Directory of Open Access Journals (Sweden)
Gan Xiaoni
2010-04-01
Full Text Available Abstract Background We recently characterized HAmo SINE and its partner LINE in silver carp and bighead carp based on hybridization capture of repetitive elements from digested genomic DNA in solution using a bead-probe 1. To reveal the distribution and evolutionary history of SINEs and LINEs in cyprinid genomes, we performed a multi-species search for HAmo SINE and its partner LINE using the bead-probe capture and internal-primer-SINE polymerase chain reaction (PCR techniques. Results Sixty-seven full-size and 125 internal-SINE sequences (as well as 34 full-size and 9 internal sequences previously reported in bighead carp and silver carp from 17 species of the family Cyprinidae were aligned as well as 14 new isolated HAmoL2 sequences. Four subfamilies (type I, II, III and IV, which were divided based on diagnostic nucleotides in the tRNA-unrelated region, expanded preferentially within a certain lineage or within the whole family of Cyprinidae as multiple active source genes. The copy numbers of HAmo SINEs were estimated to vary from 104 to 106 in cyprinid genomes by quantitative RT-PCR. Over one hundred type IV members were identified and characterized in the primitive cyprinid Danio rerio genome but only tens of sequences were found to be similar with type I, II and III since the type IV was the oldest subfamily and its members dispersed in almost all investigated cyprinid fishes. For determining the taxonomic distribution of HAmo SINE, inter-primer SINE PCR was conducted in other non-cyprinid fishes, the results shows that HAmo SINE- related sequences may disperse in other families of order Cypriniforms but absent in other orders of bony fishes: Siluriformes, Polypteriformes, Lepidosteiformes, Acipenseriformes and Osteoglossiforms. Conclusions Depending on HAmo LINE2, multiple source genes (subfamilies of HAmo SINE actively expanded and underwent retroposition in a certain lineage or within the whole family of Cyprinidae. From this
Tong, Chaobo; Guo, Baocheng; He, Shunping
2009-01-01
Background Short and long interspersed elements (SINEs and LINEs, respectively), two types of retroposons, are active in shaping the architecture of genomes and powerful tools for studies of phylogeny and population biology. Here we developed special protocol to apply biotin-streptavidin bead system into isolation of interspersed repeated sequences rapidly and efficiently, in which SINEs and LINEs were captured directly from digested genomic DNA by hybridization to bead-probe complex in solution instead of traditional strategy including genomic library construction and screening. Results A new couple of SINEs and LINEs that shared an almost identical 3'tail was isolated and characterized in silver carp and bighead carp of two closely related species. These SINEs (34 members), designated HAmo SINE family, were little divergent in sequence and flanked by obvious TSD indicated that HAmo SINE was very young family. The copy numbers of this family was estimated to 2 × 105 and 1.7 × 105 per haploid genome by Real-Time qPCR, respectively. The LINEs, identified as the homologs of LINE2 in other fishes, had a conserved primary sequence and secondary structures of the 3'tail region that was almost identical to that of HAmo SINE. These evidences suggest that HAmo SINEs are active and amplified recently utilizing the enzymatic machinery for retroposition of HAmoL2 through the recognition of higher-order structures of the conserved 42-tail region. We analyzed the possible structures of HAmo SINE that lead to successful amplification in genome and then deduced that HAmo SINE, SmaI SINE and FokI SINE that were similar in sequence each other, were probably generated independently and created by LINE family within the same lineage of a LINE phylogeny in the genomes of different hosts. Conclusion The presented results show the advantage of the novel method for retroposons isolation and a pair of young SINE family and its partner LINE family in two carp fishes, which strengthened
Directory of Open Access Journals (Sweden)
Guo Baocheng
2009-02-01
Full Text Available Abstract Background Short and long interspersed elements (SINEs and LINEs, respectively, two types of retroposons, are active in shaping the architecture of genomes and powerful tools for studies of phylogeny and population biology. Here we developed special protocol to apply biotin-streptavidin bead system into isolation of interspersed repeated sequences rapidly and efficiently, in which SINEs and LINEs were captured directly from digested genomic DNA by hybridization to bead-probe complex in solution instead of traditional strategy including genomic library construction and screening. Results A new couple of SINEs and LINEs that shared an almost identical 3'tail was isolated and characterized in silver carp and bighead carp of two closely related species. These SINEs (34 members, designated HAmo SINE family, were little divergent in sequence and flanked by obvious TSD indicated that HAmo SINE was very young family. The copy numbers of this family was estimated to 2 × 105 and 1.7 × 105 per haploid genome by Real-Time qPCR, respectively. The LINEs, identified as the homologs of LINE2 in other fishes, had a conserved primary sequence and secondary structures of the 3'tail region that was almost identical to that of HAmo SINE. These evidences suggest that HAmo SINEs are active and amplified recently utilizing the enzymatic machinery for retroposition of HAmoL2 through the recognition of higher-order structures of the conserved 42-tail region. We analyzed the possible structures of HAmo SINE that lead to successful amplification in genome and then deduced that HAmo SINE, SmaI SINE and FokI SINE that were similar in sequence each other, were probably generated independently and created by LINE family within the same lineage of a LINE phylogeny in the genomes of different hosts. Conclusion The presented results show the advantage of the novel method for retroposons isolation and a pair of young SINE family and its partner LINE family in two carp
Identification of a Recently Active Mammalian SINE Derived from Ribosomal RNA
Longo, Mark S.; Brown, Judy D.; Zhang, Chu; O’Neill, Michael J.; O’Neill, Rachel J.
2015-01-01
Complex eukaryotic genomes are riddled with repeated sequences whose derivation does not coincide with phylogenetic history and thus is often unknown. Among such sequences, the capacity for transcriptional activity coupled with the adaptive use of reverse transcription can lead to a diverse group of genomic elements across taxa, otherwise known as selfish elements or mobile elements. Short interspersed nuclear elements (SINEs) are nonautonomous mobile elements found in eukaryotic genomes, typically derived from cellular RNAs such as tRNAs, 7SL or 5S rRNA. Here, we identify and characterize a previously unknown SINE derived from the 3′-end of the large ribosomal subunit (LSU or 28S rDNA) and transcribed via RNA polymerase III. This new element, SINE28, is represented in low-copy numbers in the human reference genome assembly, wherein we have identified 27 discrete loci. Phylogenetic analysis indicates these elements have been transpositionally active within primate lineages as recently as 6 MYA while modern humans still carry transcriptionally active copies. Moreover, we have identified SINE28s in all currently available assembled mammalian genome sequences. Phylogenetic comparisons indicate that these elements are frequently rederived from the highly conserved LSU rRNA sequences in a lineage-specific manner. We propose that this element has not been previously recognized as a SINE given its high identity to the canonical LSU, and that SINE28 likely represents one of possibly many unidentified, active transposable elements within mammalian genomes. PMID:25637222
SINE Retrotransposition: Evaluation of Alu Activity and Recovery of De Novo Inserts.
Ade, Catherine; Roy-Engel, Astrid M
2016-01-01
Mobile element activity is of great interest due to its impact on genomes. However, the types of mobile elements that inhabit any given genome are remarkably varied. Among the different varieties of mobile elements, the Short Interspersed Elements (SINEs) populate many genomes, including many mammalian species. Although SINEs are parasites of Long Interspersed Elements (LINEs), SINEs have been highly successful in both the primate and rodent genomes. When comparing copy numbers in mammals, SINEs have been vastly more successful than other nonautonomous elements, such as the retropseudogenes and SVA. Interestingly, in the human genome the copy number of Alu (a primate SINE) outnumbers LINE-1 (L1) copies 2 to 1. Estimates suggest that the retrotransposition rate for Alu is tenfold higher than LINE-1 with about 1 insert in every twenty births. Furthermore, Alu-induced mutagenesis is responsible for the majority of the documented instances of human retroelement insertion-induced disease. However, little is known on what contributes to these observed differences between SINEs and LINEs. The development of an assay to monitor SINE retrotransposition in culture has become an important tool for the elucidation of some of these differences. In this chapter, we present details of the SINE retrotransposition assay and the recovery of de novo inserts. We also focus on the nuances that are unique to the SINE assay.
Kramerov, Dmitri A; Vassetzky, Nikita S
2011-01-01
Short interspersed elements (SINEs) are mobile genetic elements that invade the genomes of many eukaryotes. Since their discovery about 30 years ago, many gaps in our understanding of the biology and function of SINEs have been filled. This review summarizes the past and recent advances in the studies of SINEs. The structure and origin of SINEs as well as the processes involved in their amplification, transcription, RNA processing, reverse transcription, and integration of a SINE copy into the genome are considered. Then we focus on the significance of SINEs for the host genomes. While these genomic parasites can be deleterious to the cell, the long-term being in the genome has made SINEs a valuable source of genetic variation providing regulatory elements for gene expression, alternative splice sites, polyadenylation signals, and even functional RNA genes. Copyright © 2011 John Wiley & Sons, Ltd.
MetaSINEs: Broad Distribution of a Novel SINE Superfamily in Animals.
Nishihara, Hidenori; Plazzi, Federico; Passamonti, Marco; Okada, Norihiro
2016-02-12
SINEs (short interspersed elements) are transposable elements that typically originate independently in each taxonomic clade (order/family). However, some SINE families share a highly similar central sequence and are thus categorized as a SINE superfamily. Although only four SINE superfamilies (CORE-SINEs, V-SINEs, DeuSINEs, and Ceph-SINEs) have been reported so far, it is expected that new SINE superfamilies would be discovered by deep exploration of new SINEs in metazoan genomes. Here we describe 15 SINEs, among which 13 are novel, that have a similar 66-bp central region and therefore constitute a new SINE superfamily, MetaSINEs. MetaSINEs are distributed from fish to cnidarians, suggesting their common evolutionary origin at least 640 Ma. Because the 3' tails of MetaSINEs are variable, these SINEs most likely survived by changing their partner long interspersed elements for retrotransposition during evolution. Furthermore, we examined the presence of members of other SINE superfamilies in bivalve genomes and characterized eight new SINEs belonging to the CORE-SINEs, V-SINEs, and DeuSINEs, in addition to the MetaSINEs. The broad distribution of bivalve SINEs suggests that at least three SINEs originated in the common ancestor of Bivalvia. Our comparative analysis of the central domains of the SINEs revealed that, in each superfamily, only a restricted region is shared among all of its members. Because the functions of the central domains of the SINE superfamilies remain unknown, such structural information of SINE superfamilies will be useful for future experimental and comparative analyses to reveal why they have been retained in metazoan genomes during evolution. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
MetaSINEs: Broad Distribution of a Novel SINE Superfamily in Animals
Nishihara, Hidenori; Plazzi, Federico; Passamonti, Marco; Okada, Norihiro
2016-01-01
SINEs (short interspersed elements) are transposable elements that typically originate independently in each taxonomic clade (order/family). However, some SINE families share a highly similar central sequence and are thus categorized as a SINE superfamily. Although only four SINE superfamilies (CORE-SINEs, V-SINEs, DeuSINEs, and Ceph-SINEs) have been reported so far, it is expected that new SINE superfamilies would be discovered by deep exploration of new SINEs in metazoan genomes. Here we de...
Isolation and characterization of active LINE and SINEs from the eel.
Kajikawa, Masaki; Ichiyanagi, Kenji; Tanaka, Nozomu; Okada, Norihiro
2005-03-01
Long interspersed elements (LINEs) and short interspersed elements (SINEs) are retrotransposons. These elements can mobilize by the "copy-and-paste" mechanism, in which their own RNA is reverse-transcribed into complementary DNA (cDNA). LINEs and SINEs not only are components of eukaryotic genomes but also drivers of genomic evolution. Thus, studies of the amplification mechanism of LINEs and SINEs are important for understanding eukaryotic genome evolution. Here we report the characterization of one LINE family (UnaL2) and two SINE families (UnaSINE1 and UnaSINE2) from the eel (Anguilla japonica) genome. UnaL2 is approximately 3.6 kilobases (kb) and encodes only one open reading frame (ORF). UnaL2 belongs to the stringent type--thought to be a major group of LINEs--and can mobilize in HeLa cells. We also show that UnaL2 and the two UnaSINEs have similar 3' tails, and that both UnaSINE1 and UnaSINE2 can be mobilized by UnaL2 in HeLa cells. These elements are thus useful for delineating the amplification mechanism of stringent type LINEs as well as that of SINEs.
PCR-based approach to SINE isolation: simple and complex SINEs.
Borodulina, Olga R; Kramerov, Dmitri A
2005-04-11
Highly repeated copies of short interspersed elements (SINEs) occur in eukaryotic genomes. The distribution of each SINE family is usually restricted to some genera, families, or orders. SINEs have an RNA polymerase III internal promoter, which is composed of boxes A and B. Here we propose a method for isolation of novel SINE families based on genomic DNA PCR with oligonucleotide identical to box A as a primer. Cloning of the size-heterogeneous PCR-products and sequencing of their terminal regions allow determination of SINE structure. Using this approach, two novel SINE families, Rhin-1 and Das-1, from the genomes of great horseshoe bat (Rhinolophus ferrumequinum) and nine-banded armadillo (Dasypus novemcinctus), respectively, were isolated and studied. The distribution of Rhin-1 is restricted to two of six bat families tested. Copies of this SINE are characterized by frequent internal insertions and significant length (200-270 bp). Das-1 being only 90 bp in length is one of the shortest SINEs known. Most of Das-1 nucleotide sequences demonstrate significant similarity to alanine tRNA which appears to be an evolutionary progenitor of this SINE. Together with three other known SINEs (ID, Vic-1, and CYN), Das-1 constitutes a group of simple SINEs. Interestingly, three SINE families of this group are alanine tRNA-derived. Most probably, this tRNA gave rise to short and simple but successful SINEs several times during mammalian evolution.
Bov-B-mobilized SINEs in vertebrate genomes.
Gogolevsky, Konstantin P; Vassetzky, Nikita S; Kramerov, Dmitri A
2008-01-15
Two new short retroposon families (SINEs) have been found in the genome of springhare Pedetes capensis (Rodentia). One of them, Ped-1, originated from 5S rRNA, while the other one, Ped-2, originated from tRNA-derived SINE ID. In contrast to most currently active mammalian SINEs mobilized by L1 long retrotransposon (LINE), Ped-1 and Ped-2 are mobilized by Bov-B, a LINE family of the widely distributed RTE clade. The 3' part of these SINEs originates from two sequences in the 5' and 3' regions of Bov-B. Such bipartite structure of the LINE-derived part has been revealed in all Bov-B-mobilized SINEs known to date (AfroSINE, Bov-tA, Mar-1, and Ped-1/2), which distinguishes them from other SINEs with only a 3' LINE-derived part. Structural analysis and the distribution of Bov-B LINEs and partner SINEs supports the horizontal transfer of Bov-B, while the SINEs emerged independently in lineages with this LINE.
SINEs as driving forces in genome evolution.
Schmitz, J
2012-01-01
SINEs are short interspersed elements derived from cellular RNAs that repetitively retropose via RNA intermediates and integrate more or less randomly back into the genome. SINEs propagate almost entirely vertically within their host cells and, once established in the germline, are passed on from generation to generation. As non-autonomous elements, their reverse transcription (from RNA to cDNA) and genomic integration depends on the activity of the enzymatic machinery of autonomous retrotransposons, such as long interspersed elements (LINEs). SINEs are widely distributed in eukaryotes, but are especially effectively propagated in mammalian species. For example, more than a million Alu-SINE copies populate the human genome (approximately 13% of genomic space), and few master copies of them are still active. In the organisms where they occur, SINEs are a challenge to genomic integrity, but in the long term also can serve as beneficial building blocks for evolution, contributing to phenotypic heterogeneity and modifying gene regulatory networks. They substantially expand the genomic space and introduce structural variation to the genome. SINEs have the potential to mutate genes, to alter gene expression, and to generate new parts of genes. A balanced distribution and controlled activity of such properties is crucial to maintaining the organism's dynamic and thriving evolution. Copyright © 2012 S. Karger AG, Basel.
Carnivore-specific SINEs (Can-SINEs): distribution, evolution, and genomic impact.
Walters-Conte, Kathryn B; Johnson, Diana L E; Allard, Marc W; Pecon-Slattery, Jill
2011-01-01
Short interspersed nuclear elements (SINEs) are a type of class 1 transposable element (retrotransposon) with features that allow investigators to resolve evolutionary relationships between populations and species while providing insight into genome composition and function. Characterization of a Carnivora-specific SINE family, Can-SINEs, has, has aided comparative genomic studies by providing rare genomic changes, and neutral sequence variants often needed to resolve difficult evolutionary questions. In addition, Can-SINEs constitute a significant source of functional diversity with Carnivora. Publication of the whole-genome sequence of domestic dog, domestic cat, and giant panda serves as a valuable resource in comparative genomic inferences gleaned from Can-SINEs. In anticipation of forthcoming studies bolstered by new genomic data, this review describes the discovery and characterization of Can-SINE motifs as well as describes composition, distribution, and effect on genome function. As the contribution of noncoding sequences to genomic diversity becomes more apparent, SINEs and other transposable elements will play an increasingly large role in mammalian comparative genomics.
Ben-David, Smadar; Yaakov, Beery; Kashkush, Khalil
2013-10-01
Short interspersed nuclear elements (SINEs) are non-autonomous non-LTR retroelements that are present in most eukaryotic species. While SINEs have been intensively investigated in humans and other animal systems, they are poorly studied in plants, especially in wheat (Triticum aestivum). We used quantitative PCR of various wheat species to determine the copy number of a wheat SINE family, termed Au SINE, combined with computer-assisted analyses of the publicly available 454 pyrosequencing database of T. aestivum. In addition, we utilized site-specific PCR on 57 Au SINE insertions, transposon methylation display and transposon display on newly formed wheat polyploids to assess retrotranspositional activity, epigenetic status and genetic rearrangements in Au SINE, respectively. We retrieved 3706 different insertions of Au SINE from the 454 pyrosequencing database of T. aestivum, and found that most of the elements are inserted in A/T-rich regions, while approximately 38% of the insertions are associated with transcribed regions, including known wheat genes. We observed typical retrotransposition of Au SINE in the second generation of a newly formed wheat allohexaploid, and massive hypermethylation in CCGG sites surrounding Au SINE in the third generation. Finally, we observed huge differences in the copy numbers in diploid Triticum and Aegilops species, and a significant increase in the copy numbers in natural wheat polyploids, but no significant increase in the copy number of Au SINE in the first four generations for two of three newly formed allopolyploid species used in this study. Our data indicate that SINEs may play a prominent role in the genomic evolution of wheat through stress-induced activation. © 2013 Ben-Gurion University The Plant Journal © 2013 John Wiley & Sons Ltd.
The Evolution of SINEs and LINEs in the genus Chironomus (Diptera).
Papusheva, Ekaterina; Gruhl, Mary C; Berezikov, Eugene; Groudieva, Tatiana; Scherbik, Svetlana V; Martin, Jon; Blinov, Alexander; Bergtrom, Gerald
2004-03-01
Genomic DNA amplification from 51 species of the family Chironomidae shows that most contain relatives of NLRCth1 LINE and CTRT1 SINE retrotransposons first found in Chironomus thummi. More than 300 cloned PCR products were sequenced. The amplified region of the reverse transcriptase gene in the LINEs is intact and highly conserved, suggesting active elements. The SINEs are less conserved, consistent with minimal/no selection after transposition. A mitochondrial gene phylogeny resolves the Chironomus genus into six lineages (Guryev et al. 2001). LINE and SINE phylogenies resolve five of these lineages, indicating their monophyletic origin and vertical inheritance. However, both the LINE and the SINE tree topologies differ from the species phylogeny, resolving the elements into "clusters I-IV" and "cluster V" families. The data suggest a descent of all LINE and SINE subfamilies from two major families. Based on the species phylogeny, a few LINEs and a larger number of SINEs are cladisitically misplaced. Most misbranch with LINEs or SINEs from species with the same families of elements. From sequence comparisons, cladistically misplaced LINEs and several misplaced SINEs arose by convergent base substitutions. More diverged SINEs result from early transposition and some are derived from multiple source SINEs in the same species. SINEs from two species (C. dorsalis, C. pallidivittatus), expected to belong to the clusters I-IV family, branch instead with cluster V family SINEs; apparently both families predate separation of cluster V from clusters I-IV species. Correlation of the distribution of active SINEs and LINEs, as well as similar 3' sequence motifs in CTRT1 and NLRCth1, suggests coevolving retrotransposon pairs in which CTRT1 transposition depends on enzymes active during NLRCth1 LINE mobility.
SINEs, evolution and genome structure in the opossum.
Gu, Wanjun; Ray, David A; Walker, Jerilyn A; Barnes, Erin W; Gentles, Andrew J; Samollow, Paul B; Jurka, Jerzy; Batzer, Mark A; Pollock, David D
2007-07-01
Short INterspersed Elements (SINEs) are non-autonomous retrotransposons, usually between 100 and 500 base pairs (bp) in length, which are ubiquitous components of eukaryotic genomes. Their activity, distribution, and evolution can be highly informative on genomic structure and evolutionary processes. To determine recent activity, we amplified more than one hundred SINE1 loci in a panel of 43 M. domestica individuals derived from five diverse geographic locations. The SINE1 family has expanded recently enough that many loci were polymorphic, and the SINE1 insertion-based genetic distances among populations reflected geographic distance. Genome-wide comparisons of SINE1 densities and GC content revealed that high SINE1 density is associated with high GC content in a few long and many short spans. Young SINE1s, whether fixed or polymorphic, showed an unbiased GC content preference for insertion, indicating that the GC preference accumulates over long time periods, possibly in periodic bursts. SINE1 evolution is thus broadly similar to human Alu evolution, although it has an independent origin. High GC content adjacent to SINE1s is strongly correlated with bias towards higher AT to GC substitutions and lower GC to AT substitutions. This is consistent with biased gene conversion, and also indicates that like chickens, but unlike eutherian mammals, GC content heterogeneity (isochore structure) is reinforced by substitution processes in the M. domestica genome. Nevertheless, both high and low GC content regions are apparently headed towards lower GC content equilibria, possibly due to a relative shift to lower recombination rates in the recent Monodelphis ancestral lineage. Like eutherians, metatherian (marsupial) mammals have evolved high CpG substitution rates, but this is apparently a convergence in process rather than a shared ancestral state.
The dynamic proliferation of CanSINEs mirrors the complex evolution of Feliforms
2014-01-01
Background Repetitive short interspersed elements (SINEs) are retrotransposons ubiquitous in mammalian genomes and are highly informative markers to identify species and phylogenetic associations. Of these, SINEs unique to the order Carnivora (CanSINEs) yield novel insights on genome evolution in domestic dogs and cats, but less is known about their role in related carnivores. In particular, genome-wide assessment of CanSINE evolution has yet to be completed across the Feliformia (cat-like) suborder of Carnivora. Within Feliformia, the cat family Felidae is composed of 37 species and numerous subspecies organized into eight monophyletic lineages that likely arose 10 million years ago. Using the Felidae family as a reference phylogeny, along with representative taxa from other families of Feliformia, the origin, proliferation and evolution of CanSINEs within the suborder were assessed. Results We identified 93 novel intergenic CanSINE loci in Feliformia. Sequence analyses separated Feliform CanSINEs into two subfamilies, each characterized by distinct RNA polymerase binding motifs and phylogenetic associations. Subfamily I CanSINEs arose early within Feliformia but are no longer under active proliferation. Subfamily II loci are more recent, exclusive to Felidae and show evidence for adaptation to extant RNA polymerase activity. Further, presence/absence distributions of CanSINE loci are largely congruent with taxonomic expectations within Feliformia and the less resolved nodes in the Felidae reference phylogeny present equally ambiguous CanSINE data. SINEs are thought to be nearly impervious to excision from the genome. However, we observed a nearly complete excision of a CanSINEs locus in puma (Puma concolor). In addition, we found that CanSINE proliferation in Felidae frequently targeted existing CanSINE loci for insertion sites, resulting in tandem arrays. Conclusions We demonstrate the existence of at least two SINE families within the Feliformia suborder, one
Enhancer SINEs Link Pol III to Pol II Transcription in Neurons
Directory of Open Access Journals (Sweden)
Cristina Policarpi
2017-12-01
Full Text Available Summary: Spatiotemporal regulation of gene expression depends on the cooperation of multiple mechanisms, including the functional interaction of promoters with distally located enhancers. Here, we show that, in cortical neurons, a subset of short interspersed nuclear elements (SINEs located in the proximity of activity-regulated genes bears features of enhancers. Enhancer SINEs (eSINEs recruit the Pol III cofactor complex TFIIIC in a stimulus-dependent manner and are transcribed by Pol III in response to neuronal depolarization. Characterization of an eSINE located in proximity to the Fos gene (FosRSINE1 indicated that the FosRSINE1-encoded transcript interacts with Pol II at the Fos promoter and mediates Fos relocation to Pol II factories, providing an unprecedented molecular link between Pol III and Pol II transcription. Strikingly, knockdown of the FosRSINE1 transcript induces defects of both cortical radial migration in vivo and activity-dependent dendritogenesis in vitro, demonstrating that FosRSINE1 acts as a strong enhancer of Fos expression in diverse physiological contexts. : Spatiotemporal regulation of gene expression requires the interaction between promoters and distally located enhancers. Policarpi et al. identify a subset of SINEs that functions as enhancers for activity-dependent neuronal genes. The enhancer SINE FosRSINE1 regulates Fos transcription and is necessary for both activity-dependent dendritogenesis and proper brain development. Keywords: neuroscience, epigenetics, transcription, enhancers, SINEs, neuronal activity, neuronal development
Mao, Hongliang; Wang, Hao
2017-03-01
Short Interspersed Nuclear Elements (SINEs) are transposable elements (TEs) that amplify through a copy-and-paste mode via RNA intermediates. The computational identification of new SINEs are challenging because of their weak structural signals and rapid diversification in sequences. Here we report SINE_Scan, a highly efficient program to predict SINE elements in genomic DNA sequences. SINE_Scan integrates hallmark of SINE transposition, copy number and structural signals to identify a SINE element. SINE_Scan outperforms the previously published de novo SINE discovery program. It shows high sensitivity and specificity in 19 plant and animal genome assemblies, of which sizes vary from 120 Mb to 3.5 Gb. It identifies numerous new families and substantially increases the estimation of the abundance of SINEs in these genomes. The code of SINE_Scan is freely available at http://github.com/maohlzj/SINE_Scan , implemented in PERL and supported on Linux. wangh8@fudan.edu.cn. Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press.
Deragon, Jean-Marc; Zhang, Xiaoyu
2006-12-01
Short interspersed elements (SINEs) are a class of dispersed mobile sequences that use RNA as an intermediate in an amplification process called retroposition. The presence-absence of a SINE at a given locus has been used as a meaningful classification criterion to evaluate phylogenetic relations among species. We review here recent developments in the characterisation of plant SINEs and their use as molecular makers to retrace phylogenetic relations among wild and cultivated Oryza and Brassica species. In Brassicaceae, further use of SINE markers is limited by our partial knowledge of endogenous SINE families (their origin and evolution histories) and by the absence of a clear classification. To solve this problem, phylogenetic relations among all known Brassicaceae SINEs were analyzed and a new classification, grouping SINEs in 15 different families, is proposed. The relative age and size of each Brassicaceae SINE family was evaluated and new phylogenetically supported subfamilies were described. We also present evidence suggesting that new potentially active SINEs recently emerged in Brassica oleracea from the shuffling of preexisting SINE portions. Finally, the comparative evolution history of SINE families present in Arabidopsis thaliana and Brassica oleracea revealed that SINEs were in general more active in the Brassica lineage. The importance of these new data for the use of Brassicaceae SINEs as molecular markers in future applications is discussed.
