for water managers. Current approaches such as suppression of algal growth with barley straw, ferric dosing or manipulation of fish stocks have not yielded long term successes. A possibility that has sparked growing interest is the encouragement and cultivation of natural filter feeders, such as mussels, which remove suspended matter from the water and reduce nutrient levels through biodeposition and assimilation. This review focusses on the zebra mussel (Dreissena polymorpha) as a tool for enhancement of water quality in reservoirs. Native to the Ponto-Caspian region, this species has invaded many lakes and reservoirs across North America and Western Europe, where it occurs in very high densities. While purposeful introduction of a non-native species into new sites is socially unacceptable, we investigate the possible benefits of encouraging increased abundance of zebra mussels in sites where the species is already established. We estimate that the annual nitrogen and phosphorus input into a large UK reservoir (Grafham Water) could be assimilated into zebra mussel biomass by encouraging settlement onto 3075 m and 1400 m of commercial mussel ropes, respectively. While zebra mussel cultivation has an incredible capacity to push eutrophic systems towards a clear water state, there are many risks associated with encouraging an invasive species, even within sites where it has already established. The zebra mussel is a prominent biofouler of native unionid mussels and raw water pipes, it changes the physical characteristics of the places it inhabits, in sites low in phosphorus it can be responsible for toxic cyanobacterial blooms, it alters nutrient cycling and community structure and it can have negative impacts on amenity value. Increased propagule pressure from elevated numbers of veliger larvae in the water column may increase the risk
Rebuilding after collapse: evidence for long-term cohort dynamics in the native Hawaiian rain forest
Boehmer, Hans Juergen; Wagner, Helene H.; Jacobi, James D.; Gerrish, Grant C.; Mueller-Dombois, Dieter
2013-01-01
Questions: Do long-term observations in permanent plots confirm the conceptual model of Metrosideros polymorpha cohort dynamics as postulated in 1987? Do regeneration patterns occur independently of substrate age, i.e. of direct volcanic disturbance impact? Location: The windward mountain slopes of the younger Mauna Loa and the older Mauna Kea volcanoes (island of Hawaii, USA). Methods: After widespread forest decline (dieback), permanent plots were established in 1976 in 13 dieback and 13 non-dieback patches to monitor the population structure of M. polymorpha at ca. 5-yr intervals. Within each plot of 20 × 20 m, all trees with DBH >2.5 cm were individually tagged, measured and tree vigour assessed; regeneration was quantified in 16 systematically placed subplots of 3 × 5 m. Data collected in the subplots included the total number of M. polymorpha seedlings and saplings (five stem height classes). Here we analyse monitoring data from six time steps from 1976 to 2003 using repeated measures ANOVA to test specific predictions derived from the 1987 conceptual model. Results: Regeneration was significantly different between dieback and non-dieback plots. In dieback plots, the collapse in the 1970s was followed by a ‘sapling wave’ that by 2003 led to new cohort stands of M. polymorpha. In non-dieback stands, seedling emergence did not result in sapling waves over the same period. Instead, a ‘sapling gap’ (i.e. very few or no M. polymorpha saplings) prevailed as typical for mature stands. Canopy dieback in 1976, degree of recovery by 2003 and the number of living trees in 2003 were unrelated to substrate age. Conclusions: Population development of M. polymorpha supports the cohort dynamics model, which predicts rebuilding of the forest with the same canopy species after dieback. The lack of association with substrate age suggests that the long-term maintenance of cohort structure in M. polymorpha does not depend on volcanic disturbance but may be related to
Daunys, Darius; Zemlys, Petras; Olenin, Sergej; Zaiko, Anastasija; Ferrarin, Christian
2006-05-01
The role of the zebra mussel Dreissena polymorpha in redistribution of total particulate material (TPM) between the water column and bottom sediment was estimated using the TPM budget for a mussel bed in the Curonian lagoon, the Baltic Sea. Seasonal clearance rates were derived from the TPM budget assuming two resuspension scenarios: no resuspension and full resuspension of biodeposits. Estimated clearance rates for both scenarios were compared with the rates calculated from the population clearance rate model. Seasonal clearance rates estimated using the population model (1.1 and 11.8 l g-1 SFDW day-1) fitted well into the interval of seasonal clearance rates calculated from TPM budgets assuming no resuspension of biodeposits (3.2 and 21.4 l g SFDW-1 day-1). In the scenario with biodeposits resuspension clearance rates were much higher (57.4 and 148.9 g SFDW-1 day-1). The ratio of clearance to residence time was highly dependent on the fate of biodeposits. Therefore its use in interpretation of the species impact on TPM was limited. An alternative measure based on the ratio of the amount of TPM biodeposited to TPM transported into the bed was used. It was found that zebra mussels are able to deposit between 10 and 30% of the incoming TPM, and the amount of biodeposited material was correlated with water residence time. Results indicate that the impact of zebra mussels on TPM in the lagoon is small relative to the high transport rates of TPM over the bed. However, annual biosedimentation rate (~590 g m-2) in the mussel bed was higher than physical deposition rate (~380 g m-2) in accumulation areas devoid of large suspension feeders. We suggest that a local impact due to enhanced availability of organic material to other trophic groups of associated benthic organisms may be more significant than effects on TPM pathways at an ecosystem scale.
Rich nutrition from the poorest - cereal fermentations in Africa and Asia.
Nout, M J Rob
2009-10-01
Cereal fermentations in Africa and Asia involve mainly the processing of maize, rice, sorghum and the millets. Lactic acid bacteria (Lactobacillus, Pediococcus), Enterobacter spp., yeasts (Candida, Debaryomyces, Endomycopsis, Hansenula, Pichia, Saccharomyces and Trichosporon spp.) and filamentous fungi (Amylomyces, Aspergillus, Mucor, and Rhizopus spp.) contribute to desirable modifications of taste, flavour, acidity, digestibility, and texture in non-alcoholic beverages (e.g., uji, and ben-saalga), porridges (e.g., mawè) and cooked gels (e.g., kenkey, idli, and mifen). In addition, alcoholic beverages (beers such as tchoukoutou and jnard; and spirits e.g. jiu) are obtained using malt, or using amylolytic mixed microbial starter cultures as generators of fermentable substrates. Wet processing, marketing of multi-purpose intermediate products, co-fermentation for texture and nutrition, and mixed culture fermentations as practiced in indigenous fermentation processes are of interest for industrial innovation and for better control of natural mixed culture fermentation systems. On the other hand, the nutritional properties of traditional cereal fermented products can be enhanced by increasing their nutrient and energy density, as well as by increasing their mineral status by combining mineral fortification and dephytinization.
International Nuclear Information System (INIS)
Sakamoto, Fuminori; Ohnuki, Toshihiko; Kozai, Naofumi; Wakai, Eiichi; Francis, A.J.
2005-01-01
We have carried out the growth experiments of 3 strains of yeast in a medium containing uranium (VI) to elucidate the effect of U (VI) on the growth of microorganisms. Hansenula fabianii J640 grew in the liquid medium containing 0.1 mM U (VI) at lower rate than the control, but Saccharomyces cerevisiae did not grow under this condition. The H. fabianii J640 pre-cultured for 21 h in the liquid medium without U (VI) grew even after the exposure to 1 mM U (VI), but did not grow without pre-cultivation. For the pre-cultured H. fabianii J640, radioactivity of U in the medium was the same as the initial one for 110 h, and then gradually decreased. TEM-EDS analysis of H. fabianii J640 exposed to 1 mM U (VI) for 165 h showed accumulation of U (VI) on the cells. When H. fabianii J640 was not pre-cultured, radioactivity of U in the medium was lower than the initial one. These results indicated that U (VI) inhibits the growth of yeast, and that the adsorption of U (VI) by the cells depends on the metabolism of yeast. (author)
Cluster formation in liverwort-associated methylobacteria and its implications
Kutschera, U.; Thomas, J.; Hornschuh, M.
2007-08-01
Pink-pigmented methylotropic bacteria of the genus Methylobacterium inhabit the surfaces of plant organs. In bryophytes, these methylobacteria enhance cell growth, but the nature of this plant-microbe interaction is largely unknown. In this study, methylobacteria were isolated from the upper surface of the free-living thalli of the liverwort Marchantia polymorpha L. Identification of one strain by 16S ribosomal RNA (rRNA) gene-targeted polymerase chain reaction (PCR) and other data show that these microbes represent an undescribed species of the genus Methylobacterium ( Methylobacterium sp.). The growth-promoting activity of these wild-type methylobacteria was tested and compared with that of the type strain Methylobacterium mesophilicum. Both types of methylobacteria stimulated surface expansion of isolated gemmae from Marchantia polymorpha by about 350%. When suspended in water, the liverwort-associated bacteria ( Methylobacterium sp.) formed dense clusters of up to 600 cells. In liquid cultures of Methylobacterium mesophilicum, single cells were observed, but no clustering occurred. We suggest that the liverwort-associated methylobacteria are co-evolved symbionts of the plants: Cluster formation may be a behavior that enhances the survival of the epiphytic microbes during periods of drought of these desiccation-tolerant lower plants.
Observations on the biological cold fusion or the biological transmutation of elements
International Nuclear Information System (INIS)
Komaki, Hisatoki
1993-01-01
In previous paper, the author, with Prof. Dr. C. Louis KERVRAN, suggested the probable occurrence of the biological cold fusion or the biological transmutation of elements. In order to confirm the phenomena, under the more controlled condition, potassium, magnesium, iron and calcium were determined in cells of Aspergillus niger IFO 4066, Penicillium chrysogenum IFO 4689, Rhizopus nigricans IFO 5781, Mucor rouxii IFO 0396, Saccharomyces cerevisiae IFO 0308, Torulopsis utilis IFO 0396, Saccharomyces ellipsoideus IFO 0213 and Hansenula anomala IFO 0118 cultured in normal medium and media deficient in one of potassium, magnesium iron or calcium. Values of potassium 1890-2650 μg, magnesium 380-510 μg, iron 95-120 μg, and calcium 60-95 μg were obtained per g dried cells cultured in each deficient medium, while potassium 8650-11050 μg, magnesium 1920-2160 μg, iron 510-680 μg, and calcium 380-450 μg were found per g dried cells obtained by cultivation in the normal medium. The author would like to suggest the probable occurrence of the phenomena relevant to biological cold fusion. (author)
Directory of Open Access Journals (Sweden)
Fernández González, J.
1992-08-01
Full Text Available The paper studies the changes of the physico-chemical and microbiological characteristics of the fermentation in aerobic conditions that occur during the storage stage of Hojiblanca cultivar used to elaborate ripe olives. Assayed treatments include all the conditions used at industrial level (correction of initial pH to 4,0-4,2 units with acetic acid, sodium chloride concentration ranging between 3 and 6%, green to yellow-pink green fruits and bubling of air at a rate of 0,3 liter per hour and liter of the vessel capacity.
The process was characterized by a maintenance of the pH values, a slow sugar consumption, very low content of carbon dioxide and progressive increase of the salt concentration. Gram-negative rods and Bacillus grew at the beginning of the process; however, the most representative germs of these fermentation were the yeasts, whose population grew rapidly from brining (at higher rate as the salt content was slower. They remained throughout the storage, although after 180 days a decrease tendency was observed. The most representative species were: Pichía membranae faciens (51% of frequency, Pichía fementans (6% and Hansenula polymorpha (6%. No gas-pocket or shrivelling was appreciated in any treatment.
El trabajo estudia la evolución de las características físico-químicas y microbiológicas de la fermentación en medio aeróbico durante la conservación de aceitunas de la variedad Hojiblanca, en las diversas condiciones de los actuales procesos industriales (pH corregido inicialmente con acético a 4,0-4,2 unidades, concentración de sal entre 3 y 6%, frutos verdes o con una mayor madurez y aireación a razón de 0,3 litros de aire por hora y litro de capacidad del recipiente.
La misma se caracteriza por un mantenimiento del pH, lenta utilización de los azúcares, bajos niveles de anhídrido carbónico disuelto y progresiva subida de la concentración de sal. Asimismo, se desarrollan bacilos
Grutters, Bart M C; Verhofstad, Michiel J J M; van der Velde, Gerard; Rajagopal, Sanjeevi; Leuven, Rob S E W
2012-01-01
The quagga mussel (Dreissena rostriformis bugensis) and zebra mussel (Dreissena polymorpha) are invasive freshwater bivalves in Europe and North America. The distribution range of both Dreissena species is still expanding and both species cause major biofouling and ecological effects, in particular when they invade new areas. In order to assess the effect of temperature, salinity and light on the initial byssogenesis of both species, 24 h re-attachment experiments in standing water were conducted. At a water temperature of 25°C and a salinity of 0.2 psu, the rate of byssogenesis of D. polymorpha was significantly higher than that of D. rostriformis bugensis. In addition, byssal thread production by the latter levelled out between 15°C and 25°C. The rate of byssogenesis at temperatures<25°C was similar for both species. Neither species produced any byssal threads at salinities of 4 psu or higher. At a salinity of 1 psu and a water temperature of 15°C, D. polymorpha produced significantly more byssal threads than D. rostriformis bugensis. There was no significant effect of the length of illumination on the byssogenesis of either species. Overall, D. polymorpha produced slightly more byssal threads than D. rostriformis bugensis at almost all experimental conditions in 24 h re-attachment experiments, but both species had essentially similar initial re-attachment abilities. The data imply that D. rostriformis bugensis causes biofouling problems identical to those of D. polymorpha.
Rohde, Cláudia; Silva, Diva Maria Izabel O; Oliveira, Geórgia F; Monteiro, Liv S; Montes, Martín A; Garcia, Ana Cristina L
2014-12-01
Brazil has a high diversity of flies of the genus Drosophila, and part of this richness is represented by the cardini group. We analyzed the fluctuations in the richness and abundance of this group, in environments that had never previously been studied in the northeastern region of Brazil. Among the 28,204 drosophilids sampled, 1,294 belonged to the cardini group and were represented by D. polymorpha, D. cardini, D. neocardini and D. cardinoides. Occurrences of D. neocardini and D. cardinoides were registered for the first time in the Caatinga. In this biome, D. cardini stood out as having the highest abundance, and D. polymorpha was not observed. In the coastal Atlantic Forest, D. cardini was not registered, but D. polymorpha was found in all the localities investigated. Mangrove swamps were the environment with the lowest abundance and richness of the cardini group. The High-altitude Forest presented the highest richness of this group. We suggest that the high abundance of D. polymorpha in the High-altitude Forest and in the coastal Atlantic Forest may be a reflection of the historical relationship between these two environments.
Invasive species management restores a plant-pollinator mutualism in Hawaii
Hanna, Cause; Foote, David; Kremen, Claire
2013-01-01
1.The management and removal of invasive species may give rise to unanticipated changes in plant–pollinator mutualisms because they can alter the composition and functioning of plant–pollinator interactions in a variety of ways. To utilize a functional approach for invasive species management, we examined the restoration of plant–pollinator mutualisms following the large-scale removal of an invasive nectar thief and arthropod predator, Vespula pensylvanica. 2.We reduced V. pensylvanica populations in large plots managed over multiple years to examine the response of plant–pollinator mutualisms and the fruit production of a functionally important endemic Hawaiian tree species, Metrosideros polymorpha. To integrate knowledge of the invader's behaviour and the plant's mating system, we determined the efficacy of V. pensylvanica as a pollinator of M. polymorpha and quantified the dependence of M. polymorpha on animal pollination (e.g. level of self-compatibility and pollen limitation). 3.The reduction of V. pensylvanica in managed sites, when compared to unmanaged sites, resulted in a significant increase in the visitation rates of effective bee pollinators (e.g. introduced Apis mellifera and native Hylaeus spp.) and in the fruit production of M. polymorpha. 4.Apis mellifera, following the management of V. pensylvanica, appears to be acting as a substitute pollinator for M. polymorpha, replacing extinct or threatened bird and bee species in our study system. 5.Synthesis and applications. Fruit production of the native M. polymorpha was increased after management of the invasive pollinator predator V. pensylvanica; however, the main pollinators were no longer native but introduced. This research thus demonstrates the diverse impacts of introduced species on ecological function and the ambiguous role they play in restoration. We recommend incorporating ecological function and context into invasive species management as this approach may enable conservation
Takemura, Miho; Maoka, Takashi; Misawa, Norihiko
2015-03-01
MpBHY codes for a carotene β-ring 3(,3')-hydroxylase responsible for both zeaxanthin and lutein biosynthesis in liverwort. MpCYP97C functions as an ε-ring hydroxylase (zeinoxanthin 3'-hydroxylase) to produce lutein in liverwort. Xanthophylls are oxygenated or hydroxylated carotenes that are most abundant in the light-harvesting complexes of plants. The plant-type xanthophylls consist of α-xanthophyll (lutein) and β-xanthophylls (zeaxanthin, antheraxanthin, violaxanthin and neoxanthin). The α-xanthophyll and β-xanthophylls are derived from α-carotene and β-carotene by carotene hydroxylase activities, respectively. β-Ring 3,3'-hydroxylase that mediates the route of zeaxanthin from β-carotene via β-cryptoxanthin is present in higher plants and is encoded by the BHY (BCH) gene. On the other hand, CYP97A (or BHY) and CYP97C genes are responsible for β-ring 3-hydroxylation and ε-ring 3'-hydroxylation, respectively, in routes from α-carotene to lutein. To elucidate the evolution of the biosynthetic routes of such hydroxylated carotenoids from carotenes in land plants, we identified and functionally analyzed carotenoid hydroxylase genes of liverwort Marchantia polymorpha L. Three genes homologous to higher plants, BHY, CYP97A, and CYP97C, were isolated and named MpBHY, MpCYP97A, and MpCYP97C, respectively. MpBHY was found to code for β-ring hydroxylase, which is responsible for both routes starting from β-carotene and α-carotene. MpCYP97C functioned as an ε-ring hydroxylase not for α-carotene but for zeinoxanthin, while MpCYP97A showed no hydroxylation activity for β-carotene or α-carotene. These findings suggest the original functions of the hydroxylation enzymes of carotenes in land plants, which are thought to diversify in higher plants. In addition, we generated recombinant Escherichia coli cells, which produced rare and novel carotenoids such as α-echinenone and 4-ketozeinoxanthin, through pathway engineering using bacterial carotenogenic genes
Directory of Open Access Journals (Sweden)
Homero Sáenz
2003-12-01
Full Text Available La terapia de remplazo enzimático (TRE, consiste en suministrarle a un paciente una proteína exógena, que en su organismo está siendo sintetizada anormalmente. La proteína puede provenir de tejidos y fluidos humanos, ser sintetizada en bacterias, células de mamífero o levaduras, a las cuales se les ha introducido el gen correspondiente. Actualmente son tratadas con TRE las enfermedades de Gaucher, Fabry y la inmunodeficiencia humana combinada. Además existen avanzados estudios en las enfermedades de Hurler, Hunter, Pompe, Niemann-Pick tipo B, Morquio A, angioderma hereditario y pénfigo vulgar. Una de las limitantes de la TRE ha sido sus altos costos, debido al relativamente pequeño número de pacientes que se tratan a nivel mundial y a que el sistema usado hasta ahora, es decir, la expresión en células de mamífero, requiere procedimientos muy costosos. La expresión en bacterias o levaduras sería mucho más barato, pero las primeras no expresan proteínas glicosiladas que constituyen el 91% del total de proteínas y la mayoría de las levaduras tienen sistemas de glicosilación, distintos a los de mamíferos.Sin embargo, Pichia pastoris y Hansenula polymorpha parecen producir proteínas muy similares a las humanas, con lo cual se evitan los problemas de rechazo por parte del organismo humano. En el Instituto de Errores Innatos del Metabolismo (IEIM de la Pontificia Universidad Javeriana se adelantan estudios conducentes a la implementación de un sistema de expresión de proteínas recombinantes en levaduras para uso clínico en enfermedades lisosomales como los síndromes de Hunter y Morquio A. Este modelo, si funciona a cabalidad, podría emplearse para la mayoría de las enfermedades lisosomales (42 en total y para otros errores innatos del metabolismo.
Studies on yeasts and yeast-like microorganisms in the denitrification unit biocenosis
Directory of Open Access Journals (Sweden)
Elena Sláviková
2014-08-01
Full Text Available It was found that Candida famata, Hansenula californica and Rhodotorula rubra occurred in reactor UASB-type biocenosis in the course of denitrification carried out in the presence of lactic acid as a carbon source. The role of those species in nitrogen removal process was discussed with respect to their physiology.
Energy Technology Data Exchange (ETDEWEB)
Akaki, M.; Takahashi, T.; Ishiguro, K.
1981-01-01
Cane molasses distillation slops were used as substrate for the cultivation of 203 strains of yeast. Most yeast strains, especially Hansenula, Debaryomyces, and Rhodotorula, assimilated the molasses distillation wastes. Yeast cell dry weight reached 0.9 grams/100 mL, and yeasts removed greater than 30% of the COD of the waste material.
THE PREVALENCE OF LERNAEID ECTOPARASITES IN GRASS CARP (CTENOPHARYNGODON IDELLA
Directory of Open Access Journals (Sweden)
Z. TASAWAR, S. ZAFAR, M. H. LASHARI AND C. S. HAYAT1
2009-05-01
Full Text Available The present study was conducted to investigate the prevalence of lernaeid ectoparasites in grass carp (Ctenopharyngodon idella. For this purpose, 597 fishes (Ctenopharyngodon idella were examined for lernaeid ectoparasites at a private fish farm located in Multan, Pakistan. Four species of the genus Lernaea i.e. L. cyprinacea, L. polymorpha, L. oryzophila, and L. lophiara were recorded. It was observed that L. polymorpha had the highest (P20 cm.
Energy Technology Data Exchange (ETDEWEB)
Lazzara, Raimondo; Fernandes, Denise, E-mail: deniseferna@gmail.com; Faria, Melissa; Lopez, Jordi F.; Tauler, Roma; Porte, Cinta, E-mail: cinta.porte@cid.csic.es
2012-08-15
Total lipids and fatty acid profiles were determined along the reproductive cycle of the zebra mussel (Dreissena polymorpha). A total of 33 fatty acids with carbon atoms from 14 to 22 were identified: palmitic acid (16:0) was the most abundant fatty acid (13-24%) followed by docosahexaenoic acid (DHA; 22:6n-3), eicosapentaenoic acid (EPA; 20:5n-3) and palmitoleic acid (16:1n-7). Some individual fatty acids (16:0, 16:2n-4, 18:1n-7, 18:2n-6, 18:3n-4, 18:4n-3, 20:4n-3, 20:5n-3) were strongly related to reproductive events, while others having structural-type functions (18:0 and 22:6n-3) were rather stable during the study period. Multivariate analysis of the whole data set using the multivariate curve resolution alternating least squares method confirmed the strong relationship of fatty acid profiles with the reproductive cycle of zebra mussel. Additionally, the effects of the pharmaceutical clofibrate on lipid composition and fatty acid profiles were assessed following 7-day exposure of zebra mussels to a wide range of concentrations (20 ng/L to 2 mg/L). A significant reduction in total triglycerides (38%-48%) together with an increase in the amount of fatty acids per gram wet weight (1.5- to 2.2-fold) was observed in the exposed mussels. This work highlights the ability of clofibrate to induce changes on the lipidome of zebra mussels at concentrations as low as 200 ng/L. -- Highlights: Black-Right-Pointing-Pointer Clofibrate exposure leads to a reduction of total triglycerides in zebra mussel. Black-Right-Pointing-Pointer The amount of fatty acids per gram wet weight increased in exposed mussels. Black-Right-Pointing-Pointer The effects were evidenced at concentrations of clofibrate as low as 200 ng/L. Black-Right-Pointing-Pointer Fatty acid profiles were closely related to reproductive events.
International Nuclear Information System (INIS)
Lazzara, Raimondo; Fernandes, Denise; Faria, Melissa; López, Jordi F.; Tauler, Romà; Porte, Cinta
2012-01-01
Total lipids and fatty acid profiles were determined along the reproductive cycle of the zebra mussel (Dreissena polymorpha). A total of 33 fatty acids with carbon atoms from 14 to 22 were identified: palmitic acid (16:0) was the most abundant fatty acid (13–24%) followed by docosahexaenoic acid (DHA; 22:6n−3), eicosapentaenoic acid (EPA; 20:5n−3) and palmitoleic acid (16:1n−7). Some individual fatty acids (16:0, 16:2n−4, 18:1n−7, 18:2n−6, 18:3n−4, 18:4n−3, 20:4n−3, 20:5n−3) were strongly related to reproductive events, while others having structural-type functions (18:0 and 22:6n−3) were rather stable during the study period. Multivariate analysis of the whole data set using the multivariate curve resolution alternating least squares method confirmed the strong relationship of fatty acid profiles with the reproductive cycle of zebra mussel. Additionally, the effects of the pharmaceutical clofibrate on lipid composition and fatty acid profiles were assessed following 7-day exposure of zebra mussels to a wide range of concentrations (20 ng/L to 2 mg/L). A significant reduction in total triglycerides (38%–48%) together with an increase in the amount of fatty acids per gram wet weight (1.5- to 2.2-fold) was observed in the exposed mussels. This work highlights the ability of clofibrate to induce changes on the lipidome of zebra mussels at concentrations as low as 200 ng/L. -- Highlights: ► Clofibrate exposure leads to a reduction of total triglycerides in zebra mussel. ► The amount of fatty acids per gram wet weight increased in exposed mussels. ► The effects were evidenced at concentrations of clofibrate as low as 200 ng/L. ► Fatty acid profiles were closely related to reproductive events.
Cultural Robotics: The Culture of Robotics and Robotics in Culture
Directory of Open Access Journals (Sweden)
Hooman Samani
2013-12-01
Full Text Available In this paper, we have investigated the concept of “Cultural Robotics” with regard to the evolution of social into cultural robots in the 21st Century. By defining the concept of culture, the potential development of a culture between humans and robots is explored. Based on the cultural values of the robotics developers, and the learning ability of current robots, cultural attributes in this regard are in the process of being formed, which would define the new concept of cultural robotics. According to the importance of the embodiment of robots in the sense of presence, the influence of robots in communication culture is anticipated. The sustainability of robotics culture based on diversity for cultural communities for various acceptance modalities is explored in order to anticipate the creation of different attributes of culture between robots and humans in the future.
Cultural Robotics: The Culture of Robotics and Robotics in Culture
Hooman Samani; Elham Saadatian; Natalie Pang; Doros Polydorou; Owen Noel Newton Fernando; Ryohei Nakatsu; Jeffrey Tzu Kwan Valino Koh
2013-01-01
In this paper, we have investigated the concept of “Cultural Robotics” with regard to the evolution of social into cultural robots in the 21st Century. By defining the concept of culture, the potential development of a culture between humans and robots is explored. Based on the cultural values of the robotics developers, and the learning ability of current robots, cultural attributes in this regard are in the process of being formed, which would define the new concept of cultural robotics. Ac...
Safeguards Culture: Analogies from Safety Culture and Security Culture
International Nuclear Information System (INIS)
Naito, K.
2013-01-01
The terminology of 'safeguards culture' has been used loosely by safeguards experts as an essential element for establishing an organizational environment of stakeholders for the effective and efficient implementation of international safeguards. However, unlike the other two triplet brothers/ sisters of 3S's (Safety, Security, Safeguards), there is no formally established definition of safeguards culture. In the case of safety culture, INSAG (the International Nuclear Safety Advisory Group) has extensively dealt with its concept, elaborating its definition and key characteristics, and published its report, INSAG-4, as the IAEA Safety Series 75. On the other hand, security culture has also been defined by AdSec (the Advisory Group on Nuclear Security). In this paper, a provisional definition of safeguards culture is made on the analogies of safety culture and security culture, and an effort is made to describe essential elements of safeguards culture. It is proposed for SAGSI (the Standing Advisory Group on Safeguards Implementation) to formally consider the definition of safeguards culture and its characteristics. The paper is followed by the slides of the presentation. (author)
In vitro and in vivo antifungal activity of natural inhibitors against Penicillium expansum
Directory of Open Access Journals (Sweden)
Claudia Fieira
2013-02-01
Full Text Available Penicillium expansum is the causative agent of apple blue mold. The inhibitory effects of the capsaicin derived from Capsicum spp. fruits and yeast Hansenula wingei against P. expansum were evaluated in an in vitro and in in vivo assay using Fuji apples. The minimum inhibitory concentration of capsaicin determined using the broth micro-dilution method was 122.16 µg mL-1. Capsaicin did not reduce blue mold incidence in apples. However, it was able to delay fungal growth in the first 14 days of the in vivo assay. The in vivo effect of the yeast Hansenula wingei AM2(-2, alone and combined with thiabendazole at low dosage (40 µg mL-1, on the incidence of apple diseases caused by P. expansum was also described. H. wingei AM2(-2 combined with a low fungicide dosage (10% of the dosage recommended by the manufacturer showed the best efficacy (100% up to 7 days of storage at 21 ºC, later showing a non-statistically different decrease (p > 0.05 after 14 (80.45% and 21 days (72.13%, respectively. These results contribute providing new options for using antifungal agents against Penicillium expansum.
Comparative study of different alcohol sensors based on Screen-Printed Carbon Electrodes.
Costa Rama, Estefanía; Biscay, Julien; González García, María Begoña; Julio Reviejo, A; Pingarrón Carrazón, José Manuel; Costa García, Agustín
2012-05-30
Different very simple single-use alcohol enzyme sensors were developed using alcohol oxidase (AOX) from three different yeast, Hansenula sp., Pichia pastoris and Candida boidinii, and employing three different commercial mediator-based Screen-Printed Carbon Electrodes as transducers. The mediators tested, Prussian Blue, Ferrocyanide and Co-phthalocyanine were included into the ink of the working electrode. The procedure to obtain these sensors consists of the immobilization of the enzyme on the electrode surface by adsorption. For the immobilization, an AOX solution is deposited on the working electrode and left until dried (1h) at room temperature. The best results were obtained with the biosensor using Screen-Printed Co-phthalocyanine/Carbon Electrode and AOX from Hansenula sp. The reduced cobalt-phthalocyanine form is amperometrically detected at +0.4V (vs. Ag pseudo reference electrode). This sensor shows good sensitivity (1211 nA mM(-1)), high precision (2.1% RSD value for the slope value of the calibration plot) and wide linear response (0.05-1.00 mM) for ethanol determination. The sensor provides also accurate results for ethanol quantification in alcoholic drinks. Copyright © 2012 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
D'Antoni Maurizia
2011-08-01
Full Text Available Resumen:El ensayo nace como parte de una investigación mayor que se publicará sobre la inserción profesional docente en la Universidad de Costa Rica. Su finalidad en la investigación en curso es la de explorar los aportes de los estudios sobre competencia cultural e inteligencia cultural, para identificar planteamientos teóricos que fortalezcan nuevos espacios para la mediación cultural docente en la Universidad. Se concluye que el concepto de competencia cultural representa un aporte importante, si se revisa la idea de cultura que subyace y se le transforma en “competencia intercultural”. Luego, se define mediación cultural, evidenciándose la importancia de la nueva figura profesional en el contexto actual, los ámbitos de acción donde se ha empleado y se manifiesta la necesidad de promover mediadores y mediadoras culturales en Costa Rica también.Abstract: The essay comes as part of a larger investigation to be published about teachers’ professional integration at the University of Costa Rica. His purpose in the ongoing investigation is to explore the contributions of studies on cultural competency and cultural understanding, to identify new theoretical approaches and strengthen new cultural spaces for teaching mediation at the University. We conclude that the concept of cultural competence represents an important contribution, if we review the underlying idea of culture and it is transformed into "intercultural competence". The definition of cultural mediation points to the importance of the new professional figure in the current context, evidencing the areas of action where it has been used and showing the need to promote cultural mediators in Costa Rica as well.
ORGANIZATIONAL CULTURE AND MANAGEMENT CULTURE
Tudor Hobeanu; Loredana Vacarescu Hobeanu
2010-01-01
Communication reveals the importance of organizational culture and management culture supported by the remarkable results in economic and social level of organization. Their functions are presented and specific ways of expression levels of organizational culture and ways of adapting to the requirements of the organization's management culture.
Energy Technology Data Exchange (ETDEWEB)
El-Sayed, R M
1978-11-30
Citric acid is produced in 2 stages, in the first of which Escherichia coli KG93 F-is cultured on a substrate consisting of whey permeate to which phosphate and nitrate or urea is added. In the second stage, Hansenula wickerhamii CBS 4308 is cultured on the culture solution from the first stage and the citric acid isolated in the usual manner. Thus, a whey permeate comprising fat 0.20, protein 0.05, lactose 5.0, lactic acid 0.1, and salts 0.6% (Ca 0.06, P 0.06, K 0.16, N 0.03, and NaCl 0.3%) was amended with 1.2 g phosphate/L and 1.0 g NO/sub 3/sup -///L. After introducing the whey permeate into a continuous fermentor, it was inoculated with E. coli K693 F- and allowed to incubate at 37/sup 0/ and pH 7 (Maintained with NH/sub 3/ gas) for 12 h with aeration, thereby producing concentration pyruvic acid. After an additional 6 h cultivation without aeration, the broth was transferred to another fermentor and there inoculated with H. wickerhamii CBS 4308. The second cultivation step was carried out at 30/sup 0/ and a pH of 5 for 24 h with the pH stabilized by NH/sub 3/ gas. To the second stage culture, 0.3 g Fe(CN)/sup 4 -//L was added. The yield of pyruvic acid in the first stage was 32 g/L and the final yield of citric acid was 43 g/L.
Cultural commons and cultural evolution
Bravo, Giangiacomo
2010-01-01
Culture evolves following a process that is akin to biological evolution, although with some significant differences. At the same time culture has often a collective good value for human groups. This paper studies culture in an evolutionary perspective, with a focus on the implications of group definition for the coexistence of different cultures. A model of cultural evolution is presented where agents interacts in an artificial environment. The belonging to a specific memetic group is a majo...
Directory of Open Access Journals (Sweden)
Dominik Marchowski
Full Text Available The European population of Greater Scaup Aythya marila has experienced an alarming, ~60% decline in numbers over the last two decades. The brackish lagoons of the Odra River Estuary (ORE in the south-western Baltic Sea, represent an important area for the species during the non-breeding season in Europe. The lagoons regularly support over 20 000 Scaup, with peaks exceeding 100 000 (38%-70% of the population wintering in NW Europe and the highest number recorded in April 2011-105 700. In the ORE, Scaup feed almost exclusively on the non-native Zebra Mussel Dreissena polymorpha. This mussel was present in the ORE already in the 19th century and continues to be superabundant. Using the results of 22 Scaup censuses (November to April 2002/2003 to 2013/2014 from the whole ORE (523 km2 of water, we show that Scaup flocks follow areas with the greatest area of occurrence and biomass of the Zebra Mussel, while areas with low mussel densities are ignored. The numbers of Scaup in the ORE are primarily related to the area of Zebra Mussel occurrence on the lagoon's bottom (km2 in a non-linear fashion. Zebra Mussels were absolutely prevalent (97% of biomass in the digestive tracts of birds unintentionally by-caught in fishing nets (n = 32. We estimate that Scaup alone consume an average of 5 400 tons of Zebra Mussels annually, which represents 5.6% of the total resources of the mussel in the ORE. Our results provide a clear picture of the strong dependence of the declining, migratory duck species on the non-native mussel, its primary food in the ORE. Our findings are particularly important as they can form the basis for the conservation action plan aimed at saving the north-western European populations of Scaup.
Marchowski, Dominik; Neubauer, Grzegorz; Ławicki, Łukasz; Woźniczka, Adam; Wysocki, Dariusz; Guentzel, Sebastian; Jarzemski, Maciej
2015-01-01
The European population of Greater Scaup Aythya marila has experienced an alarming, ~60% decline in numbers over the last two decades. The brackish lagoons of the Odra River Estuary (ORE) in the south-western Baltic Sea, represent an important area for the species during the non-breeding season in Europe. The lagoons regularly support over 20 000 Scaup, with peaks exceeding 100 000 (38%-70% of the population wintering in NW Europe and the highest number recorded in April 2011-105 700). In the ORE, Scaup feed almost exclusively on the non-native Zebra Mussel Dreissena polymorpha. This mussel was present in the ORE already in the 19th century and continues to be superabundant. Using the results of 22 Scaup censuses (November to April 2002/2003 to 2013/2014) from the whole ORE (523 km2 of water), we show that Scaup flocks follow areas with the greatest area of occurrence and biomass of the Zebra Mussel, while areas with low mussel densities are ignored. The numbers of Scaup in the ORE are primarily related to the area of Zebra Mussel occurrence on the lagoon's bottom (km2) in a non-linear fashion. Zebra Mussels were absolutely prevalent (97% of biomass) in the digestive tracts of birds unintentionally by-caught in fishing nets (n = 32). We estimate that Scaup alone consume an average of 5 400 tons of Zebra Mussels annually, which represents 5.6% of the total resources of the mussel in the ORE. Our results provide a clear picture of the strong dependence of the declining, migratory duck species on the non-native mussel, its primary food in the ORE. Our findings are particularly important as they can form the basis for the conservation action plan aimed at saving the north-western European populations of Scaup.
Culture-lovers and Culture-leavers
Frank Huysmans; Andries van den Broek; Jos de Haan
2005-01-01
Who are the people in the Netherlands with an active interest in cultural heritage and the performing arts, and who prefer to leave these forms of culture alone? Have the size and composition of the groups of 'culture-lovers' and 'culture-leavers' changed since the end of the 1970s? These are the
Cultural Humility and Hospital Safety Culture.
Hook, Joshua N; Boan, David; Davis, Don E; Aten, Jamie D; Ruiz, John M; Maryon, Thomas
2016-12-01
Hospital safety culture is an integral part of providing high quality care for patients, as well as promoting a safe and healthy environment for healthcare workers. In this article, we explore the extent to which cultural humility, which involves openness to cultural diverse individuals and groups, is related to hospital safety culture. A sample of 2011 hospital employees from four hospitals completed measures of organizational cultural humility and hospital safety culture. Higher perceptions of organizational cultural humility were associated with higher levels of general perceptions of hospital safety, as well as more positive ratings on non-punitive response to error (i.e., mistakes of staff are not held against them), handoffs and transitions, and organizational learning. The cultural humility of one's organization may be an important factor to help improve hospital safety culture. We conclude by discussing potential directions for future research.
Directory of Open Access Journals (Sweden)
Aníbal Monasterio Astobiza
2017-07-01
Full Text Available The idea of culture is somewhat vague and ambiguous for the formal goals of economics. The aim of this paper is to define the notion of culture better so as to help build economic explanations based on culture and therefore to measure its impact in every activity or beliefs associated with culture. To define culture according to the canonical evolutionary definition, it is any kind of ritualised behaviour that becomes meaningful for a group and that remains more or less constant and is transmitted down through the generations. Economic institutions are founded, implicitly or explicitly, on a worldview of how humans function; culture is an essential part of understanding us as humans, making it necessary to describe what we understand by culture correctly. In this paper we review the literature on evolutionary anthropology and psychology dealing with the concept of culture to warn that economic modelling ignores intangible benefits of culture rendering economics unable to measure certain cultural items in the digital consumer society.
FROM CULTURAL IMPOTENCE TO CULTURAL AMPUTATION
Directory of Open Access Journals (Sweden)
Sukhanov Vyacheslav Vladimirovich
2013-02-01
Full Text Available Cultural space of any state is formed by a population that is within its borders. In this article, the author introduces a new cultural definitions «cultural impotence» and «cultural amputation», justifying their use, both in terms of population of the Russian Federation and the European Union and America. The article analyzes the state of society and the cultural factors that influence the development of society in Russia, there are options to bring the country out of a deep cultural crisis. Also established a close relationship between the domestic policy of the state and development of culture.
FROM CULTURAL IMPOTENCE TO CULTURAL AMPUTATION
Directory of Open Access Journals (Sweden)
Вячеслав Владимирович Суханов
2013-04-01
Full Text Available Cultural space of any state is formed by a population that is within its borders. In this article, the author introduces a new cultural definitions «cultural impotence» and «cultural amputation», justifying their use, both in terms of population of the Russian Federation and the European Union and America. The article analyzes the state of society and the cultural factors that influence the development of society in Russia, there are options to bring the country out of a deep cultural crisis. Also established a close relationship between the domestic policy of the state and development of culture.DOI: http://dx.doi.org/10.12731/2218-7405-2013-2-1
Japanese Shame Culture and American Guilt Culture
Institute of Scientific and Technical Information of China (English)
Lu Weijie
2016-01-01
Culture is an important factor contributing to the success of intercultural communication. In the east and west, there are many different cultures, among which Japanese shame culture and American guilt culture are two typical ones. Influenced by different cultures, these two countries have different characteristics, which reminds us that in intercultural communication culture should be paid much attention to.
Bhawuk, Dharm P. S.
1998-01-01
In a multimethod evaluation of cross-cultural training tools involving 102 exchange students at a midwestern university, a theory-based individualism and collectivism assimilator tool had significant advantages over culture-specific and culture-general assimilators and a control condition. Results support theory-based culture assimilators. (SLD)
Cultural Analysis - towards cross-cultural understanding
DEFF Research Database (Denmark)
Gullestrup, Hans
The book considers intercultural understanding and co-action, partly by means of general insight into concept of culture and the dimensions which bring about cultural differences, and partly as a methodology to analyse a certain culture - whether one's own or others'. This leads towards an unders......The book considers intercultural understanding and co-action, partly by means of general insight into concept of culture and the dimensions which bring about cultural differences, and partly as a methodology to analyse a certain culture - whether one's own or others'. This leads towards...... a theoretical/abstract proposal for cultural understanding. The second part presents a theoretical/abstract proposal for under-standing intercultural plurality and complexity. The third part provides an empirical model for the analysis of intercultural co-action. Finally, the fourth part present and discusses...
Hispanic Culture and Relational Cultural Theory
Ruiz, Elizabeth
2005-01-01
Traditional personality theories do not consider the impact of culture on personality development. Yet, to provide culturally relevant services to the increasing Hispanic population in the U.S., more culturally relevant theories must be identified. This paper presents Relational Cultural Theory (RCT) as an alternative model to understanding…
National Research Council Canada - National Science Library
Karcanes, James A
2007-01-01
.... Understanding the different levels of cultural awareness -- cultural consideration, cultural understanding, and cultural competence -- will help usher in a new focus on culture-centric warfare...
Feldheim, Kevin A; Brown, Joshua E; Murphy, Douglas J; Stepien, Carol A
2011-07-01
We developed and tested 14 new polymorphic microsatellite loci for dreissenid mussels, including the two species that have invaded many freshwater habitats in Eurasia and North America, where they cause serious industrial fouling damage and ecological alterations. These new loci will aid our understanding of their genetic patterns in invasive populations as well as throughout their native Ponto-Caspian distributions. Eight new loci for the zebra mussel Dreissena polymorpha polymorpha and six for the quagga mussel D. rostriformis bugensis were compared with new results from six previously published loci to generate a robust molecular toolkit for dreissenid mussels and their relatives. Taxa tested include D. p. polymorpha, D. r. bugensis, D. r. grimmi, D. presbensis, the 'living fossil'Congeria kusceri, and the dark false mussel Mytilopsis leucophaeata (the latter also is invasive). Overall, most of the 24 zebra mussel (N = 583) and 13 quagga mussel (N = 269) population samples conformed to Hardy-Weinberg equilibrium expectations for the new loci following sequential Bonferroni correction. The 11 loci (eight new, three previously published) evaluated for D. p. polymorpha averaged 35.1 alleles and 0.72 mean observed heterozygosity per locus, and 25.3 and 0.75 for the nine loci (six new, three previously published) developed for D. r. bugensis. All but three of these loci successfully amplified the other species of Dreissena, and all but one also amplified Congeria and Mytilopsis. All species and populations tested were significantly divergent using the microsatellite data, with neighbour-joining trees reflecting their evolutionary relationships; our results reveal broad utility for resolving their biogeographic, evolutionary, population and ecological patterns. © 2011 Blackwell Publishing Ltd.
Smith, Timothy B; Rodríguez, Melanie Domenech; Bernal, Guillermo
2011-02-01
This article summarizes the definitions, means, and research of adapting psychotherapy to clients' cultural backgrounds. We begin by reviewing the prevailing definitions of cultural adaptation and providing a clinical example. We present an original meta-analysis of 65 experimental and quasi-experimental studies involving 8,620 participants. The omnibus effect size of d = .46 indicates that treatments specifically adapted for clients of color were moderately more effective with that clientele than traditional treatments. The most effective treatments tended to be those with greater numbers of cultural adaptations. Mental health services targeted to a specific cultural group were several times more effective than those provided to clients from a variety of cultural backgrounds. We recommend a series of research-supported therapeutic practices that account for clients' culture, with culture-specific treatments being more effective than generally culture-sensitive treatments. © 2010 Wiley Periodicals, Inc.
A Cultural Sexuality or a Sexual Culture?
Vandermeersch, Patrick
1990-01-01
P. Vandermeersch, A Cultural Sexuality or a Sexual Culture? In: F. VAN DE VIJVER & G. HUTSCHEMAEKERS (ed.), The Investigation of Culture. Current Issues in Cultural Psychology, Tilburg, Tilburg University Press, 1990, 43-58.
CONNECTION BETWEEN ECONOMICS, CULTURE AND CULTURAL DIPLOMACY
Directory of Open Access Journals (Sweden)
Agil Valiyev
2017-09-01
Full Text Available Today, culture is one of the main feeble factors of economic development. The leading role of culture in economic development should be argued as multiplied: so, on firstly, as domestic value, on secondly, as a main factor of regional economic development advanced to raised gravity of different regions for residents, tourists and investors, on thirdly, as major parameters of social development based on tolerance, creativity and knowledge. To the different international experiences, culture is main part of economic development in our life. Cultural diversities are combined into a main reason economic development model. The article consist of explainations about the understanding of culture, cultural diplomacy and economics, approach on conflicts between culture and economics, to find how affecting of culture to economic development, the role of culture in economic development of Azerbaijan. The article can be considered as a useful resource for experts and researchers conducting research in this field.
Culture éducative, culture méthodologique et apprenants d'une langue-culture lointaine
サガズ, ミシェル; Sagaz, Michel
2016-01-01
It has long been recognized that we cannot separate culture and language (cultural and linguistic dimensions) when speaking of teaching and learning foreign languages. But, in this context, it seems that the notion of culture is related, exclusively or largely, to the culture which is linked to the language being studied by students (arts, popular culture, everyday life culture, etc.). This article highlights the fact that other aspects of culture should be taken into account in the intercult...
Kempe, Marius; Lycett, Stephen J; Mesoudi, Alex
2014-10-21
Diverse species exhibit cultural traditions, i.e. population-specific profiles of socially learned traits, from songbird dialects to primate tool-use behaviours. However, only humans appear to possess cumulative culture, in which cultural traits increase in complexity over successive generations. Theoretically, it is currently unclear what factors give rise to these phenomena, and consequently why cultural traditions are found in several species but cumulative culture in only one. Here, we address this by constructing and analysing cultural evolutionary models of both phenomena that replicate empirically attestable levels of cultural variation and complexity in chimpanzees and humans. In our model of cultural traditions (Model 1), we find that realistic cultural variation between populations can be maintained even when individuals in different populations invent the same traits and migration between populations is frequent, and under a range of levels of social learning accuracy. This lends support to claims that putative cultural traditions are indeed cultural (rather than genetic) in origin, and suggests that cultural traditions should be widespread in species capable of social learning. Our model of cumulative culture (Model 2) indicates that both the accuracy of social learning and the number of cultural demonstrators interact to determine the complexity of a trait that can be maintained in a population. Combining these models (Model 3) creates two qualitatively distinct regimes in which there are either a few, simple traits, or many, complex traits. We suggest that these regimes correspond to nonhuman and human cultures, respectively. The rarity of cumulative culture in nature may result from this interaction between social learning accuracy and number of demonstrators. Copyright © 2014 Elsevier Ltd. All rights reserved.
Reconceptualizing Cultural Globalization: Connecting the “Cultural Global” and the “Cultural Local”
Directory of Open Access Journals (Sweden)
Stephen Magu
2015-08-01
Full Text Available Scholars generally are in agreement that the pace of globalization is rapidly accelerating. Globalization’s impact, beyond the socio-economic and political discourses, is affecting conceptions of culture and cultural studies, and changing and restructuring spaces, global, national and personal interactions and relationships. The “texts” and artifacts borne of culture—activities, events and our conception thereof are a mechanism for the propagation of culture. Simultaneously Westernization/Americanization impacts local cultures through consumerism, which obfuscates local traditions, knowledge and experiences. This research argues that culture is a dynamic, adaptive concept and practice, “borrowing” liberally from ideological and technological innovations of other cultures and integrating these borrowed aspects into the construction and modification of culture across spatial and geographical divides to ensure particular cultures’ survival. The research shows that the local affects the global, and vice versa. It selects local communication “texts” to show that cultures are not “victims” of globalization or the proliferation of mass media. Cultures actively adopt and integrate globalization’s technological artifacts. Globalization’s positive effects are dynamic and span cultural interactions and permeate structures of authority at personal, national and global levels.
Academic Culture and Campus Culture of Universities
Shen, Xi; Tian, Xianghong
2012-01-01
Academic culture of universities mainly consists of academic outlooks, academic spirits, academic ethics and academic environments. Campus culture in a university is characterized by individuality, academic feature, opening, leading, variety and creativity. The academic culture enhances the construction of campus culture. The campus culture…
The effect of cultural interaction on cumulative cultural evolution.
Nakahashi, Wataru
2014-07-07
Cultural transmission and cultural evolution are important for animals, especially for humans. I developed a new analytical model of cultural evolution, in which each newborn learns cultural traits from multiple individuals (exemplars) in parental generation, individually explores around learned cultural traits, judges the utility of known cultural traits, and adopts a mature cultural trait. Cultural evolutionary speed increases when individuals explore a wider range of cultural traits, accurately judge the skill level of cultural traits (strong direct bias), do not strongly conform to the population mean, increase the exploration range according to the variety of socially learned cultural traits (condition dependent exploration), and make smaller errors in social learning. Number of exemplars, population size, similarity of cultural traits between exemplars, and one-to-many transmission have little effect on cultural evolutionary speed. I also investigated how cultural interaction between two populations with different mean skill levels affects their cultural evolution. A population sometimes increases in skill level more if it encounters a less skilled population than if it does not encounter anyone. A less skilled population sometimes exceeds a more skilled population in skill level by cultural interaction between both populations. The appropriateness of this analytical method is confirmed by individual-based simulations. Copyright © 2014 Elsevier Ltd. All rights reserved.
Cross-cultural dimensions : organisational culture in Philip Morris, Lietuva
Grundey, Dainora
2008-01-01
Business globalization raised the new priorities for cross-cultural management theory and practice. The goal of this article is according to cross-cultural management and organizational culture theories to propose a new model of organizational culture with cross-cultural dimensions. The objectives of the paper are as follows: a) to disclose the essence of cross-cultural management and organizational culture; b) to carry out the empirical research of organizational culture in a selected Lithua...
Cultural Centre, Destination Cultural Offer and Visitor Satisfaction
Directory of Open Access Journals (Sweden)
Benxiang Zeng
2017-10-01
Full Text Available This paper aims to establish the link between tourists’ perceptions on cultural offers and their overall satisfaction, and explore the implication of this link for sustainable tourist destination management. Assessing online customers’ reviews, this study identifies a positive correlation between visitors’ perspectives and experiences at the on-site cultural centre and visitors’ destination satisfaction. It suggests that the on-site cultural centre plays a critical role in building up visitors’ perception on cultural attributes of the destination, and its impact on visitor satisfaction is a double-edged sword. Visitors’ positive perspectives on the cultural centre enhance visitors’ experiences and contribute to their destination satisfaction; however, not only does a negative perspective on their cultural and spiritual experience compromise visitors’ satisfaction, but also subsequent negative online reviews damage the destination image and discourage visitor return/visit. The findings help destination management organisations to better understand visitors’ preference for cultural centres and therefore to improve visitors’ cultural experience. This paper appeals for further study of on-site cultural centres’ role in forming destination cultural attributes, and of social media’s potential in enriching cultural experience.
Cultural Understanding Through Cross-Cultural Analysis.
Briere, Jean-Francois
1986-01-01
A college course used an explicit intercultural approach and collective research activities to compare French and American cultures and to examine the reasons for cultural attitudes and culture conflict. Class assignments dealt with contrastive analyses of American and French institutions like advertising, cinema, feminism, etc. (MSE)
Cultural similarity, cultural competence, and nurse workforce diversity.
McGinnis, Sandra L; Brush, Barbara L; Moore, Jean
2010-11-01
Proponents of health workforce diversity argue that increasing the number of minority health care providers will enhance cultural similarity between patients and providers as well as the health system's capacity to provide culturally competent care. Measuring cultural similarity has been difficult, however, given that current benchmarks of workforce diversity categorize health workers by major racial/ethnic classifications rather than by cultural measures. This study examined the use of national racial/ethnic categories in both patient and registered nurse (RN) populations and found them to be a poor indicator of cultural similarity. Rather, we found that cultural similarity between RN and patient populations needs to be established at the level of local labor markets and broadened to include other cultural parameters such as country of origin, primary language, and self-identified ancestry. Only then can the relationship between cultural similarity and cultural competence be accurately determined and its outcomes measured.