Ogiwara, Ikuo; Miya, Masaki; Ohshima, Kazuhiko; Okada, Norihiro
2002-01-01
We have identified a new superfamily of vertebrate short interspersed repetitive elements (SINEs), designated V-SINEs, that are widespread in fishes and frogs. Each V-SINE includes a central conserved domain preceded by a 5′-end tRNA-related region and followed by a potentially recombinogenic (TG)n tract, with a 3′ tail derived from the 3′ untranslated region (UTR) of the corresponding partner long interspersed repetitive element (LINE) that encodes a functional reverse transcriptase. The central domain is strongly conserved and is even found in SINEs in the lamprey genome, suggesting that V-SINEs might be ∼550 Myr old or older in view of the timing of divergence of the lamprey lineage from the bony fish lineage. The central conserved domain might have been subject to some form of positive selection. Although the contemporary 3′ tails of V-SINEs differ from one another, it is possible that the original 3′ tail might have been replaced, via recombination, by the 3′ tails of more active partner LINEs, thereby retaining retropositional activity and the ability to survive for long periods on the evolutionary time scale. It seems plausible that V-SINEs may have some function(s) that have been maintained by the coevolution of SINEs and LINEs during the evolution of vertebrates. [The sequences reported in this paper have been deposited in the DDBJ/GenBank database under accession nos. AB072981–AB073004. Supplemental figures are available online at http://www.genome.org.] PMID:11827951
Selective activation of primary afferent fibers evaluated by sine-wave electrical stimulation
Directory of Open Access Journals (Sweden)
Katafuchi Toshihiko
2005-03-01
Full Text Available Abstract Transcutaneous sine-wave stimuli at frequencies of 2000, 250 and 5 Hz (Neurometer are thought to selectively activate Aβ, Aδ and C afferent fibers, respectively. However, there are few reports to test the selectivity of these stimuli at the cellular level. In the present study, we analyzed action potentials (APs generated by sine-wave stimuli applied to the dorsal root in acutely isolated rat dorsal root ganglion (DRG preparations using intracellular recordings. We also measured excitatory synaptic responses evoked by transcutaneous stimuli in substantia gelatinosa (SG neurons of the spinal dorsal horn, which receive inputs predominantly from C and Aδ fibers, using in vivo patch-clamp recordings. In behavioral studies, escape or vocalization behavior of rats was observed with both 250 and 5 Hz stimuli at intensity of ~0.8 mA (T5/ T250, whereas with 2000 Hz stimulation, much higher intensity (2.14 mA, T2000 was required. In DRG neurons, APs were generated at T5/T250 by 2000 Hz stimulation in Aβ, by 250 Hz stimulation both in Aβ and Aδ, and by 5 Hz stimulation in all three classes of DRG neurons. However, the AP frequencies elicited in Aβ and Aδ by 5 Hz stimulation were much less than those reported previously in physiological condition. With in vivo experiments large amplitude of EPSCs in SG neurons were elicited by 250 and 5 Hz stimuli at T5/ T250. These results suggest that 2000 Hz stimulation excites selectively Aβ fibers and 5 Hz stimulation activates noxious transmission mediated mainly through C fibers. Although 250 Hz stimulation activates both Aδ and Aβ fibers, tactile sensation would not be perceived when painful sensation is produced at the same time. Therefore, 250 Hz was effective stimulus frequency for activation of Aδ fibers initiating noxious sensation. Thus, the transcutaneous sine-wave stimulation can be applied to evaluate functional changes of sensory transmission by comparing thresholds with the three
Exact solutions to sine-Gordon-type equations
International Nuclear Information System (INIS)
Liu Shikuo; Fu Zuntao; Liu Shida
2006-01-01
In this Letter, sine-Gordon-type equations, including single sine-Gordon equation, double sine-Gordon equation and triple sine-Gordon equation, are systematically solved by Jacobi elliptic function expansion method. It is shown that different transformations for these three sine-Gordon-type equations play different roles in obtaining exact solutions, some transformations may not work for a specific sine-Gordon equation, while work for other sine-Gordon equations
Genome-wide mapping of infection-induced SINE RNAs reveals a role in selective mRNA export.
Karijolich, John; Zhao, Yang; Alla, Ravi; Glaunsinger, Britt
2017-06-02
Short interspersed nuclear elements (SINEs) are retrotransposons evolutionarily derived from endogenous RNA Polymerase III RNAs. Though SINE elements have undergone exaptation into gene regulatory elements, how transcribed SINE RNA impacts transcriptional and post-transcriptional regulation is largely unknown. This is partly due to a lack of information regarding which of the loci have transcriptional potential. Here, we present an approach (short interspersed nuclear element sequencing, SINE-seq), which selectively profiles RNA Polymerase III-derived SINE RNA, thereby identifying transcriptionally active SINE loci. Applying SINE-seq to monitor murine B2 SINE expression during a gammaherpesvirus infection revealed transcription from 28 270 SINE loci, with ∼50% of active SINE elements residing within annotated RNA Polymerase II loci. Furthermore, B2 RNA can form intermolecular RNA-RNA interactions with complementary mRNAs, leading to nuclear retention of the targeted mRNA via a mechanism involving p54nrb. These findings illuminate a pathway for the selective regulation of mRNA export during stress via retrotransposon activation. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.
Recombinant SINEs are formed at high frequency during induced retrotransposition in vivo.
Yadav, Vijay Pal; Mandal, Prabhat Kumar; Bhattacharya, Alok; Bhattacharya, Sudha
2012-05-22
Non-long terminal repeat Retrotransposons are referred to as long interspersed nuclear elements (LINEs) and their non-autonomous partners are short interspersed nuclear elements (SINEs). It is believed that an active SINE copy, upon retrotransposition, generates near identical copies of itself, which subsequently accumulate mutations resulting in sequence polymorphism. Here we show that when a retrotransposition-competent cell line of the parasitic protist Entamoeba histolytica, transfected with a marked SINE copy, is induced to retrotranspose, >20% of the newly retrotransposed copies are neither identical to the marked SINE nor to the mobilized resident SINEs. Rather they are recombinants of resident SINEs and the marked SINE. They are a consequence of retrotransposition and not DNA recombination, as they are absent in cells not expressing the retrotransposition functions. This high-frequency recombination provides a new explanation for the existence of mosaic SINEs, which may impact on genetic analysis of SINE lineages, and measurement of phylogenetic distances.
Novel SINEs families in Medicago truncatula and Lotus japonicus: bioinformatic analysis.
Gadzalski, Marek; Sakowicz, Tomasz
2011-07-01
Although short interspersed elements (SINEs) were discovered nearly 30 years ago, the studies of these genomic repeats were mostly limited to animal genomes. Very little is known about SINEs in legumes--one of the most important plant families. Here we report identification, genomic distribution and molecular features of six novel SINE elements in Lotus japonicus (named LJ_SINE-1, -2, -3) and Medicago truncatula (MT_SINE-1, -2, -3), model species of legume. They possess all the structural features commonly found in short interspersed elements including RNA polymerase III promoter, polyA tail and flanking repeats. SINEs described here are present in low to moderate copy numbers from 150 to 3000. Bioinformatic analyses were used to searched public databases, we have shown that three of new SINE elements from M. truncatula seem to be characteristic of Medicago and Trifolium genera. Two SINE families have been found in L. japonicus and one is present in both M. truncatula and L. japonicus. In addition, we are discussing potential activities of the described elements. Copyright © 2011 Elsevier B.V. All rights reserved.
Sauria SINEs: Novel short interspersed retroposable elements that are widespread in reptile genomes.
Piskurek, Oliver; Austin, Christopher C; Okada, Norihiro
2006-05-01
SINEs are short interspersed retrotransposable elements that invade new genomic sites. Their retrotransposition depends on reverse transcriptase and endonuclease activities encoded by partner LINEs (long interspersed elements). Recent genomic research has demonstrated that retroposons account for at least 40% of the human genome. Hitherto, more than 30 families of SINEs have been characterized in mammalian genomes, comprising approximately 4600 extant species; the distribution and extent of SINEs in reptilian genomes, however, are poorly documented. With more than 7400 species of lizards and snakes, Squamata constitutes the largest and most diverse group of living reptiles. We have discovered and characterized a novel SINE family, Sauria SINEs, whose members are widely distributed among genomes of lizards, snakes, and tuataras. Sauria SINEs comprise a 5' tRNA-related region, a tRNA-unrelated region, and a 3' tail region (containing short tandem repeats) derived from LINEs. We distinguished eight Sauria SINE subfamilies in genomes of four major squamate lineages and investigated their evolutionary relationships. Our data illustrate the overall efficacy of Sauria SINEs as novel retrotransposable markers for elucidation of squamate evolutionary history. We show that all Sauria SINEs share an identical 3' sequence with Bov-B LINEs and propose that they utilize the enzymatic machinery of Bov-B LINEs for their own retrotransposition. This finding, along with the ubiquity of Bov-B LINEs previously demonstrated in squamate genomes, suggests that these LINEs have been an active partner of Sauria SINEs since this SINE family was generated more than 200 million years ago.
Matveev, Vitaliy; Nishihara, Hidenori; Okada, Norihiro
2007-08-01
Short interspersed elements (SINEs) constitute a group of retroposons propagating in the genome via a mechanism of reverse transcription, in which they depend on the enzymatic machinery of long retroposons (LINEs). Over 70 SINE families have been described to date from the genomes of various eukaryotes. Here, we characterize two novel SINEs from salmons (Actinopterygii: Salmonoidei). The first family, termed SlmI, was shown to be widespread among all genera of the suborder. These SINEs have a tRNA(Leu)-related promoter region at their 5'-end, a unique central conserved domain with a subfamily-specific region, and an end with RSg-1-LINE-derived 3'-terminus preceding the A/T-rich tail. The same LINE-related segment is also shared by two other salmonid SINEs: HpaI and OS-SINE1. The structural peculiarities and overall sequence identity of the SlmI 3'-terminus suggest that it has been acquired from HpaI SINEs but not directly from the partner LINE. This region plays a crucial role in the process of retrotransposition of short interspersed elements, and the case of its SINE-to-SINE transmission is the first recorded to date. Possible scenarios and potential evolutionary implications of the observed interaction between short retroposons are discussed. Apart from the above, we found a copy of the SlmI SINE in the GenBank entry for the blood fluke, Schistosoma japonicum (Trematoda: Strigeiformes) -- a trematode causing one of the most important human helminth infections, with its genome known to host other groups of salmonoid retroposons. In the present article, we suggest our views with regard to possible ways in which such an intensive horizontal transfer of salmonoid retroposons to the schistosomal genome occurs. The second novel SINE family, termed SlmII, originates from one of the SlmI subfamilies, with which it shares the same tRNA-related region, central domain, and a part of RSg-1-derived segment, but has a different 3'-tail of unidentified origin. Its distribution
International Nuclear Information System (INIS)
Kaelbermann, G
2004-01-01
Nonperturbative, oscillatory, winding number 1 solutions of the sine-Gordon equation are presented and studied numerically. We call these nonperturbative shape modes wobble solitons. Perturbed sine-Gordon kinks are found to decay to wobble solitons
High SINE RNA Expression Correlates with Post-Transcriptional Downregulation of BRCA1
Directory of Open Access Journals (Sweden)
Giovanni Bosco
2013-04-01
Full Text Available Short Interspersed Nuclear Elements (SINEs are non-autonomous retrotransposons that comprise a large fraction of the human genome. SINEs are demethylated in human disease, but whether SINEs become transcriptionally induced and how the resulting transcripts may affect the expression of protein coding genes is unknown. Here, we show that downregulation of the mRNA of the tumor suppressor gene BRCA1 is associated with increased transcription of SINEs and production of sense and antisense SINE small RNAs. We find that BRCA1 mRNA is post-transcriptionally down-regulated in a Dicer and Drosha dependent manner and that expression of a SINE inverted repeat with sequence identity to a BRCA1 intron is sufficient for downregulation of BRCA1 mRNA. These observations suggest that transcriptional activation of SINEs could contribute to a novel mechanism of RNA mediated post-transcriptional silencing of human genes.
5S rRNA-derived and tRNA-derived SINEs in fruit bats.
Gogolevsky, Konstantin P; Vassetzky, Nikita S; Kramerov, Dmitri A
2009-05-01
Most short retroposons (SINEs) descend from cellular tRNA of 7SL RNA. Here, four new SINEs were found in megabats (Megachiroptera) but neither in microbats nor in other mammals. Two of them, MEG-RS and MEG-RL, descend from another cellular RNA, 5S rRNA; one (MEG-T2) is a tRNA-derived SINE; and MEG-TR is a hybrid tRNA/5S rRNA SINE. Insertion locus analysis suggests that these SINEs were active in the recent fruit bat evolution. Analysis of MEG-RS and MEG-RL in comparison with other few 5S rRNA-derived SINEs demonstrates that the internal RNA polymerase III promoter is their most invariant region, while the secondary structure is more variable. The mechanisms underlying the modular structure of these and other SINEs as well as their variation are discussed. The scenario of evolution of MEG SINEs is proposed.
Sines and Cosines. Part 1 of 3
Apostol, Tom M. (Editor)
1992-01-01
Applying the concept of similarities, the mathematical principles of circular motion and sine and cosine waves are presented utilizing both film footage and computer animation in this 'Project Mathematics' series video. Concepts presented include: the symmetry of sine waves; the cosine (complementary sine) and cosine waves; the use of sines and cosines on coordinate systems; the relationship they have to each other; the definitions and uses of periodic waves, square waves, sawtooth waves; the Gibbs phenomena; the use of sines and cosines as ratios; and the terminology related to sines and cosines (frequency, overtone, octave, intensity, and amplitude).
Identification of an active ID-like group of SINEs in the mouse.
Kass, David H; Jamison, Nicole
2007-09-01
The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.
SINEBase: a database and tool for SINE analysis.
Vassetzky, Nikita S; Kramerov, Dmitri A
2013-01-01
SINEBase (http://sines.eimb.ru) integrates the revisited body of knowledge about short interspersed elements (SINEs). A set of formal definitions concerning SINEs was introduced. All available sequence data were screened through these definitions and the genetic elements misidentified as SINEs were discarded. As a result, 175 SINE families have been recognized in animals, flowering plants and green algae. These families were classified by the modular structure of their nucleotide sequences and the frequencies of different patterns were evaluated. These data formed the basis for the database of SINEs. The SINEBase website can be used in two ways: first, to explore the database of SINE families, and second, to analyse candidate SINE sequences using specifically developed tools. This article presents an overview of the database and the process of SINE identification and analysis.
Newly discovered young CORE-SINEs in marsupial genomes.
Munemasa, Maruo; Nikaido, Masato; Nishihara, Hidenori; Donnellan, Stephen; Austin, Christopher C; Okada, Norihiro
2008-01-15
Although recent mammalian genome projects have uncovered a large part of genomic component of various groups, several repetitive sequences still remain to be characterized and classified for particular groups. The short interspersed repetitive elements (SINEs) distributed among marsupial genomes are one example. We have identified and characterized two new SINEs from marsupial genomes that belong to the CORE-SINE family, characterized by a highly conserved "CORE" domain. PCR and genomic dot blot analyses revealed that the distribution of each SINE shows distinct patterns among the marsupial genomes, implying different timing of their retroposition during the evolution of marsupials. The members of Mar3 (Marsupialia 3) SINE are distributed throughout the genomes of all marsupials, whereas the Mac1 (Macropodoidea 1) SINE is distributed specifically in the genomes of kangaroos. Sequence alignment of the Mar3 SINEs revealed that they can be further divided into four subgroups, each of which has diagnostic nucleotides. The insertion patterns of each SINE at particular genomic loci, together with the distribution patterns of each SINE, suggest that the Mar3 SINEs have intensively amplified after the radiation of diprotodontians, whereas the Mac1 SINE has amplified only slightly after the divergence of hypsiprimnodons from other macropods. By compiling the information of CORE-SINEs characterized to date, we propose a comprehensive picture of how SINE evolution occurred in the genomes of marsupials.
Tajaddod, Mansoureh; Tanzer, Andrea; Licht, Konstantin; Wolfinger, Michael T; Badelt, Stefan; Huber, Florian; Pusch, Oliver; Schopoff, Sandy; Janisiw, Michael; Hofacker, Ivo; Jantsch, Michael F
2016-10-25
Short interspersed elements (SINEs) represent the most abundant group of non-long-terminal repeat transposable elements in mammalian genomes. In primates, Alu elements are the most prominent and homogenous representatives of SINEs. Due to their frequent insertion within or close to coding regions, SINEs have been suggested to play a crucial role during genome evolution. Moreover, Alu elements within mRNAs have also been reported to control gene expression at different levels. Here, we undertake a genome-wide analysis of insertion patterns of human Alus within transcribed portions of the genome. Multiple, nearby insertions of SINEs within one transcript are more abundant in tandem orientation than in inverted orientation. Indeed, analysis of transcriptome-wide expression levels of 15 ENCODE cell lines suggests a cis-repressive effect of inverted Alu elements on gene expression. Using reporter assays, we show that the negative effect of inverted SINEs on gene expression is independent of known sensors of double-stranded RNAs. Instead, transcriptional elongation seems impaired, leading to reduced mRNA levels. Our study suggests that there is a bias against multiple SINE insertions that can promote intramolecular base pairing within a transcript. Moreover, at a genome-wide level, mRNAs harboring inverted SINEs are less expressed than mRNAs harboring single or tandemly arranged SINEs. Finally, we demonstrate a novel mechanism by which inverted SINEs can impact on gene expression by interfering with RNA polymerase II.
Borodulina, O R; Kramerov, D A
2001-10-01
Four tRNA-related SINE families were isolated from the genome of the shrew Sorex araneus (SOR element), mole Mogera robusta (TAL element), and hedgehog Mesechinus dauuricus (ERI-1 and ERI-2 elements). Each of these SINEs families is specific for a single Insectivora family: SOR, for Soricidae (shrews); TAL, for Talpidae (moles and desmans); ERI-1 and ERI-2, for Erinaceidae (hedgehogs). There is a long polypyrimidine region (TC-motif) in TAL, ERI-1, and ERI-2 elements located immediately upstream of an A-rich tail with polyadenylation signals (AATAAA) and an RNA polymerase III terminator (T(4-6)) or TCT(3-4)). Ten out of 14 analyzed mammalian tRNA-related SINE families have an A-rich tail similar to that of TAL, ERI-1, and ERI-2 elements. These elements were assigned to class T+. The other four SINEs including SOR element have no polyadenylation signal and transcription terminator in their A-rich tail and were assigned to class T-. Class T+ SINEs occur only in mammals, and most of them have a long polypyrimidine region. Possible models of retroposition of class T+ and T- SINEs are discussed.
Kanhayuwa, Lakkhana; Coutts, Robert H A
2016-01-01
Novel families of short interspersed nuclear element (SINE) sequences in the human pathogenic fungus Aspergillus fumigatus, clinical isolate Af293, were identified and categorised into tRNA-related and 5S rRNA-related SINEs. Eight predicted tRNA-related SINE families originating from different tRNAs, and nominated as AfuSINE2 sequences, contained target site duplications of short direct repeat sequences (4-14 bp) flanking the elements, an extended tRNA-unrelated region and typical features of RNA polymerase III promoter sequences. The elements ranged in size from 140-493 bp and were present in low copy number in the genome and five out of eight were actively transcribed. One putative tRNAArg-derived sequence, AfuSINE2-1a possessed a unique feature of repeated trinucleotide ACT residues at its 3'-terminus. This element was similar in sequence to the I-4_AO element found in A. oryzae and an I-1_AF long nuclear interspersed element-like sequence identified in A. fumigatus Af293. Families of 5S rRNA-related SINE sequences, nominated as AfuSINE3, were also identified and their 5'-5S rRNA-related regions show 50-65% and 60-75% similarity to respectively A. fumigatus 5S rRNAs and SINE3-1_AO found in A. oryzae. A. fumigatus Af293 contains five copies of AfuSINE3 sequences ranging in size from 259-343 bp and two out of five AfuSINE3 sequences were actively transcribed. Investigations on AfuSINE distribution in the fungal genome revealed that the elements are enriched in pericentromeric and subtelomeric regions and inserted within gene-rich regions. We also demonstrated that some, but not all, AfuSINE sequences are targeted by host RNA silencing mechanisms. Finally, we demonstrated that infection of the fungus with mycoviruses had no apparent effects on SINE activity.
On d -Dimensional Lattice (co)sine n -Algebra
International Nuclear Information System (INIS)
Yao Shao-Kui; Zhang Chun-Hong; Zhao Wei-Zhong; Ding Lu; Liu Peng
2016-01-01
We present the (co)sine n-algebra which is indexed by the d-dimensional integer lattice. Due to the associative operators, this generalized (co)sine n-algebra is the higher order Lie algebra for the n even case. The particular cases are the d-dimensional lattice sine 3 and cosine 5-algebras with the special parameter values. We find that the corresponding d-dimensional lattice sine 3 and cosine 5-algebras are the Nambu 3-algebra and higher order Lie algebra, respectively. The limiting case of the d-dimensional lattice (co)sine n-algebra is also discussed. Moreover we construct the super sine n-algebra, which is the super higher order Lie algebra for the n even case. (paper)
Short interspersed elements (SINEs) of the Geomyoidea superfamily rodents.
Gogolevsky, Konstantin P; Kramerov, Dmitri A
2006-05-24
A new short interspersed element (SINE) was isolated from the genome of desert kangaroo rat (Dipodomys deserti) using single-primer PCR. This SINE consists of two monomers: the left monomer (IDL) resembles rodent ID element and other tRNAAla(CGC)-derived SINEs, whereas the right one (Geo) shows no similarity with known SINE sequences. PCR and hybridization analyses demonstrated that IDL-Geo SINE is restricted to the rodent superfamily Geomyoidea (families Geomyidea and Heteromyidea). Isolation and analysis of IDL-Geo from California pocket mouse (Chaetodipus californicus) and Botta's pocket gopher (Thomomys bottae) revealed some species-specific features of this SINE family. The structure and evolution of known dimeric SINEs are discussed.
Directory of Open Access Journals (Sweden)
Kenichi Kondo
2013-11-01
Full Text Available Ultradiscretization with negative values is a long-standing problem and several attempts have been made to solve it. Among others, we focus on the symmetrized max-plus algebra, with which we ultradiscretize the discrete sine-Gordon equation. Another ultradiscretization of the discrete sine-Gordon equation has already been proposed by previous studies, but the equation and the solutions obtained here are considered to directly correspond to the discrete counterpart. We also propose a noncommutative discrete analogue of the sine-Gordon equation, reveal its relations to other integrable systems including the noncommutative discrete KP equation, and construct multisoliton solutions by a repeated application of Darboux transformations. Moreover, we derive a noncommutative ultradiscrete analogue of the sine-Gordon equation and its 1-soliton and 2-soliton solutions, using the symmetrized max-plus algebra. As a result, we have a complete set of commutative and noncommutative versions of continuous, discrete, and ultradiscrete sine-Gordon equations.
CORE-SINEs: eukaryotic short interspersed retroposing elements with common sequence motifs.
Gilbert, N; Labuda, D
1999-03-16
A 65-bp "core" sequence is dispersed in hundreds of thousands copies in the human genome. This sequence was found to constitute the central segment of a group of short interspersed elements (SINEs), referred to as mammalian-wide interspersed repeats, that proliferated before the radiation of placental mammals. Here, we propose that the core identifies an ancient tRNA-like SINE element, which survived in different lineages such as mammals, reptiles, birds, and fish, as well as mollusks, presumably for >550 million years. This element gave rise to a number of sequence families (CORE-SINEs), including mammalian-wide interspersed repeats, whose distinct 3' ends are shared with different families of long interspersed elements (LINEs). The evolutionary success of the generic CORE-SINE element can be related to the recruitment of the internal promoter from highly transcribed host RNA as well as to its capacity to adapt to changing retropositional opportunities by sequence exchange with actively amplifying LINEs. It reinforces the notion that the very existence of SINEs depends on the cohabitation with both LINEs and the host genome.
Lenoir, A; Pélissier, T; Bousquet-Antonelli, C; Deragon, J M
2005-01-01
Brassica oleracea and Arabidopsis thaliana belong to the Brassicaceae(Cruciferae) family and diverged 16 to 19 million years ago. Although the genome size of B. oleracea (approximately 600 million base pairs) is more than four times that of A. thaliana (approximately 130 million base pairs), their gene content is believed to be very similar with more than 85% sequence identity in the coding region. Therefore, this important difference in genome size is likely to reflect a different rate of non-coding DNA accumulation. Transposable elements (TEs) constitute a major fraction of non-coding DNA in plant species. A different rate in TE accumulation between two closely related species can result in significant genome size variations in a short evolutionary period. Short interspersed elements (SINEs) are non-autonomous retroposons that have invaded the genome of most eukaryote species. Several SINE families are present in B. oleracea and A. thaliana and we found that two of them (called RathE1 and RathE2) are present in both species. In this study, the tempo of evolution of RathE1 and RathE2 SINE families in both species was compared. We observed that most B. oleracea RathE2 SINEs are "young" (close to the consensus sequence) and abundant while elements from this family are more degenerated and much less abundant in A. thaliana. However, the situation is different for the RathE1 SINE family for which the youngest elements are found in A. thaliana. Surprisingly, no SINE was found to occupy the same (orthologous) genomic locus in both species suggesting that either these SINE families were not amplified at a significant rate in the common ancestor of the two species or that older elements were lost and only the recent (lineage-specific) insertions remain. To test this latter hypothesis, loci containing a recently inserted SINE in the A. thaliana col-0 ecotype were selected and characterized in several other A. thaliana ecotypes. In addition to the expected SINE containing
Evolutionary modes of emergence of short interspersed nuclear element (SINE) families in grasses.
Kögler, Anja; Schmidt, Thomas; Wenke, Torsten
2017-11-01
Short interspersed nuclear elements (SINEs) are non-autonomous transposable elements which are propagated by retrotransposition and constitute an inherent part of the genome of most eukaryotic species. Knowledge of heterogeneous and highly abundant SINEs is crucial for de novo (or improvement of) annotation of whole genome sequences. We scanned Poaceae genome sequences of six important cereals (Oryza sativa, Triticum aestivum, Hordeum vulgare, Panicum virgatum, Sorghum bicolor, Zea mays) and Brachypodium distachyon to examine the diversity and evolution of SINE populations. We comparatively analyzed the structural features, distribution, evolutionary relation and abundance of 32 SINE families and subfamilies within grasses, comprising 11 052 individual copies. The investigation of activity profiles within the Poaceae provides insights into their species-specific diversification and amplification. We found that Poaceae SINEs (PoaS) fall into two length categories: simple SINEs of up to 180 bp and dimeric SINEs larger than 240 bp. Detailed analysis at the nucleotide level revealed that multimerization of related and unrelated SINE copies is an important evolutionary mechanism of SINE formation. We conclude that PoaS families diversify by massive reshuffling between SINE families, likely caused by insertion of truncated copies, and provide a model for this evolutionary scenario. Twenty-eight of 32 PoaS families and subfamilies show significant conservation, in particular either in the 5' or 3' regions, across Poaceae species and share large sequence stretches with one or more other PoaS families. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.
Ichiyanagi, Kenji
2013-01-01
Short interspersed elements (SINEs) are a class of retrotransposons, which amplify their copy numbers in their host genomes by retrotransposition. More than a million copies of SINEs are present in a mammalian genome, constituting over 10% of the total genomic sequence. In contrast to the other two classes of retrotransposons, long interspersed elements (LINEs) and long terminal repeat (LTR) elements, SINEs are transcribed by RNA polymerase III. However, like LINEs and LTR elements, the SINE transcription is likely regulated by epigenetic mechanisms such as DNA methylation, at least for human Alu and mouse B1. Whereas SINEs and other transposable elements have long been thought as selfish or junk DNA, recent studies have revealed that they play functional roles at their genomic locations, for example, as distal enhancers, chromatin boundaries and binding sites of many transcription factors. These activities imply that SINE retrotransposition has shaped the regulatory network and chromatin landscape of their hosts. Whereas it is thought that the epigenetic mechanisms were originated as a host defense system against proliferation of parasitic elements, this review discusses a possibility that the same mechanisms are also used to regulate the SINE-derived functions.
Functional noncoding sequences derived from SINEs in the mammalian genome.
Nishihara, Hidenori; Smit, Arian F A; Okada, Norihiro
2006-07-01
Recent comparative analyses of mammalian sequences have revealed that a large number of nonprotein-coding genomic regions are under strong selective constraint. Here, we report that some of these loci have been derived from a newly defined family of ancient SINEs (short interspersed repetitive elements). This is a surprising result, as SINEs and other transposable elements are commonly thought to be genomic parasites. We named the ancient SINE family AmnSINE1, for Amniota SINE1, because we found it to be present in mammals as well as in birds, and some copies predate the mammalian-bird split 310 million years ago (Mya). AmnSINE1 has a chimeric structure of a 5S rRNA and a tRNA-derived SINE, and is related to five tRNA-derived SINE families that we characterized here in the coelacanth, dogfish shark, hagfish, and amphioxus genomes. All of the newly described SINE families have a common central domain that is also shared by zebrafish SINE3, and we collectively name them the DeuSINE (Deuterostomia SINE) superfamily. Notably, of the approximately 1000 still identifiable copies of AmnSINE1 in the human genome, 105 correspond to loci phylogenetically highly conserved among mammalian orthologs. The conservation is strongest over the central domain. Thus, AmnSINE1 appears to be the best example of a transposable element of which a significant fraction of the copies have acquired genomic functionality.