Energy Technology Data Exchange (ETDEWEB)
Singer, Christoph [Zoologisches Institut I-Oekologie, Universitaet Karlsruhe, Geb. 07.01, Kornblumenstrasse 13, D-76131 Karlsruhe (Germany); Zimmermann, Sonja [Zoologisches Institut I-Oekologie, Universitaet Karlsruhe, Geb. 07.01, Kornblumenstrasse 13, D-76131 Karlsruhe (Germany); Sures, Bernd [Zoologisches Institut I-Oekologie, Universitaet Karlsruhe, Geb. 07.01, Kornblumenstrasse 13, D-76131 Karlsruhe (Germany)]. E-mail: dc11@rz.uni-karlsruhe.de
2005-10-05
An increasing number of papers concentrate on the availability and uptake of platinum group elements (PGE) by different organisms. These metals are discharged into the environment from different anthropogenic sources, such as automobile catalytic converters, hospitals and other medical institutions. As the effects of these precious metals on organisms remain unclear, the induction of heat shock proteins (hsp70) in zebra mussels (Dreissena polymorpha) following exposure to soluble salts of platinum, palladium and rhodium was compared with the hsp70 induction in mussels following exposure to cadmium and lead. Mussels were sampled weekly during a period of 10 weeks and analyzed for their metal concentration and their hsp70 level. Highest metal uptake was found for Cd, followed by Pt, Pb and Pd. Rh demonstrated the lowest uptake rate. A clear time-dependent increase of hsp70 levels occurred in all exposed mussels. Concentrations of hsp70 started to rise between days 18 and 25, except for the Pt-exposed group, where the initial increase was between days 25 and 32. All groups reached maximal hsp70 concentrations at day 39. Subsequently, hsp70 levels decreased to initial levels for the remaining exposure period. Threshold metal levels for the hsp70 induction varied among the metals and increased in the order: Rh < Pd {<=} Pb < Pt < Cd. Highest hsp70 values were found for mussels exposed to Pd, with a 25-fold higher level than in the controls, followed by Pt- and Rh-exposed mussels, which showed a 19-fold increase. The hsp70 levels of the mussels exposed to Cd and Pb were much lower, showing 6- and 12-fold higher values than the control, respectively. The clear induction of hsp70 due to exposure to Pt, Pd and Rh gives evidence for strong cellular effects of these metals, especially, when compared with lead and cadmium. Among the metals tested, Pd seems to have the highest potential as inducer for hsp70 production due to its low threshold level in combination with the
International Nuclear Information System (INIS)
Singer, Christoph; Zimmermann, Sonja; Sures, Bernd
2005-01-01
An increasing number of papers concentrate on the availability and uptake of platinum group elements (PGE) by different organisms. These metals are discharged into the environment from different anthropogenic sources, such as automobile catalytic converters, hospitals and other medical institutions. As the effects of these precious metals on organisms remain unclear, the induction of heat shock proteins (hsp70) in zebra mussels (Dreissena polymorpha) following exposure to soluble salts of platinum, palladium and rhodium was compared with the hsp70 induction in mussels following exposure to cadmium and lead. Mussels were sampled weekly during a period of 10 weeks and analyzed for their metal concentration and their hsp70 level. Highest metal uptake was found for Cd, followed by Pt, Pb and Pd. Rh demonstrated the lowest uptake rate. A clear time-dependent increase of hsp70 levels occurred in all exposed mussels. Concentrations of hsp70 started to rise between days 18 and 25, except for the Pt-exposed group, where the initial increase was between days 25 and 32. All groups reached maximal hsp70 concentrations at day 39. Subsequently, hsp70 levels decreased to initial levels for the remaining exposure period. Threshold metal levels for the hsp70 induction varied among the metals and increased in the order: Rh < Pd ≤ Pb < Pt < Cd. Highest hsp70 values were found for mussels exposed to Pd, with a 25-fold higher level than in the controls, followed by Pt- and Rh-exposed mussels, which showed a 19-fold increase. The hsp70 levels of the mussels exposed to Cd and Pb were much lower, showing 6- and 12-fold higher values than the control, respectively. The clear induction of hsp70 due to exposure to Pt, Pd and Rh gives evidence for strong cellular effects of these metals, especially, when compared with lead and cadmium. Among the metals tested, Pd seems to have the highest potential as inducer for hsp70 production due to its low threshold level in combination with the
Cultural neuroscience and psychopathology: prospects for cultural psychiatry.
Choudhury, Suparna; Kirmayer, Laurence J
2009-01-01
There is a long tradition that seeks to understand the impact of culture on the causes, form, treatment, and outcome of psychiatric disorders. An early, colonialist literature attributed cultural characteristics and variations in psychopathology and behavior to deficiencies in the brains of colonized peoples. Contemporary research in social and cultural neuroscience holds the promise of moving beyond these invidious comparisons to a more sophisticated understanding of cultural variations in brain function relevant to psychiatry. To achieve this, however, we need better models of the nature of psychopathology and of culture itself. Culture is not simply a set of traits or characteristics shared by people with a common geographic, historical, or ethnic background. Current anthropology understands culture as fluid, flexible systems of discourse, institutions, and practices, which individuals actively use for self-fashioning and social positioning. Globalization introduces new cultural dynamics and demands that we rethink culture in relation to a wider domain of evolving identities, knowledge, and practice. Psychopathology is not reducible to brain dysfunction in either its causes, mechanisms, or expression. In addition to neuropsychiatric disorders, the problems that people bring to psychiatrists may result from disorders in cognition, the personal and social meanings of experience, and the dynamics of interpersonal interactions or social systems and institutions. The shifting meanings of culture and psychopathology have implications for efforts to apply cultural neuroscience to psychiatry. We consider how cultural neuroscience can refine use of culture and its role in psychopathology using the example of adolescent aggression as a symptom of conduct disorder.
Cross-Cultural Impression Management: A Cultural Knowledge Audit Model
Spong, Abigail; Kamau, Caroline
2012-01-01
Purpose: Many people moving into a new culture for work or study do so without prior cross-cultural training, yet successful cultural adaptation has important ramifications. The purpose of this paper is to focus on cross-cultural impression management as an element of cultural adaptation. Does cultural adaptation begin by paying strong attention…
Dehistoricized Cultural Identity and Cultural Othering
Weiguo, Qu
2013-01-01
The assumption that each culture has its own distinctive identity has been generally accepted in the discussion of cultural identities. Quite often identity formation is not perceived as a dynamic and interactive ongoing process that engages other cultures and involves change in its responses to different challenges at different times. I will…
What Is so "Cultural" About Cultural Entrepreneurship
Directory of Open Access Journals (Sweden)
Staffan Albinsson
2017-04-01
Full Text Available The term “cultural entrepreneurship” has been increasingly used during the new millennium, mirroring the rapidly growing importance of the “quaternary sector of the economy,” i.e. knowledge-based industries, including culture. Exploration of the literature in which the term “cultural entrepreneurship” is used does not bring a solid, clear-cut, and unambiguous understanding of its definition or meaning. The aim of this paper is to present various uses of the concept and to bring about some clarity in how the concept can be understood. Two overarching uses of the cultural entrepreneurship concept have been found: 1. the anthropologist’s and institutional economist’s use, which indicates the dynamic development of intangible cultural features such as symbols, myths, languages, beliefs, values, norms, rituals, and attitudes in and between societies, and 2. the arts development use, which indicates the dynamic development of cultural services, tangible goods, and individual or collective career promotion. Most authors use a cultural entrepreneurship concept without defining it. Authors could apply more precise definitions by using a quadruple bottom-line framework to position themselves in the nexus of financial, social, artistic, and cultural perspectives.
Cultural tourism and tourism cultures
DEFF Research Database (Denmark)
Ooi, Can-Seng
Presenting a comprehensive and dynamic understanding of cultural tourism, this volume examines cultural mediators and how they help tourists appreciate foreign cultures. It also shows how tourism experiences are strategically crafted by mediators, the complexity of the mediation process, and how...... various products are mediated differently. A number of different products are investigated, including destination brand identities, "living" cultures and everyday life, art and history. The author illustrates his arguments by comparing the tourism strategies of Copenhagen and Singapore, and demonstrates...... how tourism is an agent for social change. The author also offers an original and refreshing way of understanding tourist behaviour through the concept of the "versatile tourist". The book's empirical cases and dialogic framework provide new and deep insights into tourism activities. In his...
Zoochorous dispersal of freshwater bivalves: an overlooked vector in biological invasions?
Directory of Open Access Journals (Sweden)
Coughlan Neil E.
2017-01-01
Full Text Available Vectors that underpin the natural dispersal of invasive alien species are frequently unknown. In particular, the passive dispersal (zoochory of one organism (or propagule by another, usually more mobile animal, remains poorly understood. Field observations of the adherence of invasive freshwater bivalves to other organisms have prompted us to assess the importance of zoochory in the spread of three prolific invaders: zebra mussel Dreissena polymorpha; quagga mussel Dreissena bugensis; and Asian clam Corbicula fluminea. An extensive, systematic search of the literature was conducted across multiple on-line scientific databases using various search terms and associated synonyms. In total, only five publications fully satisfied the search criteria. It appears that some fish species can internally transport viable adult D. polymorpha and C. fluminea specimens. Additionally, literature indicates that veligers and juvenile D. polymorpha can adhere to the external surfaces of waterbirds. Overall, literature suggests that zoochorous dispersal of invasive bivalves is possible, but likely a rare occurrence. However, even the establishment of a few individuals (or a single self-fertilising C. fluminea specimen can, over-time, result in a substantial population. Here, we highlight knowledge gaps, identify realistic opportunities for data collection, and suggest management protocols to mitigate the spread of invasive alien species.
Examining Cultural Intelligence and Cross-Cultural Negotiation Effectiveness
Groves, Kevin S.; Feyerherm, Ann; Gu, Minhua
2015-01-01
International negotiation failures are often linked to deficiencies in negotiator cross-cultural capabilities, including limited understanding of the cultures engaged in the transaction, an inability to communicate with persons from different cultural backgrounds, and limited behavioral flexibility to adapt to culturally unfamiliar contexts.…
Culture-specific delusions. Sense and nonsense in cultural context.
Gaines, A D
1995-06-01
It can be said that a definition of delusions requires the invocation of cultural understandings, standards of acceptability, as well as conceptions of reality and the forces that animate it. For these reasons, the determination of delusional or normative ideation can only be effected properly within particular cultural contexts. The cross-cultural record suggests that it is difficult to separate the delusional from the cultural; a belief that is patterened and culturally specific is, by definition a cultural, not a delusional belief. One must rely upon particular, relevant local cultural understandings to ascertain when the bounds of culture have been transgressed and meaning has given way to unshareable nonsense.
Culture suédoise, culture d’entreprise, culture populaire
Merle, Anthony
2013-01-01
Plus qu’un commerce, IKEA est un phénomène culturel à trois dimensions, à la fois image (construite ?) de la culture suédoise, modèle (prétendu ?) d’une certaine culture d’entreprise, et marque imprégnant largement la culture populaire. Par sa communication et sa politique, le groupe IKEA se présente comme vendeur d’un Ailleurs, à savoir celui de son origine suédoise. À partir du cas IKEA, cet article a pour objectif d’interroger le rôle de la distance cognitive (Ici/Ailleurs) pour comprendre...
Schein, Edgar H.
1988-01-01
Cultural orientations of an organization can be its greatest strength, providing the basis for problem solving, cooperation, and communication. Culture, however, can also inhibit needed changes. Cultural changes typically happen slowly – but without cultural change, many other organizational changes are doomed to fail. The dominant culture of an organization is a major contributor to its success. But, of course, no organizational culture is purely one type or another. And the existence of sec...
Cultural tourism is in context of mass culture
Гарбар, Г. А.
2014-01-01
Philosophic analysis of tourist activity within mass culture is carried out in the thesis. Cultural tourism within mass culture is more than orientation on cultural values, it is the understanding of peculiar cultural values within the context of generally accepted ones, confirmation of tourist activity peculiarities.Having reviewed tourism as a coherent system, the facts about impact of tourism on the society development are determined, potential development zones are identified, which are a...
Citizenship and cultural diversity in agenda of cultural policies
Directory of Open Access Journals (Sweden)
Patricia Silva Dorneles
2016-01-01
Full Text Available This is a discussion paper which aims to contribute to the systematization of studies, concepts and practices on cultural policies which have been developed in previous years in Brazil and are orienting cultural actions and public programs in the country, also influencing the Occupational Therapy. Citizenship and Cultural Diversity are concepts under construction and are part of the of the agenda of cultural policies and as well as the reflections and practices of various occupational therapists who are acting in a constant dialogue with the cultural area by means of the formation in cultural management, cultural mapping, programs and grant projects aimed to promote inventive identities, traditional communities, native populations, urban mobility, and cultural networks and exchange initiatives, among others. The article presents the process of this conceptual construction and the constitution of experiences aiming the democratization of the culture in the history of Brazilian cultural public policies, over which are being discussed approach paths and possibilities for Occupational Therapy.
Cultural hegemony? Educators' perspectives on facilitating cross-cultural dialogue.
Zaidi, Zareen; Verstegen, Daniëlle; Vyas, Rashmi; Hamed, Omayma; Dornan, Tim; Morahan, Page
2016-01-01
We live in an age when education is being internationalized. This can confront students with 'cultural hegemony' that can result from the unequal distribution of power and privilege in global society. The name that is given to awareness of social inequality is 'critical consciousness'. Cross-cultural dialogue provides an opportunity for learners to develop critical consciousness to counter cultural hegemony. The purpose of this research was to understand how learners engage with cross-cultural dialogue, so we can help them do so more effectively in the future. The setting for this research was an online discussion in an international health professions educator fellowship program. We introduced scenarios with cultural references to study the reaction of participants to cultural conversation cues. We used an inductive thematic analysis to explore power and hegemony issues. Participants reflected that personally they were more likely to take part in cross-cultural discussions if they recognized the context discussed or had prior exposure to educational settings with cultural diversity. They identified barriers as lack of skills in facilitating cross-cultural discussions and fear of offending others. They suggested deliberately introducing cultural issues throughout the curriculum. Our results indicate that developing critical consciousness and cross-cultural competency will require instructional design to identify longitudinal opportunities to bring up cross-cultural issues, and training facilitators to foster cross-cultural discussions by asking clarifying questions and navigating crucial/sensitive conversations.
Energy Technology Data Exchange (ETDEWEB)
Frazar, Sarah L.; Mladineo, Stephen V.
2012-07-01
The concepts of nuclear safety and security culture are well established; however, a common understanding of safeguards culture is not internationally recognized. Supported by the National Nuclear Security Administration, the authors prepared this report, an analysis of the concept of safeguards culture, and gauged its value to the safeguards community. The authors explored distinctions between safeguards culture, safeguards compliance, and safeguards performance, and evaluated synergies and differences between safeguards culture and safety/security culture. The report concludes with suggested next steps.
Cultural hegemony? Educators’ perspectives on facilitating cross-cultural dialogue
Directory of Open Access Journals (Sweden)
Zareen Zaidi
2016-11-01
Full Text Available Background: We live in an age when education is being internationalized. This can confront students with ‘cultural hegemony’ that can result from the unequal distribution of power and privilege in global society. The name that is given to awareness of social inequality is ‘critical consciousness’. Cross-cultural dialogue provides an opportunity for learners to develop critical consciousness to counter cultural hegemony. The purpose of this research was to understand how learners engage with cross-cultural dialogue, so we can help them do so more effectively in the future. Method: The setting for this research was an online discussion in an international health professions educator fellowship program. We introduced scenarios with cultural references to study the reaction of participants to cultural conversation cues. We used an inductive thematic analysis to explore power and hegemony issues. Results: Participants reflected that personally they were more likely to take part in cross-cultural discussions if they recognized the context discussed or had prior exposure to educational settings with cultural diversity. They identified barriers as lack of skills in facilitating cross-cultural discussions and fear of offending others. They suggested deliberately introducing cultural issues throughout the curriculum. Conclusion: Our results indicate that developing critical consciousness and cross-cultural competency will require instructional design to identify longitudinal opportunities to bring up cross-cultural issues, and training facilitators to foster cross-cultural discussions by asking clarifying questions and navigating crucial/sensitive conversations.
Cultural hegemony? Educators’ perspectives on facilitating cross-cultural dialogue
Zaidi, Zareen; Verstegen, Daniëlle; Vyas, Rashmi; Hamed, Omayma; Dornan, Tim; Morahan, Page
2016-01-01
Background We live in an age when education is being internationalized. This can confront students with ‘cultural hegemony’ that can result from the unequal distribution of power and privilege in global society. The name that is given to awareness of social inequality is ‘critical consciousness’. Cross-cultural dialogue provides an opportunity for learners to develop critical consciousness to counter cultural hegemony. The purpose of this research was to understand how learners engage with cross-cultural dialogue, so we can help them do so more effectively in the future. Method The setting for this research was an online discussion in an international health professions educator fellowship program. We introduced scenarios with cultural references to study the reaction of participants to cultural conversation cues. We used an inductive thematic analysis to explore power and hegemony issues. Results Participants reflected that personally they were more likely to take part in cross-cultural discussions if they recognized the context discussed or had prior exposure to educational settings with cultural diversity. They identified barriers as lack of skills in facilitating cross-cultural discussions and fear of offending others. They suggested deliberately introducing cultural issues throughout the curriculum. Conclusion Our results indicate that developing critical consciousness and cross-cultural competency will require instructional design to identify longitudinal opportunities to bring up cross-cultural issues, and training facilitators to foster cross-cultural discussions by asking clarifying questions and navigating crucial/sensitive conversations. PMID:27890048
CULTURE, CULTURE LEARNING AND NEW TECHNOLOGIES: TOWARDS A PEDAGOGICAL FRAMEWORK
Directory of Open Access Journals (Sweden)
Mike Levy
2007-02-01
Full Text Available This paper seeks to improve approaches to the learning and teaching of culture using new technologies by relating the key qualities and dimensions of the culture concept to elements within a pedagogical framework. In Part One, five facets of the culture concept are developed: culture as elemental; culture as relative; culture as group membership; culture as contested; and culture as individual (variable and multiple. Each perspective aims to provide a focus for thinking about culture, and thereby to provide a valid and useful point of departure for thinking about the practice of culture learning and teaching with new technologies. The referenced literature draws from a broad range of disciplines and definitions of culture. In Part Two, five projects are chosen to represent relevant technologies currently in use for culture learning: e-mail, chat, a discussion forum and a Web-based project. Each project is used to illustrate facets of the culture concept discussed in Part One with a view to identifying key elements within a pedagogical framework that can help us respond effectively to the challenge of culture learning and teaching utilising new technologies. Thus the goal is to align fundamental qualities of the culture concept with specific pedagogical designs, tasks and technologies.
A Survey of Freshwater Mussels in the West Pearl River, Mississippi and Louisiana, 1995
National Research Council Canada - National Science Library
Miller, Andrew
1997-01-01
.... The nonindigenous zebra mussel, Dreissena polymorpha, introduced into the Great Lakes in the late 1980s, and the threatened mussel, Potamilus inflatus, listed as endangered, were not found although...
National Research Council Canada - National Science Library
Karcanes, James A
2007-01-01
The term "cultural awareness" serves as the new favorite Department of Defense buzzword but fails in its definition to adequately articulate the complexity of culture and the high level of cultural...
Cultural Journalism and Cultural Critique in a changing Media Landscape
DEFF Research Database (Denmark)
Nørgaard Kristensen, Nete; From, Unni
2015-01-01
This special issue addresses a topic of journalism studies that has previously been somewhat neglected but which has gained increasing scholarly attention since the mid-2000s: the coverage and evaluation of art and culture, or what we term “cultural journalism and cultural critique.......” In this introduction, we highlight three issues that serve to frame the study of cultural journalism and cultural critique more generally and the eight articles of this special issue more specifically: (1) the constant challenge of demarcating cultural journalism and cultural critique, including the interrelations...... of “journalism” and “critique”; (2) the dialectic of globalisation’s cultural homogenisation, on the one hand, and the specificity of local/national cultures, on the other; and (3) the digital media landscape seen in terms of the need to rethink, perhaps even redefine cultural journalism and cultural critique...
Sperry, Len
2010-01-01
Cultural sensitivity and cultural competence in the selection of culturally sensitive treatments is a requisite for effective counseling practice in working with diverse clients and their families, particularly when clients present with health issues or medical problems. Described here is a strategy for selecting culturally sensitive treatments…
Cultured Trash, Not Trash Culture
Directory of Open Access Journals (Sweden)
Taufiqurrohman Taufiqurrohman
2017-09-01
Full Text Available As civilized creature, human actually can manage trash as well as possible although it is often stereotyped as a vain thing. This article gives the proof that trash can be cultured as well so that a society can take benefits from the existence of it. This article parses ways of orderly managing it at schools, in this case two schools in Jepara. The results say that trash can be cultured by having an organization to manage the Trash Bank at schools and to train students to classify and recycle trash then take advantage of it by selling the collected and the recycled trash. It makes trash have good transformation of values, repelling against the prior stereotype. Finally, by taking example from Trash Bank management at schools, human can have so cultured trash that they would not be trapped by trash culture.
A. Klamer (Arjo)
2011-01-01
textabstractCultural entrepreneurship is a new character in the cultural sector. This paper characterizes the cultural entrepreneur paying homage to the hermeneutic approach of Don Lavoie and others. The challenge is to render the "cultural" meaningful. An invention is the highlighting of the
Ferguson, Gail M; Nguyen, Jacqueline; Iturbide, Maria I
2017-01-01
Cultural variability (CV) is introduced as an overlooked dimension of cultural identity development pertaining to emphasizing and de-emphasizing the influence of a single cultural identity (i.e., cultural influence [CI]) on daily interactions and behaviors. The Cultural IDentity Influence Measure (CIDIM) is introduced as a novel measure of CI and CV, and hypothesis-driven validation is conducted in two samples along with exploration of associations between CV and well-being. A multicultural sample of 242 emerging adults participated in a daily diary study (Mage = 19.95 years, SDage = 1.40) by completing up to eight daily online surveys containing the CIDIM, criterion measures (ethnic identity, other group orientation, ethnic identity salience and daily variability in salience, social desirability), and measures of personal and interpersonal well-being. A second validation sample (n = 245) completed a 1-time survey with the CIDIM and a subset of criterion measures. Results using both samples show evidence of CI and CV and demonstrate the validity, reliability, and domain-sensitivity of the CIDIM. Further, CV made unique and positive contributions to predicting interaction quality after accounting for ethnic salience and variability in ethnic salience. An analytic approach utilizing standard deviations produced near-identical results to multilevel modeling and is recommended for parsimony. Ethnic minority and majority individuals make daily adjustments to play up and play down the influence of cultural identity on their social interactions and behaviors, and these adjustments predict interpersonal well-being. Cultural influence and cultural variability contribute to our emerging understanding of cultural identity as dynamic and agentic. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Migration, cultural bereavement and cultural identity
BHUGRA, DINESH; BECKER, MATTHEW A
2005-01-01
Migration has contributed to the richness in diversity of cultures, ethnicities and races in developed countries. Individuals who migrate experience multiple stresses that can impact their mental well being, including the loss of cultural norms, religious customs, and social support systems, adjustment to a new culture and changes in identity and concept of self. Indeed, the rates of mental illness are increased in some migrant groups. Mental health practitioners need to be ...
Managing Culture--Making Culture Work for You
National Centre for Vocational Education Research (NCVER), 2006
2006-01-01
An understanding of culture in organisations can offer insights into individual and group behaviour, and leadership. It can help to explain not just what happens in an organisation, but why it happens. However, many people are concerned not just with understanding culture, and hence organisational life. They see culture as something to be…
Types of cross-cultural studies in cross-cultural psychology
van de Vijver, F.J.R.; Lonner, W.J.; Dinnel, D.L.; Hayes, S.A.; Sattler, D.N.
2003-01-01
From a methodological perspective cross-cultural studies in psychology differ in three dimensions. First, cross-cultural psychological studies can be exploratory or test specific hypotheses. Second, some cross-cultural studies compare countries or ethnic groups while other cross-cultural studies
Cultural values and cross-cultural video consumption on YouTube
Macy, Michael
2017-01-01
Video-sharing social media like YouTube provide access to diverse cultural products from all over the world, making it possible to test theories that the Web facilitates global cultural convergence. Drawing on a daily listing of YouTube’s most popular videos across 58 countries, we investigate the consumption of popular videos in countries that differ in cultural values, language, gross domestic product, and Internet penetration rate. Although online social media facilitate global access to cultural products, we find this technological capability does not result in universal cultural convergence. Instead, consumption of popular videos in culturally different countries appears to be constrained by cultural values. Cross-cultural convergence is more advanced in cosmopolitan countries with cultural values that favor individualism and power inequality. PMID:28531228
Cultural values and cross-cultural video consumption on YouTube.
Park, Minsu; Park, Jaram; Baek, Young Min; Macy, Michael
2017-01-01
Video-sharing social media like YouTube provide access to diverse cultural products from all over the world, making it possible to test theories that the Web facilitates global cultural convergence. Drawing on a daily listing of YouTube's most popular videos across 58 countries, we investigate the consumption of popular videos in countries that differ in cultural values, language, gross domestic product, and Internet penetration rate. Although online social media facilitate global access to cultural products, we find this technological capability does not result in universal cultural convergence. Instead, consumption of popular videos in culturally different countries appears to be constrained by cultural values. Cross-cultural convergence is more advanced in cosmopolitan countries with cultural values that favor individualism and power inequality.
Cultural values and cross-cultural video consumption on YouTube.
Directory of Open Access Journals (Sweden)
Minsu Park
Full Text Available Video-sharing social media like YouTube provide access to diverse cultural products from all over the world, making it possible to test theories that the Web facilitates global cultural convergence. Drawing on a daily listing of YouTube's most popular videos across 58 countries, we investigate the consumption of popular videos in countries that differ in cultural values, language, gross domestic product, and Internet penetration rate. Although online social media facilitate global access to cultural products, we find this technological capability does not result in universal cultural convergence. Instead, consumption of popular videos in culturally different countries appears to be constrained by cultural values. Cross-cultural convergence is more advanced in cosmopolitan countries with cultural values that favor individualism and power inequality.
Blood culture bottles are superior to conventional media for vitreous culture.
Thariya, Patsuda; Yospaiboon, Yosanan; Sinawat, Suthasinee; Sanguansak, Thuss; Bhoomibunchoo, Chavakij; Laovirojjanakul, Wipada
2016-08-01
To compare blood culture bottles and conventional media for the vitreous culture in patients with clinically suspected infectious endophthalmitis. Retrospective comparative study at KKU Eye Center, Khon Kaen University. There were 342 patients with clinically suspected infectious endophthalmitis participated in the study. The vitreous specimens were inoculated in both blood culture bottles and on conventional culture media (blood agar, MacConkey agar, chocolate agar, Sabouraud dextrose agar and thioglycolate broth). The number of positive culture yields in both blood culture bottles and conventional media. Positive culture yields in both methods were found in 151 eyes (49.5%). There were 136 of 151 eyes (90.1%) with positive culture in blood culture bottles, whereas 99 of 151 eyes (65.6%) yielded positive cultures in conventional media. These findings were different with a statistical significance (P culture bottles and conventional media improved the yield. Blood culture bottles are superior to conventional media for vitreous culture in clinically suspected infectious endophthalmitis. Vitreous culture using blood culture bottles should be recommended as the primary method for microbiological diagnosis. A combination of both methods further improves the positive culture yield. © 2016 Royal Australian and New Zealand College of Ophthalmologists.
Family Counseling: Cultural Sensitivity, Relativism, and the Cultural Defense.
May, Kathleen M.
1998-01-01
Cultural sensitivity, cultural relativism, and the cultural defense are defined and described. Each concept is addressed in terms of its relationship to couple and family counseling. The role of counselor must be broadened and deepened to include the role of cultural broker. (Author/EMK)
DEFF Research Database (Denmark)
Rasmussen, Lauge Baungaard
1996-01-01
The chapter deals with different paradigms andtheories of cultural development. The problem toexplain change and methods to analyse developmentin different cultures are presented and discussed.......The chapter deals with different paradigms andtheories of cultural development. The problem toexplain change and methods to analyse developmentin different cultures are presented and discussed....
Beyond cultural values? Cultural leadership ideals and entrepreneurship
Stephan, Ute; Pathak, Saurav
2016-01-01
This paper offers a fresh perspective on national culture and entrepreneurship research. It explores the role of Culturally-endorsed implicit Leadership Theories (CLTs) – i.e., the cultural expectations about outstanding, ideal leadership – on individual entrepreneurship. Developing arguments based on culture-entrepreneurship fit, we predict that charismatic and self-protective CLTs positively affect entrepreneurship. They provide a context that enables entrepreneurs to be co-operative in ord...
Articulating cultures: socio-cultural experiences of black female ...
African Journals Online (AJOL)
Articulating cultures: socio-cultural experiences of black female immigrant students in South African schools 1. ... Gender and Behaviour ... and worrisome issue is that of the erosion of the social and cultural mores of Black3 immigrant students.
Occupation, well-being, and culture: Theory and cultural humility.
Hammell, Karen R Whalley
2013-10-01
The Canadian Model of Occupational Performance and Engagement depicts individuals embedded within cultural environments that afford occupational possibilities. Culture pertains not solely to ethnicity or race but to any dimension of diversity, including class, gender, sexual orientation, and ability. This paper highlights specific dimensions of cultural diversity and their relationships to occupational engagement and well-being. Cultural variations constitute the basis for a socially constructed hierarchy of traits that significantly determine occupational opportunities and impact mental health and well-being. Cultural humility is an approach to redressing power imbalances in client-therapist relationships by incorporating critical self-evaluation and recognizing that cultural differences lie not within clients but within client-therapist relationships. It is proposed that theoretical relevance would be enhanced if culturally diverse perspectives were incorporated into theories of occupation. Cultural humility is advocated as an approach to theoretical development and in efforts to counter professional Eurocentrism, ethnocentrism, and intellectual colonialism.
Nuclear safety culture based on the organizational and individual culture
International Nuclear Information System (INIS)
Li Jingxi; Ren Ou
2005-01-01
The nuclear safety culture is used increasingly and developed by countries that have nu- clear plants all over the world, since the term 'safety culture' was first introduced by IAEA in 1986. Enterprises culture reflects many terms in an enterprise, such as management level and staff quality. The safety culture is the center in a nuclear enterprises culture, and relates directly to the safety and outstanding achievement of operation. This paper discusses the nuclear safety culture from the viewpoints of the organizational and individual cultures. (authors)
Directory of Open Access Journals (Sweden)
Aleksandra Uzelac
2010-05-01
Full Text Available Digital culture is a new and complex concept. Digital advances are increasingly interacting with the world of culture and the arts, leading to a convergence of technologies, media and information and shaping communication modes. The new possibilities offered by the digital technologies -namely, global connectivity and the emergence of new networks- challenge our traditional understanding of culture and make it necessary for us to take on the board the concept of a digital culture. This article views digital culture as a new social system that determines experiences and opportunities for the citizens of today. Digital technologies and the networked environment have introduced new practices, opportunities and threats, and the culture sector needs to find appropriate ways for operating in this new reality.
Exploring the 'cultural' in cultural competencies in Pacific mental health.
Samu, Kathleen Seataoai; Suaalii-Sauni, Tamasailau
2009-02-01
Cultural competency is about the ability of individuals and systems to respond respectfully and effectively to the cultural needs of peoples of all cultures. Its general attributes include knowledge, attitudes, skills and professional judgment. In Pacific mental health, 'the cultural' is generally understood to be ethnic culture. Accordingly, Pacific cultural competencies assume ethnic specific markers. In mental health Pacific cultural competencies has seen a blending of cultural and clinical beliefs and practices. This paper provides an overview of five key theme areas arising from Auckland-based ethnic-specific Pacific workshop data: language, family, tapu relationships, skills and organisation policy. Workshop participants comprised of Pacific mental health providers, Pacific consumers, family members of Pacific consumers and members of the Pacific community members. This paper purports that identifying the perceptions of different Pacific groups on ethnic-specific elements of cultural competencies are necessary to build and strengthen the capacity and capability of mental health services to provide culturally relevant services.
On Tea Bowl from Jianzhan to Tenmoku: Material Culture and Intangible Culture in Cultural Diffusion
Directory of Open Access Journals (Sweden)
Jianping Guan
2014-12-01
Full Text Available According to precise and scientific literature that recorded, Chinese tea culture has a documented history of more than 1700 years. During which period, Yuan Dynasty was considered a crucial turning-point with great changes. The current tea culture in China is an adoption and innovation of Ming and Qing dynasty, especially in the form of processing technology. For those elements inherited from Tang and Song dynasties, however, they were more directly adopted systematically by Japan. Ever since powdered tea culture from Song dynasty was accepted in Japan, Jianzhan, the tea bowl that gained renowned reputation in the Song tea culture was also introduced and became tenmoku (tianmu after localization. As the transformation of Chinese tea culture ended in Japan, Japanese tea culture of wabi-cha was shaped after the tenmoku’s obvious decline in value. Jianzhan’s prosper, and tenmoku’s emergence and transition, all proved a definitive impact from intangible culture.
Bridging Culture On-Line: Strategies for Teaching Cultural Sensitivity.
Wendler, M. Cecilia; Struthers, Roxanne
2002-01-01
An online cross-cultural health course for nurses sought to provide access to cultural experiences by culturally congruent use of a minority visiting scholar and required participation in cultural enrichment activities. Course and faculty evaluations were designed to be appropriate for the asynchronous environment. (Contains 25 references.) (SK)
Cultural relativism and cultural diversity: implications for nursing practice.
Baker, C
1997-09-01
This article examines the doctrine of cultural relativism in nursing practice. To introduce the issue, an overview of the intellectual history of cultural relativism is presented. The academic themes of the debate surrounding cultural relativism are illustrated with an example of the social controversy in France involving cultural relativism as used to defend the practice of female genital excision among immigrant communities. The dilemma faced by nursing in making cross-cultural judgments is then examined in the light of the academic and social debates. The article concludes with a theoretical resolution of the issue of cultural relativism for nursing practice that is based on hermeneutic philosophy.
Culture Analysis: The Interaction of Organizational and National Culture
Marina Arnoldovna Makarchenko
2015-01-01
The article is devoted to the interaction between organizational culture factors. A comparative analysis of the Russian and Argentine companies culture using different methods shows the impact of the national mentality in organizational culture. The thesis is the need to introduce the term "regional culture" in relation to modern Russia.
Cultural evolutionary theory: How culture evolves and why it matters.
Creanza, Nicole; Kolodny, Oren; Feldman, Marcus W
2017-07-24
Human cultural traits-behaviors, ideas, and technologies that can be learned from other individuals-can exhibit complex patterns of transmission and evolution, and researchers have developed theoretical models, both verbal and mathematical, to facilitate our understanding of these patterns. Many of the first quantitative models of cultural evolution were modified from existing concepts in theoretical population genetics because cultural evolution has many parallels with, as well as clear differences from, genetic evolution. Furthermore, cultural and genetic evolution can interact with one another and influence both transmission and selection. This interaction requires theoretical treatments of gene-culture coevolution and dual inheritance, in addition to purely cultural evolution. In addition, cultural evolutionary theory is a natural component of studies in demography, human ecology, and many other disciplines. Here, we review the core concepts in cultural evolutionary theory as they pertain to the extension of biology through culture, focusing on cultural evolutionary applications in population genetics, ecology, and demography. For each of these disciplines, we review the theoretical literature and highlight relevant empirical studies. We also discuss the societal implications of the study of cultural evolution and of the interactions of humans with one another and with their environment.
Making Safety Culture a Corporate Culture
International Nuclear Information System (INIS)
Svenningsson, J.
2016-01-01
Safety Culture is something that we have actively worked with in the nuclear industry for a long time. Formally, it has been on the agenda since the Chernobyl accident. However, the work with creating a safe organizational culture can of course be traced back even further in time. Over the years a lot has happened in how we are approaching the concept of safety culture and especially how we look upon the human being as a part of the system and how we as humans interact with the organization and technology. For an organization to have a culture that promotes safety it is essential to create an ownership of safety with all workers within the site. To create this ownership it is vital to have the undivided commitment of the management. It all starts with the fundamental values of the organization. These values must then be concluded in firm expectations of behaviors that apply to all workers and management. This could be referred to as expectation of a Professional Behavior that allows us to live up to the company values. At OKG nuclear power plant, a successful Business Improvement Program was recently carried out with intention to develop and contribute to the maturity of the organization in terms of safety. One of the sub-programs of the program was called Professional Behavior - With purpose of making safety into a corporate culture. At OKG, Safety culture is something that systematically been addressed and worked with since 2004. Even though the Safety Culture program could be considered to already have reached a certain level of maturity the Business Improvement program helped the organization to lay the foundation for further development by clarify expected behaviors that was firmly cemented in to the corporate values.
Creating Cultural Consumers: The Dynamics of Cultural Capital Acquisition
Kisida, Brian; Greene, Jay P.; Bowen, Daniel H.
2014-01-01
The theories of cultural reproduction and cultural mobility have largely shaped the study of the effects of cultural capital on academic outcomes. Missing in this debate has been a rigorous examination of how children actually acquire cultural capital when it is not provided by their families. Drawing on data from a large-scale experimental study…
Mediating production and consumption: cultural capital and 'cultural workers'.
Wright, David
2005-03-01
This paper examines recent debates about the role of what Bourdieu termed cultural intermediaries in the formation and reproduction of the relations of cultural capital. Workers in the cultural or creative industries were given a central place in Bourdieu's schema in the creation of hierarchies of value in the production and consumption of symbolic goods. Subsequent writers about the apparent emergence of a creative economy (Lash and Urry 1994; Featherstone 1991) have given workers involved in the production and distribution of cultural goods a pivotal place in the development of late or post-modernity. More recent work (Negus 2002; Nixon and du Gay 2002) has criticized the validity and coherence of the term as it has come to be understood and called for more rigour in its definition and use. This paper adds to this debate by considering the book trade as a space in which the gap between production and consumption of cultural goods is mediated. It suggests that cultural intermediaries, as cultural workers, are engaged in the reproduction of the cultural aspects of social class by 'shoring up' their insecure position in the relations of cultural capital, rather than simply being the taste leaders of a reflexive modernity.
Forensic culture as epistemic culture: the sociology of forensic science.
Cole, Simon A
2013-03-01
This paper explores whether we can interpret the notion of 'forensic culture' as something akin to what Knorr-Cetina called an 'epistemic culture'. Can we speak of a 'forensic culture', and, if so, how is it similar to, or different from, other epistemic cultures that exist in what is conventionally called 'science'? This question has important policy implications given the National Academy Science's (NAS) recent identification of 'culture' as one of the problems at the root of what it identified as 'serious deficiencies' in U.S. forensic science and 'scientific culture' as an antidote to those problems. Finding the NAS's characterisation of 'scientific culture' overly general and naïve, this paper offers a preliminary exploration of what might be called a 'forensic culture'. Specifically, the paper explores the way in which few of the empirical findings accumulated by sociologists of science about research science seem to apply to forensic science. Instead, forensic science seems to have developed a distinct culture for which a sociological analysis will require new explanatory tools. Faithful sociological analysis of 'forensic culture' will be a necessary prerequisite for the kind of culture change prescribed by external reformist bodies like the NAS. Copyright © 2012. Published by Elsevier Ltd.
Culture Three Ways: Culture and Subcultures Within Countries.
Oyserman, Daphna
2017-01-03
Culture can be thought of as a set of everyday practices and a core theme-individualism, collectivism, or honor-as well as the capacity to understand each of these themes. In one's own culture, it is easy to fail to see that a cultural lens exists and instead to think that there is no lens at all, only reality. Hence, studying culture requires stepping out of it. There are two main methods to do so: The first involves using between-group comparisons to highlight differences and the second involves using experimental methods to test the consequences of disruption to implicit cultural frames. These methods highlight three ways that culture organizes experience: (a) It shields reflexive processing by making everyday life feel predictable, (b) it scaffolds which cognitive procedure (connect, separate, or order) will be the default in ambiguous situations, and (c) it facilitates situation-specific accessibility of alternate cognitive procedures. Modern societal social-demographic trends reduce predictability and increase collectivism and honor-based go-to cognitive procedures.
Leung, Angela K-Y; Cohen, Dov
2011-03-01
The CuPS (Culture × Person × Situation) approach attempts to jointly consider culture and individual differences, without treating either as noise and without reducing one to the other. Culture is important because it helps define psychological situations and create meaningful clusters of behavior according to particular logics. Individual differences are important because individuals vary in the extent to which they endorse or reject a culture's ideals. Further, because different cultures are organized by different logics, individual differences mean something different in each. Central to these studies are concepts of honor-related violence and individual worth as being inalienable versus socially conferred. We illustrate our argument with 2 experiments involving participants from honor, face, and dignity cultures. The studies showed that the same "type" of person who was most helpful, honest, and likely to behave with integrity in one culture was the "type" of person least likely to do so in another culture. We discuss how CuPS can provide a rudimentary but integrated approach to understanding both within- and between-culture variation. (c) 2011 APA, all rights reserved
Driving Cultures: Cars, Young People and Cultural Research
Directory of Open Access Journals (Sweden)
Sarah Redshaw
2011-11-01
Full Text Available This article describes the Driving Cultures research, the cultural importance of the car and the psychological approaches central to research in the field of road safety and investigations of the over–representation of young people in crashes. The aim of the article is to outline driving as a cultural practice drawing on the experiences of young people as described in focus groups in order to show how cultural research can contribute to a social concern such as traffic injury and death.
Exploration of Food Culture in Kisumu: A Socio-Cultural Perspective
Directory of Open Access Journals (Sweden)
Fredrick Argwenge Odede
2017-07-01
Full Text Available Increasingly food culture in the context of socio-cultural dimension is becoming important for sustainable urban development. In the last four years food festivals have been held in Kisumu attracting several interests both from within and without the City. The Kisumu fish night event of 2013 marked the melting point of food culture in Kisumu. This paper thus explores the noble intention of integrating food culture in Kisumu as a socio-cultural capital for the advancement of City sustainable development agenda. To an agrarian society, life is about food from its production, the processing/preservation up to the consumption or the sharing. People connect to their cultural or ethnic background through similar food patterns. People from different cultural backgrounds eat different foods leading to the question: Are Luos in Kisumu defined by their own food culture? This study further investigated the mode of production, and storage of food resources, examined food cuisines of the Luo community in Kisumu, and assessed the food habits, practices and beliefs associated with food cuisines, as well as, the nutritional and socio-cultural values of Luo cuisines. The research employed qualitative methods of data collection such as interviews, observation, focused group discussion and photography using purposive and snowball sampling technique. Content analysis was used to draw general universal statements in thematic areas with respect to the research objectives. The study revealed that Luo community in Kisumu has a food culture laced with rich cultural practices, rituals and societal norms that defines them as a distinct cultural identity but interacts with other cultural groups in the metropolitan city of Kisumu. Further, the study confirms that indeed food culture is vital for sustainable development of urban centre granted that Kisumu largely evolved as urban centre for exchange of goods for food.
Cultural Studies and Sociology of Culture in Germany: Relations and Interrelations
Directory of Open Access Journals (Sweden)
Udo Göttlich
2013-06-01
Full Text Available Over the last three decades, attitudes towards cultural studies in Germany have developed within contexts of contact and conflict with a variety of disciplines, e.g. ethnology, anthropology, sociology, as well as the sociology of culture, liter-ary studies and Kulturwissenschaft(en. On the one hand there is a strong academ-ic interest in how cultural studies perceives and analyzes media culture, popular culture and everyday life. On the other hand boundaries with humanities and so-cial science remain, which leads to criticism and conflicts with cultural studies and its achievements.I will discuss some of the problems concerning the perception and reception of cultural studies among representatives of Kulturwissenschaft(en and sociology of culture. Furthermore I will draw on the role of cultural studies in thematizing cul-tural change and conflicts, and its ability to do so in a way that shows the im-portance of culture and politics.
Film Cross-culture Research under the Perspective of Language and Culture
Institute of Scientific and Technical Information of China (English)
罗淞译
2015-01-01
Language as an important tool of cultural transmission, it can achieve the cross-culture development of film. With the strength of globalization, film cross-culture communication are increasing, and how to enhance the communication of film through language and culture and let more people enjoy the thought expressed in film is one of the most important content for cross-culture development of mant films. Different cultural backgrounds will produce large diversities in watching a same film, so it is helpful for the cross-culture development of film when making good use of culture and language, on the contrary, it will become a hindrance. This article do research on cross-culture development of film under the perspective of language and culture to find out the existing problems in present cross-culture development of film and put forward effective resolution strategy in order to promote certain reference for the internationalization of China’s film industry.
CORPORATE CULTURE AS A TOOL TO IMPROVE SAFETY CULTURE
Directory of Open Access Journals (Sweden)
Erika SUJOVÁ
2013-07-01
Full Text Available The aim of the article is to explain interconnectivity between corporate culture and safety culture, which aim to utilize motivation to prevent work accidents and other unwanted events in an enterprise. The article deals with ways how to improve approaches to Occupational Health & Safety, OH&S, at work place through proper direction of corporate culture. It introduces internal and external determinants of corporate culture, which have a significant effect. The article introduces common features of corporate culture and safety culture as an element of the OH&S management system with emphasis on system effectiveness. The final portion of the article presents the hierarchy of needs model, which may serve as a basis motivating employees to follow safety and health rules at work place.
Competencia cultural e inteligencia cultural. Aportes a la mediación cultural docente
Directory of Open Access Journals (Sweden)
Maurizia D'Antoni
2011-01-01
Full Text Available El ensayo nace como parte de una investigación mayor que se publicará sobre la inserción profesional docente en la Universidad de Costa Rica. Su finalidad en la investigación en curso es la de explorar los aportes de los estudios sobre competencia cultural e inteligencia cultural, para identificar planteamientos teóricos que fortalezcan nuevos espacios para la mediación cultural docente en la Universidad. Se concluye que el concepto de competencia cultural representa un aporte importante, si se revisa la idea de cultura que subyace y se le transforma en "competencia intercultural". Luego, se define mediación cultural, evidenciándose la importancia de la nueva figura profesional en el contexto actual, los ámbitos de acción donde se ha empleado y se manifiesta la necesidad de promover mediadores y mediadoras culturales en Costa Rica también.
Human nature, human culture: the case of cultural evolution.
Lewens, Tim
2017-10-06
In recent years, far from arguing that evolutionary approaches to our own species permit us to describe the fundamental character of human nature, a prominent group of cultural evolutionary theorists has instead argued that the very idea of 'human nature' is one we should reject. It makes no sense, they argue, to speak of human nature in opposition to human culture. The very same sceptical arguments have also led some thinkers-usually from social anthropology-to dismiss the intimately related idea that we can talk of human culture in opposition to human nature. How, then, are we supposed to understand the cultural evolutionary project itself, whose proponents seem to deny the distinction between human nature and human culture, while simultaneously relying on a closely allied distinction between 'genetic' (or sometimes 'organic') evolution and 'cultural' evolution? This paper defends the cultural evolutionary project against the charge that, in refusing to endorse the concept of human nature, it has inadvertently sabotaged itself.
Impact of Inter-Row Spacing on Yield and Yield Components of several Annual Medics Species
Directory of Open Access Journals (Sweden)
Mahnaz BAGHERI
2010-12-01
Full Text Available A field study was conducted in Faculty of Agriculture, Tarbiat Modares University, Tehran, Iran to evaluate the effects of three within-row spacing treatments (20, 30 and 40 cm on forage and seed production of five species of annual medics (Medicago scutellata cv. Sava; M. littoralis cv. Herald; M. polymorpha cv. Santiago; M. minima cv. Orion and M. truncatula cv. Mogul. The experiment was carried out in Faculty of Agriculture, Tarbiat Modares University, Tehran, Iran. The results of the experiment indicated that M. polymorpha had the highest forage yield out of the highest plant population. Latter with average 443.09 Kg ha-1 and M. scutellata with average 409.99 Kg ha-1 produced the highest seed yield. Also, the last species with 1306.78 Kg ha-1 had the highest pod yields. The highest seed yield and pod yield were produced at 20 cm within-row spacing because there were not adequate plants for maximum seed and pod yields in 30 and 40 cm within-row spacing. The tested plant densities did not affect on seeds number per pod, 1000 seeds weight and seeds to burr pod weight ratio. The M. truncatula and M. minima have the highest seeds number per pod. In addition, M. scutellata had the highest 1000 seeds weight with an average of 12.57 g. The highest seeds to burr pod ratio was observed in M. polymorpha. The most pod numbers were obtained in 20 and 30 cm within-row spacing and M. polymorpha while, the least pod numbers was observed in M. scutellata. Plant densities did not affect on pod numbers of the mentioned species. The highest dry forage yield was produced in 20 cm within-row spacing. Among the tested tested species, M. truncatula had the highest forage yield with average 870.07 Kg ha-1. This experiment indicated that there is possibility for seed and forage production of tested annual medics in the mentioned zone with the considering suitable plant densities.
Fung, Helene H
2013-06-01
This article reviews the empirical studies that test socioemotional aging across cultures. The review focuses on comparisons between Western (mostly North Americans and Germans) and Eastern cultures (mostly Chinese) in areas including age-related personality, social relationships, and cognition. Based on the review, I argue that aging is a meaning-making process. Individuals from each cultural context internalize cultural values with age. These internalized cultural values become goals that guide adult development. When individuals from different cultures each pursue their own goals with age, cultural differences in socioemotional aging occur.
Culture, cross-role consistency, and adjustment: testing trait and cultural psychology perspectives.
Church, A Timothy; Anderson-Harumi, Cheryl A; del Prado, Alicia M; Curtis, Guy J; Tanaka-Matsumi, Junko; Valdez Medina, José L; Mastor, Khairul A; White, Fiona A; Miramontes, Lilia A; Katigbak, Marcia S
2008-09-01
Trait and cultural psychology perspectives on cross-role consistency and its relation to adjustment were examined in 2 individualistic cultures, the United States (N=231) and Australia (N=195), and 4 collectivistic cultures, Mexico (N=199), the Philippines (N=195), Malaysia (N=217), and Japan (N=180). Cross-role consistency in trait ratings was evident in all cultures, supporting trait perspectives. Cultural comparisons of mean consistency provided support for cultural psychology perspectives as applied to East Asian cultures (i.e., Japan) but not collectivistic cultures more generally. Some but not all of the hypothesized predictors of consistency were supported across cultures. Cross-role consistency predicted aspects of adjustment in all cultures, but prediction was most reliable in the U.S. sample and weakest in the Japanese sample. Alternative constructs proposed by cultural psychologists--personality coherence, social appraisal, and relationship harmony--predicted adjustment in all cultures but were not, as hypothesized, better predictors of adjustment in collectivistic cultures than in individualistic cultures.
Considering the culture of disability in cultural competence education.
Eddey, Gary E; Robey, Kenneth L
2005-07-01
Cultural competence extends beyond understanding those values, beliefs, and needs that are associated with patients' age or gender or with their racial, ethnic, or religious backgrounds. People hold many simultaneous cultural associations, and each have implications for the care process. The "culture of disability" is a pan-ethnic culture for which a set of physician competencies are required to ensure appropriate, culturally sensitive care to persons with congenital or acquired disabilities. Such competencies include communicating with patients who have deficits in verbal communication and avoidance of infantilizing speech; understanding the values and needs of persons with disabilities; the ability to encourage self-advocacy skills of patients and families; acknowledging the core values of disability culture including the emphasis on interdependence rather than independence; and feeling comfortable with patients with complex disabilities. Medical schools have developed programs to increase students' exposure to persons with disabilities and it is suggested that such programs are most effective when they are the result of collaboration with community-based facilities or organizations that serve persons with disabilities in the natural environment. Combining lecture-based instruction and structured experiences with the opportunity for students to interact with patients in their natural environments may facilitate development of competencies with respect to patients with disabilities. The culture of disability should be included as one of the many cultures addressed in cultural competence initiatives in medical school and residency curricula.
Culture and sensitivity - urine ... when urinating. You also may have a urine culture after you have been treated for an infection. ... when bacteria or yeast are found in the culture. This likely means that you have a urinary ...
National Research Council Canada - National Science Library
Sauer, Jennifer
2004-01-01
...) were added to the sampling design in 1993 and zebra mussels (Dreissena Polymorpha) were added in 1995. Sampling was based on a stratified random design and conducted at approximately 125 sites per study area...
DEFF Research Database (Denmark)
Reeh, Henrik
2012-01-01
Spatial Culture – A Humanities Perspective Abstract of introductory essay by Henrik Reeh Secured by alliances between socio-political development and cultural practices, a new field of humanistic studies in spatial culture has developed since the 1990s. To focus on links between urban culture...... and modern society is, however, an intellectual practice which has a much longer history. Already in the 1980s, the debate on the modern and the postmodern cited Paris and Los Angeles as spatio-cultural illustrations of these major philosophical concepts. Earlier, in the history of critical studies, the work...... Foucault considered a constitutive feature of 20th-century thinking and one that continues to occupy intellectual and cultural debates in the third millennium. A conceptual framework is, nevertheless, necessary, if the humanities are to adequa-tely address city and space – themes that have long been...
Mace, Ruth; Jordan, Fiona M
2011-02-12
A growing body of theoretical and empirical research has examined cultural transmission and adaptive cultural behaviour at the individual, within-group level. However, relatively few studies have tried to examine proximate transmission or test ultimate adaptive hypotheses about behavioural or cultural diversity at a between-societies macro-level. In both the history of anthropology and in present-day work, a common approach to examining adaptive behaviour at the macro-level has been through correlating various cultural traits with features of ecology. We discuss some difficulties with simple ecological associations, and then review cultural phylogenetic studies that have attempted to go beyond correlations to understand the underlying cultural evolutionary processes. We conclude with an example of a phylogenetically controlled approach to understanding proximate transmission pathways in Austronesian cultural diversity.
Mucosal culture; Culture - skin; Culture - mucosal; Nail culture; Culture - fingernail; Fingernail culture ... There, it is placed in a special dish (culture). It is then watched to see if bacteria, ...
Culture - bile ... is placed in a special dish called a culture medium to see if bacteria, viruses, or fungi ... Chernecky CC, Berger BJ. Body fluid - anaerobic culture. In: ... . 6th ed. St Louis, MO: Elsevier Saunders; 2013:225-226. Kim AY, ...
Cordeiro, Juliana; De Toni, Daniela Cristina; da Silva, Gisele de Souza; Valente, Vera Lucia da Silva
2014-10-01
Detailed chromosome photomaps are the first step to develop further chromosomal analysis to study the evolution of the genetic architecture in any set of species, considering that chromosomal rearrangements, such as inversions, are common features of genome evolution. In this report, we analyzed inversion polymorphisms in 25 different populations belonging to six neotropical species in the cardini group: Drosophila cardini, D. cardinoides, D. neocardini, D. neomorpha, D. parthenogenetica and D. polymorpha. Furthermore, we present the first reference photomaps for the Neotropical D. cardini and D. parthenogenetica and improved photomaps for D. cardinoides, D. neocardini and D. polymorpha. We found 19 new inversions for these species. An exhaustive pairwise comparison of the polytene chromosomes was conducted for the six species in order to understand evolutionary patterns of their chromosomes.
Directory of Open Access Journals (Sweden)
İsmail Fırat Altay
2005-04-01
Full Text Available This paper aims at emphasizing the issue of teaching of culture in foreign languageteaching. In this respect, the reasons of teaching culture in foreign language classes arefocused on initially. So, the justifications of teaching culture are considered and explainedand by the help of a dialogue. Right after this, ways of developing cultural awareness is takeninto account. At this step, types of courses to develop cultural awareness are dealt with.Developing cultural awareness in class is another aspect to handle. Besides, ways ofdeveloping cultural awareness outside the class are worked on. Whether there are dangers ofusing culture in foreign language class is explained in dangers and problems part. In theconclusion, ideas of the writer on the subject as final remarks are clarified.
Cultural Diversity and the Changing Culture of Education
Nderu-Boddington, Eulalee
2008-01-01
The paper will examine the change in schools brought about by cultural diversity and examines the theories that surround the topic. I will evaluate and examine ways in which schools can accommodate cultural diversity. References will be made to cultural and social changes in our schools and how education is affected by such changes. The issue of…
DEFF Research Database (Denmark)
Michelsen, Anders Ib
INTRODUCTION The present publication deals with issues of imagination and creativity as a notion, philosophy – and social and cultural form, with point of departure in current debates on visual culture. Whereas these debates cover a large ground, spanning from media studies over design to cultural...... studies, they seldom reflect on the basic fact that visual culture in its present form indicates a huge collective creativity in some capacity, implicating the entire postwar era. From early focuses on the possible social and cultural roles of the image in the 1950s and 60s - e.g. in work of Roland...... and cognitive science. Thus visual culture points to an interesting inroad to - and a possible novel focus on - the image - pictorial representation - as an issue of cultural creativity. For one thing the current interest in visual culture goes along with a surge in concrete interest in culture and creativity...