Directory of Open Access Journals (Sweden)
Lakkhana Kanhayuwa
Full Text Available Novel families of short interspersed nuclear element (SINE sequences in the human pathogenic fungus Aspergillus fumigatus, clinical isolate Af293, were identified and categorised into tRNA-related and 5S rRNA-related SINEs. Eight predicted tRNA-related SINE families originating from different tRNAs, and nominated as AfuSINE2 sequences, contained target site duplications of short direct repeat sequences (4-14 bp flanking the elements, an extended tRNA-unrelated region and typical features of RNA polymerase III promoter sequences. The elements ranged in size from 140-493 bp and were present in low copy number in the genome and five out of eight were actively transcribed. One putative tRNAArg-derived sequence, AfuSINE2-1a possessed a unique feature of repeated trinucleotide ACT residues at its 3'-terminus. This element was similar in sequence to the I-4_AO element found in A. oryzae and an I-1_AF long nuclear interspersed element-like sequence identified in A. fumigatus Af293. Families of 5S rRNA-related SINE sequences, nominated as AfuSINE3, were also identified and their 5'-5S rRNA-related regions show 50-65% and 60-75% similarity to respectively A. fumigatus 5S rRNAs and SINE3-1_AO found in A. oryzae. A. fumigatus Af293 contains five copies of AfuSINE3 sequences ranging in size from 259-343 bp and two out of five AfuSINE3 sequences were actively transcribed. Investigations on AfuSINE distribution in the fungal genome revealed that the elements are enriched in pericentromeric and subtelomeric regions and inserted within gene-rich regions. We also demonstrated that some, but not all, AfuSINE sequences are targeted by host RNA silencing mechanisms. Finally, we demonstrated that infection of the fungus with mycoviruses had no apparent effects on SINE activity.
Directory of Open Access Journals (Sweden)
Luca Crepaldi
Full Text Available In neurons, the timely and accurate expression of genes in response to synaptic activity relies on the interplay between epigenetic modifications of histones, recruitment of regulatory proteins to chromatin and changes to nuclear structure. To identify genes and regulatory elements responsive to synaptic activation in vivo, we performed a genome-wide ChIPseq analysis of acetylated histone H3 using somatosensory cortex of mice exposed to novel enriched environmental (NEE conditions. We discovered that Short Interspersed Elements (SINEs located distal to promoters of activity-dependent genes became acetylated following exposure to NEE and were bound by the general transcription factor TFIIIC. Importantly, under depolarizing conditions, inducible genes relocated to transcription factories (TFs, and this event was controlled by TFIIIC. Silencing of the TFIIIC subunit Gtf3c5 in non-stimulated neurons induced uncontrolled relocation to TFs and transcription of activity-dependent genes. Remarkably, in cortical neurons, silencing of Gtf3c5 mimicked the effects of chronic depolarization, inducing a dramatic increase of both dendritic length and branching. These findings reveal a novel and essential regulatory function of both SINEs and TFIIIC in mediating gene relocation and transcription. They also suggest that TFIIIC may regulate the rearrangement of nuclear architecture, allowing the coordinated expression of activity-dependent neuronal genes.
Crepaldi, Luca; Policarpi, Cristina; Coatti, Alessandro; Sherlock, William T; Jongbloets, Bart C; Down, Thomas A; Riccio, Antonella
2013-01-01
In neurons, the timely and accurate expression of genes in response to synaptic activity relies on the interplay between epigenetic modifications of histones, recruitment of regulatory proteins to chromatin and changes to nuclear structure. To identify genes and regulatory elements responsive to synaptic activation in vivo, we performed a genome-wide ChIPseq analysis of acetylated histone H3 using somatosensory cortex of mice exposed to novel enriched environmental (NEE) conditions. We discovered that Short Interspersed Elements (SINEs) located distal to promoters of activity-dependent genes became acetylated following exposure to NEE and were bound by the general transcription factor TFIIIC. Importantly, under depolarizing conditions, inducible genes relocated to transcription factories (TFs), and this event was controlled by TFIIIC. Silencing of the TFIIIC subunit Gtf3c5 in non-stimulated neurons induced uncontrolled relocation to TFs and transcription of activity-dependent genes. Remarkably, in cortical neurons, silencing of Gtf3c5 mimicked the effects of chronic depolarization, inducing a dramatic increase of both dendritic length and branching. These findings reveal a novel and essential regulatory function of both SINEs and TFIIIC in mediating gene relocation and transcription. They also suggest that TFIIIC may regulate the rearrangement of nuclear architecture, allowing the coordinated expression of activity-dependent neuronal genes.
Conserved domains and SINE diversity during animal evolution.
Luchetti, Andrea; Mantovani, Barbara
2013-10-01
Eukaryotic genomes harbour a number of mobile genetic elements (MGEs); moving from one genomic location to another, they are known to impact on the host genome. Short interspersed elements (SINEs) are well-represented, non-autonomous retroelements and they are likely the most diversified MGEs. In some instances, sequence domains conserved across unrelated SINEs have been identified; remarkably, one of these, called Nin, has been conserved since the Radiata-Bilateria splitting. Here we report on two new domains: Inv, derived from Nin, identified in insects and in deuterostomes, and Pln, restricted to polyneopteran insects. The identification of Inv and Pln sequences allowed us to retrieve new SINEs, two in insects and one in a hemichordate. The diverse structural combination of the different domains in different SINE families, during metazoan evolution, offers a clearer view of SINE diversity and their frequent de novo emergence through module exchange, possibly underlying the high evolutionary success of SINEs. © 2013 Elsevier Inc. All rights reserved.
Mass renormalization in sine-Gordon model
International Nuclear Information System (INIS)
Xu Bowei; Zhang Yumei
1991-09-01
With a general gaussian wave functional, we investigate the mass renormalization in the sine-Gordon model. At the phase transition point, the sine-Gordon system tends to a system of massless free bosons which possesses conformal symmetry. (author). 8 refs, 1 fig
Evolutionary applications of MIRs and SINEs
Buchanan, F; Crawford, A; Strobeck, C; Palsboll, P; Plante, Y
It is believed that short interspersed elements (SINEs) are irreversibly inserted into genomes. We use this concept to try to deduce the evolution of whales using sequence and hybridization studies. The observation that microsatellites are associated with SINEs lead us to screen sequences
Origin and evolution of SINEs in eukaryotic genomes.
Kramerov, D A; Vassetzky, N S
2011-12-01
Short interspersed elements (SINEs) are one of the two most prolific mobile genomic elements in most of the higher eukaryotes. Although their biology is still not thoroughly understood, unusual life cycle of these simple elements amplified as genomic parasites makes their evolution unique in many ways. In contrast to most genetic elements including other transposons, SINEs emerged de novo many times in evolution from available molecules (for example, tRNA). The involvement of reverse transcription in their amplification cycle, huge number of genomic copies and modular structure allow variation mechanisms in SINEs uncommon or rare in other genetic elements (module exchange between SINE families, dimerization, and so on.). Overall, SINE evolution includes their emergence, progressive optimization and counteraction to the cell's defense against mobile genetic elements.
Expansion of CORE-SINEs in the genome of the Tasmanian devil.
Nilsson, Maria A; Janke, Axel; Murchison, Elizabeth P; Ning, Zemin; Hallström, Björn M
2012-05-06
The genome of the carnivorous marsupial, the Tasmanian devil (Sarcophilus harrisii, Order: Dasyuromorphia), was sequenced in the hopes of finding a cure for or gaining a better understanding of the contagious devil facial tumor disease that is threatening the species' survival. To better understand the Tasmanian devil genome, we screened it for transposable elements and investigated the dynamics of short interspersed element (SINE) retroposons. The temporal history of Tasmanian devil SINEs, elucidated using a transposition in transposition analysis, indicates that WSINE1, a CORE-SINE present in around 200,000 copies, is the most recently active element. Moreover, we discovered a new subtype of WSINE1 (WSINE1b) that comprises at least 90% of all Tasmanian devil WSINE1s. The frequencies of WSINE1 subtypes differ in the genomes of two of the other Australian marsupial orders. A co-segregation analysis indicated that at least 66 subfamilies of WSINE1 evolved during the evolution of Dasyuromorphia. Using a substitution rate derived from WSINE1 insertions, the ages of the subfamilies were estimated and correlated with a newly established phylogeny of Dasyuromorphia. Phylogenetic analyses and divergence time estimates of mitochondrial genome data indicate a rapid radiation of the Tasmanian devil and the closest relative the quolls (Dasyurus) around 14 million years ago. The radiation and abundance of CORE-SINEs in marsupial genomes indicates that they may be a major player in the evolution of marsupials. It is evident that the early phases of evolution of the carnivorous marsupial order Dasyuromorphia was characterized by a burst of SINE activity. A correlation between a speciation event and a major burst of retroposon activity is for the first time shown in a marsupial genome.
Expansion of CORE-SINEs in the genome of the Tasmanian devil
Directory of Open Access Journals (Sweden)
Nilsson Maria A
2012-05-01
Full Text Available Abstract Background The genome of the carnivorous marsupial, the Tasmanian devil (Sarcophilus harrisii, Order: Dasyuromorphia, was sequenced in the hopes of finding a cure for or gaining a better understanding of the contagious devil facial tumor disease that is threatening the species’ survival. To better understand the Tasmanian devil genome, we screened it for transposable elements and investigated the dynamics of short interspersed element (SINE retroposons. Results The temporal history of Tasmanian devil SINEs, elucidated using a transposition in transposition analysis, indicates that WSINE1, a CORE-SINE present in around 200,000 copies, is the most recently active element. Moreover, we discovered a new subtype of WSINE1 (WSINE1b that comprises at least 90% of all Tasmanian devil WSINE1s. The frequencies of WSINE1 subtypes differ in the genomes of two of the other Australian marsupial orders. A co-segregation analysis indicated that at least 66 subfamilies of WSINE1 evolved during the evolution of Dasyuromorphia. Using a substitution rate derived from WSINE1 insertions, the ages of the subfamilies were estimated and correlated with a newly established phylogeny of Dasyuromorphia. Phylogenetic analyses and divergence time estimates of mitochondrial genome data indicate a rapid radiation of the Tasmanian devil and the closest relative the quolls (Dasyurus around 14 million years ago. Conclusions The radiation and abundance of CORE-SINEs in marsupial genomes indicates that they may be a major player in the evolution of marsupials. It is evident that the early phases of evolution of the carnivorous marsupial order Dasyuromorphia was characterized by a burst of SINE activity. A correlation between a speciation event and a major burst of retroposon activity is for the first time shown in a marsupial genome.
A New Class of SINEs with snRNA Gene-Derived Heads.
Kojima, Kenji K
2015-05-27
Eukaryotic genomes are colonized by various transposons including short interspersed elements (SINEs). The 5' region (head) of the majority of SINEs is derived from one of the three types of RNA genes--7SL RNA, transfer RNA (tRNA), or 5S ribosomal RNA (rRNA)--and the internal promoter inside the head promotes the transcription of the entire SINEs. Here I report a new group of SINEs whose heads originate from either the U1 or U2 small nuclear RNA gene. These SINEs, named SINEU, are distributed among crocodilians and classified into three families. The structures of the SINEU-1 subfamilies indicate the recurrent addition of a U1- or U2-derived sequence onto the 5' end of SINEU-1 elements. SINEU-1 and SINEU-3 are ancient and shared among alligators, crocodiles, and gharials, while SINEU-2 is absent in the alligator genome. SINEU-2 is the only SINE family that was active after the split of crocodiles and gharials. All SINEU families, especially SINEU-3, are preferentially inserted into a family of Mariner DNA transposon, Mariner-N4_AMi. A group of Tx1 non-long terminal repeat retrotransposons designated Tx1-Mar also show target preference for Mariner-N4_AMi, indicating that SINEU was mobilized by Tx1-Mar. © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Guinea pig ID-like families of SINEs.
Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy
2009-05-01
Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.
Bioinformatic analysis of Entamoeba histolytica SINE1 elements
Directory of Open Access Journals (Sweden)
Butcher Sarah A
2010-05-01
Full Text Available Abstract Background Invasive amoebiasis, caused by infection with the human parasite Entamoeba histolytica remains a major cause of morbidity and mortality in some less-developed countries. Genetically E. histolytica exhibits a number of unusual features including having approximately 20% of its genome comprised of repetitive elements. These include a number of families of SINEs - non-autonomous elements which can, however, move with the help of partner LINEs. In many eukaryotes SINE mobility has had a profound effect on gene expression; in this study we concentrated on one such element - EhSINE1, looking in particular for evidence of recent transposition. Results EhSINE1s were detected in the newly reassembled E. histolytica genome by searching with a Hidden Markov Model developed to encapsulate the key features of this element; 393 were detected. Examination of their sequences revealed that some had an internal structure showing one to four 26-27 nt repeats. Members of the different classes differ in a number of ways and in particular those with two internal repeats show the properties expected of fairly recently transposed SINEs - they are the most homogeneous in length and sequence, they have the longest (i.e. the least decayed target site duplications and are the most likely to show evidence (in a cDNA library of active transcription. Furthermore we were able to identify 15 EhSINE1s (6 pairs and one triplet which appeared to be identical or very nearly so but inserted into different sites in the genome; these provide good evidence that if mobility has now ceased it has only done so very recently. Conclusions Of the many families of repetitive elements present in the genome of E. histolytica we have examined in detail just one - EhSINE1. We have shown that there is evidence for waves of transposition at different points in the past and no evidence that mobility has entirely ceased. There are many aspects of the biology of this parasite which
BoS: a large and diverse family of short interspersed elements (SINEs) in Brassica oleracea.
Zhang, Xiaoyu; Wessler, Susan R
2005-05-01
Short interspersed elements (SINEs) are nonautonomous non-LTR retrotransposons that populate eukaryotic genomes. Numerous SINE families have been identified in animals, whereas only a few have been described in plants. Here we describe a new family of SINEs, named BoS, that is widespread in Brassicaceae and present at approximately 2000 copies in Brassica oleracea. In addition to sharing a modular structure and target site preference with previously described SINEs, BoS elements have several unusual features. First, the head regions of BoS RNAs can adopt a distinct hairpin-like secondary structure. Second, with 15 distinct subfamilies, BoS represents one of the most diverse SINE families described to date. Third, several of the subfamilies have a mosaic structure that has arisen through the exchange of sequences between existing subfamilies, possibly during retrotransposition. Analysis of BoS subfamilies indicate that they were active during various time periods through the evolution of Brassicaceae and that active elements may still reside in some Brassica species. As such, BoS elements may be a valuable tool as phylogenetic makers for resolving outstanding issues in the evolution of species in the Brassicaceae family.
Gauge symmetry of Sine-Gordon model
International Nuclear Information System (INIS)
Shen Jian-Min; Li Kang; Sheng Zhengmao.
1993-03-01
We have found that the strong coupled interaction of Sine-Gordon model is related to its weak coupled interaction by the su(2) gauge transformation. We therefore develop a semi-classical approach to deal with the infrared divergence in the conventional perturbation theory of the Hamiltonian of the quantum Sine-Gordon model. (author). 10 refs
Scaling in the sine-Gordon theory
International Nuclear Information System (INIS)
Ben-Abraham, S.I.
1976-01-01
It is shown that both the classical and the quantum sine-Gordon theory depend on a single scaling parameter and therefore the coupling constant cannot be freely chosen. To introduce a meaningful coupling constant it is proposed to include higher Fourier terms in the sine-Gordon potential. The two term case is exactly solvable. (Auth.)
Development of sine/cosine coil based on cross-section modulation
International Nuclear Information System (INIS)
Harada, Takahiro; Kondoh, Junji; Tsuji-Iio, Shunji; Shimada, Ryuichi
1996-01-01
New type sine and cosine coils whose areas of cross sections vary as sine and cosine are proposed. The measurements of current position by the new coils showed their availability. Traditional sine or cosine coil is wound with a pitch which varies as sine or cosine. However these coils have a problem of manufacturing, i.e. it is not easy to wind wire exactly with a pitch of sine or cosine. This new modulation, i.e. varying cross section, provides handy and accurate measurements of the current position. (author)
Inverse PCR-based method for isolating novel SINEs from genome.
Han, Yawei; Chen, Liping; Guan, Lihong; He, Shunping
2014-04-01
Short interspersed elements (SINEs) are moderately repetitive DNA sequences in eukaryotic genomes. Although eukaryotic genomes contain numerous SINEs copy, it is very difficult and laborious to isolate and identify them by the reported methods. In this study, the inverse PCR was successfully applied to isolate SINEs from Opsariichthys bidens genome in Eastern Asian Cyprinid. A group of SINEs derived from tRNA(Ala) molecular had been identified, which were named Opsar according to Opsariichthys. SINEs characteristics were exhibited in Opsar, which contained a tRNA(Ala)-derived region at the 5' end, a tRNA-unrelated region, and AT-rich region at the 3' end. The tRNA-derived region of Opsar shared 76 % sequence similarity with tRNA(Ala) gene. This result indicated that Opsar could derive from the inactive or pseudogene of tRNA(Ala). The reliability of method was tested by obtaining C-SINE, Ct-SINE, and M-SINEs from Ctenopharyngodon idellus, Megalobrama amblycephala, and Cyprinus carpio genomes. This method is simpler than the previously reported, which successfully omitted many steps, such as preparation of probes, construction of genomic libraries, and hybridization.
Vacuum instability in the quantum sine-gordon model
International Nuclear Information System (INIS)
Bogolyubov, N.M.; Izergin, A.G.; Korepin, V.E.
1985-01-01
A review is given of papers dealing with regularization of the sine-Gordon model and the construction of the integrable lattice sine-Gordon (LSG) model. The regularization by means of LSG model seems to be much more natural as it is done in terms of initial boson fields entering Hamiltonian which describes relativistic scalar field with essentially nonlinear self-interaction. Changes in physical vacuum due to regularizations of the sine-Gordon model is shown
Greally, John M
2002-01-08
To test whether regions undergoing genomic imprinting have unique genomic characteristics, imprinted and nonimprinted human loci were compared for nucleotide and retroelement composition. Maternally and paternally expressed subgroups of imprinted genes were found to differ in terms of guanine and cytosine, CpG, and retroelement content, indicating a segregation into distinct genomic compartments. Imprinted regions have been normally permissive to L1 long interspersed transposable element retroposition during mammalian evolution but universally and significantly lack short interspersed transposable elements (SINEs). The primate-specific Alu SINEs, as well as the more ancient mammalian-wide interspersed repeat SINEs, are found at significantly low densities in imprinted regions. The latter paleogenomic signature indicates that the sequence characteristics of currently imprinted regions existed before the mammalian radiation. Transitions from imprinted to nonimprinted genomic regions in cis are characterized by a sharp inflection in SINE content, demonstrating that this genomic characteristic can help predict the presence and extent of regions undergoing imprinting. During primate evolution, SINE accumulation in imprinted regions occurred at a decreased rate compared with control loci. The constraint on SINE accumulation in imprinted regions may be mediated by an active selection process. This selection could be because of SINEs attracting and spreading methylation, as has been found at other loci. Methylation-induced silencing could lead to deleterious consequences at imprinted loci, where inactivation of one allele is already established, and expression is often essential for embryonic growth and survival.
International Nuclear Information System (INIS)
Nouroz, F.; Naveed, M.
2018-01-01
The non-LTR retrotransposons (retroposons) are abundant in plant genomes including members of Brassicaceae. Of the retroposons, long interspersed nuclear elements (LINEs) are more copious followed by short interspersed nuclear elements (SINEs) in sequenced eukaryotic genomes. The SINEs are short elements and ranged from 100-500 bps flanked by variable sized target site duplications, 5' tRNA region with polymerase III promoter, internal tRNA unrelated region, 3' LINEs derived region and a poly adenosine tail. Different computational approaches were used for the identification and characterization of SINEs, while PCR was used to detect the SINEs insertion polymorphisms in various Brassica genotypes. Ten previously unidentified families of SINEs were identified and characterized from Brassica genomes. The structural features of these SINEs were studied in detail, which showed typical SINE features displaying small sizes, target site duplications, head regions, internal regions (body) of variable sizes and a poly (A) tail at the 3' terminus. The elements from various families ranged from 206-558 bp, where BoSINE2 family displayed smallest SINE element (206 bp), while larger members belonged to BoSINE9 family (524-558 bp). The distribution and abundance of SINEs in various Brassica species and genotypes (40) at a particular site/locus were investigated by SINEs based PCR markers. Various SINE insertion polymorphisms were detected from different genotypes, where higher PCR bands amplified the SINE insertions, while lower bands amplified the pre-insertion sites (flanking regions). The analysis of Brassica SINEs copy numbers from 10 identified families revealed that around 860 and 1712 copies of SINEs were calculated from B. rapa and B. oleracea Whole-genome shotgun contigs (WGS) respectively. Analysis of insertion sites of Brassica SINEs revealed that the members from all 10 SINE families had shown an insertion preference in AT rich regions. The present
The Perception of "Sine-Wave Speech" by Adults with Developmental Dyslexia.
Rosner, Burton S.; Talcott, Joel B.; Witton, Caroline; Hogg, James D.; Richardson, Alexandra J.; Hansen, Peter C.; Stein, John F.
2003-01-01
"Sine-wave speech" sentences contain only four frequency-modulated sine waves, lacking many acoustic cues present in natural speech. Adults with (n=19) and without (n=14) dyslexia were asked to reproduce orally sine-wave utterances in successive trials. Results suggest comprehension of sine-wave sentences is impaired in some adults with…
Gravity localization in sine-Gordon braneworlds
International Nuclear Information System (INIS)
Cruz, W.T.; Maluf, R.V.; Sousa, L.J.S.; Almeida, C.A.S.
2016-01-01
In this work we study two types of five-dimensional braneworld models given by sine-Gordon potentials. In both scenarios, the thick brane is generated by a real scalar field coupled to gravity. We focus our investigation on the localization of graviton field and the behaviour of the massive spectrum. In particular, we analyse the localization of massive modes by means of a relative probability method in a Quantum Mechanics context. Initially, considering a scalar field sine-Gordon potential, we find a localized state to the graviton at zero mode. However, when we consider a double sine-Gordon potential, the brane structure is changed allowing the existence of massive resonant states. The new results show how the existence of an internal structure can aid in the emergence of massive resonant modes on the brane.
Critical boundary sine-Gordon revisited
International Nuclear Information System (INIS)
Hasselfield, M.; Lee, Taejin; Semenoff, G.W.; Stamp, P.C.E.
2006-01-01
We revisit the exact solution of the two space-time dimensional quantum field theory of a free massless boson with a periodic boundary interaction and self-dual period. We analyze the model by using a mapping to free fermions with a boundary mass term originally suggested in Ref. [J. Polchinski, L. Thorlacius, Phys. Rev. D 50 (1994) 622]. We find that the entire SL (2, C) family of boundary states of a single boson are boundary sine-Gordon states and we derive a simple explicit expression for the boundary state in fermion variables and as a function of sine-Gordon coupling constants. We use this expression to compute the partition function. We observe that the solution of the model has a strong-weak coupling generalization of T-duality. We then examine a class of recently discovered conformal boundary states for compact bosons with radii which are rational numbers times the self-dual radius. These have simple expression in fermion variables. We postulate sine-Gordon-like field theories with discrete gauge symmetries for which they are the appropriate boundary states
Polypteridae (Actinopterygii: Cladistia) and DANA-SINEs insertions.
Morescalchi, Maria Alessandra; Barucca, Marco; Stingo, Vincenzo; Capriglione, Teresa
2010-06-01
SINE sequences are interspersed throughout virtually all eukaryotic genomes and greatly outnumber the other repetitive elements. These sequences are of increasing interest for phylogenetic studies because of their diagnostic power for establishing common ancestry among taxa, once properly characterized. We identified and characterized a peculiar family of composite tRNA-derived short interspersed SINEs, DANA-SINEs, associated with mutational activities in Danio rerio, in a group of species belonging to one of the most basal bony fish families, the Polypteridae, in order to investigate their own inner specific phylogenetic relationships. DANA sequences were identified, sequenced and then localized, by means of fluorescent in situ hybridization (FISH), in six Polypteridae species (Polypterus delhezi, P. ornatipinnis, P. palmas, P. buettikoferi P. senegalus and Erpetoichthys calabaricus) After cloning, the sequences obtained were aligned for phylogenetic analysis, comparing them with three Dipnoan lungfish species (Protopterus annectens, P. aethiopicus, Lepidosiren paradoxa), and Lethenteron reissneri (Petromyzontidae)was used as outgroup. The obtained overlapping MP, ML and NJ tree clustered together the species belonging to the two taxonomically different Osteichthyans groups: the Polypteridae, by one side, and the Protopteridae by the other, with the monotypic genus Erpetoichthys more distantly related to the Polypterus genus comprising three distinct groups: P. palmas and P. buettikoferi, P. delhezi and P. ornatipinnis and P. senegalus. In situ hybridization with DANA probes marked along the whole chromosome arms in the metaphases of all the Polypteridae species examined. Copyright © 2010 Elsevier B.V. All rights reserved.
Universal precision sine bar attachment
Mann, Franklin D. (Inventor)
1989-01-01
This invention relates to an attachment for a sine bar which can be used to perform measurements during lathe operations or other types of machining operations. The attachment can be used for setting precision angles on vises, dividing heads, rotary tables and angle plates. It can also be used in the inspection of machined parts, when close tolerances are required, and in the layout of precision hardware. The novelty of the invention is believed to reside in a specific versatile sine bar attachment for measuring a variety of angles on a number of different types of equipment.
Electro-mechanical sine/cosine generator
Flagge, B. (Inventor)
1972-01-01
An electromechanical device for generating both sine and cosine functions is described. A motor rotates a cylinder about an axis parallel to and a slight distance from the central axis of the cylinder. Two noncontacting displacement sensing devices are placed ninety degrees apart, equal distances from the axis of rotation of the cylinder and short distances above the surface of cylinder. Each of these sensing devices produces an electrical signal proportional to the distance that it is away from the cylinder. Consequently, as the cylinder is rotated the outputs from the two sensing devices are the sine and cosine functions.
Possible involvement of SINEs in mammalian-specific brain formation.
Sasaki, Takeshi; Nishihara, Hidenori; Hirakawa, Mika; Fujimura, Koji; Tanaka, Mikiko; Kokubo, Nobuhiro; Kimura-Yoshida, Chiharu; Matsuo, Isao; Sumiyama, Kenta; Saitou, Naruya; Shimogori, Tomomi; Okada, Norihiro
2008-03-18
Retroposons, such as short interspersed elements (SINEs) and long interspersed elements (LINEs), are the major constituents of higher vertebrate genomes. Although there are many examples of retroposons' acquiring function, none has been implicated in the morphological innovations specific to a certain taxonomic group. We previously characterized a SINE family, AmnSINE1, members of which constitute a part of conserved noncoding elements (CNEs) in mammalian genomes. We proposed that this family acquired genomic functionality or was exapted after retropositioning in a mammalian ancestor. Here we identified 53 new AmnSINE1 loci and refined 124 total loci, two of which were further analyzed. Using a mouse enhancer assay, we demonstrate that one SINE locus, AS071, 178 kbp from the gene FGF8 (fibroblast growth factor 8), is an enhancer that recapitulates FGF8 expression in two regions of the developing forebrain, namely the diencephalon and the hypothalamus. Our gain-of-function analysis revealed that FGF8 expression in the diencephalon controls patterning of thalamic nuclei, which act as a relay center of the neocortex, suggesting a role for FGF8 in mammalian-specific forebrain patterning. Furthermore, we demonstrated that the locus, AS021, 392 kbp from the gene SATB2, controls gene expression in the lateral telencephalon, which is thought to be a signaling center during development. These results suggest important roles for SINEs in the development of the mammalian neuronal network, a part of which was initiated with the exaptation of AmnSINE1 in a common mammalian ancestor.
A SINE-derived element constitutes a unique modular enhancer for mammalian diencephalic Fgf8.