International Nuclear Information System (INIS)
Keen, L.J.
2003-01-01
Safety culture has become a topic of increasing interest for industry and regulators as issues are raised on safety problems around the world. The keys to safety culture are organizational effectiveness, effective communications, organizational learning, and a culture that encourages the identification and resolution of safety issues. The necessity of a strong safety culture places an onus on all of us to continually question whether the safety measures already in place are sufficient, and are being applied. (author)
Development of safety culture - A Chinese traditional cultural perspective
International Nuclear Information System (INIS)
Zhou Weihong . E-mail zhouwh@lanps.com
2002-01-01
Living in a social community, the culture of an enterprise is certainly under the influence of that society. Safety culture of nuclear utilities is the core of the enterprise culture. As a formal expression as defined in INSAG 3 and 4 by IAEA, it as a matter of fact originated from the summing up of the experiences of western nuclear industry, particularly after such epoch-making accidents of Three Miles Island and Chernobyl. In view of the geographical culture theory, whether or not this conception of western industrial culture will be absorbed and assimilated by Chinese Nuclear Industry is a challenging issue. This is because, on the one hand, Nuclear Power is comparatively speaking a newly developing industry in China and, on the other hand, China has enjoyed an uninterrupted history of traditional culture over five thousand years. In other words, whether the new and alien values will conflict with or be constructively assimilated by our traditional mindset is a critical question to be answered in any development program of safety culture. (author)
Directory of Open Access Journals (Sweden)
Dana POP
2016-07-01
Full Text Available In this paper we will try to analyse the cultural tourism. We will start by referring to the complex concepts of tourism and culture and to the synergies existing between them. We will define cultural tourism and present its appearance and evolution as well as its importance as a modern form of tourism. We will present the various types of cultural tourism with their characteristics and the specific features of cultural tourists according to their interests. We will also mention that there are advantages and disadvantages for any kind of tourism depending on the position – local communities, companies or tourists. For the future we will refer to the new partnership between UNWTO and UNESCO.
Cultural humility: measuring openness to culturally diverse clients.
Hook, Joshua N; Davis, Don E; Owen, Jesse; Worthington, Everett L; Utsey, Shawn O
2013-07-01
Building on recent theory stressing multicultural orientation, as well as the development of virtues and dispositions associated with multicultural values, we introduce the construct of cultural humility, defined as having an interpersonal stance that is other-oriented rather than self-focused, characterized by respect and lack of superiority toward an individual's cultural background and experience. In 4 studies, we provide evidence for the estimated reliability and construct validity of a client-rated measure of a therapist's cultural humility, and we demonstrate that client perceptions of their therapist's cultural humility are positively associated with developing a strong working alliance. Furthermore, client perceptions of their therapist's cultural humility were positively associated with improvement in therapy, and this relationship was mediated by a strong working alliance. We consider implications for research, practice, and training. PsycINFO Database Record (c) 2013 APA, all rights reserved.
National Culture Influence over the Organizational Culture in Romania
Carataº Maria Alina; Spãtariu Elena Cerasela
2012-01-01
The present paper aims highlighting the characteristics of the organisational culture concept in Romania. In the first part of the paper, we have presented the importance of organizational culture theory through a literature review; we described the factors that have an impact on it. In the second part, we developed ideas about the national culture of Romania, the national frame and how this affects the organizational culture, and we presented its peculiarities.
Pieter van Nispen tot Pannerden
2011-01-01
The article indicates how companies may prepare for and deal with cultural differences. Because the research base is still rather limited an overall perspective may not be realised. After discussing definitions and concepts of culture, as well as values, cultural differences between states are
Churnalism, Cultural (Inter)mediation and Sourcing in Cultural Journalism
DEFF Research Database (Denmark)
Kristensen, Nete Nørgaard
2017-01-01
Taking a point of departure in theories about cultural (inter)mediation, this article provides a theoretical framework for explaining the pervasion of churnalism within the specialised beat of cultural journalism. Compared to other types of journalists, cultural journalists are “journalists...
Working with culture: culturally appropriate mental health care for Asian Americans.
Park, Mijung; Chesla, Catherine A; Rehm, Roberta S; Chun, Kevin M
2011-11-01
The aim of this study is to describe how mental healthcare providers adapted their practice to meet the unique needs of Asian Americans. As the number of ethnic minorities and multicultural patients and families rapidly increases, cultural competency becomes an essential skill for all healthcare providers. The lack of knowledge about how healthcare providers grapple with diverse cultures and cultural competency limits the ability of others to deliver patient-centred care across cultural lines. Interpretive phenomenology guided the design and conduct of this study. Twenty mental healthcare providers who treated Asian Americans were recruited. Narrative data were collected through face-to-face, in-depth interviews between 2006 and 2007. Three characteristics of culturally appropriate care for Asian Americans were identified. Cultural brokering: providers addressed issues stemming from cultural differences via bicultural skills education. Asian American patients generally received broader education than current literature recommended. Supporting families in transition: providers assisted Asian American families during transition from and to professional care. Using cultural knowledge to enhance competent care: providers' knowledge of Asian culture and flexible attitudes affected the care that they provided. Culturally competent providers were able to identify cultural issues that were relevant to the specific situation, and incorporated cultural solutions into the care provided. Culturally appropriate care is nuanced and context specific. Thus, more sophisticated and broader conceptualizations are necessary to prepare nurses for such complex practice. © 2011 Blackwell Publishing Ltd.
Barron, Daniel D.
1993-01-01
Discusses the lack of literature relating to cultural differences and school library media programs and reviews the book "Beyond Culture" by Edward T. Hall. Highlights include the population/environment crisis, cultural literacy, the use of technology, and Marshall McLuhan's idea of the global village. (LRW)
DEFF Research Database (Denmark)
Grodal, Torben Kragh
2007-01-01
The article argues on the basis of analyses of successful films for children that not only cultural determinants but also innate determinats are important, and that film studies should combine cultural studies with cognitive theory, evolutionary theory and neuroscience, an approach that is called...... Bio-culturalism....
Perceived cultural importance and actual self-importance of values in cultural identification.
Wan, Ching; Chiu, Chi-yue; Tam, Kim-pong; Lee, Sau-lai; Lau, Ivy Yee-man; Peng, Siqing
2007-02-01
Cross-cultural psychologists assume that core cultural values define to a large extent what a culture is. Typically, core values are identified through an actual self-importance approach, in which core values are those that members of the culture as a group strongly endorse. In this article, the authors propose a perceived cultural importance approach to identifying core values, in which core values are values that members of the culture as a group generally believe to be important in the culture. In 5 studies, the authors examine the utility of the perceived cultural importance approach. Results consistently showed that, compared with values of high actual self-importance, values of high perceived cultural importance play a more important role in cultural identification. These findings have important implications for conceptualizing and measuring cultures. ((c) 2007 APA, all rights reserved).
Culture-sensitive psychotraumatology
Schnyder, Ulrich; Bryant, Richard A.; Ehlers, Anke; Foa, Edna B.; Hasan, Aram; Mwiti, Gladys; Kristensen, Christian H.; Neuner, Frank; Oe, Misari; Yule, William
2016-01-01
Background Although there is some evidence of the posttraumatic stress disorder (PTSD) construct's cross cultural validity, trauma-related disorders may vary across cultures, and the same may be true for treatments that address such conditions. Experienced therapists tailor psychotherapy to each patient's particular situation, to the nature of the patient's psychopathology, to the stage of therapy, and so on. In addition, culture-sensitive psychotherapists try to understand how culture enhances the meaning of their patient's life history, the cultural components of their illness and help-seeking behaviors, as well as their expectations with regard to treatment. We cannot take for granted that all treatment-seeking trauma survivors speak our language or share our cultural values. Therefore, we need to increase our cultural competencies. Methods The authors of this article are clinicians and/or researchers from across the globe, working with trauma survivors in various settings. Each author focused on one or more specific cultural aspects of working with trauma survivors and highlighted the following aspects. Results As a result of culture-specific individual and collective meanings linked to trauma and trauma-related disorders survivors may be exposed to (self-)stigma in the aftermath of trauma. Patients who are reluctant to talk about their traumatic experiences may instead be willing to write or use other ways of accessing the painful memories such as drawing. In other cultures, community and family cohesion are crucial elements of recovery. While awareness of culture-specific aspects is important, we also need to beware of premature cultural stereotyping. When disseminating empirically supported psychotherapies for PTSD across cultures, a number of additional challenges need to be taken into account: many low and middle income countries have very limited resources available and suffer from a poor health infrastructure. Conclusions In summary, culture
Creating a Culture by Governance: Issues in Managing Culture
Directory of Open Access Journals (Sweden)
Ma. Victoria T. Herrera
2001-12-01
Full Text Available The management of culture involves a network of agencies, institutions and entities both from the public and private sectors. This is part of a collective process by which objects acwuire cultural significance. We create images of our nations, tell stories, and construct experiences for other people through exhibitions, festivals and other cultural activities. Our role is never neutral and it is important to recognize this power and the implications of our actions.In the Philippines, government has taken an active role in the production and management of culture. In spite of the relatively small percentage of funding spent on culture and the arts, it has extended support through various institutions and agencies that, at present, comprise a complex network. Through their respective programs, government has defined paths of cultural production-- from the larger policy framework for organizations to specific commemorative programs. Given this range of involvement, how has the state empowered people and organizations shape culture? What strategies has it taken to extend to support the production and distribution of culture?This paper focuses on two case studies that represent strategies the state has taken in cultural management. At a macro level, the changes the Cultural Center of the Philippines underwent reflect shifting policies and priorities. As products of changing political administrations, this institution went through a re-orientation of its mission. This came with an abrupt expansion in scale but without the necessary resources to support the CCP's new programs. At a micro level, the second evaluates the refurbished Rizal Shrine, Fort Santiago, one of the major projects of the now defunct National Centennial Commission. This underscores the need for a more transparent decision-making process, prioritizing the interest of the museum's public and not just that of the specialists who control the production of knowledge.
Culture of health of a person as a part of physical culture
A.P. Khalajtsan
2014-01-01
Purpose: to determine the general concepts of the theory and methods of physical education. On the basis of their form defining the components of physical culture and personality reflect the place of culture health of individuals among these components. Material: processed more than 40 references. Results: a definition of generalizing concepts of "culture", "health", "physical culture", "culture of health" formulated defining components of physical culture personality: health culture personal...
Directory of Open Access Journals (Sweden)
Mohammad Reza Dehshiri
2010-01-01
Full Text Available First of all, the present study would explain 6-layer dimensions of culture –including beliefs, values, and norms (as the core of culture, and symbols, rituals, and customs, technologies, skills, and innovations (as the culture surface. Then, applying communication theories besides exploring the concept of “culture-building” involving culture-admission (affecting both core and surface of culture and culture-orientation (affecting culture’s surface; it would analyze the cultural affects media has in thoughts, normalizing, symbolizing, socialization, modeling, and innovation. The assessed hypothesis emphasizes that in the core of culture, media play an educational and stabilizing role in culture-admission process, while in the surface of culture –the culture-orientation process- they could transform behaviors and social models.
DEFF Research Database (Denmark)
Koda, Tomoko; Ishida, Toru; Rehm, Matthias
2009-01-01
and Western designers. The goals of the study were: (1) to investigate cultural differences in avatar expression evaluation and apply findings from psychological studies of human facial expression recognition, (2) to identify expressions and design features that cause cultural differences in avatar facial...... expression interpretation. The results of our study confirmed that (1) there are cultural differences in interpreting avatars’ facial expressions, and the psychological theory that suggests physical proximity affects facial expression recognition accuracy is also applicable to avatar facial expressions, (2......Avatars are increasingly used to express our emotions in our online communications. Such avatars are used based on the assumption that avatar expressions are interpreted universally among all cultures. This paper investigated cross-cultural evaluations of avatar expressions designed by Japanese...
“What Cultural Policies?” Explicit and Implicit Cultural Policies in Lebanon
Directory of Open Access Journals (Sweden)
Nadia von Maltzahn
2017-01-01
Full Text Available Cultural policies define a vision for culture, and provide frameworks for institutional practice to translate this vision on the ground. A 1981 study on Lebanese cultural policy reached the conclusion that one cannot speak of cultural policies in Lebanon if one refers to state laws, regulations and plans. However, if cultural policy was understood as the method of a state to give its citizens the space to develop themselves in a way that they could create culture, one could certainly speak of cultural policies in Lebanon (Abou Rizk. In cultural policy research, there is a distinction between explicit and implicit cultural policy (Ahearne. In this article, the concept of explicit and implicit cultural policy is applied to the case of Lebanon. The two terms are extended so that the former does not only include cultural policies designatedas such by the state, but also those created by civil society actors, and that the latter does not only include political strategies, but also practices that in the end determine cultural policies. Drawing on empirical research conducted in the context of a larger study on the role of cultural institutions in the public sphere, the power struggles between different actors involved in cultural policy making cultural policy defined in the Lebanese context, which in turn will be positioned within the regional context.
The outcome of infected total knee arthroplasty: culture-positive versus culture-negative.
Kim, Young-Hoo; Park, Jang-Won; Kim, Jun-Shik; Kim, Dong-Jin
2015-10-01
We studied the outcome in culture-positive and culture-negative infected total knee arthroplasty (TKA). We retrospectively reviewed 140 patients with culture-positive and 102 patients with culture-negative infected TKAs. We determined the infection control rate and clinical outcome after repeated debridement, and repeated 2-stage TKA in the culture-positive and culture-negative groups. The mean follow-up was 9.3 years (range 5-14 years) in the culture-positive group and 10.6 years (5-22) in the culture-negative group. The overall infection control rate was 56 % in both groups after the first treatment. The overall infection control rate was 90 % in the culture-positive group and 95 % in the culture-negative group. A functional knee was obtained in 90 % in the culture-positive group and 95 % in the culture-negative group. The data suggest that treatment according to the types of infection in both culture-positive and culture-negative groups after TKA controlled infection and maintained functional TKA with a firm level of fixation for most patients. Repeated debridement and repeated two-stage exchange TKA further improved infection control rates after the initial treatment and increased the likelihood of maintaining a functional TKA.
Culture-sensitive psychotraumatology
Directory of Open Access Journals (Sweden)
Ulrich Schnyder
2016-07-01
Full Text Available Background: Although there is some evidence of the posttraumatic stress disorder (PTSD construct's cross cultural validity, trauma-related disorders may vary across cultures, and the same may be true for treatments that address such conditions. Experienced therapists tailor psychotherapy to each patient's particular situation, to the nature of the patient's psychopathology, to the stage of therapy, and so on. In addition, culture-sensitive psychotherapists try to understand how culture enhances the meaning of their patient's life history, the cultural components of their illness and help-seeking behaviors, as well as their expectations with regard to treatment. We cannot take for granted that all treatment-seeking trauma survivors speak our language or share our cultural values. Therefore, we need to increase our cultural competencies. Methods: The authors of this article are clinicians and/or researchers from across the globe, working with trauma survivors in various settings. Each author focused on one or more specific cultural aspects of working with trauma survivors and highlighted the following aspects. Results: As a result of culture-specific individual and collective meanings linked to trauma and trauma-related disorders survivors may be exposed to (self-stigma in the aftermath of trauma. Patients who are reluctant to talk about their traumatic experiences may instead be willing to write or use other ways of accessing the painful memories such as drawing. In other cultures, community and family cohesion are crucial elements of recovery. While awareness of culture-specific aspects is important, we also need to beware of premature cultural stereotyping. When disseminating empirically supported psychotherapies for PTSD across cultures, a number of additional challenges need to be taken into account: many low and middle income countries have very limited resources available and suffer from a poor health infrastructure. Conclusions: In summary
Exploring Culture : Exercises, Stories and Synthetic Cultures
Hofstede, G.J.
2002-01-01
A unique training book containing over 100 culture awareness exercises, dialogues, stories incidents and simulations that bring to life Geert Hofstede's five dimensions of culture. These dimensions are: power distance, collectivism versus individualism, femininity versus masculinity, uncertainly
Laboratory Workflow Analysis of Culture of Periprosthetic Tissues in Blood Culture Bottles.
Peel, Trisha N; Sedarski, John A; Dylla, Brenda L; Shannon, Samantha K; Amirahmadi, Fazlollaah; Hughes, John G; Cheng, Allen C; Patel, Robin
2017-09-01
Culture of periprosthetic tissue specimens in blood culture bottles is more sensitive than conventional techniques, but the impact on laboratory workflow has yet to be addressed. Herein, we examined the impact of culture of periprosthetic tissues in blood culture bottles on laboratory workflow and cost. The workflow was process mapped, decision tree models were constructed using probabilities of positive and negative cultures drawn from our published study (T. N. Peel, B. L. Dylla, J. G. Hughes, D. T. Lynch, K. E. Greenwood-Quaintance, A. C. Cheng, J. N. Mandrekar, and R. Patel, mBio 7:e01776-15, 2016, https://doi.org/10.1128/mBio.01776-15), and the processing times and resource costs from the laboratory staff time viewpoint were used to compare periprosthetic tissues culture processes using conventional techniques with culture in blood culture bottles. Sensitivity analysis was performed using various rates of positive cultures. Annualized labor savings were estimated based on salary costs from the U.S. Labor Bureau for Laboratory staff. The model demonstrated a 60.1% reduction in mean total staff time with the adoption of tissue inoculation into blood culture bottles compared to conventional techniques (mean ± standard deviation, 30.7 ± 27.6 versus 77.0 ± 35.3 h per month, respectively; P < 0.001). The estimated annualized labor cost savings of culture using blood culture bottles was $10,876.83 (±$337.16). Sensitivity analysis was performed using various rates of culture positivity (5 to 50%). Culture in blood culture bottles was cost-effective, based on the estimated labor cost savings of $2,132.71 for each percent increase in test accuracy. In conclusion, culture of periprosthetic tissue in blood culture bottles is not only more accurate than but is also cost-saving compared to conventional culture methods. Copyright © 2017 American Society for Microbiology.
The Reaffirmation of Cultural Identity in Cross-cultural Encounters.
Kosmitzki, Corinne
1996-01-01
Examines the relationship between cultural contact and cultural identity as conceptualized in two research approaches: social identity theory and acculturation. The groups studied were German and Americans who either lived in their nonnative culture or had no direct contact. Comparisons between bicultural and monocultural groups revealed a…
Blockbusters as vehicles for cultural debate in cultural journalism
DEFF Research Database (Denmark)
From, Unni; Kristensen, Nete Nørgaard
2014-01-01
Taking our point of departure in ‘the cultural intermediary’ as theoretical concept (Bourdieu, 1984; Maguire and Matthews, 2012) and in the coverage of blockbuster movies on Danish cultural pages from 1960 to 2012, this paper analyses the changing role of the cultural journalist and the changing ...
DEFF Research Database (Denmark)
What do Mesoamerica, Greece, Byzantium, Island, Chad, Ethiopia, India, Tibet, China and Japan have in common? Like many other cultures of the world, they share a particular form of cultural heritage: ancient handwritten documents. In 2007, scholars from some20 countries around the world gathered...... at the University of Copenhagen for a workshop on manuscripts to compare notes. This event led to the publication of this volume, which brings together16 articles on philological, cultural, and material aspects of manuscripts in search for a common ground across disciplines and cultures....
Urban Cultural Heritage Endangerment: Degradation of historico-cultural landscapes
Vaz, Eric; Cabral, Pedro; Caetano, Mário; Painho, Marco; Nijkamp, Peter
2010-05-01
Sustainable development has become one of the great debates of policy-making of the XXI century. The world, is facing unprecedented change following the anthropocentrism of socio-economic growth. However, the commitment of man to ‘transmit to future generations at least the same as had' (ref) seems to be a narrowing, given extensive urban growth, population increase and climate change. However, over the last twenty years, the usage of spatial information systems have brought a positive contribution for better acknowledging the problem of environmental change, and bringing more constructive approaches to planning. Prompted by much research interest in Europe, a broad specter of biodiversity loss models, pollution and environmental degradation algorithms as well as climate change models, have become important tools under the European umbrella. Recognizing the essence of sustainable development, historico-cultural and archaeological regions have a remarkable role in the transformation of landscapes and maintenance of cultural and regional identity. Furthermore, the socio-economic, political-geographic and cultural-scientific history of the dynamics of places and localities on our earth is reflected in their historico-cultural heritage. This patrimony comprises cultural assets, such as old churches, palaces, museums, urban parks, historical architecture of cities, or landscapes of historical interest. Historico-cultural heritage also includes archaeological sites, which sometimes not only have a local value but may have a worldwide significance (e.g. Pompeii). However, massive urban growth is affecting directly the existing historico-cultural resources throughout the European region, and little attention is given to this juxtaposing reality of peri-urban growth and cultural / archaeological heritage preservation. Also, the settling patterns within historico-cultural local clusters follow a similar pattern as current growth tendencies, given the physical conditions of
Cultural diversity for virtual characters investigating behavioral aspects across cultures
Endrass, Birgit
2014-01-01
Culture plays a crucial role in our lives. Depending on our cultural background, we judge on and react to everything that we encounter. Subtle differences in behavior can lead to misunderstandings or even culture shock. In a similar manner, virtual characters can be declined by certain user groups when showing culturally inappropriate behavior. But how can social aspects such as culture be integrated into the behavioral models of virtual characters Birgit Endrass addresses this question by carrying out a hybrid approach that is based on theoretical background from the social sciences as well a
Developing cultural sensitivity
DEFF Research Database (Denmark)
Ruddock, Heidi; Turner, deSalle
2007-01-01
. Background. Many countries are becoming culturally diverse, but healthcare systems and nursing education often remain mono-cultural and focused on the norms and needs of the majority culture. To meet the needs of all members of multicultural societies, nurses need to develop cultural sensitivity......Title. Developing cultural sensitivity: nursing students’ experiences of a study abroad programme Aim. This paper is a report of a study to explore whether having an international learning experience as part of a nursing education programme promoted cultural sensitivity in nursing students...... and incorporate this into caregiving. Method. A Gadamerian hermeneutic phenomenological approach was adopted. Data were collected in 2004 by using in-depth conversational interviews and analysed using the Turner method. Findings. Developing cultural sensitivity involves a complex interplay between becoming...
Tomiyama, AJ; Mann, T
2008-01-01
The authors evaluated the validity of familial enmeshment (extreme proximity in family relationships) as a risk factor for eating disorders across cultural value orientations. They tested the hypothesis that although familial enmeshment may be a risk factor for eating disorder pathology for (1) participants of non-Asian descent or (2) culturally independent participants, enmeshment will not be a risk factor for (1) participants of Asian descent or (2) culturally interdependent participants. P...
Templates for Cross-Cultural and Culturally Specific Usability Testing
DEFF Research Database (Denmark)
Clemmensen, Torkil
2011-01-01
The cultural diversity of users of technology challenges our methods for usability testing. This article suggests templates for cross-culturally and culturally specific usability testing, based on studies of usability testing in companies in Mumbai, Beijing, and Copenhagen. Study 1 was a cross...... tests. The result was the construction of templates for usability testing. The culturally specific templates were in Mumbai “user-centered evaluation,” Copenhagen “client-centered evaluation,” and Beijing “evaluator-centered evaluation.” The findings are compared with related research...
Understanding Culture: A Literature Review Comparing Three Cultural Pedagogies
Tabitha Kidwell
2017-01-01
Culture is an integral part of language study, but the field has yet to put forward a coherent theoretical argument for how culture can or should be incorporated in language education. In an effort to remedy this situation, this paper reviews literature on the teaching of culture, drawing on Larzén’s (2005) identification of three pedagogies used to teach about culture within the language classroom: through a pedagogy of information, a pedagogy of preparation, and a pedagogy of encounter. ...
Grist and mills: on the cultural origins of cultural learning
Heyes, Cecilia
2012-01-01
Cumulative cultural evolution is what ‘makes us odd’; our capacity to learn facts and techniques from others, and to refine them over generations, plays a major role in making human minds and lives radically different from those of other animals. In this article, I discuss cognitive processes that are known collectively as ‘cultural learning’ because they enable cumulative cultural evolution. These cognitive processes include reading, social learning, imitation, teaching, social motivation and theory of mind. Taking the first of these three types of cultural learning as examples, I ask whether and to what extent these cognitive processes have been adapted genetically or culturally to enable cumulative cultural evolution. I find that recent empirical work in comparative psychology, developmental psychology and cognitive neuroscience provides surprisingly little evidence of genetic adaptation, and ample evidence of cultural adaptation. This raises the possibility that it is not only ‘grist’ but also ‘mills’ that are culturally inherited; through social interaction in the course of development, we not only acquire facts about the world and how to deal with it (grist), we also build the cognitive processes that make ‘fact inheritance’ possible (mills). PMID:22734061
Farmanyan, S. V.; Mickaelian, A. M.
2015-07-01
Cultural Astronomy is the reflection of sky events in various fields of nations' culture. In foreign literature this field is also called "Astronomy in Culture" or "Astronomy and Culture". Cultural astronomy is the set of interdisciplinary fields studying the astronomical systems of current or ancient societies and cultures. It is manifested in Religion, Mythology, Folklore, Poetry, Art, Linguistics and other fields. In recent years, considerable attention has been paid to this sphere, particularly international organizations were established, conferences are held and journals are published. Armenia is also rich in cultural astronomy. The present paper focuses on Armenian archaeoastronomy and cultural astronomy, including many creations related to astronomical knowledge; calendars, rock art, mythology, etc. On the other hand, this subject is rather poorly developed in Armenia; there are only individual studies on various related issues (especially many studies related to Anania Shirakatsi) but not coordinated actions to manage this important field of investigation.
Teaching Culture Perception: Documenting and Transforming Institutional Teaching Cultures
Kustra, Erika; Doci, Florida; Gillard, Kaitlyn; Hondzel, Catharine Dishke; Goff, Lori; Gabay, Danielle; Meadows, Ken N.; Borin, Paola; Wolf, Peter; Ellis, Donna; Eiliat, Hoda; Grose, Jill; Dawson, Debra L.; Hughes, Sandy
2015-01-01
An institutional culture that values teaching is likely to lead to improved student learning. The main focus of this study was to determine faculty, graduate and undergraduate students' perception of the teaching culture at their institution and identify indicators of that teaching culture. Themes included support for teaching development; support…
The impact of indigenous cultural identity and cultural engagement on violent offending.
Shepherd, Stephane M; Delgado, Rosa Hazel; Sherwood, Juanita; Paradies, Yin
2017-07-24
Possessing a strong cultural identity has been shown to protect against mental health symptoms and buffer distress prompted by discrimination. However, no research to date has explored the protective influences of cultural identity and cultural engagement on violent offending. This paper investigates the relationships between cultural identity/engagement and violent recidivism for a cohort of Australian Indigenous people in custody. A total of 122 adults from 11 prisons in the state of Victoria completed a semi-structured interview comprising cultural identification and cultural engagement material in custody. All official police charges for violent offences were obtained for participants who were released from custody into the community over a period of 2 years. No meaningful relationship between cultural identity and violent recidivism was identified. However a significant association between cultural engagement and violent recidivism was obtained. Further analyses demonstrated that this relationship was significant only for participants with a strong Indigenous cultural identity. Participants with higher levels of cultural engagement took longer to violently re-offend although this association did not reach significance. For Australian Indigenous people in custody, 'cultural engagement' was significantly associated with non-recidivism. The observed protective impact of cultural engagement is a novel finding in a correctional context. Whereas identity alone did not buffer recidivism directly, it may have had an indirect influence given its relationship with cultural engagement. The findings of the study emphasize the importance of culture for Indigenous people in custody and a greater need for correctional institutions to accommodate Indigenous cultural considerations.
The impact of indigenous cultural identity and cultural engagement on violent offending
Directory of Open Access Journals (Sweden)
Stephane M. Shepherd
2017-07-01
Full Text Available Abstract Background Possessing a strong cultural identity has been shown to protect against mental health symptoms and buffer distress prompted by discrimination. However, no research to date has explored the protective influences of cultural identity and cultural engagement on violent offending. This paper investigates the relationships between cultural identity/engagement and violent recidivism for a cohort of Australian Indigenous people in custody. Methods A total of 122 adults from 11 prisons in the state of Victoria completed a semi-structured interview comprising cultural identification and cultural engagement material in custody. All official police charges for violent offences were obtained for participants who were released from custody into the community over a period of 2 years. Results No meaningful relationship between cultural identity and violent recidivism was identified. However a significant association between cultural engagement and violent recidivism was obtained. Further analyses demonstrated that this relationship was significant only for participants with a strong Indigenous cultural identity. Participants with higher levels of cultural engagement took longer to violently re-offend although this association did not reach significance. Conclusions For Australian Indigenous people in custody, ‘cultural engagement’ was significantly associated with non-recidivism. The observed protective impact of cultural engagement is a novel finding in a correctional context. Whereas identity alone did not buffer recidivism directly, it may have had an indirect influence given its relationship with cultural engagement. The findings of the study emphasize the importance of culture for Indigenous people in custody and a greater need for correctional institutions to accommodate Indigenous cultural considerations.
Fox, Lisette
1999-01-01
Examines aspects of cross-cultural studies, delineates a concept of culture, explores the interplay of culture and ethics, and analyzes the shifting cultural and economic values as issues that either the economists or the humanists will deal with under the banner of the future global village. (Author/VWL)
Intersubjective Culture: The Role of Intersubjective Perceptions in Cross-Cultural Research.
Chiu, Chi-Yue; Gelfand, Michele J; Yamagishi, Toshio; Shteynberg, Garriy; Wan, Ching
2010-07-01
Intersubjective perceptions refer to shared perceptions of the psychological characteristics that are widespread within a culture. In this article, we propose the intersubjective approach as a new approach to understanding the role that culture plays in human behavior. In this approach, intersubjective perceptions, which are distinct from personal values and beliefs, mediate the effect of the ecology on individuals' responses and adaptations. We review evidence that attests to the validity and utility of the intersubjective approach in explicating culture's influence on human behaviors and discuss the implications of this approach for understanding the interaction between the individual, ecology, and culture; the nature of cultural competence; management of multicultural identities; cultural change; and measurement of culture. © The Author(s) 2010.
Brantefors, Lotta
2015-01-01
The aim here is to describe and discuss how different cultural meanings, offered in education, can contribute to unjust cultural relations such as othering and xenophobia. By analysing the cultural and discursive content in curricula using a (neo)pragmatic curriculum theory research method, dominating ideas, values and discourses between 1948 and…
Porter, David
2013-01-01
The internet has recently grown from a fringe cultural phenomenon to a significant site of cultural production and transformation. Internet Culture maps this new domain of language, politics and identity, locating it within the histories of communication and the public sphere. Internet Culture offers a critical interrogation of the sustaining myths of the virtual world and of the implications of the current mass migration onto the electronic frontier. Among the topics discussed in Internet Culture are the virtual spaces and places created by the citizens of the Net and their claims to the hotly contested notion of "virtual community"; the virtual bodies that occupy such spaces; and the desires that animate these bodies. The contributors also examine the communication medium behind theworlds of the Net, analyzing the rhetorical conventions governing online discussion, literary antecedents,and potential pedagogical applications.
Culture and Local Development: the Interaction of Cultural Heritage and Creative Industries
Directory of Open Access Journals (Sweden)
Valery Gordin
2011-10-01
Full Text Available The aim of the study is to examine the various forms of interaction between cultural heritage and creative industries to support the development of various types of cultural clusters in St. Petersburg. The study was based on a model, which provides several types of partnership cultural heritage (CH could have with the creative industries (CI: CH as a “decoration” for the CI, as “content”, as a “brand”, as the creator of the needs. Authors’ classification of cultural clusters in St. Petersburg is described, including clusters of cultural heritage, ethnic cultural clusters, the mass-cultural (consumer-oriented cultural clusters, art - incubators. One of the main findings is the low willingness of many public cultural institutions to have any form of interaction with the creative industries. The second group of findings concerned the ability to attract creative industries to provide services for residents of St. Petersburg in cooperation with public institutions of culture.
Culture, Cross-Role Consistency, and Adjustment: Testing Trait and Cultural Psychology Perspectives
Church, A. Timothy; Anderson-Harumi, Cheryl A.; del Prado, Alicia M.; Curtis, Guy J.; Tanaka-Matsumi, Junko; Valdez Medina, José L.; Mastor, Khairul A.; White, Fiona A.; Miramontes, Lilia A.; Katigbak, Marcia S.
2008-01-01
Trait and cultural psychology perspectives on cross-role consistency and its relation to adjustment were examined in two individualistic cultures, the United States (N = 231) and Australia (N = 195), and four collectivistic cultures, Mexico (N = 199), Philippines (N = 195), Malaysia (N = 217), and Japan (N = 180). Cross-role consistency in trait ratings was evident in all cultures, supporting trait perspectives. Cultural comparisons of mean consistency provided support for cultural psychology...
Directory of Open Access Journals (Sweden)
E. V. Sukharenko
2017-05-01
Full Text Available Processed by-products of oil are the most common pollutants in all river and sea water. The increase in oxidative stress in bivalve molluscs was studied in both tissues of the hepatopancreas and the gill. The model for artificial treatment with processed by-products of oil was performed in a laboratory experiment with the river mollusc Dreissena polymorpha Pallas, 1771. The exposure of the molluscs over 28 days to mazut 50 mg/l induced significant increase of both final product of lipid peroxidation (LPO and antioxidant enzime activity. A significant increase in LPO was observed in the hepatopancreas and gill of D. polymorpha treated with mazut compared to the control group. Antioxidant enzyme activity of cartalase, supeoxide dismutase, glutathione reductase and glutathione-S-transferase showed a greater increase (by almost 1.5 times in the hepatopancreas than in the gill of D. polymorpha. A similar LPO growth and modulation of antioxidant enzyme activity were determined in the hepatopancreas and gill of the mussel Mytilus galloprovincialis Lamarck, 1879 collected in an area polluted with resins, hydrocarbons and asphaltenes, Donuzlav lake in the Kerch gulf. Varied cellular reactivation of the antioxidant enzyme system in the hepatopancreas rather than the gill was observed in both kinds of mollusc Dreissena and Mytilus. The obtained results are evidence of the higher sensitivity of the hepatopancreas cells of bivalve molluscs to organic pollutants compared to the gill cells.
Cultural influences on personality.
Triandis, Harry C; Suh, Eunkook M
2002-01-01
Ecologies shape cultures; cultures influence the development of personalities. There are both universal and culture-specific aspects of variation in personality. Some culture-specific aspects correspond to cultural syndromes such as complexity, tightness, individualism, and collectivism. A large body of literature suggests that the Big Five personality factors emerge in various cultures. However, caution is required in arguing for such universality, because most studies have not included emic (culture-specific) traits and have not studied samples that are extremely different in culture from Western samples.
Cultural Capital in Context: Heterogeneous Returns to Cultural Capital Across Schooling Environments
DEFF Research Database (Denmark)
Andersen, Ida Gran; Jæger, Mads Meier
2015-01-01
This paper tests two competing explanations of differences in returns to cultural capital across schooling environments: Cultural reproduction (cultural capital yields a higher returns in high-achieving environments than in low-achieving ones) and cultural mobility (cultural capital yields higher...... returns in low-achieving environments). Using multilevel mixture models, empirical results from analyses based on PISA data from three countries (Canada, Germany, and Sweden) show that returns to cultural capital tend to be higher in low-achieving schooling environments than in high-achieving ones....... These results principally support the cultural mobility explanation and suggest that research should pay explicit attention to the institutional contexts in which cultural capital is converted into educational success....
Cultural Interchangeability? Culture-Specific Items in Translation
Directory of Open Access Journals (Sweden)
Ajtony Zsuzsanna
2016-12-01
Full Text Available This paper summarizes the results of the translation work carried out within an international project aiming to develop the language skills of staff working in hotel and catering services. As the topics touched upon in the English source texts are related to several European cultures, these cultural differences bring about several challenges related to the translation of realia, or culture-specific items (CSIs. In the first part of the paper, a series of translation strategies for rendering source-language CSIs into the target language are enlisted, while the second part presents the main strategies employed in the prepared translations.
DIAGNOSIS OF CULTURAL ORGANIZATIONS
Directory of Open Access Journals (Sweden)
ALBU MĂDĂLINA
2015-04-01
Full Text Available Cultural institution management is to direct the organization to a specific cultural profile purpose, namely production values esthetic sense, artistic, moral, spiritual, distribution, promotion of these values, protection and circulation of cultural heritage. In this regard, an analysis in the diagnosis cultural organizations aims to determine the main strengths and weaknesses, assess the potential and making recommendations focused on the root causes of failures and positive aspects. This paper presents considerations diligence activity Culture House "IL Caragiale "in Ploiesti. The mission of this organization is to contribute to the cultural development of the community by initiating projects and cultural programs, offer development programs and services to meet cultural needs, increase public access to diverse cultural life, providing a constant presence institution circuit local, national, European and international level. Conclusions drawn from the analysis shows that in a world of economic globalization, information and culture in a company in constant change, in a competitive market where there is information readily available means and leisure, but not cultural consistency in a social environment where interest in culture of people is declining, the situation of the population is impaired, the remuneration of staff working in the field of cultural education is demotivating, the funds allocated to culture have grown lately effectively lead a cultural institution is a challenge.
Think Global, Act Local : Cultural Policies of Dundee from World Cultural Perspective
Hietala, Verneri
2017-01-01
Despite growing interest in neo-institutionalism and world culture theory in recent years, few studies have researched urban cultural policies from this perspective. By far the most research on urban cultural policy-making relies on rational choice and structural theoretical perspectives. The purpose of this thesis is to acquire new knowledge on urban cultural policies by examining the main justifications of cultural policies in Dundee from world cultural theoretical perspective. This th...
Energy Technology Data Exchange (ETDEWEB)
Krieg, H.J. [Hydrobiologische Untersuchungen und Gutachten - HUuG, Tangstedt (Germany); Gaumert, T. [comps.] [Wasserguetestelle Elbe, Hamburg (Germany)
1998-04-01
The pollutant burden of the Elbe river can now be assessed more accurately with the aid of a new classification system based on pollutant accumulation in the soft tissue of the zebra mussel (Dreissena polymorpha), which provided the basis for a 7-stage pollution scale for individual substances. This closes a gap in pollution analysis of the Elbe river and makes statements on pollutant levels more efficient. [Deutsch] Die Schadstoffbelastung der Elbe kann mit Hilfe eines neuen und hier erstmalig vorgestellten Klassifizierungssystems besser als bisher bewertet werden. Die Auswertung angereicherter Schadstoffgehalte im Weichkoerper der in den Elbe-Messstationen gehaelterten Dreikantmuschel Dreissena polymorpha fuehrte zur Entwicklung einer siebenstufigen Belastungs-Skala fuer einzelne Substanzen. Mit diesem Verfahren kann somit ein offener Bereich bei der Bewertung der Schadstoffbelastung der Elbe geschlossen und die Gewaesserueberwachung mit einer hoeheren Aussagekraft betrieben werden. (orig.)
Cultural Mega-Events as an International, Cultural, and Political Tool
Directory of Open Access Journals (Sweden)
Julia Nikolaeva
2017-12-01
Full Text Available This article is an attempt to offer a conceptual understanding of various kinds of mega-events and to determine their significance as an instrument of the official international cultural policy. The article examines scientific approaches to understanding and classification of mega-events. The case studies focus on such mega-events as international cross-cultural years and cultural forums. The fact that the official foreign policy of¬ten defines and shapes the goals of mega-events proves their value in establishing and promoting a positive international image of the country. Recent Russian experience in organizing cross-cultural years is examined to discuss positive and negative socio-cultural impact.
DEFF Research Database (Denmark)
Andersen, Ida Gran; Jæger, Mads Meier
This paper analyzes the extent to which the effect of cultural capital on academic achievement varies across high- and low-achieving schooling environments. We distinguish three competing theoretical models: Cultural reproduction (cultural capital yields higher returns in high-achieving schooling...... to be higher in low-achieving schooling environments than in high-achieving ones. These results support the cultural mobility explanation and are in line with previous research suggesting that children from low-SES families benefit more from cultural capital than children from high-SES families....... environments than in low-achieving ones), cultural mobility (cultural capital yields higher returns in low-achieving environments), and cultural resources (cultural capital yields the same returns in different environments). We analyze PISA data from six countries and find that returns to cultural capital tend...
The Concept of Culture and CulturalTransformation: Views of Malik Bennabi
Directory of Open Access Journals (Sweden)
Abdulaziz Berghout
2001-06-01
Full Text Available This article aims at contributing to an integrated understanding of Malik Bennabi's view of culture and cultural transformation. An attempt is made to analyze Bennabi's concepts and ideas that constitute the core of his study of culture and its dynamic civilizing function. The paper introduces Bennabi's understanding of culture as a project with a pivotal educational value. His cultural envisioning shows that ethics, aesthetics, practical reasoning and technical skills form the nucleus of any civilizational change. The paper highlights Bennabi's view that culture is an important social and educational agent of change that can restore the sense of efficacy and creativity to the Islamic society.
Congruence between Culturally Competent Treatment and Cultural Needs of Older Latinos
Costantino, Giuseppe; Malgady, Robert G.; Primavera, Louis H.
2009-01-01
This study investigated a new 2-factor construct, termed "cultural congruence", which is related to cultural competence in the delivery of mental health services to ethnic minority clients. Cultural congruence was defined as the distance between the cultural competence characteristics of the health care organization and the clients' perception of…
Cultural Adaptations: A Complex Interplay between Clinical and Cultural Issues
Hwang, Wei-Chin
2011-01-01
Psychotherapy is a Western method of treating mental illness. Culturally adapting psychotherapy to better meet the needs of ethnic minorities is an important endeavor. Hall et al. (2011) did an excellent job of reviewing the intersection and divergence between Asian culture and mindfulness and acceptance-based therapies. They also point out that some therapies can be naturally syntonic with Asian American cultural values and belief systems. This is especially important given cultural differen...
Andersen, Ida Gran; Jæger, Mads Meier
2015-03-01
This paper tests two competing explanations of differences in returns to cultural capital across schooling environments: Cultural reproduction (cultural capital yields a higher returns in high-achieving environments than in low-achieving ones) and cultural mobility (cultural capital yields higher returns in low-achieving environments). Using multilevel mixture models, empirical results from analyses based on PISA data from three countries (Canada, Germany, and Sweden) show that returns to cultural capital tend to be higher in low-achieving schooling environments than in high-achieving ones. These results principally support the cultural mobility explanation and suggest that research should pay explicit attention to the institutional contexts in which cultural capital is converted into educational success. Copyright © 2014 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Valtysson, Bjarki
of the European Union, and how its cultural policy responds to the changes that the digital paradigm has brought upon the field. The self-publishing features of various Web 2.0 platforms, along with the interactive and distributional potentials that the Internet offers, have given rise to what is referred to here...... in cultural production and consumption. The first part of this works looks at how these changes respond to the field of cultural policy, as well as suggesting a possible culturepolitical reaction in a model which I refer to as access culture. In terms of theoretical approach, the notion of digital cultural...... of YouTube, MySpace, Facebook and Flickr, along with lesser known platforms such as the animated short film Elephants Dream, the BBC's Creative Archive, various Internet artworks and the Internet Archive. I furthermore introduce the copyright system Creative Commons in order to suggest legal, widely...
Cultures of choice: towards a sociology of choice as a cultural phenomenon.
Schwarz, Ori
2017-09-07
The article explores different ways to conceptualize the relationship between choice and culture. These two notions are often constructed as opposites: while sociologies of modernization (such as Giddens') portray a shift from cultural traditions to culturally disembedded choice, dispositional sociologies (such as Bourdieu's) uncover cultural determination as the hidden truth behind apparent choice. However, choice may be real and cultural simultaneously. Culture moulds choice not only by inculcating dispositions or shaping repertoires of alternatives, but also by offering culturally specific choice practices, ways of choosing embedded in meaning, normativity, and materiality; and by shaping attributions of choice in everyday life. By bringing together insights from rival schools, I portray an outline for a comparative cultural sociology of choice, and demonstrate its purchase while discussing the digitalization of choice; and cultural logics that shape choice attribution in ways opposing neoliberal trends. © London School of Economics and Political Science 2017.
Morpho-phenological diversity among natural populations of ...
African Journals Online (AJOL)
sunny t
populations (Badri et al., 2007, 2010; Arraouadi et al.,. 2009; Lazrek et al., 2009) were measured for the lines of. M. polymorpha. ..... an organism (Holderegger et al., 2006). Adaptation .... Mouradov A, Cremer F, Coupland G (2002). Control of ...
“What Cultural Policies?” Explicit and Implicit Cultural Policies in Lebanon
Nadia von Maltzahn
2017-01-01
Cultural policies define a vision for culture, and provide frameworks for institutional practice to translate this vision on the ground. A 1981 study on Lebanese cultural policy reached the conclusion that one cannot speak of cultural policies in Lebanon if one refers to state laws, regulations and plans. However, if cultural policy was understood as the method of a state to give its citizens the space to develop themselves in a way that they could create culture, one could certainly speak of...
Bardi, Anat; Guerra, V. M.
2011-01-01
Three studies establish the relations between cultural values and coping using multicultural samples of international students. Study 1 established the cross-cultural measurement invariance of subscales of the Cope inventory (Carver, Scheier, & Weintraub, 1989) used in the paper. The cultural value dimensions of embeddedness vs. autonomy and hierarchy vs. egalitarianism predicted how international students from 28 (Study 2) and 38 (Study 3) countries coped with adapting to living in a new cou...
Family law and national culture
Arguing against the cultural constraints argument
Directory of Open Access Journals (Sweden)
Masha Antokolskaia
2008-06-01
Full Text Available The ‘cultural constraints argument’, submits that family laws are embedded in unique national cultures, that this cultural and historical diversity is unbridgeable and therefore family laws are not spontaneously converging and cannot be deliberately harmonised. This article argues against the core assumption of the cultural constraints argument – the alleged embedment of family laws in unique and unchangeable national cultures. History shows that in the field of family ideology and law one cannot really talk of unique national cultures, but rather of a pan-European culture, which is not homogeneous but an amalgamation of pan-European ‘conservative’ and pan-European ‘progressive’ cultures. The relative influence of these two opposing family ‘cultures’ varies from country to country and from time to time. Examinations of history of family law suggest that there are the differences in the balance of political power between ‘progressive’ and ‘conservative’ forces, rather than national culture that determines the differences in the pertinent national family laws.
... Alternative Names Culture - CSF; Spinal fluid culture; CSF culture Images Pneumococci organism References Karcher DS, McPherson RA. Cerebrospinal, synovial, serous body fluids, and alternative specimens. In: McPherson RA, Pincus ...
Cultural Saga: Does Pakhtun Culture Impede Women Employment ...
African Journals Online (AJOL)
Cultural Saga: Does Pakhtun Culture Impede Women Employment? ... undue religious injunctions serve as barrier to women paid jobs and women employment. Less number of women to men at household composition with fallacies based on ...
Une maison de culture (A Culture Center).
Mourlevat, Alain
1980-01-01
Describes the "Culture Center" designed by Le Corbusier and located in Firminy, France. The role of the center in arousing intellectual curiosity in people living in a technological age is discussed. The audience of this culture center, young people, and the types of activities directed toward them are described. (AMH)
Efficient Cultures: Exploring the Relationship between Culture and Organizational Performance.
Wilkins, Alan L.; Ouchi, William G.
1983-01-01
Arguing from a transaction costs perspective, this paper contends that local organizational cultures distinct from shared background cultures exist relatively infrequently. The relationship between local organizational culture and organizational efficiency is discussed, and it is concluded that changing organizations are more adaptive than is…
Resolving conflicting safety cultures
International Nuclear Information System (INIS)
Slider, J.E.; Patterson, M.
1993-01-01
Several nuclear power plant sites have been wounded in the crossfire between two distinct corporate cultures. The traditional utility culture lies on one side and that of the nuclear navy on the other. The two corporate cultures lead to different perceptions of open-quotes safety culture.close quotes This clash of safety cultures obscures a very important point about nuclear plant operations: Safety depends on organizational learning. Organizational learning provides the foundation for a perception of safety culture that transcends the conflict between utility and nuclear navy cultures. Corporate culture may be defined as the knowledge, attitudes, and beliefs shared by employees of a given company. Safety culture is the part of corporate culture concerning shared attitudes and beliefs affecting individual or public safety. If the safety culture promotes behaviors that lead to greater safety, employees will tend to open-quotes do the right thingclose quotes even when circumstances and formal guidance alone do not ensure that actions will be correct. Safety culture has become particularly important to nuclear plant owners and regulators as they have sought to establish and maintain a high level of safety in today's plants
Cultural Education and the Voluntary Provision of Cultural Goods: An Experimental Study
Massimo Finocchiaro Castro
2004-01-01
We study the effect that the possibility of investing in cultural education has on the voluntary contributions to a cultural good. This is done in a two-stage public-good experiment. We also provide treatments with different context in order to control for a possible framing effect. Our results show the absence of an effect of cultural education on the contributions to the cultural good and a slight increase in the allocations of subjectsÂendowments to the cultural good when the cultural cont...
Institute of Scientific and Technical Information of China (English)
周志
2016-01-01
Chinese cultural contains a great number of styles;culture differentiation does not depend on region differentiation.This research would interpret what difference between Hong Kong and Shenzhen.1.Food culture in china Traditional Chinese medicine suggests eating local seasonal fruit and vegetables,as they are most suitable for the body during a particular season.It is also divided food into 3 characteristics:cooling foods,warming foods and balance or
Cultural Context and Translation
Institute of Scientific and Technical Information of China (English)
张敏
2009-01-01
cultural context plays an important role in translation. Because translation is a cross-culture activity, the culture context that influ-ences translating is consisted of both the culture contexts of source language and target language. This article firstly analyzes the concept of context and cultural context, then according to the procedure of translating classifies cultural context into two stages and talks about how they respectively influence translating.
Interaction between cultural/creative tourism and tourism/cultural heritage industries
Jurėnienė, Virginija
2016-01-01
The chapter presents a review of the conceptions of cultural and creative tourism, their resources, objectives and their benefit and damage to the nature and the society. It is very important in the postmodern society to not only develop cultural tourism that is one of the most rapidly growing branches of economy, but also to employ cultural heritage and does not always develop the common heritage and tourism industry. This is an especially sore point because the common cultural heritage and ...
Farmer, Jane; Bourke, Lisa; Taylor, Judy; Marley, Julia V; Reid, John; Bracksley, Stacey; Johnson, Nicole
2012-10-01
This paper considers the role of culture in rural health, suggesting that the concept and its impacts are insufficiently understood and studied. It reviews some of the ways that culture has been considered in (rural) health, and states that culture is either used ambiguously and broadly - for example, suggesting that there is a rural culture, or narrowly - indeed perhaps interchangeably with ethnicity, for example Aboriginal culture as a unity. The paper notes that, although culture is a dynamic social concept, it has been adopted into a biomedical research paradigm as though it is fixed. Culture is often treated as though it is something that can be addressed simplistically, for example, through cultural sensitivity education. Authors suggest that culture is an unaddressed 'elephant in the room' in rural health, and that exploring cultural differences and beliefs and facing up to cultural differences are vital in understanding and addressing rural health and health system challenges. © 2012 The Authors. Australian Journal of Rural Health © National Rural Health Alliance Inc.
Characterizing European cultural landscapes
DEFF Research Database (Denmark)
Tieskens, Koen F.; Schulp, Catharina J E; Levers, Christian
2017-01-01
intensification and land abandonment. To prevent the loss of cultural landscapes, knowledge on the location of different types of cultural landscapes is needed. In this paper, we present a characterization of European cultural landscapes based on the prevalence of three key dimensions of cultural landscapes......Almost all rural areas in Europe have been shaped or altered by humans and can be considered cultural landscapes, many of which now are considered to entail valuable cultural heritage. Current dynamics in land management have put cultural landscapes under a huge pressure of agricultural...... the three dimensions into a continuous “cultural landscape index” that allows for a characterization of Europe's rural landscapes. The characterization identifies hotspots of cultural landscapes, where all three dimensions are present, such as in the Mediterranean. On the other hand, Eastern and Northern...
CULTURAL PHENOMENA AND PROCESSES IN CONTEMPORARY SOCIETY – DETERMINANTS OF CULTURAL POLICIES
Directory of Open Access Journals (Sweden)
ANDREEA MIHAELA NITA
2012-05-01
Full Text Available Cultural phenomena and processes in the contemporary society, influenced by the social development models and by the fact that the constitutive elements of the culture have become the decisive factors of social change, are the determinants of the cultural policies. They are centered on the active process of cultural globalization that emphasizes besides the assimilation of the European principles, also the preservation of the cultural dialog without identity loss. Contemporary culture cannot be appreciated unless we know the main processes and phenomena that lately have generated impressive changes in the area of technology and means of communication. Due to these transformations we witness a change of the cultural paradigms, a mutation of values.
DEFF Research Database (Denmark)
Bülow, Anne Marie; Kumar, Rajesh
2011-01-01
The literature on cross-cultural negotiation has expanded considerably over the past few decades, but the findings are often ambiguous and sometimes even contradictory. This introduction highlights the critical areas where objections are commonly raised about the relevance of national culture......, the applicability of typologies that treat cultures as static, and the problem of ambiguous terminology. It may not be surprising that studies contradict each other given the ambiguity of the national cultural construct and variations in the context of the negotiating situations that are studied. The articles...... in this issue contribute to deepening our understanding about cross-cultural negotiation processes....
Culture - lymph node ... or viruses grow. This process is called a culture. Sometimes, special stains are also used to identify specific cells or microorganisms before culture results are available. If needle aspiration does not ...
The Quagga mussel invades the Lake Superior basin - journal article
Prior studies recognized the presence of a single dreissenid species in Lake Superior--the zebra mussel Dreissena polymorpha. However, taxonomic keys based on traditional shell morphology are not always able to differentiate dreissenid species with confidence. We thus employed ge...
Lammens, E.H.R.R.; Nes, van E.H.; Mooij, W.M.
2002-01-01
1. The development of bream populations, water transparency, chlorophyll-a concentration, extent of submerged vegetation and densities of the zebra mussel, Dreissena polymorpha, were analysed in three shallow eutrophic lake systems subject to different fish management. 2. In Lake Veluwemeer, the
Lammens, E.H.R.R.; Van Nes, E.H.; Mooij, W.M.
2002-01-01
SUMMARY1. The development of bream populations, water transparency, chlorophyll-a concentration, extent of submerged vegetation and densities of the zebra mussel, Dreissena polymorpha, were analysed in three shallow eutrophic lake systems subject to different fish management. 2. In Lake Veluwemeer,
International Nuclear Information System (INIS)
Borcherding, J.; Volpers, M.