Directory of Open Access Journals (Sweden)
Akiko Nakanishi
Full Text Available Transposable elements, including short interspersed repetitive elements (SINEs, comprise nearly half the mammalian genome. Moreover, they are a major source of conserved non-coding elements (CNEs, which play important functional roles in regulating development-related genes, such as enhancing and silencing, serving for the diversification of morphological and physiological features among species. We previously reported a novel SINE family, AmnSINE1, as part of mammalian-specific CNEs. One AmnSINE1 locus, named AS071, showed an enhancer property in the developing mouse diencephalon. Indeed, AS071 appears to recapitulate the expression of diencephalic fibroblast growth factor 8 (Fgf8. Here we established three independent lines of AS071-transgenic mice and performed detailed expression profiling of AS071-enhanced lacZ in comparison with that of Fgf8 across embryonic stages. We demonstrate that AS071 is a distal enhancer that directs Fgf8 expression in the developing diencephalon. Furthermore, enhancer assays with constructs encoding partially deleted AS071 sequence revealed a unique modular organization in which AS071 contains at least three functionally distinct sub-elements that cooperatively direct the enhancer activity in three diencephalic domains, namely the dorsal midline and the lateral wall of the diencephalon, and the ventral midline of the hypothalamus. Interestingly, the AmnSINE1-derived sub-element was found to specify the enhancer activity to the ventral midline of the hypothalamus. To our knowledge, this is the first discovery of an enhancer element that could be separated into respective sub-elements that determine regional specificity and/or the core enhancing activity. These results potentiate our understanding of the evolution of retroposon-derived cis-regulatory elements as well as the basis for future studies of the molecular mechanism underlying the determination of domain-specificity of an enhancer.
Mobile Element Evolution Playing Jigsaw—SINEs in Gastropod and Bivalve Mollusks
Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette
2016-01-01
SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc—snail and SCoica—mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain—Snail—is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5′ end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves—extending the distribution range of this superfamily. PMID:26739168
Comparison of renormalization group schemes for sine-Gordon-type models
International Nuclear Information System (INIS)
Nandori, I.; Nagy, S.; Sailer, K.; Trombettoni, A.
2009-01-01
The scheme dependence of the renormalization group (RG) flow has been investigated in the local potential approximation for two-dimensional periodic, sine-Gordon type field-theoretic models discussing the applicability of various functional RG methods in detail. It was shown that scheme-independent determination of such physical parameters is possible as the critical frequency (temperature) at which Kosterlitz-Thouless-Berezinskii type phase transition takes place in the sine-Gordon and the layered sine-Gordon models, and the critical ratio characterizing the Ising-type phase transition of the massive sine-Gordon model. For the latter case, the Maxwell construction represents a strong constraint on the RG flow, which results in a scheme-independent infrared value for the critical ratio. For the massive sine-Gordon model also the shrinking of the domain of the phase with spontaneously broken periodicity is shown to take place due to the quantum fluctuations.
Evidence for convergent evolution of SINE-directed Staufen-mediated mRNA decay.
Lucas, Bronwyn A; Lavi, Eitan; Shiue, Lily; Cho, Hana; Katzman, Sol; Miyoshi, Keita; Siomi, Mikiko C; Carmel, Liran; Ares, Manuel; Maquat, Lynne E
2018-01-30
Primate-specific Alu short interspersed elements (SINEs) as well as rodent-specific B and ID (B/ID) SINEs can promote Staufen-mediated decay (SMD) when present in mRNA 3'-untranslated regions (3'-UTRs). The transposable nature of SINEs, their presence in long noncoding RNAs, their interactions with Staufen, and their rapid divergence in different evolutionary lineages suggest they could have generated substantial modification of posttranscriptional gene-control networks during mammalian evolution. Some of the variation in SMD regulation produced by SINE insertion might have had a similar regulatory effect in separate mammalian lineages, leading to parallel evolution of the Staufen network by independent expansion of lineage-specific SINEs. To explore this possibility, we searched for orthologous gene pairs, each carrying a species-specific 3'-UTR SINE and each regulated by SMD, by measuring changes in mRNA abundance after individual depletion of two SMD factors, Staufen1 (STAU1) and UPF1, in both human and mouse myoblasts. We identified and confirmed orthologous gene pairs with 3'-UTR SINEs that independently function in SMD control of myoblast metabolism. Expanding to other species, we demonstrated that SINE-directed SMD likely emerged in both primate and rodent lineages >20-25 million years ago. Our work reveals a mechanism for the convergent evolution of posttranscriptional gene regulatory networks in mammals by species-specific SINE transposition and SMD.
Mobile Element Evolution Playing Jigsaw - SINEs in Gastropod and Bivalve Mollusks.
Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette
2016-01-06
SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc-snail and SCoica-mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain-Snail-is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5' end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves-extending the distribution range of this superfamily. © The Author(s) 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Generalized sine-Gordon solitons
International Nuclear Information System (INIS)
Santos, C dos; Rubiera-Garcia, D
2011-01-01
In this paper, we construct analytical self-dual soliton solutions in (1+1) dimensions for two families of models which can be seen as generalizations of the sine-Gordon system but where the kinetic term is non-canonical. For that purpose we use a projection method applied to the sine-Gordon soliton. We focus our attention on the wall and lump-like soliton solutions of these k-field models. These solutions and their potentials reduce to those of the Klein-Gordon kink and the standard lump for the case of a canonical kinetic term. As we increase the nonlinearity on the kinetic term the corresponding potentials get modified and the nature of the soliton may change, in particular, undergoing a topology modification. The procedure constructed here is shown to be a sort of generalization of the deformation method for a specific class of k-field models. (paper)
On the supersymmetric sine-Gordon model
International Nuclear Information System (INIS)
Hruby, J.
1977-01-01
The sine-Gordon model as the theory of a massless scalar field in one space and one time dimension with interaction Lagrangian density proportional to cosβsub(phi) is generalized for a scalar superfield and it is shown that the solution of the supercovariant sine-Gordon equation is the ''supersoliton'', it is the superfield, which has all ordinary fields in two dimensions as a type of the soliton solution. We also obtain the massive Thirring model and the new equations of motion coupling the Fermi field and the Bose field. The notice about supersymmetric ''SLAC-BAG'' model is done
On the Fresnel sine integral and the convolution
Directory of Open Access Journals (Sweden)
Adem Kılıçman
2003-01-01
Full Text Available The Fresnel sine integral S(x, the Fresnel cosine integral C(x, and the associated functions S+(x, S−(x, C+(x, and C−(x are defined as locally summable functions on the real line. Some convolutions and neutrix convolutions of the Fresnel sine integral and its associated functions with x+r, xr are evaluated.
Evolutionary history of 7SL RNA-derived SINEs in Supraprimates.
Kriegs, Jan Ole; Churakov, Gennady; Jurka, Jerzy; Brosius, Jürgen; Schmitz, Jürgen
2007-04-01
The evolutionary relationships of 7SL RNA-derived SINEs such as the primate Alu or the rodent B1 elements have hitherto been obscure. We established an unambiguous phylogenetic tree for Supraprimates, and derived intraordinal relationships of the 7SL RNA-derived SINEs. As well as new elements in Tupaia and primates, we also found that the purported ancestral fossil Alu monomer was restricted to Primates, and provide here the first description of a potential chimeric promoter box region in SINEs.
Abundant Interaction Solutions of Sine-Gordon Equation
Directory of Open Access Journals (Sweden)
DaZhao Lü
2012-01-01
Full Text Available With the help of computer symbolic computation software (e.g., Maple, abundant interaction solutions of sine-Gordon equation are obtained by means of a constructed Wronskian form expansion method. The method is based upon the forms and structures of Wronskian solutions of sine-Gordon equation, and the functions used in the Wronskian determinants do not satisfy linear partial differential equations. Such interaction solutions are difficultly obtained via other methods. And the method can be automatically carried out in computer.
Modified sine bar device measures small angles with high accuracy
Thekaekara, M.
1968-01-01
Modified sine bar device measures small angles with enough accuracy to calibrate precision optical autocollimators. The sine bar is a massive bar of steel supported by two cylindrical rods at one end and one at the other.
Sine-Bar Attachment For Machine Tools
Mann, Franklin D.
1988-01-01
Sine-bar attachment for collets, spindles, and chucks helps machinists set up quickly for precise angular cuts that require greater precision than provided by graduations of machine tools. Machinist uses attachment to index head, carriage of milling machine or lathe relative to table or turning axis of tool. Attachment accurate to 1 minute or arc depending on length of sine bar and precision of gauge blocks in setup. Attachment installs quickly and easily on almost any type of lathe or mill. Requires no special clamps or fixtures, and eliminates many trial-and-error measurements. More stable than improvised setups and not jarred out of position readily.
Sines and Cosines. Part 3 of 3
Apostol, Tom M. (Editor)
1994-01-01
In this 'Project Mathematics' series video, the addition formulas of sines and cosines are explained and their real life applications are demonstrated. Both film footage and computer animation is used. Several mathematical concepts are discussed and include: Ptolemy's theorem concerned with quadrilaterals; the difference between a central angle and an inscribed angle; sines and chord lengths; special angles; subtraction formulas; and a application to simple harmonic motion. A brief history of the city Alexandria, its mathematicians, and their contribution to the field of mathematics is shown.
A novel singular pattern in the sine-Gordon equation
International Nuclear Information System (INIS)
Huang, Debin
2003-01-01
By the scatter problem and the Backlund transformation of the sine-Gordon equation, we find a novel solution with the singularity of jumping phenomenon, which displays pattern structure similar respectively to soliton, kink, anti-kink and double pole solution with the different choice of the purely imaginary spectrum of the sine-Gordon equation
Mao, Hongliang; Wang, Hao
2017-08-01
Instances of highly conserved plant short interspersed nuclear element (SINE) families and their enrichment near genes have been well documented, but little is known about the general patterns of such conservation and enrichment and underlying mechanisms. Here, we perform a comprehensive investigation of the structure, distribution, and evolution of SINEs in the grass family by analyzing 14 grass and 5 other flowering plant genomes using comparative genomics methods. We identify 61 SINE families composed of 29,572 copies, in which 46 families are first described. We find that comparing with other grass TEs, grass SINEs show much higher level of conservation in terms of genomic retention: The origin of at least 26% families can be traced to early grass diversification and these families are among most abundant SINE families in 86% species. We find that these families show much higher level of enrichment near protein coding genes than families of relatively recent origin (51%:28%), and that 40% of all grass SINEs are near gene and the percentage is higher than other types of grass TEs. The pattern of enrichment suggests that differential removal of SINE copies in gene-poor regions plays an important role in shaping the genomic distribution of these elements. We also identify a sequence motif located at 3' SINE end which is shared in 17 families. In short, this study provides insights into structure and evolution of SINEs in the grass family. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Characterization of three novel SINE families with unusual features in Helicoverpa armigera.
Directory of Open Access Journals (Sweden)
Jianjun Wang
Full Text Available Although more than 120 families of short interspersed nuclear elements (SINEs have been isolated from the eukaryotic genomes, little is known about SINEs in insects. Here, we characterize three novel SINEs from the cotton bollworm, Helicoverpa armigera. Two of them, HaSE1 and HaSE2, share similar 5' -structure including a tRNA-related region immediately followed by conserved central domain. The 3' -tail of HaSE1 is significantly similar to that of one LINE retrotransposon element, HaRTE1.1, in H. armigera genome. The 3' -region of HaSE2 showed high identity with one mariner-like element in H. armigera. The third family, termed HaSE3, is a 5S rRNA-derived SINE and shares both body part and 3'-tail with HaSE1, thus may represent the first example of a chimera generated by recombination between 5S rRNA and tRNA-derived SINE in insect species. Further database searches revealed the presence of these SINEs in several other related insect species, but not in the silkworm, Bombyx mori, indicating a relatively narrow distribution of these SINEs in Lepidopterans. Apart from above, we found a copy of HaSE2 in the GenBank EST entry for the cotton aphid, Aphis gossypii, suggesting the occurrence of horizontal transfer.
Characterization of Three Novel SINE Families with Unusual Features in Helicoverpa armigera
Wang, Jianjun; Wang, Aina; Han, Zhaojun; Zhang, Zan; Li, Fei; Li, Xianchun
2012-01-01
Although more than 120 families of short interspersed nuclear elements (SINEs) have been isolated from the eukaryotic genomes, little is known about SINEs in insects. Here, we characterize three novel SINEs from the cotton bollworm, Helicoverpa armigera. Two of them, HaSE1 and HaSE2, share similar 5′ -structure including a tRNA-related region immediately followed by conserved central domain. The 3′ -tail of HaSE1 is significantly similar to that of one LINE retrotransposon element, HaRTE1.1, in H. armigera genome. The 3′ -region of HaSE2 showed high identity with one mariner-like element in H. armigera. The third family, termed HaSE3, is a 5S rRNA-derived SINE and shares both body part and 3′-tail with HaSE1, thus may represent the first example of a chimera generated by recombination between 5S rRNA and tRNA-derived SINE in insect species. Further database searches revealed the presence of these SINEs in several other related insect species, but not in the silkworm, Bombyx mori, indicating a relatively narrow distribution of these SINEs in Lepidopterans. Apart from above, we found a copy of HaSE2 in the GenBank EST entry for the cotton aphid, Aphis gossypii, suggesting the occurrence of horizontal transfer. PMID:22319625
Directory of Open Access Journals (Sweden)
Kensuke Tashiro
Full Text Available Short interspersed repetitive elements (SINEs are highly repeated sequences that account for a significant proportion of many eukaryotic genomes and are usually considered "junk DNA". However, we previously discovered that many AmnSINE1 loci are evolutionarily conserved across mammalian genomes, suggesting that they may have acquired significant functions involved in controlling mammalian-specific traits. Notably, we identified the AS021 SINE locus, located 390 kbp upstream of Satb2. Using transgenic mice, we showed that this SINE displays specific enhancer activity in the developing cerebral cortex. The transcription factor Satb2 is expressed by cortical neurons extending axons through the corpus callosum and is a determinant of callosal versus subcortical projection. Mouse mutants reveal a crucial function for Sabt2 in corpus callosum formation. In this study, we compared the enhancer activity of the AS021 locus with Satb2 expression during telencephalic development in the mouse. First, we showed that the AS021 enhancer is specifically activated in early-born Satb2(+ neurons. Second, we demonstrated that the activity of the AS021 enhancer recapitulates the expression of Satb2 at later embryonic and postnatal stages in deep-layer but not superficial-layer neurons, suggesting the possibility that the expression of Satb2 in these two subpopulations of cortical neurons is under genetically distinct transcriptional control. Third, we showed that the AS021 enhancer is activated in neurons projecting through the corpus callosum, as described for Satb2(+ neurons. Notably, AS021 drives specific expression in axons crossing through the ventral (TAG1(-/NPY(+ portion of the corpus callosum, confirming that it is active in a subpopulation of callosal neurons. These data suggest that exaptation of the AS021 SINE locus might be involved in enhancement of Satb2 expression, leading to the establishment of interhemispheric communication via the corpus callosum
The role of pulse shape in motor cortex transcranial magnetic stimulation using full-sine stimuli.
Directory of Open Access Journals (Sweden)
Igor Delvendahl
Full Text Available A full-sine (biphasic pulse waveform is most commonly used for repetitive transcranial magnetic stimulation (TMS, but little is known about how variations in duration or amplitude of distinct pulse segments influence the effectiveness of a single TMS pulse to elicit a corticomotor response. Using a novel TMS device, we systematically varied the configuration of full-sine pulses to assess the impact of configuration changes on resting motor threshold (RMT as measure of stimulation effectiveness with single-pulse TMS of the non-dominant motor hand area (M1. In young healthy volunteers, we (i compared monophasic, half-sine, and full-sine pulses, (ii applied two-segment pulses consisting of two identical half-sines, and (iii manipulated amplitude, duration, and current direction of the first or second full-sine pulse half-segments. RMT was significantly higher using half-sine or monophasic pulses compared with full-sine. Pulses combining two half-sines of identical polarity and duration were also characterized by higher RMT than full-sine stimuli resulting. For full-sine stimuli, decreasing the amplitude of the half-segment inducing posterior-anterior oriented current in M1 resulted in considerably higher RMT, whereas varying the amplitude of the half-segment inducing anterior-posterior current had a smaller effect. These findings provide direct experimental evidence that the pulse segment inducing a posterior-anterior directed current in M1 contributes most to corticospinal pathway excitation. Preferential excitation of neuronal target cells in the posterior-anterior segment or targeting of different neuronal structures by the two half-segments can explain this result. Thus, our findings help understanding the mechanisms of neural stimulation by full-sine TMS.
Conversion Between Sine Wave and Square Wave Spatial Frequency Response of an Imaging System
National Research Council Canada - National Science Library
Nill, Norman B
2001-01-01
...), is a primary image quality metric that is commonly measured with a sine wave target. The FBI certification program for commercial fingerprint capture devices, which MITRE actively supports, has an MTF requirement...
Bunched soliton states in weakly coupled sine-Gordon systems
DEFF Research Database (Denmark)
Grønbech-Jensen, N.; Samuelsen, Mogens Rugholm; Lomdahl, P. S.
1990-01-01
The interaction between solitons of two weakly coupled sine-Gordon systems is considered. In particular, the stability of bunched states is investigated, and perturbation results are compared with numerical results.......The interaction between solitons of two weakly coupled sine-Gordon systems is considered. In particular, the stability of bunched states is investigated, and perturbation results are compared with numerical results....
Takasaki, N.; Yamaki, T.; Hamada, M.; Park, L.; Okada, N.
1997-01-01
The genomes of chum salmon and pink salmon contain a family of short interspersed repetitive elements (SINEs), designated the salmon SmaI family. It is restricted to these two species, a distribution that suggests that this SINE family might have been generated in their common ancestor. When insertions of the SmaI SINEs at 10 orthologous loci of these species were analyzed, however, it was found that there were no shared insertion sites between chum and pink salmon. Furthermore, at six loci w...
RUDI, a short interspersed element of the V-SINE superfamily widespread in molluscan genomes.
Luchetti, Andrea; Šatović, Eva; Mantovani, Barbara; Plohl, Miroslav
2016-06-01
Short interspersed elements (SINEs) are non-autonomous retrotransposons that are widespread in eukaryotic genomes. They exhibit a chimeric sequence structure consisting of a small RNA-related head, an anonymous body and an AT-rich tail. Although their turnover and de novo emergence is rapid, some SINE elements found in distantly related species retain similarity in certain core segments (or highly conserved domains, HCD). We have characterized a new SINE element named RUDI in the bivalve molluscs Ruditapes decussatus and R. philippinarum and found this element to be widely distributed in the genomes of a number of mollusc species. An unexpected structural feature of RUDI is the HCD domain type V, which was first found in non-amniote vertebrate SINEs and in the SINE from one cnidarian species. In addition to the V domain, the overall sequence conservation pattern of RUDI elements resembles that found in ancient AmnSINE (~310 Myr old) and Au SINE (~320 Myr old) families, suggesting that RUDI might be among the most ancient SINE families. Sequence conservation suggests a monophyletic origin of RUDI. Nucleotide variability and phylogenetic analyses suggest long-term vertical inheritance combined with at least one horizontal transfer event as the most parsimonious explanation for the observed taxonomic distribution.
On a rigorously classical approach to the Sine-Gordon theory
International Nuclear Information System (INIS)
Ulmer, W.
1979-01-01
It is shown that the continuum limit of an infinite set of coupled pendula yields the Sine-Gordon theory. The extension of the model to more dimensions with respect to the propagation yields a generalized Sine-Gordon equation for vector fields, containing Proca equations as a first order approximation. (author)
Perish, then publish: Thomas Harriot and the sine law of refraction.
Fishman, R S
2000-03-01
A talented young scientist, Thomas Harriot, wrote the first English account of the New World, "A Briefe and True Report of the New Found Land of Virginia," distinguished by its serious effort to describe and understand the American Indian. Harriot went on to make innovations in mathematics and was one of the first astronomers to use the telescope. His largely unappreciated contribution to the history of ophthalmology was the first formulation of the sine law of refraction of light, found in his unpublished papers long after his death in 1621. Willebrord Snell discovered the sine law in Holland in 1621 but also died without formally publishing it. Rene Descartes first published the sine law in 1637. The sine law of refraction became not only the prime law of all lens systems but ushered in a new world of physical laws.
Kink-antikink interactions in a modified sine-Gordon model
International Nuclear Information System (INIS)
Peyrard, M.; Campbell, D.K.; Los Alamos National Lab., NM
1983-01-01
We study numerically the interactions of a kink (K) and an antikink (anti K) in a parametrically modified sine-Gordon model with potential V(PHI)=(1-r) 2 (1-cos PHI)/(1+r 2 +2r cos PHI). As the parameter r is varied from the pure sine-Gordon case (r=0) to values for which the model is not completely integrable (rnot=0), we find that a rich structure arises in the Kanti K collisions. For some regions of r(-0.20 4 model, and we show that the theory recently suggested for these collisions also applies quantitatively to the modified sine-Gordon model. In other regions of r we observe new scattering phenomena, which we present in detail numerically and discuss in a qualitative manner analytically. (orig.)
Directory of Open Access Journals (Sweden)
William Dunker
2017-12-01
Full Text Available Short interspersed elements (SINEs are a family of retrotransposons evolutionarily derived from cellular RNA polymerase III transcripts. Over evolutionary time, SINEs have expanded throughout the human genome and today comprise ~11% of total chromosomal DNA. While generally transcriptionally silent in healthy somatic cells, SINE expression increases during a variety of types of stresses, including DNA virus infection. The relevance of SINE expression to viral infection was largely unexplored, however, recent years have seen great progress towards defining the impact of SINE expression on viral replication and host gene expression. Here we review the origin and diversity of SINE elements and their transcriptional control, with an emphasis on how their expression impacts host cell biology during viral infection.
The role of pulse shape in motor cortex transcranial magnetic stimulation using full-sine stimuli
DEFF Research Database (Denmark)
Delvendahl, Igor; Gattinger, Norbert; Berger, Thomas
2014-01-01
A full-sine (biphasic) pulse waveform is most commonly used for repetitive transcranial magnetic stimulation (TMS), but little is known about how variations in duration or amplitude of distinct pulse segments influence the effectiveness of a single TMS pulse to elicit a corticomotor response. Using......) compared monophasic, half-sine, and full-sine pulses, (ii) applied two-segment pulses consisting of two identical half-sines, and (iii) manipulated amplitude, duration, and current direction of the first or second full-sine pulse half-segments. RMT was significantly higher using half-sine or monophasic...... in considerably higher RMT, whereas varying the amplitude of the half-segment inducing anterior-posterior current had a smaller effect. These findings provide direct experimental evidence that the pulse segment inducing a posterior-anterior directed current in M1 contributes most to corticospinal pathway...
Noether's theorem and Steudel's conserved currents for the sine-Gordon equation
International Nuclear Information System (INIS)
Shadwick, W.F.
1980-01-01
A version of Noether's theorem appropriate for the extended Hamilton-Cartan formalism for regular first-order Lagrangians is proposed. Steudel's derivation of an infinite collection of conserved currents for the sine-Gordon equation is presented in this context and it is demonstrated that, as a consequence of the commutativity of the sine-Gordon Baecklund transformations, the conserved charges corresponding to these currents are in involution with respect to the natural Poisson bracket provided by the formalism. Thus one obtains the formal 'complete integrability' of the sine-Gordon equation as a consequence of the properties of the Baecklund transformation. (orig.)
Borodulina, Olga R; Golubchikova, Julia S; Ustyantsev, Ilia G; Kramerov, Dmitri A
2016-02-01
It is generally accepted that only transcripts synthesized by RNA polymerase II (e.g., mRNA) were subject to AAUAAA-dependent polyadenylation. However, we previously showed that RNA transcribed by RNA polymerase III (pol III) from mouse B2 SINE could be polyadenylated in an AAUAAA-dependent manner. Many species of mammalian SINEs end with the pol III transcriptional terminator (TTTTT) and contain hexamers AATAAA in their A-rich tail. Such SINEs were united into Class T(+), whereas SINEs lacking the terminator and AATAAA sequences were classified as T(-). Here we studied the structural features of SINE pol III transcripts that are necessary for their polyadenylation. Eight and six SINE families from classes T(+) and T(-), respectively, were analyzed. The replacement of AATAAA with AACAAA in T(+) SINEs abolished the RNA polyadenylation. Interestingly, insertion of the polyadenylation signal (AATAAA) and pol III transcription terminator in T(-) SINEs did not result in polyadenylation. The detailed analysis of three T(+) SINEs (B2, DIP, and VES) revealed areas important for the polyadenylation of their pol III transcripts: the polyadenylation signal and terminator in A-rich tail, β region positioned immediately downstream of the box B of pol III promoter, and τ region located upstream of the tail. In DIP and VES (but not in B2), the τ region is a polypyrimidine motif which is also characteristic of many other T(+) SINEs. Most likely, SINEs of different mammals acquired these structural features independently as a result of parallel evolution. Copyright © 2015 Elsevier B.V. All rights reserved.
Pi-kinks in a parametrically driven sine-Gordon chain
DEFF Research Database (Denmark)
Kivshar, Yuri S.; Grønbech-Jensen, Niels; Samuelsen, Mogens Rugholm
1992-01-01
We consider the sine-Gordon chain driven by a high-frequency parametric force in the presence of loss. Using an analytical approach based on the method of averaging in fast oscillations, we predict that such a parametric force may support propagation of π kinks, which are unstable in the standard...... sine-Gordon model. The steady-state velocity of the π kinks is calculated, and the analytical results are in good agreement with direct numerical simulations....
LINEs Contribute to the Origins of Middle Bodies of SINEs besides 3′ Tails
2018-01-01
Abstract Short interspersed elements (SINEs), which are nonautonomous transposable elements, require the transposition machinery of long interspersed elements (LINEs) to mobilize. SINEs are composed of two or more independently originating parts. The 5′ region is called the “head” and is derived mainly from small RNAs, and the 3′ region (“tail”) originates from the 3′ region of LINEs and is responsible for being recognized by counterpart LINE proteins. The origin of the middle “body” of SINEs is enigmatic, although significant sequence similarities among SINEs from very diverse species have been observed. Here, a systematic analysis of the similarities among SINEs and LINEs deposited on Repbase, a comprehensive database of eukaryotic repeat sequences was performed. Three primary findings are described: 1) The 5′ regions of only two clades of LINEs, RTE and Vingi, were revealed to have contributed to the middle parts of SINEs; 2) The linkage of the 5′ and 3′ parts of LINEs can be lost due to occasional tail exchange of SINEs; and 3) The previously proposed Ceph-domain was revealed to be a fusion of a CORE-domain and a 5′ part of RTE clade of LINE. Based on these findings, a hypothesis that the 5′ parts of bipartite nonautonomous LINEs, which possess only the 5′ and 3′ regions of the original LINEs, can contribute to the undefined middle part of SINEs is proposed. PMID:29325122
A specific family of interspersed repeats (SINEs facilitates meiotic synapsis in mammals
Directory of Open Access Journals (Sweden)
Johnson Matthew E
2013-01-01
Full Text Available Abstract Background Errors during meiosis that affect synapsis and recombination between homologous chromosomes contribute to aneuploidy and infertility in humans. Despite the clinical relevance of these defects, we know very little about the mechanisms by which homologous chromosomes interact with one another during mammalian meiotic prophase. Further, we remain ignorant of the way in which chromosomal DNA complexes with the meiosis-specific structure that tethers homologs, the synaptonemal complex (SC, and whether specific DNA elements are necessary for this interaction. Results In the present study we utilized chromatin immunoprecipitation (ChIP and DNA sequencing to demonstrate that the axial elements of the mammalian SC are markedly enriched for a specific family of interspersed repeats, short interspersed elements (SINEs. Further, we refine the role of the repeats to specific sub-families of SINEs, B1 in mouse and AluY in old world monkey (Macaca mulatta. Conclusions Because B1 and AluY elements are the most actively retrotransposing SINEs in mice and rhesus monkeys, respectively, our observations imply that they may serve a dual function in axial element binding; i.e., as the anchoring point for the SC but possibly also as a suppressor/regulator of retrotransposition.
A plastic miniature x-ray emission spectrometer based on the cylindrical von Hamos geometry
International Nuclear Information System (INIS)
Mattern, B. A.; Seidler, G. T.; Haave, M.; Pacold, J. I.; Gordon, R. A.; Planillo, J.; Quintana, J.; Rusthoven, B.
2012-01-01
We present a short working distance miniature x-ray emission spectrometer (miniXES) based on the cylindrical von Hamos geometry. We describe the general design principles for the spectrometer and detail a specific implementation that covers Kβ and valence level emission from Fe. Large spatial and angular access to the sample region provides compatibility with environmental chambers, microprobe, and pump/probe measurements. The primary spectrometer structure and optic is plastic, printed using a 3-dimensional rapid-prototype machine. The spectrometer is inexpensive to construct and is portable; it can be quickly set up at any focused beamline with a tunable narrow bandwidth monochromator. The sample clearance is over 27 mm, providing compatibility with a variety of environment chambers. An overview is also given of the calibration and data processing procedures, which are implemented by a multiplatform user-friendly software package. Finally, representative measurements are presented. Background levels are below the level of the Kβ 2,5 valence emission, the weakest diagram line in the system, and photometric analysis of count rates finds that the instrument is performing at the theoretical limit.
International Nuclear Information System (INIS)
Skagerstam, B.K.
1976-01-01
We discuss a generalization of the conventional sine-Gordon quantum field theory by using methods recently developed by Coleman. As a result we can argue that the equivalence between the sine-Gordon theory and the massive Thirring model is unaffected if we perturb the sine-Gordon Hamiltonian by a bounded perturbation consisting of a continuous sum of sine-Gordon type interactions
RNA-Mediated Gene Duplication and Retroposons: Retrogenes, LINEs, SINEs, and Sequence Specificity
2013-01-01
A substantial number of “retrogenes” that are derived from the mRNA of various intron-containing genes have been reported. A class of mammalian retroposons, long interspersed element-1 (LINE1, L1), has been shown to be involved in the reverse transcription of retrogenes (or processed pseudogenes) and non-autonomous short interspersed elements (SINEs). The 3′-end sequences of various SINEs originated from a corresponding LINE. As the 3′-untranslated regions of several LINEs are essential for retroposition, these LINEs presumably require “stringent” recognition of the 3′-end sequence of the RNA template. However, the 3′-ends of mammalian L1s do not exhibit any similarity to SINEs, except for the presence of 3′-poly(A) repeats. Since the 3′-poly(A) repeats of L1 and Alu SINE are critical for their retroposition, L1 probably recognizes the poly(A) repeats, thereby mobilizing not only Alu SINE but also cytosolic mRNA. Many flowering plants only harbor L1-clade LINEs and a significant number of SINEs with poly(A) repeats, but no homology to the LINEs. Moreover, processed pseudogenes have also been found in flowering plants. I propose that the ancestral L1-clade LINE in the common ancestor of green plants may have recognized a specific RNA template, with stringent recognition then becoming relaxed during the course of plant evolution. PMID:23984183
Varshney, Dhaval; Vavrova-Anderson, Jana; Oler, Andrew J.; Cowling, Victoria H.; Cairns, Bradley R.; White, Robert J.
2015-01-01
Short interspersed nuclear elements (SINEs), such as Alu, spread by retrotransposition, which requires their transcripts to be copied into DNA and then inserted into new chromosomal sites. This can lead to genetic damage through insertional mutagenesis and chromosomal rearrangements between non-allelic SINEs at distinct loci. SINE DNA is heavily methylated and this was thought to suppress its accessibility and transcription, thereby protecting against retrotransposition. Here we provide several lines of evidence that methylated SINE DNA is occupied by RNA polymerase III, including the use of high-throughput bisulphite sequencing of ChIP DNA. We find that loss of DNA methylation has little effect on accessibility of SINEs to transcription machinery or their expression in vivo. In contrast, a histone methyltransferase inhibitor selectively promotes SINE expression and occupancy by RNA polymerase III. The data suggest that methylation of histones rather than DNA plays a dominant role in suppressing SINE transcription. PMID:25798578
Quantum Hall bilayers and the chiral sine-Gordon equation
International Nuclear Information System (INIS)
Naud, J.D.; Pryadko, Leonid P.; Sondhi, S.L.
2000-01-01
The edge state theory of a class of symmetric double-layer quantum Hall systems with interlayer electron tunneling reduces to the sum of a free field theory and a field theory of a chiral Bose field with a self-interaction of the sine-Gordon form. We argue that the perturbative renormalization group flow of this chiral sine-Gordon theory is distinct from the standard (non-chiral) sine-Gordon theory, contrary to a previous assertion by Renn, and that the theory is manifestly sensible only at a discrete set of values of the inverse period of the cosine interaction (β-circumflex). We obtain exact solutions for the spectra and correlation functions of the chiral sine-Gordon theory at the two values of β-circumflex at which electron tunneling in bilayers is not irrelevant. Of these, the marginal case (β-circumflex 2 =4) is of greatest interest: the spectrum of the interacting theory is that of two Majorana fermions with different, dynamically generated, velocities. For the experimentally observed bilayer 331 state at filling factor 1/2, this implies the trifurcation of electrons added to the edge. We also present a method for fermionizing the theory at the discrete points (β-circumflex 2 is an element of Z + ) by the introduction of auxiliary degrees of freedom that could prove useful in other problems involving quantum Hall multi-layers
LINEs, SINEs and other retroelements: do birds of a feather flock together?
Roy-Engel, Astrid M
2012-01-01
Mobile elements account for almost half of the mass of the human genome. Only the retroelements from the non-LTR (long terminal repeat) retrotransposon family, which include the LINE-1 (L1) and its non-autonomous partners, are currently active and contributing to new insertions. Although these elements seem to share the same basic amplification mechanism, the activity and success of the different types of retroelements varies. For example, Alu-induced mutagenesis is responsible for the majority of the documented instances of human disease induced by insertion of retroelements. Using copy number in mammals as an indicator, some SINEs have been vastly more successful than other retroelements, such as the retropseudogenes and even L1, likely due to differences in post-insertion selection and ability to overcome cellular controls. SINE and LINE integration can be differentially influenced by cellular factors, indicating some differences between in their amplification mechanisms. We focus on the known aspects of this group of retroelements and highlight their similarities and differences that may significantly influence their biological impact.
An integrable noncommutative version of the sine-Gordon system
International Nuclear Information System (INIS)
Grisaru, Marcus T.; Penati, Silvia
2003-01-01
Using the bicomplex approach we discuss an integrable noncommutative system in two-dimensional Euclidean space. It is described by an equation of motion which reduces to the ordinary sine-Gordon equation when the noncommutation parameter is removed, plus a constraint equation which is nontrivial only in the noncommutative case. The implications of this constraint, which is required by integrability but seems to reduce the space of classical solutions, remain to be understood. We show that the system has an infinite number of conserved currents and we give the general recursive relation for constructing them. For the particular cases of lower spin nontrivial currents we work out the explicit expressions and perform a direct check of their conservation. These currents reduce to the usual sine-Gordon currents in the commutative limit. We find classical 'localized' solutions to first order in the noncommutativity parameter and describe the Backlund transformations for our system. Finally, we comment on the relation of our noncommutative system to the commutative sine-Gordon system
Extended sine-Gordon Equation Method and Its Application to Maccari's System
International Nuclear Information System (INIS)
Song Lina; Zhang Hongqing
2005-01-01
An extended sine-Gordon equation method is proposed to construct exact travelling wave solutions to Maccari's equation based upon a generalized sine-Gordon equation. It is shown that more new travelling wave solutions can be found by this new method, which include bell-shaped soliton solutions, kink-shaped soliton solutions, periodic wave solution, and new travelling waves.
Light-front quantization of the sine-Gordon model
International Nuclear Information System (INIS)
Burkardt, M.
1993-01-01
It is shown how to modify the canonical light-front quantization of the (1+1)-dimensional sine-Gordon model such that the zero-mode problem of light-front quantization is avoided. The canonical sine-Gordon Lagrangian is replaced by an effective Lagrangian which does not lead to divergences as k + =(k 0 +k 1 )/ √2 →0. After canonically quantizing the effective Lagrangian, one obtains the effective light-front Hamiltonian which agrees with the naive light-front (LF) Hamiltonian, up to one additional renormalization. The spectrum of the effective LF Hamiltonian is determined using discrete light-cone quantization and agrees with results from equal-time quantization
Cosine and sine operators related to orthogonal polynomial sets on the interval [-1, 1
International Nuclear Information System (INIS)
Appl, Thomas; Schiller, Diethard H
2005-01-01
The quantization of phase is still an open problem. In the approach of Susskind and Glogower, the so-called cosine and sine operators play a fundamental role. Their eigenstates in the Fock representation are related to the Chebyshev polynomials of the second kind. Here we introduce more general cosine and sine operators whose eigenfunctions in the Fock basis are related in a similar way to arbitrary orthogonal polynomial sets on the interval [-1, 1]. To each polynomial set defined in terms of a weight function there corresponds a pair of cosine and sine operators. Depending on the symmetry of the weight function, we distinguish generalized or extended operators. Their eigenstates are used to define cosine and sine representations and probability distributions. We also consider the arccosine and arcsine operators and use their eigenstates to define cosine-phase and sine-phase distributions, respectively. Specific, numerical and graphical results are given for the classical orthogonal polynomials and for particular Fock and coherent states
Schröder, Christiane; Bleidorn, Christoph; Hartmann, Stefanie; Tiedemann, Ralph
2009-12-15
Investigating the dog genome we found 178965 introns with a moderate length of 200-1000 bp. A screening of these sequences against 23 different repeat libraries to find insertions of short interspersed elements (SINEs) detected 45276 SINEs. Virtually all of these SINEs (98%) belong to the tRNA-derived Can-SINE family. Can-SINEs arose about 55 million years ago before Carnivora split into two basal groups, the Caniformia (dog-like carnivores) and the Feliformia (cat-like carnivores). Genome comparisons of dog and cat recovered 506 putatively informative SINE loci for caniformian phylogeny. In this study we show how to use such genome information of model organisms to research the phylogeny of related non-model species of interest. Investigating a dataset including representatives of all major caniformian lineages, we analysed 24 randomly chosen loci for 22 taxa. All loci were amplifiable and revealed 17 parsimony-informative SINE insertions. The screening for informative SINE insertions yields a large amount of sequence information, in particular of introns, which contain reliable phylogenetic information as well. A phylogenetic analysis of intron- and SINE sequence data provided a statistically robust phylogeny which is congruent with the absence/presence pattern of our SINE markers. This phylogeny strongly supports a sistergroup relationship of Musteloidea and Pinnipedia. Within Pinnipedia, we see strong support from bootstrapping and the presence of a SINE insertion for a sistergroup relationship of the walrus with the Otariidae.
The LINEs and SINEs of Entamoeba histolytica: comparative analysis and genomic distribution.
Bakre, Abhijeet A; Rawal, Kamal; Ramaswamy, Ram; Bhattacharya, Alok; Bhattacharya, Sudha
2005-07-01
Autonomous non-long terminal repeat retrotransposons are commonly referred to as long interspersed elements (LINEs). Short non-autonomous elements that borrow the LINE machinery are called SINES. The Entamoeba histolytica genome contains three classes of LINEs and SINEs. Together the EhLINEs/SINEs account for about 6% of the genome. The recognizable functional domains in all three EhLINEs included reverse transcriptase and endonuclease. A novel feature was the presence of two types of members-some with a single long ORF (less frequent) and some with two ORFs (more frequent) in both EhLINE1 and 2. The two ORFs were generated by conserved changes leading to stop codon. Computational analysis of the immediate flanking sequences for each element showed that they inserted in AT-rich sequences, with a preponderance of Ts in the upstream site. The elements were very frequently located close to protein-coding genes and other EhLINEs/SINEs. The possible influence of these elements on expression of neighboring genes needs to be determined.
Group-theoretical aspects of the discrete sine-Gordon equation
International Nuclear Information System (INIS)
Orfanidis, S.J.
1980-01-01
The group-theoretical interpretation of the sine-Gordon equation in terms of connection forms on fiber bundles is extended to the discrete case. Solutions of the discrete sine-Gordon equation induce surfaces on a lattice in the SU(2) group space. The inverse scattering representation, expressing the parallel transport of fibers, is implemented by means of finite rotations. Discrete Baecklund transformations are realized as gauge transformations. The three-dimensional inverse scattering representation is used to derive a discrete nonlinear sigma model, and the corresponding Baecklund transformation and Pohlmeyer's R transformation are constructed
Zhao, Yun-wei; Zhu, Zi-qiang; Lu, Guang-yin; Han, Bo
2018-03-01
The sine and cosine transforms implemented with digital filters have been used in the Transient electromagnetic methods for a few decades. Kong (2007) proposed a method of obtaining filter coefficients, which are computed in the sample domain by Hankel transform pair. However, the curve shape of Hankel transform pair changes with a parameter, which usually is set to be 1 or 3 in the process of obtaining the digital filter coefficients of sine and cosine transforms. First, this study investigates the influence of the parameter on the digital filter algorithm of sine and cosine transforms based on the digital filter algorithm of Hankel transform and the relationship between the sine, cosine function and the ±1/2 order Bessel function of the first kind. The results show that the selection of the parameter highly influences the precision of digital filter algorithm. Second, upon the optimal selection of the parameter, it is found that an optimal sampling interval s also exists to achieve the best precision of digital filter algorithm. Finally, this study proposes four groups of sine and cosine transform digital filter coefficients with different length, which may help to develop the digital filter algorithm of sine and cosine transforms, and promote its application.
Analyses of carnivore microsatellites and their intimate association with tRNA-derived SINEs.
López-Giráldez, Francesc; Andrés, Olga; Domingo-Roura, Xavier; Bosch, Montserrat
2006-10-23
The popularity of microsatellites has greatly increased in the last decade on account of their many applications. However, little is currently understood about the factors that influence their genesis and distribution among and within species genomes. In this work, we analyzed carnivore microsatellite clones from GenBank to study their association with interspersed repeats and elucidate the role of the latter in microsatellite genesis and distribution. We constructed a comprehensive carnivore microsatellite database comprising 1236 clones from GenBank. Thirty-three species of 11 out of 12 carnivore families were represented, although two distantly related species, the domestic dog and cat, were clearly overrepresented. Of these clones, 330 contained tRNALys-derived SINEs and 357 contained other interspersed repeats. Our rough estimates of tRNA SINE copies per haploid genome were much higher than published ones. Our results also revealed a distinct juxtaposition of AG and A-rich repeats and tRNALys-derived SINEs suggesting their coevolution. Both microsatellites arose repeatedly in two regions of the interspersed repeat. Moreover, microsatellites associated with tRNALys-derived SINEs showed the highest complexity and less potential instability. Our results suggest that tRNALys-derived SINEs are a significant source for microsatellite generation in carnivores, especially for AG and A-rich repeat motifs. These observations indicate two modes of microsatellite generation: the expansion and variation of pre-existing tandem repeats and the conversion of sequences with high cryptic simplicity into a repeat array; mechanisms which are not specific to tRNALys-derived SINEs. Microsatellite and interspersed repeat coevolution could also explain different distribution of repeat types among and within species genomes.Finally, due to their higher complexity and lower potential informative content of microsatellites associated with tRNALys-derived SINEs, we recommend avoiding
Analyses of carnivore microsatellites and their intimate association with tRNA-derived SINEs
Directory of Open Access Journals (Sweden)
Bosch Montserrat
2006-10-01
Full Text Available Abstract Background The popularity of microsatellites has greatly increased in the last decade on account of their many applications. However, little is currently understood about the factors that influence their genesis and distribution among and within species genomes. In this work, we analyzed carnivore microsatellite clones from GenBank to study their association with interspersed repeats and elucidate the role of the latter in microsatellite genesis and distribution. Results We constructed a comprehensive carnivore microsatellite database comprising 1236 clones from GenBank. Thirty-three species of 11 out of 12 carnivore families were represented, although two distantly related species, the domestic dog and cat, were clearly overrepresented. Of these clones, 330 contained tRNALys-derived SINEs and 357 contained other interspersed repeats. Our rough estimates of tRNA SINE copies per haploid genome were much higher than published ones. Our results also revealed a distinct juxtaposition of AG and A-rich repeats and tRNALys-derived SINEs suggesting their coevolution. Both microsatellites arose repeatedly in two regions of the insterspersed repeat. Moreover, microsatellites associated with tRNALys-derived SINEs showed the highest complexity and less potential instability. Conclusion Our results suggest that tRNALys-derived SINEs are a significant source for microsatellite generation in carnivores, especially for AG and A-rich repeat motifs. These observations indicate two modes of microsatellite generation: the expansion and variation of pre-existing tandem repeats and the conversion of sequences with high cryptic simplicity into a repeat array; mechanisms which are not specific to tRNALys-derived SINEs. Microsatellite and interspersed repeat coevolution could also explain different distribution of repeat types among and within species genomes. Finally, due to their higher complexity and lower potential informative content of microsatellites
Mössbauer spectra linearity improvement by sine velocity waveform followed by linearization process
Kohout, Pavel; Frank, Tomas; Pechousek, Jiri; Kouril, Lukas
2018-05-01
This note reports the development of a new method for linearizing the Mössbauer spectra recorded with a sine drive velocity signal. Mössbauer spectra linearity is a critical parameter to determine Mössbauer spectrometer accuracy. Measuring spectra with a sine velocity axis and consecutive linearization increases the linearity of spectra in a wider frequency range of a drive signal, as generally harmonic movement is natural for velocity transducers. The obtained data demonstrate that linearized sine spectra have lower nonlinearity and line width parameters in comparison with those measured using a traditional triangle velocity signal.
[Non-LTR retrotransposons: LINEs and SINEs in plant genome].
Cheng, Xu-Dong; Ling, Hong-Qing
2006-06-01
Retrotransposons are one of the drivers of genome evolution. They include LTR (long terminal repeat) retrotransposons, which widespread in Eukaryotagenomes, show structural similarity to retroviruses. Non-LTR retrotransposons were first discovered in animal genomes and then identified as ubiquitous components of nuclear genomes in many species across the plant kingdom. They constitute a large fraction of the repetitive DNA. Non-LTR retrotransposons are divided into LINEs (long interspersed nuclear elements) and SINEs (short interspersed nuclear elements). Transposition of non-LTR retrotransposons is rarely observed in plants indicating that most of them are inactive and/or under regulation of the host genome. Transposition is poorly understood, but experimental evidence from other genetic systems shows that LINEs are able to transpose autonomously while non-autonomous SINEs depend on the reverse transcription machinery of other retrotransposons. Phylogenic analysis shows LINEs are probably the most ancient class of retrotransposons in plant genomes, while the origin of SINEs is unknown. This review sums up the above data and wants to show readers a clear picture of non-LTR retrotransposons.
International Nuclear Information System (INIS)
Crochiere, Marsha; Kashyap, Trinayan; Kalid, Ori; Shechter, Sharon; Klebanov, Boris; Senapedis, William; Saint-Martin, Jean-Richard; Landesman, Yosef
2015-01-01
Exportin 1 (XPO1) is a well-characterized nuclear export protein whose expression is up-regulated in many types of cancers and functions to transport key tumor suppressor proteins (TSPs) from the nucleus. Karyopharm Therapeutics has developed a series of small-molecule Selective Inhibitor of Nuclear Export (SINE) compounds, which have been shown to block XPO1 function both in vitro and in vivo. The drug candidate, selinexor (KPT-330), is currently in Phase-II/IIb clinical trials for treatment of both hematologic and solid tumors. The present study sought to decipher the mechanisms that render cells either sensitive or resistant to treatment with SINE compounds, represented by KPT-185, an early analogue of KPT-330. Using the human fibrosarcoma HT1080 cell line, resistance to SINE was acquired over a period of 10 months of constant incubation with increasing concentration of KPT-185. Cell viability was assayed by MTT. Immunofluorescence was used to compare nuclear export of TSPs. Fluorescence activated cell sorting (FACS), quantitative polymerase chain reaction (qPCR), and immunoblots were used to measure effects on cell cycle, gene expression, and cell death. RNA from naïve and drug treated parental and resistant cells was analyzed by Affymetrix microarrays. Treatment of HT1080 cells with gradually increasing concentrations of SINE resulted in > 100 fold decrease in sensitivity to SINE cytotoxicity. Resistant cells displayed prolonged cell cycle, reduced nuclear accumulation of TSPs, and similar changes in protein expression compared to parental cells, however the magnitude of the protein expression changes were more significant in parental cells. Microarray analyses comparing parental to resistant cells indicate that a number of key signaling pathways were altered in resistant cells including expression changes in genes involved in adhesion, apoptosis, and inflammation. While the patterns of changes in transcription following drug treatment are similar in parental
Oscillating and rotating sine-Gordon system
DEFF Research Database (Denmark)
Olsen, O. H.; Samuelsen, Mogens Rugholm
1986-01-01
The interaction between a 2π kink and the background or vacuum is investigated in the pure sine-Gordon system. For an oscillating background (i.e., the k=0 part of the phonon spectrum) the 2π kink oscillates, while for increasing or decreasing vacuum two phenomena have been observed, depending...
Terai, Yohey; Takezaki, Naoko; Mayer, Werner E; Tichy, Herbert; Takahata, Naoyuki; Klein, Jan; Okada, Norihiro
2004-01-01
Genomic DNA libraries were prepared from two endemic species of Lake Victoria haplochromine (cichlid) fish and used to isolate and characterize a set of short interspersed elements (SINEs). The distribution and sequences of the SINEs were used to infer phylogenetic relationships among East African haplochromines. The SINE-based classification divides the fish into four groups, which, in order of their divergence from a stem lineage, are the endemic Lake Tanganyika flock (group 1); fish of the nonendemic, monotypic, widely distributed genus Astatoreochromis (group 2); the endemic Lake Malawi flock (group 3); and group 4, which contains fish from widely dispersed East African localities including Lakes Victoria, Edward, George, Albert, and Rukwa, as well as many rivers. The group 4 haplochromines are characterized by a subset of polymorphic SINEs, each of which is present in some individuals and absent in others of the same population at a given locality, the same morphologically defined species, and the same mtDNA-defined haplogroup. SINE-defined group 4 contains six of the seven previously described mtDNA haplogroups. One of the polymorphic SINEs appears to be fixed in the endemic Lake Victoria flock; four others display the presence-or-absence polymorphism within the species of this flock. These findings have implications for the origin of Lake Victoria cichlids and for their founding population sizes.
New quasi-periodic waves of the (2+1)-dimensional sine-Gordon system
International Nuclear Information System (INIS)
Hu, H.C.; Lou, S.Y.
2005-01-01
New exact solutions of the well-known (2+1)-dimensional sine-Gordon system are studied by introducing the modified mapping relations between the cubic nonlinear Klein-Gordon and sine-Gordon equations. Two arbitrary functions are included into the Jacobi elliptic function solutions. By proper selections of the arbitrary functions, new quasi-periodic wave solutions are obtained and displayed graphically
Reshaping-induced spatiotemporal chaos in driven, damped sine-Gordon systems
International Nuclear Information System (INIS)
Chacon, R.
2007-01-01
Spatiotemporal chaos arising from the competition between sine-Gordon-breather and kink-antikink-pair solitons by reshaping an ac force is demonstrated. After introducing soliton collective coordinates, Melnikov's method is applied to the resulting effective equation of motion to estimate the parameter-space regions of the ac force where homoclinic bifurcations are induced. The analysis reveals that the chaos-order threshold exhibits sensitivity to small changes in the force shape. Computer simulations of the sine-Gordon system show good agreement with these theoretical predictions
Reshaping-induced spatiotemporal chaos in driven, damped sine-Gordon systems
Energy Technology Data Exchange (ETDEWEB)
Chacon, R. [Departamento de Electronica e Ingenieria Electromecanica, Escuela de Ingenierias Industriales, Universidad de Extremadura, E-06071 Badajoz (Spain)]. E-mail: rchacon@unex.es
2007-03-15
Spatiotemporal chaos arising from the competition between sine-Gordon-breather and kink-antikink-pair solitons by reshaping an ac force is demonstrated. After introducing soliton collective coordinates, Melnikov's method is applied to the resulting effective equation of motion to estimate the parameter-space regions of the ac force where homoclinic bifurcations are induced. The analysis reveals that the chaos-order threshold exhibits sensitivity to small changes in the force shape. Computer simulations of the sine-Gordon system show good agreement with these theoretical predictions.
Conjunctival amelanotic malignant melanoma arising in primary acquired melanosis sine pigmento.
Jay, V; Font, R L
1998-01-01
The authors describe an amelanotic malignant melanoma of the conjunctiva in association with primary acquired melanosis (PAM) sine pigmento, and highlight the clinical and pathologic features of this rare entity. Histopathologic and immunohistochemical studies were performed on a conjunctival tumor in a 54-year-old white woman. Case report. Histopathologic examination revealed an invasive amelanotic melanoma of the conjunctiva, with anterior orbital extension arising from intraepithelial dysplastic melanocytes that lacked melanin pigment (PAM sine pigmento). Both the malignant melanoma cells and the intraepithelial dysplastic melanocytes in the areas of PAM exhibited S-100 and HMB-45 positivity. The patient underwent an orbital exenteration that disclosed tumor within the anterior orbit inferiorly. Amelanotic invasive malignant melanoma can arise in association with PAM sine pigmento, as seen in our patient who had orbital invasion necessitating exenteration. This aggressive form of conjunctival melanoma is often associated with a poor prognosis and risk of metastatic disease. Absence of conjunctival pigmentation in PAM sine pigmento prevents early clinical detection of this variant of PAM. This lack of pigmentation also makes clinical diagnosis virtually impossible, and diagnosis can only be established histopathologically. Awareness of this nonpigmented variety of PAM is crucial for early recognition and appropriate management of the associated melanoma.
Unilateral retinitis pigmentosa sine pigmento.
Pearlman, J T; Saxton, J; Hoffman, G
1976-05-01
A patient presented with unilateral findings of night blindness shown by impaired rod function and dark adaptation, constricted visual fields with good central acuity, a barely recordable electro-retinographic b-wave, and a unilaterally impaired electro-oculogram. There were none of the pigmentary changes usually associated with retinitis pigmentosa. The unaffected right eye was normal in all respects. Therefore the case is most probably one of unilateral retinitis pigmentosa sine pigmento.
Modified hyperbolic sine model for titanium dioxide-based memristive thin films
Abu Bakar, Raudah; Syahirah Kamarozaman, Nur; Fazlida Hanim Abdullah, Wan; Herman, Sukreen Hana
2018-03-01
Since the emergence of memristor as the newest fundamental circuit elements, studies on memristor modeling have been evolved. To date, the developed models were based on the linear model, linear ionic drift model using different window functions, tunnelling barrier model and hyperbolic-sine function based model. Although using hyperbolic-sine function model could predict the memristor electrical properties, the model was not well fitted to the experimental data. In order to improve the performance of the hyperbolic-sine function model, the state variable equation was modified. On the one hand, the addition of window function cannot provide an improved fitting. By multiplying the Yakopcic’s state variable model to Chang’s model on the other hand resulted in the closer agreement with the TiO2 thin film experimental data. The percentage error was approximately 2.15%.
International Nuclear Information System (INIS)
Nandori, I; Jentschura, U D; Nagy, S; Sailer, K; Vad, K; Meszaros, S
2007-01-01
We find a mapping of the layered sine-Gordon model to an equivalent gas of topological excitations and determine the long-range interaction potentials of the topological defects. This enables us to make a detailed comparison to the so-called layered vortex gas, which can be obtained from the layered Ginzburg-Landau model. The layered sine-Gordon model has been proposed in the literature as a candidate field-theoretical model for Josephson-coupled high-T c superconductors, and the implications of our analysis for the applicability of the layered sine-Gordon model to high-T c superconductors are discussed. We are led to the conjecture that the layered sine-Gordon and the layered vortex gas models belong to different universality classes. The determination of the critical temperature of the layered sine-Gordon model is based on a renormalization-group analysis
Deterministic approach for multiple-source tsunami hazard assessment for Sines, Portugal
Wronna, M.; Omira, R.; Baptista, M. A.
2015-01-01
In this paper, we present a deterministic approach to tsunami hazard assessment for the city and harbour of Sines, Portugal, one of the test sites of project ASTARTE (Assessment, STrategy And Risk Reduction for Tsunamis in Europe). Sines has one of the most important deep-water ports, which has oil-bearing, petrochemical, liquid-bulk, coal, and container terminals. The port and its industrial infrastructures face the ocean southwest towards the main seismogenic sources. This...
The elliptic sine-Gordon equation in a half plane
International Nuclear Information System (INIS)
Pelloni, B; Pinotsis, D A
2010-01-01
We consider boundary value problems for the elliptic sine-Gordon equation posed in the half plane y > 0. This problem was considered in Gutshabash and Lipovskii (1994 J. Math. Sci. 68 197–201) using the classical inverse scattering transform approach. Given the limitations of this approach, the results obtained rely on a nonlinear constraint on the spectral data derived heuristically by analogy with the linearized case. We revisit the analysis of such problems using a recent generalization of the inverse scattering transform known as the Fokas method, and show that the nonlinear constraint of Gutshabash and Lipovskii (1994 J. Math. Sci. 68 197–201) is a consequence of the so-called global relation. We also show that this relation implies a stronger constraint on the spectral data, and in particular that no choice of boundary conditions can be associated with a decaying (possibly mod 2π) solution analogous to the pure soliton solutions of the usual, time-dependent sine-Gordon equation. We also briefly indicate how, in contrast to the evolutionary case, the elliptic sine-Gordon equation posed in the half plane does not admit linearisable boundary conditions
Saha, T. T.