1994-01-01
The Dreissena-Monitor is a biological early warning system using the native freshwater mussel Dreissena polymorpha. A computer analyzed the opening status and the number of valve movements of 42 mussels exposed in each of two experimental channels. (orig.) [de
Product Safety Culture: A New Variant of Safety Culture?
International Nuclear Information System (INIS)
Suhanyiova, L.; Flin, R.; Irwin, A.
2016-01-01
Product safety culture is a new research area which concerns user safety rather than worker or process safety. The concept appears to have emerged after the investigation into the Nimrod aircraft accident (Haddon-Cave, 2009) which echoed aspects of NASA’s Challenger and Columbia crashes. In these cases, through a blend of human and organizational failures, the culture deteriorated to the extent of damaging product integrity, resulting in user fatalities. Haddon-Cave noted that it was due to a failure in leadership and organizational safety culture that accidents such as the Nimrod happened, where the aircraft exploded due to several serious technical failures, preceded by deficiencies in the safety case. Now some organizations are starting to measure product safety culture. This is important in day-to-day life as well, where a product failure as a result of poor organizational safety culture, can cause user harm or death, as in the case of Takata airbags scandal in 2015. Eight people have lost their lives and many were injured. According to investigation reports this was due to the company’s safety malpractices of fixing faulty airbags and proceeding to install them in vehicles, as well as secretly conducting tests to assess the integrity of their product and then deleting the data and denying safety issues as a result of the company’s cost-cutting policies. As such, organizational culture, specifically the applications of safety culture, can have far-reaching consequences beyond the workplace of an organization.
БУРЯК Н.Ю.
2016-01-01
The article deals with the importance of cultural awareness for businesspeople when they go abroad. It also gives some cultural advice and factors which are thought to be the most important in creating a culture.
The Politics of the Omnivores: Elite Culture, Popular Culture, and Libertarianism
D. Houtman (Dick); P.H.J. Achterberg (Peter)
2004-01-01
textabstractPaper prepared for the workshop Collapsing Cultural Canons: Elite Culture, Popular Culture, and Politics in Late Modernity Ecole des Hautes Etudes en Sciences Sociales, Marseille, France, October 28-29, 2004
Socio-cultural animation in hospitals and the right to access culture
Directory of Open Access Journals (Sweden)
Dušana Findeisen
2015-01-01
Full Text Available Socio-cultural animation has a long tradition in French hospitals. It started in most probability with a theatre performance staged by Marquis de Sade between 1800-1810, while he was patient of a Parisian hospital. The theatrical performance was attended by ”le Tout Paris” – all notables of the city. In 1999, a convention of ”Culture and Health” was signed and culture has been moving to hospitals ever since, transforming them into open institutions, with patients and staff having acquired a different perspective on body and culture. Moreover, Slovenian Third Age University has been educating and training cultural mediators (its students for transmitting culture and knowledge gained at the U3A to patients, patients’ relatives and staff within the University Clinical Centre Ljubljana. In this article, author sets a frame of mind for examining the importance and implications of a fundamental universal right – the right to culture.
Cultural diversity among nursing students: reanalysis of the cultural awareness scale.
Rew, Lynn; Becker, Heather; Chontichachalalauk, Jiraporn; Lee, H Y
2014-02-01
Nurses are educated to provide culturally competent care. Cultural competence begins with cultural awareness, a concept previously measured with the Cultural Awareness Scale (CAS). The purpose of this study was to reanalyze the CAS to determine construct validity and differences in cultural awareness among students of varying educational levels and experiences. The sample consisted of 150 nursing students (92% female, 33.6% racial minorities). Confirmatory factor analysis yielded three factors (CFI = 0.868, TLI = 0.854, RMSEA = 0.065, and SRMR = 0.086). Cronbach's alpha ranged from 0.70 to 0.89. There were significant differences among educational levels, with lower division BSN students generally scoring higher than upper division and master's of science in nursing students. Students who had taken courses on cultural diversity or global health generally outscored those who had not taken such courses. Findings support the validity of the CAS and its applicability to research studies of cultural awareness in nursing. Copyright 2014, SLACK Incorporated.
Cultural diversity, democracy and the prospects of cosmopolitanism: a theory of cultural encounters.
Delanty, Gerard
2011-12-01
The most appropriate way of theorizing cultural diversity is to situate it in the context of a broader relational theory of culture in which the key dynamic is cultural encounters. The relational conception of culture places the emphasis on the relations between social actors and the processes by which some of these relations generate enduring cultural regularities and forms. This has important implications for political community and in particular for cosmopolitanism. It is in relationships that cultural phenomena are generated and become the basis of different kinds of political community. The paper outlines a typology of six kinds of cultural encounters and discusses four major cultural trends that variously emerge from these encounters. This approach with its emphasis on cultural encounters is the broad sociological context in which questions about cultural change and the prospects of cosmopolitanism should be discussed. © London School of Economics and Political Science 2011.
Sputum culture ... There, it is placed in a special dish (culture). It is then watched to see if bacteria ... Elsevier; 2018:chap 36. Chernecky CC, Berger BJ. Culture, routine. In: Chernecky CC, Berger BJ, eds. Laboratory ...
The MACBA and the CCCB. From cultural regeneration to cultural government
Directory of Open Access Journals (Sweden)
Joaquim Rius
2006-05-01
Full Text Available Twenty-five years on from the idea to open cultural institutions in Barcelona's Raval district, and ten years since they opened their doors, it is now time to take stock of the MACBA (Barcelona's Museum of Contemporary Art and the CCCB (Barcelona's Contemporary Culture Centre.Why were two important cultural institutions, the MACBA and the CCCB, opened in the Raval, a district in the old town with serious social problems? How did a vague idea based on traditional models for art museums and multidisciplinary centres become two unique models and points of reference both locally and internationally? The explanation that we have is that it went from a project based on cultural regeneration to models for unique cultural institutions that are the launch pad for what we call cultural government.This article is the result of research into the cultural policy system in Catalonia and the transformation of the Raval district, which has led to the PhD thesis entitled "A new paradigm for cultural policy. The case study of Barcelona" under the supervision of Arturo Rodríguez Morató (UB and Pierre-Michel Menger (EHESS.
Organizing Cultural Projects Through Legitimising as Cultural Entrepreneurship
DEFF Research Database (Denmark)
Lindkvist, Lars; Hjorth, Daniel
2015-01-01
Purpose This paper is a study of creating organization in the case of cultural projects; cultural entrepreneurship. This includes taking advantage of opportunities and using ones social capital through networks. It is a case study of Vandalorum which is an Swedish international art- and design...... and Design Centre. Findings The case of Vandalorum shows that organizing a cultural project like Vandalorum is characterized by no well-defined starting and stopping point, but – quite typically for entrepreneurship as an organization-creation process – builds momentum and legitimacy narratively. Originality...
Culture-Laden Imports: International Market Entry and Cultural Taboos
Directory of Open Access Journals (Sweden)
Brice William David
2016-06-01
Full Text Available This empirical study investigates American market responses to a Spanish product that is strongly culture-laden and may violate cultural taboos. Surveys were conducted in two contrasting US universities in Arkansas and California. Contrasting student majors were also chosen: Art and Business. The product is a life-sized baby doll, designed to be breast-fed rather than bottle-fed, which highlights the benefits and normality of breast-feeding babies. Although this product is popular in its original European market, US media accounts suggested strongly negative morality-based American reactions. This study found a strong overall non-acceptance of this product in all groups, but with significant differences between groups. Results quantify the market reaction and illuminate its cultural basis by comparing responses between two culturally different regions, two contrasting college majors, different genders, and different ethnicities. In doing so, this study helps to break new ground in the international marketing of culture-laden products.
Influence of Cultural Cognition, Social Aspect of Culture, and Personality on Trust. Annotation
2011-12-13
world through a different lens). BIV-2_Leroux, J. (1994). Cognition. In D. Matsumoto (Ed.), People: Psychology from a Cultural Perspective...interactions. A-2 Human behavior in global perspective: An introduction to cross- cultural psychology . A-3 The analysis of subjective culture A-4...Hofstede – Culturally questionable? A-5 Through an Arab cultural lens. A-6 Bringing culture to basic psychological theory–beyond individualism
Cultural Self-Awareness as a Crucial Component of Military Cross-Cultural Competence
2013-04-08
the interpersonal skills to interact appropriately with individuals from other cultures and then when presented unfamiliar cultural cues adapt their...Maribel, Liv Egholm Feldt, and Michael Jakobsen. "If Only Cultural Chameleons Could Fly Too: A Critical Discussion of the Concept of Cultural
On Managing Cultural Integration and Cultural Change Processes in Mergers and Acquisitions
Bijlsma-Frankema, K.M.
2001-01-01
This article discusses success factors of cultural integration and cultural change processes in mergers and acquisitions. The focus of the project is on the effects of frictions between structure and cultures, and frictions between different cultures, on the functioning of the organisation. The
Role of Cultural Inspiration with Different Types in Cultural Product Design Activities
Luo, Shi-Jian; Dong, Ye-Nan
2017-01-01
Inspiration plays an important role in the design activities and design education. This paper describes "ancient cultural artefacts" as "cultural inspiration," consisting of two types called "cultural-pictorial inspiration" (CPI) and "cultural-textual inspiration" (CTI). This study aims to test the important…
Urine culture - catheterized specimen
Culture - urine - catheterized specimen; Urine culture - catheterization; Catheterized urine specimen culture ... urinary tract infections may be found in the culture. This is called a contaminant. You may not ...
A Comparative Study between Chinese and Western Food Culture in Cross-cultural Communication
Institute of Scientific and Technical Information of China (English)
焦体霞
2014-01-01
The differences of food culture play an important role in cross-cultural communication. Learn the cultural rooted causes of food culture between Chinese and Western countries, will promote mutual understanding between people and enjoy different feelings different foods brings, enhance cultural exchange, complement and integration.
Cultures Around the World: A Unique Approach to Youth Cultural Diversity Education
Directory of Open Access Journals (Sweden)
Justen O. Smith
2007-09-01
Full Text Available Increasingly diverse cultural trends have significant implications for the educational needs of American youth. Learning about and valuing diverse cultures will help prepare youth to become better citizens in an ever-changing society. Cultures Around the World was developed to meet the educational needs of youth in the area of cultural diversity. The Cultures Around the World program brings to life exciting cultures and customs from countries all over the world. Countries are presented in a unique format by teaching youth (ages 10 to 18 a specific country’s history, culture, food, music, dance, language, religion, and current issues. The Cultures Around the World program can be used by any youth educator. The program comes in a ready to use CD containing presentations, handicraft instructions, language guides, and resource guides for nine different countries (Armenia, Australia, Ecuador, Egypt, England, France, Ghana, Slovakia and Mexico.
How culture shapes the body: cultural consonance and body mass in urban Brazil.
Dressler, William W; Oths, Kathryn S; Balieiro, Mauro C; Ribeiro, Rosane P; Dos Santos, José Ernesto
2012-01-01
The aim of this article is to develop a model of how culture shapes the body, based on two studies conducted in urban Brazil. Research was conducted in 1991 and 2001 in four socioeconomically distinct neighborhoods. First, cultural domain analyses were conducted with samples of key informants. The cultural domains investigated included lifestyle, social support, family life, national identity, and food. Cultural consensus analysis was used to confirm shared knowledge in each domain and to derive measures of cultural consonance. Cultural consonance assesses how closely an individual matches the cultural consensus model for each domain. Second, body composition, cultural consonance, and related variables were assessed in community surveys. Multiple regression analysis was used to examine the association of cultural consonance and body composition, controlling for standard covariates and competing explanatory variables. In 1991, in a survey of 260 individuals, cultural consonance had a curvilinear association with the body mass index that differed for men and women, controlling for sociodemographic and dietary variables. In 2001, in a survey of 267 individuals, cultural consonance had a linear association with abdominal circumference that differed for men and women, controlling for sociodemographic and dietary variables. In general, as cultural consonance increases, body mass index and abdominal circumference decline, more strongly for women than men. As individuals, in their own beliefs and behaviors, more closely approximate shared cultural models in socially salient domains, body composition also more closely approximates the cultural prototype of the body. Copyright © 2012 Wiley Periodicals, Inc.
Morality, Culture and the Dialogic Self: Taking Cultural Pluralism Seriously
Haste, Helen; Abrahams, Salie
2008-01-01
This paper explores moral reasoning within the framework of contemporary cultural theory, in which moral functioning is action mediated by tools (such as socially available discourses) within a social and cultural context. This cultural model of a "dialogic moral self" challenges many of the assumptions inherent in the individualistic Kantian…
Lopes-Murphy, Solange A.; Murphy, Christopher G.
2016-01-01
The increasing cultural and linguistic diversity in academic settings necessitates greater cultural competence on the part of teachers, and enhancing the cultural competence of teachers requires a greater understanding of both the level of cultural competence among teachers and the experiences that enhance cultural competence. Teacher educators…
Family Perspectives: Using a Cultural Prism to Understand Families from Asian Cultural Backgrounds
Lee, Suk-Hyang; Turnbull, Ann P.; Zan, Fei
2009-01-01
Educators can better serve students who come from diverse cultural backgrounds by understanding the differing cultural values of these students and their families. This article explores different cultural perspectives using a cultural prism approach, focused most specifically on the Korean and Chinese cultures. (Contains 2 tables.)
International Nuclear Information System (INIS)
Findlay, T.
2015-01-01
The paper will consider safeguards culture both at the IAEA and among member states. It will do so through the lens of organizational culture theory and taking into account developments in safeguards since the Iraq case of the early 1990s. The study will seek to identify the current characteristics of safeguards culture and how it has evolved since the 93+2 programme was initiated, as well as considering the roles of the most important purveyors of such culture, including member states and their national safeguards authorities, the General Conference and Board of Governors, the Director General, the Secretariat as a whole, the Safeguards Department and the inspectorate. The question of what might be an optimal safeguards culture at the Agency and among member states will be investigated, along with the issue of how such a culture might be engendered or encouraged. (author)
Tomasello, Michael
2016-05-01
M. Tomasello, A. Kruger, and H. Ratner (1993) proposed a theory of cultural learning comprising imitative learning, instructed learning, and collaborative learning. Empirical and theoretical advances in the past 20 years suggest modifications to the theory; for example, children do not just imitate but overimitate in order to identify and affiliate with others in their cultural group, children learn from pedagogy not just episodic facts but the generic structure of their cultural worlds, and children collaboratively co-construct with those in their culture normative rules for doing things. In all, human children do not just culturally learn useful instrumental activities and information, they conform to the normative expectations of the cultural group and even contribute themselves to the creation of such normative expectations. © 2016 The Author. Child Development © 2016 Society for Research in Child Development, Inc.
Intertextuality as A Cultural Interaction Mechanism and Socio-Cultural Phenomenon
Directory of Open Access Journals (Sweden)
E P Shiniev
2010-03-01
Full Text Available The article focuses on intertextuality as a concept associated with the tradition of postmodernism textology and a phenomenon of text interaction with the semiotic cultural environment. The concept of intertextuality emerges as an essential condition for the construction of meaning which includes the dialogical characteristics of the polylogue culture field. The author examines the evolution of intertextuality since M.M. Bakhtin up to contemporary theoreticians of postmodernism. The concept of intertextuality is the prominent characteristics of the contemporary «post» culture and the major channel of inter-cultural diffusion.
Koo Moon, Hyoung; Kwon Choi, Byoung; Shik Jung, Jae
2012-01-01
Although various antecedents of expatriates' cross-cultural adjustment have been addressed, previous international experience, predeparture cross-cultural training, and cultural intelligence (CQ) have been most frequently examined. However, there are few attempts that explore the effects of these antecedents simultaneously or consider the possible…
Universals and cultural variations in 22 emotional expressions across five cultures.
Cordaro, Daniel T; Sun, Rui; Keltner, Dacher; Kamble, Shanmukh; Huddar, Niranjan; McNeil, Galen
2018-02-01
We collected and Facial Action Coding System (FACS) coded over 2,600 free-response facial and body displays of 22 emotions in China, India, Japan, Korea, and the United States to test 5 hypotheses concerning universals and cultural variants in emotional expression. New techniques enabled us to identify cross-cultural core patterns of expressive behaviors for each of the 22 emotions. We also documented systematic cultural variations of expressive behaviors within each culture that were shaped by the cultural resemblance in values, and identified a gradient of universality for the 22 emotions. Our discussion focused on the science of new expressions and how the evidence from this investigation identifies the extent to which emotional displays vary across cultures. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Culture, Liberty and Happiness
Ura, Karma
2007-01-01
The author's intention here is to explore mainly the relationship between culture and globalization, and also to a limited extent the ties and differences, if any, between cultural liberty and happiness. This paper attempts to relate the concept of cultural liberty to the idea of Gross National Happiness. The author underlines strongly that the culture discussed is not about the particular culture of Bhutan; it is about culture in general and in abstract. Likewise happiness referred to here i...
DEFF Research Database (Denmark)
du Gay, Paul; Hall, Stuart; Janes, Linda
What does the Walkman have to do with the 21st century? The long-awaited second edition of this classic textbook takes students on a journey between past and present, giving them the skills do to cultural analysis along the way. Through the notion of the 'circuit of culture', this book teaches st......' for cultural studies. It is an essential classic, reworked for today's students in cultural studies, media studies and sociology....
Culture - peritoneal fluid ... sent to the laboratory for Gram stain and culture. The sample is checked to see if bacteria ... The peritoneal fluid culture may be negative, even if you have ... diagnosis of peritonitis is based on other factors, in addition ...
Cultural Economy. The economic impact of the cultural sector from a European perspective
Directory of Open Access Journals (Sweden)
Alba Colombo
2006-05-01
Full Text Available Culture is playing an increasingly important role in the economic development of industrialised countries. Thus, the management of large cultural events and the relationship between cultural management and cultural policies will be key elements in the development of the so-called cultural economy. This article looks at the concept of cultural economy, in terms of the appearance of the idea and the different European methodological positions. The case of the Berlin International Film Festival is taken as an example to show the importance of cultural management with regard to economic development of the sector. This case study also allows for the analysis of the increasingly complex forms of cultural management adopted, as well as their effects on the regulation of the cultural market and their links to other basic economic sectors in urban development.
Tilsen, Julie; Nylund, David
2016-06-01
Therapists recognize that popular media culture is an influential force that shapes identities and relationships in contemporary society. Indeed, people have serious relationships with the commodities and practices that emerge from pop culture. However, they often lack the conceptual and conversational resources to engage meaningfully with clients about pop culture's influence in their lives. Cultural studies is introduced as an interdisciplinary approach that provides frameworks for both theory and practice that position therapists and clients to critically examine the role of pop culture in their lives. Cultural studies and narrative therapy are discussed as praxis allies that share a populist political intention and counter-hegemonic discursive practices. The integration of cultural studies methodologies into narrative therapy practice with a parent and her teenage daughter is illustrated through a case vignette. © 2016 Family Process Institute.
How culture affects management?
Billi, Lorena
2012-01-01
The study is about how culture affects management. Culture can have many different meanings. Management has also many different ways to be approached. While doing research about cultures, the study will try to analyze how the culture affects the management. The study starts with a full explanation of the meaning of culture. Some previous analysis and studies are added to illustrate my study on the subject. The effect culture has on management is studied at different levels. The study does not...
Advice on cultural policy matters: changing times for the Council for Culture
Lelieveldt, Philomeen; Minnaert, Toine
The central question is the changing role of advisory councils in Dutch cultural policy and the subsequent change in discourse on culture and the arts within cultural policy. Our working hypothesis is that the role of the Council for Culture (Raad voor Cultuur), the formal advisory council, is
Institute of Scientific and Technical Information of China (English)
次仁德吉
2017-01-01
Cross-cultural communication refers to the communication between peoples of different cultural backgrounds. To solve and avoid the cultural conflicts and blocks, it is high time to enhance the actual skills of cross-cultural communication. This paper gives a comparative analysis of the concrete representations of differences between Chinese and western culture in cross-cultural communication. And it gives some communication principles on the cross-cultural communication.
Directory of Open Access Journals (Sweden)
MUZZIO, Henrique
2010-12-01
Full Text Available RESUMOEsse ensaio tem como objetivo analisar o contexto cultural brasileiro e a sua influência no universo organizacional a partir de uma perspectiva cultural regional que não se limite à visão funcionalista e avance por meio de conceitos contemporâneos como os fluxos culturais e os códigos culturais locais. Do ponto de vista internacional, os estudos comparativos que trabalham com a perspectiva de adaptação cultural já apresentam um volume significativo de pesquisas que enfatizam as distinções entre regiões ou nações. Mas, quando se trata dessa perspectiva dentro de países culturalmente diversos, parece ainda não haver no campo a mesma expressão. Em países em que é reconhecida a diversidade cultural, como o Brasil, análises que levem em conta as influências dessa variável podem contribuir para a eficiência das relações internas e externas da organização. Arguimos a necessidade das organizações contemplarem em suas ações o que chamamos de legitimidade cultural local, quando as organizações atuam em distintos contextos respeitando os valores e as práticas culturais locais. As diferentes culturas regionais encontradas no Brasil se refletem nos hábitos dos consumidores, no comportamento social e nas atitudes e desempenho das pessoas no trabalho, o que requer efetivamente diferentes e variadas práticas de gestão.ABSTRACTThis essay has the objective of analyzing the Brazilian cultural context and its influence on the organizations universe from a cultural regional perspective that goes beyond the functionalist paradigm and advances through contemporary concepts, like cultural flows and the local cultural codes. In an international perspective, in studies that consider the perspective of cultural adaptation, it is possible finding a significant volume of research that emphasizes the distinctions between regions or nations. On the other hand, when it these studies deal with this perspective inside each culturally
Miyamoto, Yuri
2017-12-01
A large body of research in Western cultures has demonstrated the psychological and health effects of social class. This review outlines a cultural psychological approach to social stratification by comparing psychological and health manifestations of social class across Western and East Asian cultures. These comparisons suggest that cultural meaning systems shape how people make meaning and respond to material/structural conditions associated with social class, thereby leading to culturally divergent manifestations of social class. Specifically, unlike their counterparts in Western cultures, individuals of high social class in East Asian cultures tend to show high conformity and other-orientated psychological attributes. In addition, cultures differ in how social class impacts health (i.e. on which bases, through which pathways, and to what extent). Copyright © 2017 Elsevier Ltd. All rights reserved.
Athletes’ careers across cultures
DEFF Research Database (Denmark)
Ryba, Tatiana; Stambulova, Natalia
This symposium will introduce a project developed under the auspices of the International Society of Sport Psychology (ISSP) in an effort to inspire and support the development of culturally sensitive theoretical frameworks and research methodologies in career studies and career assistance services...... around the world. The cultural approach to the theory and practice of sport psychological research has been recently articulated in two edited books, Cultural Sport Psychology (Schinke & Hanrahan, 2009) and The Cultural Turn in Sport Psychology (Ryba, Schinke, & Tenenbaum, 2010). The presenters...... in this symposium continue the initiated dialogue of the relevance of culture and cultural issues in their analyses of how social and cultural discourses shape career development and career transitions of athletes in different countries. Opening the foundations of sport psychological knowledge to culturally diverse...
An evolutionary explanation model on the transformation of culture by cultural genes*
Lee, Han
2009-01-01
This article seeks to explain how cultural transformation takes place through the evolution of cultural genes. This explanation posits that just as the evolution of an organism takes place at the genetic level, so also does the transformation of culture. As such, this paper must answer the four following questions: 1) Are there cultural genes that correspond to biological genes? 2) How can we prove that the fundamental characteristic of such cultural genes is to replicate themselves? 3) Will ...
Oers, van M.M.; Lynn, D.E.
2010-01-01
Insect cell cultures are widely used in studies on insect cell physiology, developmental biology and microbial pathology. In particular, insect cell culture is an indispensable tool for the study of insect viruses. The first continuously growing insect cell cultures were established from
Groot, B.M.
2017-01-01
This thesis explores the value of cultural and archaeological heritage through a focus on multinational corporations (MNCs) across industries and their involvement with cultural heritage. Research to date has focused mainly on industries where MNCs have a direct impact on cultural or archaeological
Cross-cultural organizational behavior.
Gelfand, Michele J; Erez, Miriam; Aycan, Zeynep
2007-01-01
This article reviews research on cross-cultural organizational behavior (OB). After a brief review of the history of cross-cultural OB, we review research on work motivation, or the factors that energize, direct, and sustain effort across cultures. We next consider the relationship between the individual and the organization, and review research on culture and organizational commitment, psychological contracts, justice, citizenship behavior, and person-environment fit. Thereafter, we consider how individuals manage their interdependence in organizations, and review research on culture and negotiation and disputing, teams, and leadership, followed by research on managing across borders and expatriation. The review shows that developmentally, cross-cultural research in OB is coming of age. Yet we also highlight critical challenges for future research, including moving beyond values to explain cultural differences, attending to levels of analysis issues, incorporating social and organizational context factors into cross-cultural research, taking indigenous perspectives seriously, and moving beyond intracultural comparisons to understand the dynamics of cross-cultural interfaces.
DEFF Research Database (Denmark)
Dao, Li
2012-01-01
The purpose of this paper is to extend a cultural sense-making perspective to the context of international joint ventures. The dominant literature on cultural issues in this inter-firm setting has been criticized for relying on a narrow view of culture mainly as a country-level construct. The pap...... through individual sense-making and mutual learning and adjustment as key to the process of cultural negotiation.......The purpose of this paper is to extend a cultural sense-making perspective to the context of international joint ventures. The dominant literature on cultural issues in this inter-firm setting has been criticized for relying on a narrow view of culture mainly as a country-level construct. The paper...... argues that dynamic aspects of culture as enacted by key individual actors and constructed in a given context are far more relevant and critical for the joint venture’s managerial process. With evidence from four Danish – Vietnamese joint ventures, the paper proposes a way of managing culture in IJVs...
Tcheang, Lili
2014-01-01
Cultural differences have been shown across a number of different cognitive domains from vision, language, and music. Mathematical cognition is another domain that is an integral part of modern society and because there are a fixed number of ways in which many math operations can be performed, it is also an apposite tool for cultural comparisons. This discussion examines the literature on mathematical processing in accordance with culture, summarizing the brain regions involved across various mathematical tasks. In doing so, we provide a clear picture of the anatomical similarities and differences between cultures when performing different math tasks. This information is useful to explore the possibility of enhancement of mathematical skills, where different strategies may be applicable in accordance with culture. It also contributes to the evolutionary development of different math skills and the growing theory that anatomical and behavioral studies must account for the cultural identity of their sample.
Directory of Open Access Journals (Sweden)
Sabina Bogilović
2016-01-01
Full Text Available We propose that employees who are highly motivated for cultural interactions (motivational cultural intelligence and can modify their thinking about cultural differences (metacognitive cultural intelligence are more likely to be creative in culturally diverse environments. Based on the social categorization theory, we propose that metacognitive and motivational cultural intelligence will be positively related to individual creativity. Moreover, we predict that metacognitive and motivational cultural intelligence can decrease the negative aspects of the social categorization process and, in turn, be positively related to creativity. A quantitative analysis of 787 employees in 20 SME multicultural companies in the Adriatic region shows that metacognitive and motivational cultural intelligence are in fact positively related to individual creativity. We discuss the implications for practice and future research.
Cultural resource management and the necessity of cultural and natural resource collaboration
Roderick Kevin Donald; Kara Kusche; Collin Gaines
2005-01-01
Cultural Resource Specialists function as interpreters of past and present human behavior through the analysis of cultural/natural resources vital to human ecological sustainability. When developing short and long-term preservation strategies for cultural resources, it is more current and innovative for Cultural Resource Specialists to think of past human populations...