1984-01-01
An equation similar to the Abbe sine condition is derived for a Wolter type II telescope. This equation and the sine condition are then combined to produce a so called generalized sine condition. Using the law of reflection, Fermat's principle, the generalized sine condition, and simple geometry the surface equations for a Wolter type II telescope and an equivalent Wolter-Schwarzschild telescope are calculated. The performances of the telescopes are compared in terms of rms blur circle radius at the Gaussian focal plane and at best focus.
Benjamin Banneker and the Law of Sines
Mahoney, John F.
2005-01-01
Benjamin Banneker, a self-taught mathematician, surveyor and astronomer published annual almanacs containing his astronomical observations and predictions. Banneker who also used logarithms to apply the Law of Sines believed that the method used to solve a mathematical problem depends on the tools available.
Critical properties of the double-frequency sine-Gordon model with applications
International Nuclear Information System (INIS)
Fabrizio, M.; Gogolin, A.O.; Nersesyan, A.A.
2000-01-01
We study the properties of the double-frequency sine-Gordon model in the vicinity of the Ising quantum phase transition displayed by this model. Using a mapping onto a generalized lattice quantum Ashkin-Teller model, we obtain critical and nearly-off-critical correlation functions of various operators. We discuss applications of the double-sine-Gordon model to one-dimensional physical systems, like spin chains in a staggered external field and interacting electrons in a staggered potential
Cross-Correlation-Function-Based Multipath Mitigation Method for Sine-BOC Signals
Directory of Open Access Journals (Sweden)
H. H. Chen
2012-06-01
Full Text Available Global Navigation Satellite Systems (GNSS positioning accuracy indoor and urban canyons environments are greatly affected by multipath due to distortions in its autocorrelation function. In this paper, a cross-correlation function between the received sine phased Binary Offset Carrier (sine-BOC modulation signal and the local signal is studied firstly, and a new multipath mitigation method based on cross-correlation function for sine-BOC signal is proposed. This method is implemented to create a cross-correlation function by designing the modulated symbols of the local signal. The theoretical analysis and simulation results indicate that the proposed method exhibits better multipath mitigation performance compared with the traditional Double Delta Correlator (DDC techniques, especially the medium/long delay multipath signals, and it is also convenient and flexible to implement by using only one correlator, which is the case of low-cost mass-market receivers.
Consommation de viande de chasse chez les Sereers du Sine (Sénégal
Directory of Open Access Journals (Sweden)
Vincke, PP.
1985-01-01
Full Text Available Consumption of game meat amongst the Sereers of Sine (Senegal. Though climatic and other factors have reduced wildlife's role in the life of Sereer villagers, hunting for food is still practised, especially by younger peuple. Thanks to a field study, this activity is examined and its future envisaged in the context of rural development.
Invariant solutions of the supersymmetric sine-Gordon equation
International Nuclear Information System (INIS)
Grundland, A M; Hariton, A J; Snobl, L
2009-01-01
A comprehensive symmetry analysis of the N=1 supersymmetric sine-Gordon equation is performed. Two different forms of the supersymmetric system are considered. We begin by studying a system of partial differential equations corresponding to the coefficients of the various powers of the anticommuting independent variables. Next, we consider the super-sine-Gordon equation expressed in terms of a bosonic superfield involving anticommuting independent variables. In each case, a Lie (super)algebra of symmetries is determined and a classification of all subgroups having generic orbits of codimension 1 in the space of independent variables is performed. The method of symmetry reduction is systematically applied in order to derive invariant solutions of the supersymmetric model. Several types of algebraic, hyperbolic and doubly periodic solutions are obtained in explicit form.
Churakov, Gennady; Smit, Arian F A; Brosius, Jürgen; Schmitz, Jürgen
2005-04-01
About half of the mammalian genome is composed of retroposons. Long interspersed elements (LINEs) and short interspersed elements (SINEs) are the most abundant repetitive elements and account for about 21% and 13% of the human genome, respectively. SINEs have been detected in all major mammalian lineages, except for the South American order Xenarthra, also termed Edentata (armadillos, anteaters, and sloths). Investigating this order, we discovered a novel high-copy-number family of tRNA derived SINEs in the nine-banded armadillo Dasypus novemcinctus, a species that successfully crossed the Central American land bridge to North America in the Pliocene. A specific computer algorithm was developed, and we detected and extracted 687 specific SINEs from databases. Termed DAS-SINEs, we further divided them into six distinct subfamilies. We extracted tRNA(Ala)-derived monomers, two types of dimers, and three subfamilies of chimeric fusion products of a tRNA(Ala) domain and an approximately 180-nt sequence of thus far unidentified origin. Comparisons of secondary structures of the DAS-SINEs' tRNA domains suggest selective pressure to maintain a tRNA-like D-arm structure in the respective founder RNAs, as shown by compensatory mutations. By analysis of subfamily-specific genetic variability, comparison of the proportion of direct repeats, and analysis of self-integrations as well as key events of dimerization and deletions or insertions, we were able to delineate the evolutionary history of the DAS-SINE subfamilies.
Scattering of topological solitons on barriers and holes of deformed Sine-Gordon models
International Nuclear Information System (INIS)
Al-Alawi, Jassem H; Zakrzewski, Wojtek J
2008-01-01
We study various scattering properties of topological solitons in two classes of models, which are the generalizations of the Sine-Gordon model and which have recently been proposed by Bazeia et al. These two classes of models depend on a positive real nonzero parameter n but in this paper we consider the models only for its integer values as when n = 2 (for the first class) and n = 1 (for the second class), the model reduces to the Sine-Gordon one. We take the soliton solutions of these models (generalizations of the 'kink' solution of the Sine-Gordon model) and consider their scattering on potential holes and barriers. We present our results for n = 1, ..., 6. We find that, like in the Sine-Gordon models, the scattering on the barrier is very elastic while the scattering on the hole is inelastic and can, at times, lead to a reflection. We discuss the dependence of our results on n and find that the critical velocity for the transmission through the hole is lowest for n = 3
The sine-Gordon model revisited I
Energy Technology Data Exchange (ETDEWEB)
Niccoli, G.; Teschner, J.
2009-10-15
We study integrable lattice regularizations of the Sine-Gordon model with the help of the Separation of Variables method of Sklyanin and the Baxter Q-operators. This allows us to characterize the spectrum (eigenvalues and eigenstates) completely in terms of polynomial solutions of the Baxter equation with certain properties. This result is analogous to the completeness of the Bethe ansatz. (orig.)
Exact, multiple soliton solutions of the double sine Gordon equation
International Nuclear Information System (INIS)
Burt, P.B.
1978-01-01
Exact, particular solutions of the double sine Gordon equation in n dimensional space are constructed. Under certain restrictions these solutions are N solitons, where N <= 2q - 1 and q is the dimensionality of space-time. The method of solution, known as the base equation technique, relates solutions of nonlinear partial differential equations to solutions of linear partial differential equations. This method is reviewed and its applicability to the double sine Gordon equation shown explicitly. The N soliton solutions have the remarkable property that they collapse to a single soliton when the wave vectors are parallel. (author)
Experimental Investigation of Trapped Sine-Gordon Solitons
DEFF Research Database (Denmark)
Davidson, A.; Dueholm, B.; Kryger, B.
1985-01-01
We have observed for the first time a single sine-Gordon soliton trapped in an annular Josephson junction. This system offers a unique possibility to study undisturbed soliton motion. In the context of perturbation theory, the soliton may be viewed as a relativistic particle moving under a uniform...
Short interspersed CAN SINE elements as prognostic markers in canine mammary neoplasia.
Gelaleti, Gabriela B; Granzotto, Adriana; Leonel, Camila; Jardim, Bruna V; Moschetta, Marina G; Carareto, Claudia M A; Zuccari, Debora Ap P C
2014-01-01
The genome of mammals is characterized by a large number of non-LTR retrotransposons, and among them, the CAN SINEs are characteristics of the canine species. Small amounts of DNA freely circulate in normal blood serum and high amounts are found in human patients with cancer, characterizing it as a candidate tumor-biomarker. The aim of this study was to estimate, through its absolute expression, the number of copies of CAN SINE sequences present in free circulating DNA of female dogs with mammary cancer, in order to correlate with the clinical and pathological characteristics and the follow-up period. The copy number of CAN SINE sequences was estimated by qPCR in 28 female dogs with mammary neoplasia. The univariate analysis showed an increased number of copies in female dogs with mammary tumor in female dogs >10 years old (p=0.02) and tumor time >18 months (pSINE fragments can be good markers for the detection of tumor DNA in blood and may characterize it as a marker of poor prognosis, being related to female dogs with shorter survival times. This estimate can be used as a prognostic marker in non-invasive breast cancer research and is useful in predicting tumor progression and patient monitoring.
Scenario based approach for multiple source Tsunami Hazard assessment for Sines, Portugal
M. Wronna; R. Omira; M. A. Baptista
2015-01-01
In this paper, we present a scenario-based approach for tsunami hazard assessment for the city and harbour of Sines – Portugal, one of the test-sites of project ASTARTE. Sines holds one of the most important deep-water ports which contains oil-bearing, petrochemical, liquid bulk, coal and container terminals. The port and its industrial infrastructures are facing the ocean southwest towards the main seismogenic sources. This work considers two different seis...
Exact expectation values of local fields in the quantum sine-Gordon model
International Nuclear Information System (INIS)
Lukyanov, S.; Rossijskaya Akademiya Nauk, Chernogolovka; Zamolodchikov, A.; Rossijskaya Akademiya Nauk, Chernogolovka
1997-01-01
We propose an explicit expression for vacuum expectation values left angle e iaφ right angle of the exponential fields in the sine-Gordon model. Our expression agrees both with semi-classical results in the sine-Gordon theory and with perturbative calculations in the massive Thirring model. We use this expression to make new predictions about the large-distance asymptotic form of the two-point correlation function in the XXZ spin chain. (orig.)
Critical values of the Yang-Yang functional in the quantum sine-Gordon model
International Nuclear Information System (INIS)
Lukyanov, Sergei L.
2011-01-01
The critical values of the Yang-Yang functional corresponding to the vacuum states of the sine-Gordon QFT in the finite-volume are studied. Two major applications are discussed: (i) generalization of Fendley-Saleur-Zamolodchikov relations to arbitrary values of the sine-Gordon coupling constant, and (ii) connection problem for a certain two-parameter family of solutions of the Painleve III equation.
Bunched soliton states in weakly coupled sine-Gordon systems
International Nuclear Information System (INIS)
Gronbech-Jensen, N.; Samuelsen, M.R.; Lomdahl, P.S.; Blackburn, J.A.
1990-01-01
The interaction between solitons of two weakly coupled sine-Gordon systems is considered. In particular, the stability of bunched states is investigated, and perturbation results are compared with numerical results
Semiclassical approach to the quantization of the periodic solutions of the sine-Gordon equation
International Nuclear Information System (INIS)
Ghika, G.; Visinescu, M.
1978-01-01
The periodic solutions of the sine-Gordon equation are proved to be singular. For the semiclassical quantization of the periodic solutions we calculate the fluctuations around them and we use the path integrals in the Gaussian approximation in order to obtain the bound states of the sine-Gordon field equation. (author)
Boson-soliton scattering in the sine-Gordon model
International Nuclear Information System (INIS)
Lowe, M.
1979-01-01
In this paper the author calculates the boson-soliton scattering amplitudes for various processes in the sine-Gordon model to obtain results in agreement with the prediction of no-particle production and equality of ingoing and outgoing sets of momenta. (Auth.)
Bumaschny, Viviana F; Low, Malcolm J; Rubinstein, Marcelo
2007-01-01
The proopiomelanocortin gene (POMC) is expressed in the pituitary gland and the ventral hypothalamus of all jawed vertebrates, producing several bioactive peptides that function as peripheral hormones or central neuropeptides, respectively. We have recently determined that mouse and human POMC expression in the hypothalamus is conferred by the action of two 5′ distal and unrelated enhancers, nPE1 and nPE2. To investigate the evolutionary origin of the neuronal enhancer nPE2, we searched available vertebrate genome databases and determined that nPE2 is a highly conserved element in placentals, marsupials, and monotremes, whereas it is absent in nonmammalian vertebrates. Following an in silico paleogenomic strategy based on genome-wide searches for paralog sequences, we discovered that opossum and wallaby nPE2 sequences are highly similar to members of the superfamily of CORE-short interspersed nucleotide element (SINE) retroposons, in particular to MAR1 retroposons that are widely present in marsupial genomes. Thus, the neuronal enhancer nPE2 originated from the exaptation of a CORE-SINE retroposon in the lineage leading to mammals and remained under purifying selection in all mammalian orders for the last 170 million years. Expression studies performed in transgenic mice showed that two nonadjacent nPE2 subregions are essential to drive reporter gene expression into POMC hypothalamic neurons, providing the first functional example of an exapted enhancer derived from an ancient CORE-SINE retroposon. In addition, we found that this CORE-SINE family of retroposons is likely to still be active in American and Australian marsupial genomes and that several highly conserved exonic, intronic and intergenic sequences in the human genome originated from the exaptation of CORE-SINE retroposons. Together, our results provide clear evidence of the functional novelties that transposed elements contributed to their host genomes throughout evolution. PMID:17922573
Directory of Open Access Journals (Sweden)
Andrea M Santangelo
2007-10-01
Full Text Available The proopiomelanocortin gene (POMC is expressed in the pituitary gland and the ventral hypothalamus of all jawed vertebrates, producing several bioactive peptides that function as peripheral hormones or central neuropeptides, respectively. We have recently determined that mouse and human POMC expression in the hypothalamus is conferred by the action of two 5' distal and unrelated enhancers, nPE1 and nPE2. To investigate the evolutionary origin of the neuronal enhancer nPE2, we searched available vertebrate genome databases and determined that nPE2 is a highly conserved element in placentals, marsupials, and monotremes, whereas it is absent in nonmammalian vertebrates. Following an in silico paleogenomic strategy based on genome-wide searches for paralog sequences, we discovered that opossum and wallaby nPE2 sequences are highly similar to members of the superfamily of CORE-short interspersed nucleotide element (SINE retroposons, in particular to MAR1 retroposons that are widely present in marsupial genomes. Thus, the neuronal enhancer nPE2 originated from the exaptation of a CORE-SINE retroposon in the lineage leading to mammals and remained under purifying selection in all mammalian orders for the last 170 million years. Expression studies performed in transgenic mice showed that two nonadjacent nPE2 subregions are essential to drive reporter gene expression into POMC hypothalamic neurons, providing the first functional example of an exapted enhancer derived from an ancient CORE-SINE retroposon. In addition, we found that this CORE-SINE family of retroposons is likely to still be active in American and Australian marsupial genomes and that several highly conserved exonic, intronic and intergenic sequences in the human genome originated from the exaptation of CORE-SINE retroposons. Together, our results provide clear evidence of the functional novelties that transposed elements contributed to their host genomes throughout evolution.
Grechko, Vernata V; Kosushkin, Sergei A; Borodulina, Olga R; Butaeva, Fatima G; Darevsky, Ilya S
2011-05-15
Short interspersed elements (SINEs) are important nuclear molecular markers of the evolution of many eukaryotes. However, the SINEs of squamate reptile genomes have been little studied. We first identified two families of SINEs, termed Squam1 and Squam2, in the DNA of meadow lizard Darevskia praticola (Lacertidae) by performing DNA hybridization and PCR. Later, the same families of retrotransposons were found using the same methods in members of another 25 lizard families (from Iguania, Scincomorpha, Gekkota, Varanoidea, and Diploglossa infraorders) and two snake families, but their abundances in these taxa varied greatly. Both SINEs were Squamata-specific and were absent from mammals, birds, crocodiles, turtles, amphibians, and fish. Squam1 possessed some characteristics common to tRNA-related SINEs from fish and mammals, while Squam2 belonged to the tRNA(Ala) group of SINEs and had a more unusual and divergent structure. Squam2-related sequences were found in several unannotated GenBank sequences of squamate reptiles. Squam1 abundance in the Polychrotidae, Agamidae, Leiolepididae, Chamaeleonidae, Scincidae, Lacertidae, Gekkonidae, Varanidae, Helodermatidae, and two snake families were 10(2) -10(4) times higher than those in other taxa (Corytophanidae, Iguanidae, Anguidae, Cordylidae, Gerrhosauridae, Pygopodidae, and Eublepharidae). A less dramatic degree of copy number variation was observed for Squam2 in different taxa. Several Squam1 copies from Lacertidae, Chamaeleonidae, Gekkonidae, Varanidae, and Colubridae were sequenced and found to have evident orthologous features, as well as taxa-specific autapomorphies. Squam1 from Lacertidae and Chamaeleonidae could be divided into several subgroups based on sequence differences. Possible applications of these SINEs as Squamata phylogeny markers are discussed. Copyright © 2010 Wiley-Liss, Inc., A Wiley Company.
Study on W-band sheet-beam traveling-wave tube based on flat-roofed sine waveguide
Fang, Shuanzhu; Xu, Jin; Jiang, Xuebing; Lei, Xia; Wu, Gangxiong; Li, Qian; Ding, Chong; Yu, Xiang; Wang, Wenxiang; Gong, Yubin; Wei, Yanyu
2018-05-01
A W-band sheet electron beam (SEB) traveling-wave tube (TWT) based on flat-roofed sine waveguide slow-wave structure (FRSWG-SWS) is proposed. The sine wave of the metal grating is replaced by a flat-roofed sine wave around the electron beam tunnel. The slow-wave characteristics including the dispersion properties and interaction impedance have been investigated by using the eigenmode solver in the 3-D electromagnetic simulation software Ansoft HFSS. Through calculations, the FRSWG SWS possesses the larger average interaction impedance than the conventional sine waveguide (SWG) SWS in the frequency range of 86-110 GHz. The beam-wave interaction was studied and particle-in-cell simulation results show that the SEB TWT can produce output power over 120 W within the bandwidth ranging from 90 to 100 GHz, and the maximum output power is 226 W at typical frequency 94 GHz, corresponding electron efficiency of 5.89%.
Sine-Gordon equation as a model of a nonlinear scalar field in the Duffin-Kemmer formalism
International Nuclear Information System (INIS)
Getmanov, B.S.
1980-01-01
The nonlinear self-interaction of a scalar field is studied in the Minkowski space-time of an arbitrary dimension. It is shown that the sine-Gordon equation can be considered as a model of the nonlinear scalar field in the Duffin-Kemmer formalism with a specific kind of nonlinearity. The ''V-A'' type interaction is found to be equivalent to the ''complex sine-Gordon'' model. Such a new formation of the sine-Gordon equation might be useful for search for its integrable generalizations
International Nuclear Information System (INIS)
Garbaczewski, P.
1982-01-01
Previously we have found that the semiclassical sine--Gordon/Thirring spectrum can be received in the absence of quantum solitons via the spin 1/2 approximation of the quantized sine--Gordon system on a lattice. Later on, we have recovered the Hilbert space of quantum soliton states for the sine--Gordon system. In the present paper we present a derivation of the Bethe Ansatz eigenstates for the generalized ice model in this soliton Hilbert space. We demonstrate that via ''Wick rotation'' of a fundamental parameter of the ice model one arrives at the Bethe Ansatz eigenstates of the quantum sine--Gordon system. The latter is a ''local transition matrix'' ancestor of the coventional sine--Gordon/Thirring model, as derived by Faddeev et al. within the quantum inverse-scattering method. Our result is essentially based on the N< infinity,Δ = 1,m<<1 regime. Consequently, the spectrum received, though resembling the semiclassical one, does not coincide with it at all
DEFF Research Database (Denmark)
Davidson, A.; Pedersen, Niels Falsig; Dueholm, B.
1985-01-01
We show some experimental results which suggest that total damping, including surface loss, plays a fundamental role in limiting the stability of high-velocity sine-Gordon solitons in real Josephson tunnel junctions.......We show some experimental results which suggest that total damping, including surface loss, plays a fundamental role in limiting the stability of high-velocity sine-Gordon solitons in real Josephson tunnel junctions....
Directory of Open Access Journals (Sweden)
Gupta Abhishek K
2011-05-01
Full Text Available Abstract Background Entamoeba histolytica and Entamoeba dispar are closely related protistan parasites but while E. histolytica can be invasive, E. dispar is completely non pathogenic. Transposable elements constitute a significant portion of the genome in these species; there being three families of LINEs and SINEs. These elements can profoundly influence the expression of neighboring genes. Thus their genomic location can have important phenotypic consequences. A genome-wide comparison of the location of these elements in the E. histolytica and E. dispar genomes has not been carried out. It is also not known whether the retrotransposition machinery works similarly in both species. The present study was undertaken to address these issues. Results Here we extracted all genomic occurrences of full-length copies of EhSINE1 in the E. histolytica genome and matched them with the homologous regions in E. dispar, and vice versa, wherever it was possible to establish synteny. We found that only about 20% of syntenic sites were occupied by SINE1 in both species. We checked whether the different genomic location in the two species was due to differences in the activity of the LINE-encoded endonuclease which is required for nicking the target site. We found that the endonucleases of both species were essentially very similar, both in their kinetic properties and in their substrate sequence specificity. Hence the differential distribution of SINEs in these species is not likely to be influenced by the endonuclease. Further we found that the physical properties of the DNA sequences adjoining the insertion sites were similar in both species. Conclusions Our data shows that the basic retrotransposition machinery is conserved in these sibling species. SINEs may indeed have occupied all of the insertion sites in the genome of the common ancestor of E. histolytica and E. dispar but these may have been subsequently lost from some locations. Alternatively, SINE
Fatigue Damage Spectrum calculation in a Mission Synthesis procedure for Sine-on-Random excitations
International Nuclear Information System (INIS)
Angeli, Andrea; Troncossi, Marco; Cornelis, Bram
2016-01-01
In many real-life environments, certain mechanical and electronic components may be subjected to Sine-on-Random vibrations, i.e. excitations composed of random vibrations superimposed on deterministic (sinusoidal) contributions, in particular sine tones due to some rotating parts of the system (e.g. helicopters, engine-mounted components,...). These components must be designed to withstand the fatigue damage induced by the “composed” vibration environment, and qualification tests are advisable for the most critical ones. In the case of an accelerated qualification test, a proper test tailoring which starts from the real environment (measured vibration signals) and which preserves not only the accumulated fatigue damage but also the “nature” of the excitation (i.e. sinusoidal components plus random process) is important to obtain reliable results. In this paper, the classic time domain approach is taken as a reference for the comparison of different methods for the Fatigue Damage Spectrum (FDS) calculation in case of Sine-on-Random vibration environments. Then, a methodology to compute a Sine-on-Random specification based on a mission FDS is proposed. (paper)
Soliton annihilation in the perturbed sine-Gordon system
DEFF Research Database (Denmark)
Pedersen, Niels Falsig; Samuelsen, Mogens Rugholm; Welner, D.
1984-01-01
Fluxon-antifluxon annihilation in the perturbed sine-Gordon equation with loss and driving terms is investigated. For the infinite line we find a simple analytic expression for the threshold driving term corresponding to annihilation. With the application of the results to a Josephson junction...
The complex sine-Gordon model on a half line
International Nuclear Information System (INIS)
Tzamtzis, Georgios
2003-01-01
In this thesis, we study the complex sine-Gordon model on a half line. The model in the bulk is an integrable (1+1) dimensional field theory which is U(1) gauge invariant and comprises a generalisation of the sine-Gordon theory. It accepts soliton and breather solutions. By introducing suitably selected boundary conditions we may consider the model on a half line. Through such conditions the model can be shown to remain integrable and various aspects of the boundary theory can be examined. The first chapter serves as a brief introduction to some basic concepts of integrability and soliton solutions. As an example of an integrable system with soliton solutions, the sine-Gordon model is presented both in the bulk and on a half line. These results will serve as a useful guide for the model at hand. The introduction finishes with a brief overview of the two methods that will be used on the fourth chapter in order to obtain the quantum spectrum of the boundary complex sine-Gordon model. In the second chapter the model is properly introduced along with a brief literature review. Different realisations of the model and their connexions are discussed. The vacuum of the theory is investigated. Soliton solutions are given and a discussion on the existence of breathers follows. Finally the collapse of breather solutions to single solitons is demonstrated and the chapter concludes with a different approach to the breather problem. In the third chapter, we construct the lowest conserved currents and through them we find suitable boundary conditions that allow for their conservation in the presence of a boundary. The boundary term is added to the Lagrangian and the vacuum is reexamined in the half line case. The reflection process of solitons from the boundary is studied and the time-delay is calculated. Finally we address the existence of boundary-bound states. In the fourth chapter we study the quantum complex sine-Gordon model. We begin with a brief overview of the theory in
Sine-Gordon breather form factors and quantum field equations
International Nuclear Information System (INIS)
Babujian, H; Karowski, M
2002-01-01
Using the results of previous investigations on sine-Gordon form factors, exact expressions of all breather matrix elements are obtained for several operators: all powers of the fundamental Bose field, general exponentials of it, the energy-momentum tensor and all higher currents. Formulae for the asymptotic behaviour of bosonic form factors are presented which are motivated by Weinberg's power counting theorem in perturbation theory. It is found that the quantum sine-Gordon field equation holds, and an exact relation between the 'bare' mass and the renormalized mass is obtained. Also a quantum version of a classical relation for the trace of the energy-momentum is proved. The eigenvalue problem for all higher conserved charges is solved. All results are compared with perturbative Feynman graph expansions and full agreement is found
The RNA polymerase dictates ORF1 requirement and timing of LINE and SINE retrotransposition.
Directory of Open Access Journals (Sweden)
Emily N Kroutter
2009-04-01
Full Text Available Mobile elements comprise close to one half of the mass of the human genome. Only LINE-1 (L1, an autonomous non-Long Terminal Repeat (LTR retrotransposon, and its non-autonomous partners-such as the retropseudogenes, SVA, and the SINE, Alu-are currently active human retroelements. Experimental evidence shows that Alu retrotransposition depends on L1 ORF2 protein, which has led to the presumption that LINEs and SINEs share the same basic insertional mechanism. Our data demonstrate clear differences in the time required to generate insertions between marked Alu and L1 elements. In our tissue culture system, the process of L1 insertion requires close to 48 hours. In contrast to the RNA pol II-driven L1, we find that pol III transcribed elements (Alu, the rodent SINE B2, and the 7SL, U6 and hY sequences can generate inserts within 24 hours or less. Our analyses demonstrate that the observed retrotransposition timing does not dictate insertion rate and is independent of the type of reporter cassette utilized. The additional time requirement by L1 cannot be directly attributed to differences in transcription, transcript length, splicing processes, ORF2 protein production, or the ability of functional ORF2p to reach the nucleus. However, the insertion rate of a marked Alu transcript drastically drops when driven by an RNA pol II promoter (CMV and the retrotransposition timing parallels that of L1. Furthermore, the "pol II Alu transcript" behaves like the processed pseudogenes in our retrotransposition assay, requiring supplementation with L1 ORF1p in addition to ORF2p. We postulate that the observed differences in retrotransposition kinetics of these elements are dictated by the type of RNA polymerase generating the transcript. We present a model that highlights the critical differences of LINE and SINE transcripts that likely define their retrotransposition timing.
NLIE of Dirichlet sine-Gordon model for boundary bound states
International Nuclear Information System (INIS)
Ahn, Changrim; Bajnok, Zoltan; Palla, Laszlo; Ravanini, Francesco
2008-01-01
We investigate boundary bound states of sine-Gordon model on the finite-size strip with Dirichlet boundary conditions. For the purpose we derive the nonlinear integral equation (NLIE) for the boundary excited states from the Bethe ansatz equation of the inhomogeneous XXZ spin 1/2 chain with boundary imaginary roots discovered by Saleur and Skorik. Taking a large volume (IR) limit we calculate boundary energies, boundary reflection factors and boundary Luescher corrections and compare with the excited boundary states of the Dirichlet sine-Gordon model first considered by Dorey and Mattsson. We also consider the short distance limit and relate the IR scattering data with that of the UV conformal field theory
Dermatomyositis Sine Myositis with Membranoproliferative Glomerulonephritis
Directory of Open Access Journals (Sweden)
Mohammad Bagher Owlia
2012-01-01
Full Text Available Dermatomyositis (DM is an autoimmune disease that is characterized by involvement of proximal musculature and skin. We report a 52-year-old woman with a 6-year history of dermatomyositis sine myositis, who developed lower extremity edema and proteinuria. Pathological examination of renal biopsy showed membranoproliferative glomerulonephritis. She received steroid, cyclophosphamide, and mycophenolate mofetil. Over the 9 to 10 months after the beginning of treatment, the proteinuria was improved.
Ground vibration test results of a JetStar airplane using impulsive sine excitation
Kehoe, Michael W.; Voracek, David F.
1989-01-01
Structural excitation is important for both ground vibration and flight flutter testing. The structural responses caused by this excitation are analyzed to determine frequency, damping, and mode shape information. Many excitation waveforms have been used throughout the years. The use of impulsive sine (sin omega t)/omega t as an excitation waveform for ground vibration testing and the advantages of using this waveform for flight flutter testing are discussed. The ground vibration test results of a modified JetStar airplane using impulsive sine as an excitation waveform are compared with the test results of the same airplane using multiple-input random excitation. The results indicated that the structure was sufficiently excited using the impulsive sine waveform. Comparisons of input force spectrums, mode shape plots, and frequency and damping values for the two methods of excitation are presented.
Arbitrarily large numbers of kink internal modes in inhomogeneous sine-Gordon equations
Energy Technology Data Exchange (ETDEWEB)
González, J.A., E-mail: jalbertgonz@yahoo.es [Department of Physics, Florida International University, Miami, FL 33199 (United States); Department of Natural Sciences, Miami Dade College, 627 SW 27th Ave., Miami, FL 33135 (United States); Bellorín, A., E-mail: alberto.bellorin@ucv.ve [Escuela de Física, Facultad de Ciencias, Universidad Central de Venezuela, Apartado Postal 47586, Caracas 1041-A (Venezuela, Bolivarian Republic of); García-Ñustes, M.A., E-mail: monica.garcia@pucv.cl [Instituto de Física, Pontificia Universidad Católica de Valparaíso, Casilla 4059 (Chile); Guerrero, L.E., E-mail: lguerre@usb.ve [Departamento de Física, Universidad Simón Bolívar, Apartado Postal 89000, Caracas 1080-A (Venezuela, Bolivarian Republic of); Jiménez, S., E-mail: s.jimenez@upm.es [Departamento de Matemática Aplicada a las TT.II., E.T.S.I. Telecomunicación, Universidad Politécnica de Madrid, 28040-Madrid (Spain); Vázquez, L., E-mail: lvazquez@fdi.ucm.es [Departamento de Matemática Aplicada, Facultad de Informática, Universidad Complutense de Madrid, 28040-Madrid (Spain)
2017-06-28
We prove analytically the existence of an infinite number of internal (shape) modes of sine-Gordon solitons in the presence of some inhomogeneous long-range forces, provided some conditions are satisfied. - Highlights: • We have found exact kink solutions to the perturbed sine-Gordon equation. • We have been able to study analytically the kink stability problem. • A kink equilibrated by an exponentially-localized perturbation has a finite number of oscillation modes. • A sufficiently broad equilibrating perturbation supports an infinite number of soliton internal modes.
International Nuclear Information System (INIS)
Kovalyov, Mikhail
2010-01-01
In this article the sets of solutions of the sine-Gordon equation and its linearization the Klein-Gordon equation are discussed and compared. It is shown that the set of solutions of the sine-Gordon equation possesses a richer structure which partly disappears during linearization. Just like the solutions of the Klein-Gordon equation satisfy the linear superposition principle, the solutions of the sine-Gordon equation satisfy a nonlinear superposition principle.
Solutions of the finite type of Sine-Gordon equation
International Nuclear Information System (INIS)
Zhao Guosong
1998-01-01
We use the technique of differential geometry to prove that the solutions of finite type of the sine-Gordon equation φ xx - φ yy = sin φ cosφ can be obtained from a system of ordinary differential equations
Seibt, Kathrin M; Wenke, Torsten; Muders, Katja; Truberg, Bernd; Schmidt, Thomas
2016-05-01
Short interspersed nuclear elements (SINEs) are highly abundant non-autonomous retrotransposons that are widespread in plants. They are short in size, non-coding, show high sequence diversity, and are therefore mostly not or not correctly annotated in plant genome sequences. Hence, comparative studies on genomic SINE populations are rare. To explore the structural organization and impact of SINEs, we comparatively investigated the genome sequences of the Solanaceae species potato (Solanum tuberosum), tomato (Solanum lycopersicum), wild tomato (Solanum pennellii), and two pepper cultivars (Capsicum annuum). Based on 8.5 Gbp sequence data, we annotated 82 983 SINE copies belonging to 10 families and subfamilies on a base pair level. Solanaceae SINEs are dispersed over all chromosomes with enrichments in distal regions. Depending on the genome assemblies and gene predictions, 30% of all SINE copies are associated with genes, particularly frequent in introns and untranslated regions (UTRs). The close association with genes is family specific. More than 10% of all genes annotated in the Solanaceae species investigated contain at least one SINE insertion, and we found genes harbouring up to 16 SINE copies. We demonstrate the involvement of SINEs in gene and genome evolution including the donation of splice sites, start and stop codons and exons to genes, enlargement of introns and UTRs, generation of tandem-like duplications and transduction of adjacent sequence regions. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.
Rotationally symmetric breather-like solutions to the sine-Gordon equation
International Nuclear Information System (INIS)
Olsen, O.H.; Samuelsen, M.R.
1980-01-01
Breather-like solutions to the spherically symmetric sine-Gordon equation are examined numerically. Depending on the initial conditions they either exhibit a return effect or expand towards infinity. (orig.)
Directory of Open Access Journals (Sweden)
M.L.B. Simas
2005-03-01
Full Text Available An assumption commonly made in the study of visual perception is that the lower the contrast threshold for a given stimulus, the more sensitive and selective will be the mechanism that processes it. On the basis of this consideration, we investigated contrast thresholds for two classes of stimuli: sine-wave gratings and radial frequency stimuli (i.e., j0 targets or stimuli modulated by spherical Bessel functions. Employing a suprathreshold summation method, we measured the selectivity of spatial and radial frequency filters using either sine-wave gratings or j0 target contrast profiles at either 1 or 4 cycles per degree of visual angle (cpd, as the test frequencies. Thus, in a forced-choice trial, observers chose between a background spatial (or radial frequency alone and the given background stimulus plus the test frequency (1 or 4 cpd sine-wave grating or radial frequency. Contrary to our expectations, the results showed elevated thresholds (i.e., inhibition for sine-wave gratings and decreased thresholds (i.e., summation for radial frequencies when background and test frequencies were identical. This was true for both 1- and 4-cpd test frequencies. This finding suggests that sine-wave gratings and radial frequency stimuli are processed by different quasi-linear systems, one working at low luminance and contrast level (sine-wave gratings and the other at high luminance and contrast levels (radial frequency stimuli. We think that this interpretation is consistent with distinct foveal only and foveal-parafoveal mechanisms involving striate and/or other higher visual areas (i.e., V2 and V4.
Quantum conserved charges in N=1 and N=2 supersymmetric sine-Gordon theories
International Nuclear Information System (INIS)
Kobayashi, Ken-ichiro; Uematsu, Tsuneo; Yu Yangzheng
1993-01-01
We investigate quantum conservation laws in the N=1 and N=2 supersymmetric sine-Gordon theories. We study conserved charges at the quantum level based on perturbation theory formulated in superspace. It will turn out that there exist extra conserved charges of the vertex operator type at the quantum level and they generate a quantum group symmetry in supersymmetric sine-Gordon systems. We also discuss the implication of the quantum group symmetry on the S-matrix structure. (orig.)
L1-mediated retrotransposition of murine B1 and B2 SINEs recapitulated in cultured cells.
Dewannieux, Marie; Heidmann, Thierry
2005-06-03
SINEs are short interspersed nucleotide elements with transpositional activity, present at a high copy number (up to a million) in mammalian genomes. They are 80-400 bp long, non-coding sequences which derive either from the 7SL RNA (e.g. human Alus, murine B1s) or tRNA (e.g. murine B2s) polymerase III-driven genes. We have previously demonstrated that Alus very efficiently divert the enzymatic machinery of the autonomous L1 LINE (long interspersed nucleotide element) retrotransposons to transpose at a high rate. Here we show, using an ex vivo assay for transposition, that both B1 and B2 SINEs can be mobilized by murine LINEs, with the hallmarks of a bona fide retrotransposition process, including target site duplications of varying lengths and integrations into A-rich sequences. Despite different phylogenetic origins, transposition of the tRNA-derived B2 sequences is as efficient as that of the human Alus, whereas that of B1s is 20-100-fold lower despite a similar high copy number of these elements in the mouse genome. We provide evidence, via an appropriate nucleotide substitution within the B1 sequence in a domain essential for its intracellular targeting, that the current B1 SINEs are not optimal for transposition, a feature most probably selected for the host sake in the course of evolution.
Perturbation analysis of a parametrically changed sine-Gordon equation
DEFF Research Database (Denmark)
Sakai, S.; Samuelsen, Mogens Rugholm; Olsen, O. H.
1987-01-01
A long Josephson junction with a spatially varying inductance is a physical manifestation of a modified sine-Gordon equation with parametric perturbation. Soliton propagation in such Josephson junctions is discussed. First, for an adiabatic model where the inductance changes smoothly compared...
Stress induction of Bm1 RNA in silkworm larvae: SINEs, an unusual class of stress genes
Kimura, Richard H.; Choudary, Prabhakara V.; Stone, Koni K.; Schmid, Carl W.
2001-01-01
This study surveys the induction of RNA polymerase III (Pol III)–directed expression of short interspersed element (SINE) transcripts by various stresses in an animal model, silkworm larvae. Sublethal heat shock and exposure to several toxic compounds increase the level of Bm1 RNA, the silkworm SINE transcript, while also transiently increasing expression of a well-characterized stress-induced transcript, Hsp70 messenger RNA (mRNA). In certain cases, the Bm1 RNA response coincides with that of Hsp70 mRNA, but more often Bm1 RNA responds later in recovery. Baculovirus infection and exposure to certain toxic compounds increase Bm1 RNA but not Hsp70 mRNA, showing that SINE induction is not necessarily coupled to transcription of this particular heat shock gene. SINEs behave as an additional class of stress-inducible genes in living animals but are unusual as stress genes because of their high copy number, genomic dispersion, and Pol III–directed transcription. PMID:11599568
Smulevich, A B; Dorozhenok, I Iu; Romanov, D V; L'vov, A N
2012-01-01
Hypochondria sine materia is a disorder with physical complains corresponding to no any somatic diagnosis. Hypochondria sine materia is a more complicated psychopathological condition compared to hypochondria cum materia. Hypochondria sine materia could be diagnosed not only in psychiatry, but mainly in general medicine. It is especially prevalent in dermatology. As a result of analysis of hypochondriac disorders involving cutaneous sphere in patients without dermatological diseases, a binary model of psychodermatological syndromes presenting with hypochondria sine materia in dermatology was developed. The binary structure of the psychodermatological syndromes includes secondary psychiatric symptoms based on primary coenesthesiopathic phenomena. The heterogeneous psychodermatological syndromes (cutaneous organ neurosis, impulsive excoriations syndrome, circumscripta hypochondria, coenesthesiopathic paranoia) could be arranged in a continuum of consecutively worsening conditions from neurotic to psychotic severity register. The syndromes differ in clinical and social prognosis requiring different approach to diagnosis and treatment.
On Darboux transformation of the supersymmetric sine-Gordon equation
International Nuclear Information System (INIS)
Siddiq, M; Hassan, M; Saleem, U
2006-01-01
Darboux transformation is constructed for superfields of the super sine-Gordon equation and the superfields of the associated linear problem. The Darboux transformation is shown to be related to the super Baecklund transformation and is further used to obtain N super soliton solutions
Roughening in random sine-Gordon systems
International Nuclear Information System (INIS)
Schwartz, M.; Nattermann, T.
1991-01-01
We consider the spatial correlations of the optimal solutions of the random sine-Gordon equation as an example of the usefulness of a very simple ansatz relating the Fourier transforms of certain functions of the field Φ to the Fourier transform of the random fields. The dramatic change in the correlations when going from above to below two dimensions is directly attributed to the transfer from dominance of long range fluctuations of the randomness to the dominance of short range fluctuations. (orig.)
The Sine Method: An Alternative Height Measurement Technique
Don C. Bragg; Lee E. Frelich; Robert T. Leverett; Will Blozan; Dale J. Luthringer
2011-01-01
Height is one of the most important dimensions of trees, but few observers are fully aware of the consequences of the misapplication of conventional height measurement techniques. A new approach, the sine method, can improve height measurement by being less sensitive to the requirements of conventional techniques (similar triangles and the tangent method). We studied...
Golden Sine Algorithm: A Novel Math-Inspired Algorithm
Directory of Open Access Journals (Sweden)
TANYILDIZI, E.
2017-05-01
Full Text Available In this study, Golden Sine Algorithm (Gold-SA is presented as a new metaheuristic method for solving optimization problems. Gold-SA has been developed as a new search algorithm based on population. This math-based algorithm is inspired by sine that is a trigonometric function. In the algorithm, random individuals are created as many as the number of search agents with uniform distribution for each dimension. The Gold-SA operator searches to achieve a better solution in each iteration by trying to bring the current situation closer to the target value. The solution space is narrowed by the golden section so that the areas that are supposed to give only good results are scanned instead of the whole solution space scan. In the tests performed, it is seen that Gold-SA has better results than other population based methods. In addition, Gold-SA has fewer algorithm-dependent parameters and operators than other metaheuristic methods, increasing the importance of this method by providing faster convergence of this new method.
Intermittent Switching between Soliton Dynamic States in a Perturbed Sine-Gordon Model
DEFF Research Database (Denmark)
Sørensen, Mads Peter; Arley, N.; Christiansen, Peter Leth
1983-01-01
Chaotic intermittency between soliton dynamic states has been found in a perturbed sine-Gordon system in the absence of an external ac driving term. The system is a model of a long Josephson oscillator with constant loss and bias current in an external magnetic field. The results predict the exis......Chaotic intermittency between soliton dynamic states has been found in a perturbed sine-Gordon system in the absence of an external ac driving term. The system is a model of a long Josephson oscillator with constant loss and bias current in an external magnetic field. The results predict...
Characterization of short interspersed elements (SINEs) in a red alga, Porphyra yezoensis.
Zhang, Wenbo; Lin, Xiaofei; Peddigari, Suresh; Takechi, Katsuaki; Takano, Hiroyoshi; Takio, Susumu
2007-02-01
Short interspersed element (SINE)-like sequences referred to as PySN1 and PySN2 were identified in a red alga, Porphyra yezoensis. Both elements contained an internal promoter with motifs (A box and B box) recognized by RNA polymerase III, and target site duplications at both ends. Genomic Southern blot analysis revealed that both elements were widely and abundantly distributed on the genome. 3' and 5' RACE suggested that PySN1 was expressed as a chimera transcript with flanking SINE-unrelated sequences and possessed the poly-A tail at the same position near the 3' end of PySN1.
Numerical simulation of the self-pumped long Josephson junction using a modified sine-Gordon model
International Nuclear Information System (INIS)
Sobolev, A.S.; Pankratov, A.L.; Mygind, J.
2006-01-01
We have numerically investigated the dynamics of a long Josephson junction (flux-flow oscillator) biased by a DC current in the presence of magnetic field. The study is performed in the frame of the modified sine-Gordon model, which includes the surface losses, RC-load at both FFO ends and the self-pumping effect. In our model the dumping parameter depends both on the spatial coordinate and the amplitude of the AC voltage. In order to find the DC FFO voltage the damping parameter has to be calculated by successive approximations and time integration of the perturbed sine-Gordon equation. The modified model, which accounts for the presence of the superconducting gap, gives better qualitative agreement with experimental results compare to the conventional sine-Gordon model
Homoclinic tubes and chaos in perturbed sine-Gordon equation
International Nuclear Information System (INIS)
Li, Y. Charles
2004-01-01
Sine-Gordon equation under a quasi-periodic perturbation or a chaotic perturbation is studied. Existence of a homoclinic tube is proved. Established are chaos associated with the homoclinic tube, and 'chaos cascade' referring to the embeddings of smaller scale chaos in larger scale chaos
Rotationally symmetric numerical solutions to the sine-Gordon equation
DEFF Research Database (Denmark)
Olsen, O. H.; Samuelsen, Mogens Rugholm
1981-01-01
We examine numerically the properties of solutions to the spherically symmetric sine-Gordon equation given an initial profile which coincides with the one-dimensional breather solution and refer to such solutions as ring waves. Expanding ring waves either exhibit a return effect or expand towards...
International Nuclear Information System (INIS)
Ka-Lin, Su; Yuan-Xi, Xie
2010-01-01
By introducing a more general auxiliary ordinary differential equation (ODE), a modified variable separated ordinary differential equation method is presented for solving the (2 + 1)-dimensional sine-Poisson equation. As a result, many explicit and exact solutions of the (2 + 1)-dimensional sine-Poisson equation are derived in a simple manner by this technique. (general)
Diffusion in the kicked quantum rotator by random corrections to a linear and sine field
International Nuclear Information System (INIS)
Hilke, M.; Flores, J.C.
1992-01-01
We discuss the diffusion in momentum space, of the kicked quantum rotator, by introducing random corrections to a linear and sine external field. For the linear field we obtain a linear diffusion behavior identical to the case with zero average in the external field. But for the sine field, accelerator modes with quadratic diffusion are found for particular values of the kicking period. (orig.)
Is the energy density of the ground state of the sine-Gordon model unbounded from below for β2 > 8π?
International Nuclear Information System (INIS)
Faber, M; Ivanov, A N
2003-01-01
We discuss Coleman's theorem concerning the energy density of the ground state of the sine-Gordon model proved in Coleman S (1975 Phys. Rev. D 11 2088). According to this theorem the energy density of the ground state of the sine-Gordon model should be unbounded from below for coupling constants β 2 > 8π. The consequence of this theorem would be the non-existence of the quantum ground state of the sine-Gordon model for β 2 > 8π. We show that the energy density of the ground state in the sine-Gordon model is bounded from below even for β 2 > 8π. This result is discussed in relation to Coleman's theorem (Coleman S 1973 Commun. Math. Phys. 31 259), particle mass spectra and soliton-soliton scattering in the sine-Gordon model
Traveling Wave Solutions of ZK-BBM Equation Sine-Cosine Method
Directory of Open Access Journals (Sweden)
Sadaf Bibi
2014-03-01
Full Text Available Travelling wave solutions are obtained by using a relatively new technique which is called sine-cosine method for ZK-BBM equations. Solution procedure and obtained results re-confirm the efficiency of the proposed scheme.
International Nuclear Information System (INIS)
Itoyama, H.; Korepin, V.E.; Thacker, H.B.
1992-01-01
In this paper, correlation functions of the Sine-Gordon model (which is equivalent of the Massive-Thirring model) are considered at the free fermion point. The authors derive a determinant formula for local correlation functions of the Sine-Gordon model, starting form Bethe ansatz wave function. Kernel of integral operator is trigonometric version of the one for Impenetrable Bosons
Directory of Open Access Journals (Sweden)
Stefania Dall'Olio
2014-09-01
Full Text Available The myostatin (MSTN gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic. The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81 and in the Thoroughbred (0.51, whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.
Dall'Olio, Stefania; Scotti, Emilio; Fontanesi, Luca; Tassinari, Marco
2014-01-01
The myostatin (MSTN) gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus) MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE) insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs) generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot) and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81) and in the Thoroughbred (0.51), whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.
STIMA DE SINE – ELEMENT IMPORTANT ÎN PROIECTAREA CARIEREI
Directory of Open Access Journals (Sweden)
Carolina PLATON
2015-11-01
Full Text Available Savanţii susţin că doar o persoană cu stimă de sine înaltă are şanse să-şi dea seama de propriul potenţial. În procesul de orientare în carieră stima de sine va ajuta persoana să ia decizii corecte, să se autoevalueze şi să acţioneze în sensul aspiraţiilor sale.SELF-ESTEEM – AN IMPORTANT ELEMENT IN THE CAREER PLANNING PROCESSThe scientists support the idea about the awakening that is happening throughout the world to the fact that a human being cannot realize his potential without a healthy self-esteem. A high self-esteem will help a person to make decisions, self-assessment and to act according to his aspirations in the career planning process.
Thermal sine-Gordon system in the presence of different types of dissipation
DEFF Research Database (Denmark)
Salerno, M.; Samuelsen, Mogens Rugholm; Svensmark, Henrik
1988-01-01
The effects of thermal fluctuations on solitons and phonons of the sine-Gordon system are investigated in the presence of a αφt-βφxxt dissipation. The analysis requires the assumption of a more general autocorrelation function for the noise than the one used in previous works. We verify that this......The effects of thermal fluctuations on solitons and phonons of the sine-Gordon system are investigated in the presence of a αφt-βφxxt dissipation. The analysis requires the assumption of a more general autocorrelation function for the noise than the one used in previous works. We verify...
The development of sine vibration test requirements for Viking lander capsule components
Barrett, S.
1974-01-01
In connection with the Viking project for exploring the planet Mars, two identical spacecraft, each consisting of an orbiter and a lander, will be launched in the third quarter of 1975. Upon arrival at the planet, the Viking lander will separate from the Viking orbiter and descend to a soft landing at a selected site on the Mars surface. It was decided to perform a sine vibration test on the Viking spacecraft, in its launch configuration, to qualify it for the booster-induced transient-dynamic environment. It is shown that component-level testing is a cost- and schedule-effective prerequisite to the system-level, sine-vibration test sequences.
From sine-Gordon to vacuumless systems in flat and curved spacetimes
Energy Technology Data Exchange (ETDEWEB)
Bazeia, D.; Moreira, D.C. [Universidade Federal da Paraiba, Departamento de Fisica, Joao Pessoa, PB (Brazil)
2017-12-15
In this work we start from the Higgs prototype model to introduce a new model, which makes a smooth transition between systems with well-located minima and systems that support no minima at all. We implement this possibility using the deformation procedure, which allows the obtaining a sine-Gordon-like model, controlled by a real parameter that gives rise to a family of models, reproducing the sine-Gordon and the so-called vacuumless models. We also study the thick brane scenarios associated with these models and investigate their stability and renormalization group flow. In particular, it is shown how gravity can change from the 5-dimensional warped geometry with a single extra dimension of infinite extent to the conventional 5-dimensional Minkowski geometry. (orig.)
Stochastically-driven coherence in a sine-Gordon chain
International Nuclear Information System (INIS)
Guerrero, L.E.; Hasmy, A.; Mata, G.J.
1994-01-01
We perform numerical simulations of the dynamical behavior of a sine-Gordon chain in a heat bath. The interaction with the heat bath is simulated by the Langevin formalism. The noise term is uncorrelated in both space and time. We use the Karhunen-Loeve decomposition to study the effective number of degrees of freedom as a function of temperature (i.e., of the noise dispersion). At low temperatures we find a spatially disordered regime, characterized by a high number of degrees of freedom. At a temperature of the order of the soliton rest mass we find a relatively sharp crossover to an ordered regime, characterized by a low number of degrees of freedom. The spatial structure of the modes suggests that the transition is associated to the appearance of thermally activated solitons. We also present an alternative estimate of the effective number of degrees of freedom. (orig.)
A SINE in the genome of the cephalochordate amphioxus is an Alu element
Holland, Linda Z.
2006-01-01
Transposable elements of about 300 bp, termed “short interspersed nucleotide elements or SINEs are common in eukaryotes. However, Alu elements, SINEs containing restriction sites for the AluI enzyme, have been known only from primates. Here I report the first SINE found in the genome of the cephalochordate, amphioxus. It is an Alu element of 375 bp that does not share substantial identity with any genomic sequences in vertebrates. It was identified because it was located in the FoxD regulatory region in a cosmid derived from one individual, but absent from the two FoxD alleles of BACs from a second individual. However, searches of sequences of BACs and genomic traces from this second individual gave an estimate of 50-100 copies in the amphioxus genome. The finding of an Alu element in amphioxus raises the question of whether Alu elements in amphioxus and primates arose by convergent evolution or by inheritance from a common ancestor. Genome-wide analyses of transposable elements in amphioxus and other chordates such as tunicates, agnathans and cartilaginous fishes could well provide the answer. PMID:16733535
Confinement, solitons and the equivalence between the sine-Gordon and massive Thirring models
International Nuclear Information System (INIS)
Blas Achic, H.S.; Ferreira, L.A.
2000-01-01
We consider a two-dimensional integrable and conformally invariant field theory possessing two Dirac spinors and three scalar fields. The interaction couples bilinear terms in the spinors to exponentials of the scalars. Its integrability properties are based on the sl(2) affine Kac-Moody algebra, and it is a simple example of the so-called conformal affine Toda theories coupled to matter fields. We show, using bosonization techniques, that the classical equivalence between a U(1) Noether current and the topological current holds true at the quantum level, and then leads to a bag model like mechanism for the confinement of the spinor fields inside the solitons. By bosonizing the spinors we show that the theory decouples into a sine-Gordon model and free scalars. We construct the two-soliton solutions and show that their interactions lead to the same time delays as those for the sine-Gordon solitons. The model provides a good laboratory to test duality ideas in the context of the equivalence between the sine-Gordon and Thirring theories
Nonlinear dynamics of a parametrically driven sine-Gordon system
DEFF Research Database (Denmark)
Grønbech-Jensen, Niels; Kivshar, Yuri S.; Samuelsen, Mogens Rugholm
1993-01-01
We consider a sine-Gordon system, driven by an ac parametric force in the presence of loss. It is demonstrated that a breather can be maintained in a steady state at half of the external frequency. In the small-amplitude limit the effect is described by an effective nonlinear Schrodinger equation...
Covariant form for the conserved currents of the sine-Gordon and Liouville theories
International Nuclear Information System (INIS)
Freedman, D.Z.; Massachusetts Inst. of Tech., Cambridge; Lerda, A.; Massachusetts Inst. of Tech., Cambridge; Penati, S.
1990-01-01
A conserved covariant fourth rank tensor current J μαβγ is constructed for these models both in flat and constant curvature space. For flat space, ∫ dx + J ++++ and its parity conjugate agree with well known results for the lowest grade sine-Gordon conserved charges. However potentially new charges such as ∫ dx + J +++- and ∫ dx + J +++α ε αβ x β either vanish or fail to be conserved because J μαβγ is not symmetric in μ↔γ. There is one curious exception for sine-Gordon models in anti-de Sitter space. (orig.)
TBA equations for excited states in the sine-Gordon model
International Nuclear Information System (INIS)
Balog, Janos; Hegedus, Arpad
2004-01-01
We propose thermodynamic Bethe ansatz (TBA) integral equations for multi-particle soliton (fermion) states in the sine-Gordon (massive Thirring) model. This is based on T-system and Y-system equations, which follow from the Bethe ansatz solution in the light-cone lattice formulation of the model. Even and odd charge sectors are treated on an equal footing, corresponding to periodic and twisted boundary conditions, respectively. The analytic properties of the Y-system functions are conjectured on the basis of the large volume solution of the system, which we find explicitly. A simple relation between the TBA Y-functions and the counting function variable of the alternative non-linear integral equation (Destri-de Vega equation) description of the model is given. At the special value β 2 = 6π of the sine-Gordon coupling, exact expressions for energy and momentum eigenvalues of one-particle states are found
Exact solutions to some modified sine-Gordon equations
International Nuclear Information System (INIS)
Saermark, K.
1983-01-01
Exact, translational solutions to a number of modified sine-Gordon equations are presented. In deriving the equations and the solutions use is made of results from the theory of ordinary differential equations without moving critical points as given by Ince. It is found that kink-like solutions exist also in cases where the coefficients of the trigonometric terms are space- and time-dependent. (Auth.)
Directory of Open Access Journals (Sweden)
Tu Zhijian
2008-08-01
Full Text Available Abstract Background SINEs (Short INterspersed Elements are homoplasy-free and co-dominant genetic markers which are considered to represent useful tools for population genetic studies, and could help clarifying the speciation processes ongoing within the major malaria vector in Africa, Anopheles gambiae s.s. Here, we report the results of the analysis of the insertion polymorphism of a nearly 200 bp-long SINE (SINE200 within genome areas of high differentiation (i.e. "speciation islands" of M and S A. gambiae molecular forms. Methods A SINE-PCR approach was carried out on thirteen SINE200 insertions in M and S females collected along the whole range of distribution of A. gambiae s.s. in sub-Saharan Africa. Ten specimens each for Anopheles arabiensis, Anopheles melas, Anopheles quadriannulatus A and 15 M/S hybrids from laboratory crosses were also analysed. Results Eight loci were successfully amplified and were found to be specific for A. gambiae s.s.: 5 on 2L chromosome and one on X chromosome resulted monomorphic, while two loci positioned respectively on 2R (i.e. S200 2R12D and X (i.e. S200 X6.1 chromosomes were found to be polymorphic. S200 2R12D was homozygote for the insertion in most S-form samples, while intermediate levels of polymorphism were shown in M-form, resulting in an overall high degree of genetic differentiation between molecular forms (Fst = 0.46 p S200 X6.1 was found to be fixed in all M- and absent in all S-specimens. This led to develop a novel easy-to-use PCR approach to straightforwardly identify A. gambiae molecular forms. This novel approach allows to overcome the constraints associated with markers on the rDNA region commonly used for M and S identification. In fact, it is based on a single copy and irreversible SINE200 insertion and, thus, is not subjected to peculiar evolutionary patterns affecting rDNA markers, e.g. incomplete homogenization of the arrays through concerted evolution and/or mixtures of M and S IGS
Correlations between chaos in a perturbed sine-Gordon equation and a truncated model system
International Nuclear Information System (INIS)
Bishop, A.R.; Flesch, R.; Forests, M.G.; Overman, E.A.