Cultural theory revised: Only five cultures or more?
van Heffen, O.; Klok, Pieter J.
2003-01-01
This article deals with cultural theory in the version of Thompson, Ellis and Wildavsky. Cultural theory is important for research in the area of political and policy science because this theory has the pretension of pinning down endogenous preference formation. Using Durkheim's dimensions, 'social
Socio-cultural dimensions to sharpen designer's cultural eyeglasses
Van Boeijen, A.G.C.
2013-01-01
This paper answers the question, how the dimensions that have been developed by anthropologists to typify cultures, can support designers in user-centred design processes. An analysis and evaluation of the use of cultural dimensions in design projects was performed. Although many of the dimensions
The relationship between DIY culture and cultural institutions
DEFF Research Database (Denmark)
Roued-Cunliffe, Henriette
in different ways and three categories in particular are of interest in connection with cultural institutions. These are volunteering, amateur activity and hacking. The motivation and value for these three categories of DIY activity are different and cultural institutions must take this into account when...
Whiten, Andrew; Hinde, Robert A.; Laland, Kevin N.; Stringer, Christopher B.
2011-01-01
Culture pervades human lives and has allowed our species to create niches all around the world and its oceans, in ways quite unlike any other primate. Indeed, our cultural nature appears so distinctive that it is often thought to separate humanity from the rest of nature and the Darwinian forces that shape it. A contrary view arises through the recent discoveries of a diverse range of disciplines, here brought together to illustrate the scope of a burgeoning field of cultural evolution and to...
Safety Culture Monitoring: How to Assess Safety Culture in Real Time?
International Nuclear Information System (INIS)
Zronek, B.; Maryska, J.; Treslova, L.
2016-01-01
Do you know what is current level of safety culture in your company? Are you able to follow trend changes? Do you know what your recent issues are? Since safety culture is understood as vital part of nuclear industry daily life, it is crucial to know what the current level is. It is common to perform safety culture survey or ad hoc assessment. This contribution shares Temelin NPP, CEZ approach how to assess safety culture level permanently. Using behavioral related outputs of gap solving system, observation program, dedicated surveys, regulatory assessment, etc., allows creating real time safety culture monitoring without the need to perform any other activities. (author)
On the Eastern and Western Cultures as Reflected in Differences in Food Culture
Institute of Scientific and Technical Information of China (English)
黄卓; 张海南
2015-01-01
When talking about differences between Eastern and Western culture,we should first think of the eating cultural differences.There are many differences in Eastern and Western food cultures,in this paper it will introduce the different food concepts,the different eating goals,the different eating habits,etc.A comparison study of Chinese and Western food culture still makes sense through the analysis of cultural differences between Chinese and Western food,we can understand their own cultural traditions in China and the West.At the same time it is able to carry out improvement and innovation of Chinese culture.Throughout the comparisons,coupled with the differences of the concept of Western food culture,objects,methods,ownership and nature,it studies these differences,identifies areas for mastery of the place,promotes cultural exchange.Thus it enables China to the world,and to make the world know China better.
On the Eastern and Western Cultures as Reflected in Differences in Food Culture
Institute of Scientific and Technical Information of China (English)
黄卓; 张海南
2015-01-01
When talking about differences between Eastern and Western culture,we should first think of the eating cultural differences.There are many differences in Eastern and Western food cultures,in this paper it will introduce the different food concepts,the different eating goals,the different eating habits,etc. A comparison study of Chinese and Western food culture still makes sense through the analysis of cultural differences between Chinese and Western food,we can understand their own cultural traditions in China and the West.At the same time it is able to carry out improvement and innovation of Chinese culture. Throughout the comparisons,coupled with the differences of the concept of Western food culture,objects,methods,ownership and nature,it studies these differences,identifies areas for mastery of the place,promotes cultural exchange.Thus it enables China to the world,and to make the world know China better.
Teaching Culture Through Films
Institute of Scientific and Technical Information of China (English)
徐婷
2016-01-01
Cultural teaching is an issue which is associated with complexity and paradox and also it is a big challenge for faculty. Teaching culture through films has become an important way of cross-cultural teaching This paper focuses on the reasons for teaching culture through films, the value and how it works. And finally it leads out the prospects of cultural teaching through films.
DEFF Research Database (Denmark)
Ørum, Tania
2016-01-01
In the 1960s high and low culture were brought into sharp conflict i Denmark. In 1961 a Ministry of Culture was established for the first time. The first minister of culture, the social democrat Julius Bomholt, saw art and culture as an important part of education for democracy that should be made...... available to everyone. The general public, however, raised demands for more popular and relaxing entertainment. The confrontation between the cultural elite and popular opinion escalated to a series of veritable culture wars....
DEFF Research Database (Denmark)
2011-01-01
Ethnographic film, Moesgård Film, Royal Anthropological Institute (59 min, 2011) Soanin Kilangit is determined to unite the people and attract international tourism through the revival of culture on Baluan Island in the South Pacific. He organizes the largest cultural festival ever held on the is......Ethnographic film, Moesgård Film, Royal Anthropological Institute (59 min, 2011) Soanin Kilangit is determined to unite the people and attract international tourism through the revival of culture on Baluan Island in the South Pacific. He organizes the largest cultural festival ever held......, performance, identity, cultural politics, exchange, and the impact of the West on traditional societies.” — Karen Stevenson, American Anthropologist, September 2012...
D.R. Gasper (Des)
2006-01-01
textabstractDiscourses on culture and development vary according to their conceptions of culture and of development and according to their standpoint. The ‘culture and development’ problematic has typically: (1) arisen from a conception of ‘culture’ as a relatively fixed, homogeneous set of mental
Cultural hegemony? Educators? perspectives on facilitating cross-cultural dialogue
Zaidi, Zareen; Verstegen, Dani?lle; Vyas, Rashmi; Hamed, Omayma; Dornan, Tim; Morahan, Page
2016-01-01
Background: We live in an age when education is being internationalized. This can confront students with ‘cultural hegemony’ that can result from the unequal distribution of power and privilege in global society. The name that is given to awareness of social inequality is ‘critical consciousness’. Cross-cultural dialogue provides an opportunity for learners to develop critical consciousness to counter cultural hegemony. The purpose of this research was to understand how learners engage with c...
Strauch, Barry
2010-04-01
I discuss cultural factors and how they may influence sociotechnical system operations. Investigations of several major transportation accidents suggest that cultural factors may have played a role in the causes of the accidents. However, research has not fully addressed how cultural factors can influence sociotechnical systems. I review literature on cultural differences in general and cultural factors in sociotechnical systems and discuss how these differences can affect team performance in sociotechnical systems. Cultural differences have been observed in social and interpersonal dimensions and in cognitive and perceptual styles; these differences can affect multioperator team performance. Cultural factors may account for team errors in sociotechnical systems, most likely during high-workload, high-stress operational phases. However, much of the research on cultural factors has methodological and interpretive shortcomings that limit their applicability to sociotechnical systems. Although some research has been conducted on the role of cultural differences on team performance in sociotechnical system operations, considerable work remains to be done before the effects of these differences can be fully understood. I propose a model that illustrates how culture can interact with sociotechnical system operations and suggest avenues of future research. Given methodological challenges in measuring cultural differences and team performance in sociotechnical system operations, research in these systems should use a variety of methodologies to better understand how culture can affect multioperator team performance in these systems.
Stevenson, Paul
1980-01-01
Compares various nutrient media, growth conditions, and stock solutions used in culturing protozoa. A hay infusion in Chalkey's solution maintained at a stable temperature is recommended for producing the most dense and diverse cultures. (WB)
Culture and psychiatric diagnosis.
Lewis-Fernández, Roberto; Aggarwal, Neil Krishan
2013-01-01
Since the publication of DSM-IV in 1994, neurobiologists and anthropologists have criticized the rigidity of its diagnostic criteria that appear to exclude whole classes of alternate illness presentations, as well as the lack of attention in contemporary psychiatric nosology to the role of contextual factors in the emergence and characteristics of psychopathology. Experts in culture and mental health have responded to these criticisms by revising the very process of diagnosis for DSM-5. Specifically, the DSM-5 Cultural Issues Subgroup has recommended that concepts of culture be included more prominently in several areas: an introductory chapter on Cultural Aspects of Psychiatric Diagnosis - composed of a conceptual introduction, a revised Outline for Cultural Formulation, a Cultural Formulation Interview that operationalizes this Outline, and a glossary on cultural concepts of distress - as well as material directly related to culture that is incorporated into the description of each disorder. This chapter surveys these recommendations to demonstrate how culture and context interact with psychiatric diagnosis at multiple levels. A greater appreciation of the interplay between culture, context, and biology can help clinicians improve diagnostic and treatment planning. Copyright © 2013 APA*
Experiencing Global Culture in Vatel
DEFF Research Database (Denmark)
Kampf, Constance Elizabeth; Broillet, Alexandra; John, Claudette
2015-01-01
To explore the meaning of “global culture” in a professional communication context, this paper explores the “unsettled” global culture of Vatel, a private business school educating students from nearly 50 different countries for the hospitality industry. This paper explores the role of knowledge...... management in understanding global culture, arguing that the notion of “unsettled” cultures demonstrates how ideologies function in global settings and draw on national “settled” cultural resources. In unpacking different aspects of Vatel's culture this paper questions assumptions built into cultural frames...... of reference by offering a global culture frame, drawing on cultural resources from country based “settled” cultural contexts, and reflects on how global cultural contexts can benefit from a knowledge management approach to this dynamic between “settled” cultural contexts and “unsettled” cultural ideologies...
Cultural Consumption of the Overseas Chinese Garden in the Process of Cross-cultural Communication
Zhai, L.
2015-08-01
When referring to the tangible cultural heritage, people tend to concern more about the conservation and research of the entity of the tangible heritage than the cross-cultural communication of the cultural heritage which is also one of the most important components of the preservation of the cultural heritage. As an exotic new born of the cultural heritage, the entity born from the cross-cultural communication inherits the properties of the cultural heritage on the one hand, and on the other hand generates diversities as a result of the differences based on social, cultural and environment. And the business model is one of the most important reasons for the production of diversities. There's no doubt that a good form of business model makes great significance to the cross-cultural communication. Therefore, the study of the business model of cultural heritage in the process of cross-cultural communication will not only contributes to the deeper understanding towards the phenomenon of the cultural heritage's cross-cultural communication, but also leads to the introspection to the tangible cultural heritage itself. In this way, a new kind of conservative notion could take form, and the goal of protecting cultural heritage could be achieved. Thus the Chinese Garden is a typical representation of the cultural heritage which makes great sense in the cross-cultural communication. As a kind of tangible cultural heritage, the Chinese gardens are well preserved in different regions in China. While the spirits of the Chinese garden carry forward through the construction of the Chinese gardens abroad during the cross-cultural communication. As a new kind of form of the cross-cultural communication of the cultural heritage, on the one hand, the Chinese gardens overseas built ever since China's Reform and Opening express creatively of the materialist and the spirituality of the traditional Chinese Garden, and on the other hand, those Chinese gardens overseas face all kinds of
Wang, Yijie; Benner, Aprile D.; Kim, Su Yeong
2015-01-01
In a culturally diverse society, youth learn about multiple cultures from a variety of sources, yet the existing assessment of cultural socialization has been limited to parents' efforts to teach youth about their heritage culture. The current study adapted and extended an existing cultural socialization measure (Umaña-Taylor & Fine, 2004) to assess four types of socialization practices encountered specifically during adolescence: cultural socialization by families and peers toward both one's heritage culture and the mainstream culture. In a pilot study, we developed the cultural socialization scale based on retrospective reports from 208 young adults, maximizing young adults' ability to reason and reflect their adolescent experiences with various socialization practices. In the primary study, we examined the psychometric properties of the scale using reports from 252 adolescents. Cultural socialization occurred from both socialization agents toward both cultures. Our cultural socialization scale demonstrated stable factor structures and high reliabilities. We observed strong factorial invariance across the four subscales (six items). MIMIC models also demonstrated invariance for each subscale across adolescents' demographic characteristics (i.e., gender, race/ethnicity, nativity, SES, language of assessment). The implications of the cultural socialization scale are discussed. PMID:25961139
Cultural Capital. On the Right to Cultural Identity
Maris, C.
2012-01-01
According to article 1 of the UN International Covenant on Economic, Social and Cultural Rights of 1966, All peoples have the right of self-determination. By virtue of that right they freely determine their political status and freely pursue their economic, social and cultural development. This
Corona, Rosalie; Rodríguez, Vivian M; McDonald, Shelby E; Velazquez, Efren; Rodríguez, Adriana; Fuentes, Vanessa E
2017-01-01
Latina/o college students experience cultural stressors that negatively impact their mental health, which places them at risk for academic problems. We explored whether cultural values buffer the negative effect of cultural stressors on mental health symptoms in a sample of 198 Latina/o college students (70 % female; 43 % first generation college students). Bivariate results revealed significant positive associations between cultural stressors (i.e., acculturative stress, discrimination) and mental health symptoms (i.e., anxiety, depressive, psychological stress), and negative associations between cultural values of familismo, respeto, and religiosity and mental health symptoms. Several cultural values moderated the influence of cultural stressors on mental health symptoms. The findings highlight the importance of helping Latina/o college students remain connected to their families and cultural values as a way of promoting their mental health.
Divergent Cumulative Cultural Evolution
Marriott, Chris; Chebib, Jobran
2016-01-01
Divergent cumulative cultural evolution occurs when the cultural evolutionary trajectory diverges from the biological evolutionary trajectory. We consider the conditions under which divergent cumulative cultural evolution can occur. We hypothesize that two conditions are necessary. First that genetic and cultural information are stored separately in the agent. Second cultural information must be transferred horizontally between agents of different generations. We implement a model with these ...
Riecken, Ted J.; Court, Deborah
1992-01-01
Advocates defining cultural literacy to recognize the mass media's role in transmitting and maintaining cultural stereotypes and shaping values and beliefs. Distinguishes between ideational and material aspects of culture. Advocates teaching critical thinking and respect for persons in light of questionable moral perspectives in certain media…
Atkinson, Dwight
1999-01-01
Looks at the question of how culture is understood in the Teaching English as a Second/Other-Language (TESOL) profession. Examines the perspectives toward culture implicitly or explicitly expressed in recent "TESOL Quarterly" articles, and concludes that different views of culture exist in the field. (Author/VWL)
Translation Strategy of Chinese Culture-loaded Lexes and the Dissemina-tion of Chinese Culture
Institute of Scientific and Technical Information of China (English)
WU Li-li
2016-01-01
Lexes are the most important and basic element of a language. Chinese culture-loaded lexes are those words or expres-sions that are greatly rich in Chinese culture. They can reflect the characteristics of Chinese culture and Chinese nation. There-fore, it is of great significance to pay attention to the translation of Chinese culture-loaded lexes as they play a decisive role in disseminating Chinese culture. It can help promote Chinese culture worldwide, improve China’s cultural exchanges and commu-nication with other nations and strengthen China’s status in the world. This paper focuses on the Chinese culture-loaded words and proposes some possible means of translation with the purpose of spreading Chinese culture.
Directory of Open Access Journals (Sweden)
Jing Liu
Full Text Available Rodent organotypic hippocampal cultures spontaneously develop epileptiform activity after approximately 2 weeks in vitro and are increasingly used as a model of chronic post-traumatic epilepsy. However, organotypic cultures are maintained in an artificial environment (culture medium, which contains electrolytes, glucose, amino acids and other components that are not present at the same concentrations in cerebrospinal fluid (CSF. Therefore, it is possible that epileptogenesis in organotypic cultures is driven by these components. We examined the influence of medium composition on epileptogenesis. Epileptogenesis was evaluated by measurements of lactate and lactate dehydrogenase (LDH levels (biomarkers of ictal activity and cell death, respectively in spent culture media, immunohistochemistry and automated 3-D cell counts, and extracellular recordings from CA3 regions. Changes in culture medium components moderately influenced lactate and LDH levels as well as electrographic seizure burden and cell death. However, epileptogenesis occurred in any culture medium that was capable of supporting neural survival. We conclude that medium composition is unlikely to be the cause of epileptogenesis in the organotypic hippocampal culture model of chronic post-traumatic epilepsy.
Liu, Jing; Saponjian, Yero; Mahoney, Mark M; Staley, Kevin J; Berdichevsky, Yevgeny
2017-01-01
Rodent organotypic hippocampal cultures spontaneously develop epileptiform activity after approximately 2 weeks in vitro and are increasingly used as a model of chronic post-traumatic epilepsy. However, organotypic cultures are maintained in an artificial environment (culture medium), which contains electrolytes, glucose, amino acids and other components that are not present at the same concentrations in cerebrospinal fluid (CSF). Therefore, it is possible that epileptogenesis in organotypic cultures is driven by these components. We examined the influence of medium composition on epileptogenesis. Epileptogenesis was evaluated by measurements of lactate and lactate dehydrogenase (LDH) levels (biomarkers of ictal activity and cell death, respectively) in spent culture media, immunohistochemistry and automated 3-D cell counts, and extracellular recordings from CA3 regions. Changes in culture medium components moderately influenced lactate and LDH levels as well as electrographic seizure burden and cell death. However, epileptogenesis occurred in any culture medium that was capable of supporting neural survival. We conclude that medium composition is unlikely to be the cause of epileptogenesis in the organotypic hippocampal culture model of chronic post-traumatic epilepsy.
Helmreich, Stefan
2011-01-01
Seawater has occupied an ambiguous place in anthropological categories of "nature" and "culture." Seawater as nature appears as potentiality of form and uncontainable flux; it moves faster than culture - with culture frequently figured through land-based metaphors - even as culture seeks to channel water's (nature's) flow. Seawater as culture manifests as a medium of pleasure, sustenance, travel, disaster. I argue that, although seawater's qualities in early anthropology were portrayed impressionistically, today technical, scientific descriptions of water's form prevail. For example, processes of globalization - which may also be called "oceanization" - are often described as "currents," "flows," and "circulations." Examining sea-set ethnography, maritime anthropologies, and contemporary social theory, I propose that seawater has operated as a “theory machine” for generating insights about human cultural organization. I develop this argument with ethnography from the Sargasso Sea and in the Sea Islands. I conclude with a critique of appeals to water's form in social theory.
The Influences of Western Food Culture on Contemporary Chinese Food Culture
Institute of Scientific and Technical Information of China (English)
张林
2017-01-01
Food, an essential prerequisite for existence, plays an irreplaceable role in the development of society and in the progress of human beings. Chinese food culture has a long and bril iant history, but under the huge impacts of the western civilization, it has been greatly influenced. From these study, the positive influences of the western food culture on the contemporary Chinese food culture can be clearly seen, which also have promoted the diverse developments of Chinese dietary culture.
Cultural diversity in hospitality management : how to improve cultural diversity workforce
Korjala, Veera
2013-01-01
The bachelor´s thesis investigates cultural diversity in the hospitality management. It aims at presenting effective ways to improve cultural diversity in a workplace. This study was commissioned by JW Marriott San Antonio Hill Country Resort & Spa in Texas, USA and three hotels in Stillwater, Oklahoma, USA: Atherton Hotel, Hampton Inn & Suites and Residence Inn. The bachelor´s thesis incorporates culture theories and their applications to the workplace. Additionally, it focuses on cultural d...
ECONOMIC IMPACT OF CULTURAL TOURISM
Directory of Open Access Journals (Sweden)
Zrinka Zadel
2013-12-01
Full Text Available The subject of analysis in the paper is economic impact of cultural tourism and identification of the main factors which directly affect cultural tourism revenues. Most countries do not have a statistical system of monitoring and analysing individual factors of cultural tourism such as the number of arrivals of cultural tourists and consumption of cultural tourists. Therefore, it is hard to assess the economic impact of cultural tourism. In cultural tourism, cultural assets are prepared and placed on the tourist market, i.e. cultural resources are transformed into cultural tourism products. The main objective is fulfilling tourists' needs, and achieving positive effects which includes economic effects. Identification of the economic impact of cultural tourism is important because cultural resources have an inestimable value for the local community. Tourism valorisation should be used in order to achieve the necessary maximum effects with minimum negative impacts which tourism may leave on cultural resources. The objective of the paper is to identify the economic contribution of cultural tourism in the Republic of Croatia and to propose a model of identification of economic impact of cultural tourism.
CHALLENGES IN CROSS CULTURAL ADVERTISING
Directory of Open Access Journals (Sweden)
Yuni Retnowati
2016-04-01
Full Text Available At first, marketing practitioners and academics consider standardized approaches to marketing and advertising strategies in globalization, and then some studies proved that the standardization of advertising across culture is not valid. Therefore, cross cultural advertising takes local culture into account when conveying messages in advertisements. Cross cultural understanding is very important in order to produce successful localized advertising that would reflect the cultural values and norms of intended audience. Challenge in cross cultural advertising is the problem of communicating to people of diverse cultural background. Cross cultural solutions are applied in areas such as language, communication style, images and cultural values. Cross cultural advertising is simply about using common sense and analyzing how the different elements of an advertising campaign are impacted by culture and modifying them to best speak to the target audience. Other challenges are determining between standardization and adaptation of cultural values content of advertising when facing different people from diverse cultures. In academic side, the challenge is preparing students to design advertisements that communicate effectively to diverse cultures.
Cultural Descriptions as Political Cultural Acts: An Exploration
Holliday, Adrian
2010-01-01
Interculturality may be something normal which everyone possesses to a degree. However, dominant neo-essentialist theories of culture give the impression that we are too different to easily cross-cultural boundaries. These theories support the development of academic disciplines and the need for professional certainty in intercultural training.…
Culture Differences and English Teaching
Wang, Jin
2011-01-01
Language is a part of culture, and plays a very important role in the development of the culture. Some sociologists consider it as the keystone of culture. They believe, without language, culture would not be available. At the same time, language is influenced and shaped by culture, it reflects culture. Therefore, culture plays a very important…
Lindholm, Kristian
2013-01-01
The purpose of the thesis is to examine the implications of culture in business. The thesis makes use of the most popular theoretical frameworks in the field, namely the cultural dimensions where data has been chiefly collected through the efforts of Geert Hofstede and Fons Trompenaars. In theory, the application of cultural knowledge as professed through the cultural dimensions into managerial practices can be applied. The validity of these theories has proven impossible to quantify and ...
Kirkman, Bradley L; Shapiro, Debra L; Lu, Shuye; McGurrin, Daniel P
2016-04-01
We first review research on culture effects in teams, illustrating that mean levels of team cultural values have main (i.e. direct) effects, indirect effects (i.e. mediated by intervening variables), and moderating influences on team processes and outcomes. Variance in team cultural values or on country of origin (i.e. nationality diversity) also has main effects on team functioning, and we highlight contextual variables that strengthen or weaken these main effects. We next review research examining the effect of variance in team cultural values on global virtual teams, specifically. Finally, we review research on how cultural values shape employees' receptivity to empowering leadership behavior in teams. We conclude by discussing critical areas for future research. Published by Elsevier Ltd.
Conceptions of ‘culture' in international communication - Limits to cultural explanations?
DEFF Research Database (Denmark)
Froholdt, Lisa Loloma; Knudsen, Fabienne
2008-01-01
The paper addresses a critical approach to static, objective and context-independent concept of culture. Conceiving of another culture as objective, persistent, and evenly shared features within a nation may bring some basic order while facing an unknown culture, but it may also have unintentional...
Byon, Andrew Sangpil
2007-01-01
This paper investigates a case of designing, implementing, and evaluating a semester-long culture portfolio project in a Korean culture class in an American university setting. The paper addresses the following four issues: (1) How does the project help the students gain insights into a particular aspect of Korean culture and encourage them to…
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
Participants at a forum on communication between cultures generate ideas on how China can deal with its growing cultural deficit Five months ago, Ding Wei, Assistant Minister of Culture, described China's deficit in international cultural trade as "huge" at a press conference held by the State Council Information Office. "Our statistics years ago showed that the ratio of imports of cultural products to exports was 10 to 1," he
Safety culture in nuclear installations. Guidance for the use in enhancement of safety culture
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-12-01
This guidance has been developed for use in the IAEA Safety Culture Services, which provides support to Member States in their efforts to develop a sound safety culture of their organizations. It will be of particular use in seminars and training workshops that are part of these services. Much of the information in this publication reflects the approach the IAEA has adopted to assist nuclear organizations in Member States in improving their safety culture. This guidance covers topics such as: what is culture, and in particular what is safety culture; what are the stages of development of safety culture, and how you can assess its development using employee surveys; what practices can be used to develop safety culture, and what indicators will help monitor progress. The symptoms of a weakening safety culture are described, as well as the lessons learned from organizations who have experienced safety culture problems. This guide also contains information on how to undertake the process of transforming the existing safety culture, and develop a learning culture in an organization that is based on continuous improvement. The relationship between quality and safety is discussed. The safety culture services offered by the IAEA are also described. The IAEA perspective of safety culture has expanded with time as its understanding of the complexities of the concept developed. The concept of safety culture was first introduced by the International Nuclear Safety Advisory Group formed by the IAEA. In their report (INSAG-4, 1991) they maintained that the establishment of a safety culture within an organization is one of the fundamental management principles necessary for the safe operation of a nuclear facility. The definition recognized that safety culture is both structural and attitudinal in nature and relates to the organization and its style, as well as to attitudes, approaches and the commitment of individuals at all levels in the organization. In the framework of the
Safety culture in nuclear installations. Guidance for the use in enhancement of safety culture
International Nuclear Information System (INIS)
2002-12-01
This guidance has been developed for use in the IAEA Safety Culture Services, which provides support to Member States in their efforts to develop a sound safety culture of their organizations. It will be of particular use in seminars and training workshops that are part of these services. Much of the information in this publication reflects the approach the IAEA has adopted to assist nuclear organizations in Member States in improving their safety culture. This guidance covers topics such as: what is culture, and in particular what is safety culture; what are the stages of development of safety culture, and how you can assess its development using employee surveys; what practices can be used to develop safety culture, and what indicators will help monitor progress. The symptoms of a weakening safety culture are described, as well as the lessons learned from organizations who have experienced safety culture problems. This guide also contains information on how to undertake the process of transforming the existing safety culture, and develop a learning culture in an organization that is based on continuous improvement. The relationship between quality and safety is discussed. The safety culture services offered by the IAEA are also described. The IAEA perspective of safety culture has expanded with time as its understanding of the complexities of the concept developed. The concept of safety culture was first introduced by the International Nuclear Safety Advisory Group formed by the IAEA. In their report (INSAG-4, 1991) they maintained that the establishment of a safety culture within an organization is one of the fundamental management principles necessary for the safe operation of a nuclear facility. The definition recognized that safety culture is both structural and attitudinal in nature and relates to the organization and its style, as well as to attitudes, approaches and the commitment of individuals at all levels in the organization. In the framework of the
Cultural effects on mindreading.
Perez-Zapata, Daniel; Slaughter, Virginia; Henry, Julie D
2016-01-01
People from other cultural backgrounds sometimes seem inscrutable. We identified a potential cause of this phenomenon in two experiments demonstrating that adults' mental state inferences are influenced by the cultural identity of the target. We adapted White, Hill, Happé, and Frith's (2009) Strange Stories to create matched intra-cultural and cross-cultural mindreading and control conditions. Experiment 1 showed that Australian participants were faster to respond and received higher scores in the intra-cultural mindreading condition relative to the cross-cultural mindreading condition, but performance in the control conditions was equivalent. Experiment 2 replicated this pattern in independent samples of Australian and Chilean participants. These findings have important implications for cross-cultural communication and understanding. Copyright © 2015 Elsevier B.V. All rights reserved.