1990-01-01
The purpose of this paper is to present a first step toward providing coordinates and associated dynamics for low-dimensional attractors in nearly integrable partial differential equations (pdes), in particular, where the truncated system reflects salient geometric properties of the pde. This is achieved by correlating: (1) numerical results on the bifurcations to temporal chaos with spatial coherence of the damped, periodically forced sine-Gordon equation with periodic boundary conditions; (2) an interpretation of the spatial and temporal bifurcation structures of this perturbed integrable system with regard to the exact structure of the sine-Gordon phase space; (3) a model dynamical systems problem, which is itself a perturbed integrable Hamiltonian system, derived from the perturbed sine-Gordon equation by a finite mode Fourier truncation in the nonlinear Schroedinger limit; and (4) the bifurcations to chaos in the truncated phase space. In particular, a potential source of chaos in both the pde and the model ordinary differential equation systems is focused on: the existence of homoclinic orbits in the unperturbed integrable phase space and their continuation in the perturbed problem. The evidence presented here supports the thesis that the chaotic attractors of the weakly perturbed periodic sine-Gordon system consists of low-dimensional metastable attacking states together with intermediate states that are O(1) unstable and correspond to homoclinic states in the integrable phase space. It is surmised that the chaotic dynamics on these attractors is due to the perturbation of these homocline integrable configurations
Campbell, Joel F.; Lin, Bing; Nehrir, Amin R.
2014-01-01
NASA Langley Research Center in collaboration with ITT Exelis have been experimenting with Continuous Wave (CW) laser absorption spectrometer (LAS) as a means of performing atmospheric CO2 column measurements from space to support the Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) mission.Because range resolving Intensity Modulated (IM) CW lidar techniques presented here rely on matched filter correlations, autocorrelation properties without side lobes or other artifacts are highly desirable since the autocorrelation function is critical for the measurements of lidar return powers, laser path lengths, and CO2 column amounts. In this paper modulation techniques are investigated that improve autocorrelation properties. The modulation techniques investigated in this paper include sine waves modulated by maximum length (ML) sequences in various hardware configurations. A CW lidar system using sine waves modulated by ML pseudo random noise codes is described, which uses a time shifting approach to separate channels and make multiple, simultaneous online/offline differential absorption measurements. Unlike the pure ML sequence, this technique is useful in hardware that is band pass filtered as the IM sine wave carrier shifts the main power band. Both amplitude and Phase Shift Keying (PSK) modulated IM carriers are investigated that exibit perfect autocorrelation properties down to one cycle per code bit. In addition, a method is presented to bandwidth limit the ML sequence based on a Gaussian filter implemented in terms of Jacobi theta functions that does not seriously degrade the resolution or introduce side lobes as a means of reducing aliasing and IM carrier bandwidth.
International Nuclear Information System (INIS)
Tian Ye; Chen Jing; Zhang Zhifei
2012-01-01
In this paper, the separation transformation approach is extended to the (N + 1)-dimensional dispersive double sine-Gordon equation arising in many physical systems such as the spin dynamics in the B phase of 3 He superfluid. This equation is first reduced to a set of partial differential equations and a nonlinear ordinary differential equation. Then the general solutions of the set of partial differential equations are obtained and the nonlinear ordinary differential equation is solved by F-expansion method. Finally, many new exact solutions of the (N + 1)-dimensional dispersive double sine-Gordon equation are constructed explicitly via the separation transformation. For the case of N > 2, there is an arbitrary function in the exact solutions, which may reveal more novel nonlinear structures in the high-dimensional dispersive double sine-Gordon equation.
Usmanova, N M; Kazakov, V I; Tomilin, N V
2008-01-01
Using computer-based methods we determined the global distribution of short interspersed nuclear elements (SINEs) in the human and mouse X chromosomes. It has been shown that this distributions is similar to the distributions of CpG islands and genes but is different from the distribution of LINE1 elements. Since SINEs (human Alu and mouse B2) may have binding sites for Polycomb protein YY1, we suggest that these repeats can serve as additional signals ("boosters") in Polycomb-dependent silencing of gene rich segments during X inactivation.
Generating Solutions to Discrete sine-Gordon Equation from Modified Baecklund Transformation
International Nuclear Information System (INIS)
Kou Xin; Zhang Dajun; Shi Ying; Zhao Songlin
2011-01-01
We modify the bilinear Baecklund transformation for the discrete sine-Gordon equation and derive variety, of solutions by freely choosing parameters from the modified Baecklund transformation. Dynamics of solutions and continuum limits are also discussed. (general)
A note on the three dimensional sine--Gordon equation
Shariati, Ahmad
1996-01-01
Using a simple ansatz for the solutions of the three dimensional generalization of the sine--Gordon and Toda model introduced by Konopelchenko and Rogers, a class of solutions is found by elementary methods. It is also shown that these equations are not evolution equations in the sense that solution to the initial value problem is not unique.
Phonons and solitons in the "thermal" sine-Gordon system
DEFF Research Database (Denmark)
Salerno, Mario; Jørgensen, E.; Samuelsen, Mogens Rugholm
1984-01-01
Standard methods of stochastic processes are used to study the coupling of the sine-Gordon system with a heat reservoir. As a result we find thermal phonons with an average energy of kB T per mode. The translational mode (zero mode) is found to carry an average energy of 1 / 2kBT. This last value...
The sine-Gordon model in the presence of defects
International Nuclear Information System (INIS)
Avan, Jean; Doikou, Anastasia
2013-01-01
The sine-Gordon model in the presence of dynamical integrable defects is investigated. This is an application of the algebraic formulation introduced for integrable defects in earlier works. The quantities in involution as well as the associated Lax pairs are explicitly extracted. Integrability i also shown using certain sewing constraints, which emerge as suitable continuity conditions.
Explicitly solvable complex Chebyshev approximation problems related to sine polynomials
Freund, Roland
1989-01-01
Explicitly solvable real Chebyshev approximation problems on the unit interval are typically characterized by simple error curves. A similar principle is presented for complex approximation problems with error curves induced by sine polynomials. As an application, some new explicit formulae for complex best approximations are derived.
Acosta, M J; Marchal, J A; Fernández-Espartero, C H; Bullejos, M; Sánchez, A
2008-01-01
The chromosomal distribution of mobile genetic elements is scarcely known in Arvicolinae species, but could be of relevance to understand the origin and complex evolution of the sex chromosome heterochromatin. In this work we cloned two retrotransposon sequences, L1 and SINE-B1, from the genome of Chionomys nivalis and investigated their chromosomal distribution on several arvicoline species. Our results demonstrate first that both retroelements are the most abundant repeated DNA sequences in the genome of these species. L1 elements, in most species, are highly accumulated in the sex chromosomes compared to the autosomes. This favoured L1 insertion could have played an important role in the origin of the enlarged heterochromatic blocks existing in the sex chromosomes of some Microtus species. Also, we propose that L1 accumulation on the X heterochromatin could have been the consequence of different, independent and rapid amplification processes acting in each species. SINE elements, however, were completely lacking from the constitutive heterochromatin, either in autosomes or in the heterochromatic blocks of sex chromosomes. These data could indicate that some SINE elements are incompatible with the formation of heterochromatic complexes and hence are necessarily missing from the constitutive heterochromatin.
Renormalization of the Sine-Gordon model and nonconservation of the kink current
International Nuclear Information System (INIS)
Huang, K.; Polonyi, J.
1991-01-01
The authors of this paper renormalize the (1 + 1)-dimensional sine-Gordon model by placing it on a Euclidean lattice, and study the renormalization group flow. The authors start with a compactified theory with controllable vortex activity. In the continuum limit the theory has a phase in which the kink current is anomalous, with divergence given by the vortex density. The phase structure is quite complicated. Roughly speaking, the system is normal for small coupling T. At the Kosterlitz-Thouless point T = π/2, the current can become anomalous. At the Coleman point T = 8π either the current becomes anomalous or the theory becomes trivial
Cross-over for the sine map and the driven damped pendulum
International Nuclear Information System (INIS)
Alstroem, P.; Levinsen, M.T.; Rasmussen, D.R.
1986-01-01
The sine map f ε (x)=x+μ-(1-ε) sin (2πx)/2π is by iteration known to exhibit a devil's staircase, which becomes complete as ε tends to zero. Here, the basic work of Shenker, concerning the scaling relations at the golden mean, is generalized. For periodic irrationals, the covergence of the step sizes, the minimal distances from cycle elements to zero mod 1, and their average values, are treated. Furthermore, the self-similarity of the step structures provides a set of ''similarity-dimensions'', as well as a set of ''sub-fractals'', emphasizing the close connection to Cantor's discontinuum. Also, the driven damped pendulum is considered. Surprisingly, some differences occur concerning the scaling exponents. Based on analog computations, scaling functions are found, and the differences from the sine map results are discussed. (orig.)
Sines and Cosines. Part 2 of 3
Apostol, Tom M. (Editor)
1993-01-01
The Law of Sines and the Law of Cosines are introduced and demonstrated in this 'Project Mathematics' series video using both film footage and computer animation. This video deals primarily with the mathematical field of Trigonometry and explains how these laws were developed and their applications. One significant use is geographical and geological surveying. This includes both the triangulation method and the spirit leveling method. With these methods, it is shown how the height of the tallest mountain in the world, Mt. Everest, was determined.
Deterministic tsunami hazard assessment of Sines - Portugal
Wronna, Martin
2015-01-01
Tese de mestrado em Ciências Geográficas, apresentada à Universidade de Lisboa, através da Faculdade de Ciências, 2015 Neste trabalho apresenta-se uma abordagem determinística de perigo de tsunamis considerando múltiplas fontes para a cidade costeira de Sines, Portugal. Tsunamis ou maremotos são eventos extremos, energeticamente elevados mas pouco frequentes. Normalmente são geradas por um deslocamento duma grande quantidade de água seja por erupções vulcânicas, colapso de caldeiras, desli...
Use of the p-SINE1-r2 in inferring evolutionary relationships of Thai rice varieties with AA genome
Directory of Open Access Journals (Sweden)
Preecha Prathepha
2006-01-01
Full Text Available In a previous study we described the prevalence and distribution in Thailand of the retroposon p- SINE1-r2, in the intron 10 of the waxy gene in cultivated and wild rice with the AA genome. In this study, additional varieties of rice were collected and sequencing was used to further characterize p-SINE1-r2. It was found that the length of the p-SINE1-r2 nucleotide sequences was about 125 bp, flanked by identical direct repeats of a 14 bp sequence. These sequences were compared and found to be similar to the sequences of p- SINE1-r2 found in Nipponbare, a rice strain discussed in a separate study. However, when compared the 48 DNA sequences identified in this study, much dissimilarity was found within the nucleotide sequences of p- SINE1-r2, in the form of base substitution mutations. Phylogenetic relationships inferred from the nucleotide sequences of these elements in cultivated rice (O. sativa and wild rice (O. nivara. It was found that rice accessions collected from the same geographical distribution have been placed in the same clade. The phylogenetic tree supports the origin and distribution of these rice strains.
Approximate treatment of two soliton solutions of the sine-Gordon equation
International Nuclear Information System (INIS)
Mihaly, L.
1979-05-01
The so called breather solution of the sine-Gordon equation is phenomenologically described by an appropri.ately choosen potential acting between two particles. For some applications the method proves to be equivalent to other classical and quantum calculations. (author)
Gene conversion as a secondary mechanism of short interspersed element (SINE) evolution
Energy Technology Data Exchange (ETDEWEB)
Kass, D.H. [Louisiana State Univ. Medical Center, New Orleans, LA (United States). Dept. of Biochemistry and Molecular Biology; Batzer, M.A. [Lawrence Livermore National Lab., CA (United States); Deininger, P.L. [Louisiana State Univ. Medical Center, New Orleans, LA (United States). Dept. of Biochemistry and Molecular Biology]|[Alton Ochsner Medical Foundation, New Orleans, LA (United States). Lab. of Molecular Genetics
1995-01-01
The Alu repetitive family of short interspersed elements (SINEs) in primates can be subdivided into distinct subfamilies by specific diagnostic nucleotide changes. The older subfamilies are generally very abundant, while the younger subfamilies have fewer copies. Some of the youngest Alu elements are absent in the orthologous loci of nonhuman primates, indicative of recent retroposition events, the primary mode of SINE evolutions. PCR analysis of one young Alu subfamily (Sb2) member found in the low-density lipoprotein receptor gene apparently revealed the presence of this element in the green monkey, orangutan, gorilla, and chimpanzee genomes, as well as the human genome. However, sequence analysis of these genomes revealed a highly mutated, older, primate-specific Alu element was present at this position in the nonhuman primates. Comparison of the flanking DNA sequences upstream of this Alu insertion corresponded to evolution expected for standard primate phylogeny, but comparison of the Alu repeat sequences revealed that the human element departed from this phylogeny. The change in the human sequence apparently occurred by a gene conversion event only within the Alu element itself, converting it from one of the oldest to one of the youngest Alu subfamilies. Although gene conversions of Alu elements are clearly very rare, this finding shows that such events can occur and contribute to specific cases of SINE subfamily evolution.
Pineda, D.; Gonzalez, J.; Callaerts, P.; Ikeo, K.; Gehring, W. J.; Salo, E.
2000-01-01
We have identified a sine oculis gene in the planarian Girardia tigrina (Platyhelminthes; Turbellaria; Tricladida). The planarian sine oculis gene (Gtso) encodes a protein with a sine oculis (Six) domain and a homeodomain that shares significant sequence similarity with so proteins assigned to the Six-2 gene family. Gtso is expressed as a single transcript in both regenerating and fully developed eyes. Whole-mount in situ hybridization studies show exclusive expression in photoreceptor cells. Loss of function of Gtso by RNA interference during planarian regeneration inhibits eye regeneration completely. Gtso is also essential for maintenance of the differentiated state of photoreceptor cells. These results, combined with the previously demonstrated expression of Pax-6 in planarian eyes, suggest that the same basic gene regulatory circuit required for eye development in Drosophila and mouse is used in the prototypic eye spots of platyhelminthes and, therefore, is truly conserved during evolution. PMID:10781056
A difference tracking algorithm based on discrete sine transform
Liu, HaoPeng; Yao, Yong; Lei, HeBing; Wu, HaoKun
2018-04-01
Target tracking is an important field of computer vision. The template matching tracking algorithm based on squared difference matching (SSD) and standard correlation coefficient (NCC) matching is very sensitive to the gray change of image. When the brightness or gray change, the tracking algorithm will be affected by high-frequency information. Tracking accuracy is reduced, resulting in loss of tracking target. In this paper, a differential tracking algorithm based on discrete sine transform is proposed to reduce the influence of image gray or brightness change. The algorithm that combines the discrete sine transform and the difference algorithm maps the target image into a image digital sequence. The Kalman filter predicts the target position. Using the Hamming distance determines the degree of similarity between the target and the template. The window closest to the template is determined the target to be tracked. The target to be tracked updates the template. Based on the above achieve target tracking. The algorithm is tested in this paper. Compared with SSD and NCC template matching algorithms, the algorithm tracks target stably when image gray or brightness change. And the tracking speed can meet the read-time requirement.
Prediction and phylogenetic analysis of mammalian short interspersed elements (SINEs).
Rogozin, I B; Mayorov, V I; Lavrentieva, M V; Milanesi, L; Adkison, L R
2000-09-01
The presence of repetitive elements can create serious problems for sequence analysis, especially in the case of homology searches in nucleotide sequence databases. Repetitive elements should be treated carefully by using special programs and databases. In this paper, various aspects of SINE (short interspersed repetitive element) identification, analysis and evolution are discussed.
Nonlinear Fourier transforms for the sine-Gordon equation in the quarter plane
Huang, Lin; Lenells, Jonatan
2018-03-01
Using the Unified Transform, also known as the Fokas method, the solution of the sine-Gordon equation in the quarter plane can be expressed in terms of the solution of a matrix Riemann-Hilbert problem whose definition involves four spectral functions a , b , A , B. The functions a (k) and b (k) are defined via a nonlinear Fourier transform of the initial data, whereas A (k) and B (k) are defined via a nonlinear Fourier transform of the boundary values. In this paper, we provide an extensive study of these nonlinear Fourier transforms and the associated eigenfunctions under weak regularity and decay assumptions on the initial and boundary values. The results can be used to determine the long-time asymptotics of the sine-Gordon quarter-plane solution via nonlinear steepest descent techniques.
Thermodynamic Bethe ansatz for boundary sine-Gordon model
International Nuclear Information System (INIS)
Lee, Taejun; Rim, Chaiho
2003-01-01
(R-channel) TBA is elaborated to find the effective central charge dependence on the boundary parameters for the massless boundary sine-Gordon model with the coupling constant (8π)/β 2 =1+λ with λ a positive integer. Numerical analysis of the massless boundary TBA demonstrates that at an appropriate boundary parameter range (cusp point) there exists a singularity crossing phenomena and this effect should be included in TBA to have the right behavior of the effective central charge
Regularized integrable version of the one-dimensional quantum sine-Gordon model
International Nuclear Information System (INIS)
Japaridze, G.I.; Nersesyan, A.A.; Wiegmann, P.B.
1983-01-01
The authors derive a regularized exactly solvable version of the one-dimensional quantum sine-Gordon model proceeding from the exact solution of the U(1)-symmetric Thirring model. The ground state and the excitation spectrum are obtained in the region ν 2 < 8π. (Auth.)
International Nuclear Information System (INIS)
Chen Yong; Yan Zhenya
2005-01-01
In this paper (2 + 1)-dimensional Gardner equation is investigated using a sine-Gordon equation expansion method, which was presented via a generalized sine-Gordon reduction equation and a new transformation. As a consequence, it is shown that the method is more powerful to obtain many types of new doubly periodic solutions of (2 + 1)-dimensional Gardner equation. In particular, solitary wave solutions are also given as simple limits of doubly periodic solutions
Breather kink-antikink-pair conversion in the driven sine-Gordon system
DEFF Research Database (Denmark)
Lomdahl, P. S.; Olsen, O. H.; Samuelsen, Mogens Rugholm
1984-01-01
Breather excitations in the sine-Gordon equation influenced by constant driving forces are investigated—large driving forces cause the breather to split into a kk― (2π kink-2π antikink) pair while for small driving forces the breather excitations enter stationary modes. A perturbation method...
Solitons and separable elliptic solutions of the sine-Gordon equation
International Nuclear Information System (INIS)
Bryan, A.C.; Haines, C.R.; Stuart, A.E.G.
1979-01-01
It is pointed out that the two-soliton (antisoliton) solutions of the sine-Gordon equation may be obtained as limiting cases of a separable, two-parameter family of elliptic solutions. The solitons are found on the boundary of the parameter space for the elliptic solutions when the latter are considered over their usual complex domain. (Auth.)
Short interspersed elements (SINEs) are a major source of canine genomic diversity.
Wang, Wei; Kirkness, Ewen F
2005-12-01
SINEs are retrotransposons that have enjoyed remarkable reproductive success during the course of mammalian evolution, and have played a major role in shaping mammalian genomes. Previously, an analysis of survey-sequence data from an individual dog (a poodle) indicated that canine genomes harbor a high frequency of alleles that differ only by the absence or presence of a SINEC_Cf repeat. Comparison of this survey-sequence data with a draft genome sequence of a distinct dog (a boxer) has confirmed this prediction, and revealed the chromosomal coordinates for >10,000 loci that are bimorphic for SINEC_Cf insertions. Analysis of SINE insertion sites from the genomes of nine additional dogs indicates that 3%-5% are absent from either the poodle or boxer genome sequences--suggesting that an additional 10,000 bimorphic loci could be readily identified in the general dog population. We describe a methodology that can be used to identify these loci, and could be adapted to exploit these bimorphic loci for genotyping purposes. Approximately half of all annotated canine genes contain SINEC_Cf repeats, and these elements are occasionally transcribed. When transcribed in the antisense orientation, they provide splice acceptor sites that can result in incorporation of novel exons. The high frequency of bimorphic SINE insertions in the dog population is predicted to provide numerous examples of allele-specific transcription patterns that will be valuable for the study of differential gene expression among multiple dog breeds.
Scenario based approach for multiple source Tsunami Hazard assessment for Sines, Portugal
Wronna, M.; Omira, R.; Baptista, M. A.
2015-08-01
In this paper, we present a scenario-based approach for tsunami hazard assessment for the city and harbour of Sines - Portugal, one of the test-sites of project ASTARTE. Sines holds one of the most important deep-water ports which contains oil-bearing, petrochemical, liquid bulk, coal and container terminals. The port and its industrial infrastructures are facing the ocean southwest towards the main seismogenic sources. This work considers two different seismic zones: the Southwest Iberian Margin and the Gloria Fault. Within these two regions, we selected a total of six scenarios to assess the tsunami impact at the test site. The tsunami simulations are computed using NSWING a Non-linear Shallow Water Model With Nested Grids. In this study, the static effect of tides is analysed for three different tidal stages MLLW (mean lower low water), MSL (mean sea level) and MHHW (mean higher high water). For each scenario, inundation is described by maximum values of wave height, flow depth, drawback, runup and inundation distance. Synthetic waveforms are computed at virtual tide gauges at specific locations outside and inside the harbour. The final results describe the impact at Sines test site considering the single scenarios at mean sea level, the aggregate scenario and the influence of the tide on the aggregate scenario. The results confirm the composite of Horseshoe and Marques Pombal fault as the worst case scenario. It governs the aggregate scenario with about 60 % and inundates an area of 3.5 km2.
Basicity of Systems of Sines with Linear Phase in Weighted Sobolev Spaces
Directory of Open Access Journals (Sweden)
V. F. Salmanov
2013-01-01
Full Text Available The perturbed systems of sines, which appear when solving some partial differential equations by the Fourier method, are considered in this paper. Basis properties of these systems in weighted Sobolev spaces of functions are studied.
Numerical simulation of the self-pumped long Josephson junction using a modified sine-Gordon model
DEFF Research Database (Denmark)
Sobolev, A.; Pankratov, A.; Mygind, Jesper
2006-01-01
We have numerically investigated the dynamics of a long Josephson junction (flux-flow oscillator) biased by a DC current in the presence of magnetic field. The study is performed in the frame of the modified sine-Gordon model, which includes the surface losses, RC-load at both FFO ends and the self-pumping...... effect. In our model the dumping parameter depends both on the spatial coordinate and the amplitude of the AC voltage. In order to find the DC FFO voltage the damping parameter has to be calculated by successive approximations and time integration of the perturbed sine-Gordon equation. The modified model...
International Nuclear Information System (INIS)
Davidson, A.; Pedersen, N.F.; Dueholm, B.
1985-01-01
We show some experimental results which suggest that total damping, including surface loss, plays a fundamental role in limiting the stability of high-velocity Sine-Gordon solitons in real Josephson tunnel junctions
2014-01-01
Background Exportin 1 (XPO1, also known as CRM1), is a chaperone protein responsible for the export of over 200 target proteins out of the nucleus. The expression and activity of XPO1 is upregulated in several human cancers and its expression is also linked to the development of chemotherapy resistance. Recent studies using both human and murine cancer cell lines have demonstrated that XPO1 is a relevant target for therapeutic intervention. The present study sought to characterize the biologic activity of an orally bioavailable selective inhibitor of nuclear export (SINE), KPT-335, against canine melanoma cell lines as a prelude to future clinical trials in dogs with melanoma. Results We evaluated the effects of KPT-335 on 4 canine malignant melanoma cell lines and found that KPT-335 inhibited proliferation, blocked colony formation, and induced apoptosis of treated cells at biologically relevant concentrations of drug. Additionally, KPT-335 downregulated XPO1 protein while inducing a concomitant increase in XPO1 messenger RNA. Lastly, KPT-335 treatment of cell lines upregulated the expression of both protein and mRNA for the tumor suppressor proteins p53 and p21, and promoted their nuclear localization. Conclusions KPT-335 demonstrates biologic activity against canine melanoma cell lines at physiologically relevant doses, suggesting that KPT-335 may represent a viable treatment option for dogs with malignant melanoma. PMID:25022346
Color Image Encryption Using Three-Dimensional Sine ICMIC Modulation Map and DNA Sequence Operations
Liu, Wenhao; Sun, Kehui; He, Yi; Yu, Mengyao
Derived from Sine map and iterative chaotic map with infinite collapse (ICMIC), a three-dimensional hyperchaotic Sine ICMIC modulation map (3D-SIMM) is proposed based on a close-loop modulation coupling (CMC) method. Based on this map, a novel color image encryption algorithm is designed by employing a hybrid model of multidirectional circular permutation and deoxyribonucleic acid (DNA) masking. In this scheme, the pixel positions of image are scrambled by multidirectional circular permutation, and the pixel values are substituted by DNA sequence operations. The simulation results and security analysis show that the algorithm has good encryption effect and strong key sensitivity, and can resist brute-force, statistical, differential, known-plaintext and chosen-plaintext attacks.
International Nuclear Information System (INIS)
Yan Zhenya
2005-01-01
A new transformation method is developed using the general sine-Gordon travelling wave reduction equation and a generalized transformation. With the aid of symbolic computation, this method can be used to seek more types of solutions of nonlinear differential equations, which include not only the known solutions derived by some known methods but new solutions. Here we choose the double sine-Gordon equation, the Magma equation and the generalized Pochhammer-Chree (PC) equation to illustrate the method. As a result, many types of new doubly periodic solutions are obtained. Moreover when using the method to these special nonlinear differential equations, some transformations are firstly needed. The method can be also extended to other nonlinear differential equations
Directory of Open Access Journals (Sweden)
Silva, M. O.
2005-12-01
Full Text Available Considering the effects of climatic conditions on groundwater resources salinization and quality, a comparative study was conducted on the coastal aquifers of Sines (Portugal and Essaouira (Morocco. Under the climatic and environmental conditions these two basins present different vulnerabilities to anthropogenic activities. Both aquifers correspond to sedimentary basins with similar structures and lithologies. From the available physical, chemical and piezometric data, two series of results of each area were selected corresponding to two different years that were analysed by Principal Component Analysis (PCA. Sines basin is characterised by a temperate climate. In the Sines aquifer the waterrock interaction process is the major mechanism responsible for the groundwater evolution, conferring a calcium-bicarbonate facies. Applying the PCA, punctual anthropogenic contamination was identified and linked to agricultural activities. The water resources of the Essaouira basin are characteristic of a semi-arid climate, and are severely impacted by the climate (quantity and quality. PCA allowed the evaluation of the contribution of the Tidzi diapir in the water recharge that confers to the groundwater a sodium-chloride facies. Although this statistical method did not shown a nitrate contamination input in the Essaouira multi-aquifer, this polluent presents locally high values. Also the very high evaporation and scarce precipitation activate the processes of salinization and contamination.Considerando los efectos de las condiciones climáticas sobre la calidad y la salinidad de las aguas subterráneas, se ha llevado a cabo un estudio comparativo entre los acuíferos costeros de Sines (Portugal y de Essaouira (Marruecos. Teniendo en cuenta las condiciones climáticas y el medio ambiente de estas dos cuencas, resultan distintas vulnerabilidades a las actividades antrópicas. Ambos acuíferos se localizan en cuencas sedimentarias de estructura y de litolog
Internal oscillation frequencies and anharmonic effects for the double sine-Gordon kink
DEFF Research Database (Denmark)
Salerno, M.; Samuelsen, Mogens Rugholm
1989-01-01
A simple derivation of the small oscillation frequency around 4π-kink solutions of the double sine-Gordon equation is presented. Small corrections to these frequencies due to anharmonic effects are also numerically and analytically investigated. The analysis is based on energetic considerations...
Sine-Gordon quantum field theory on the half-line with quantum boundary degrees of freedom
International Nuclear Information System (INIS)
Baseilhac, P.; Koizumi, K.
2003-01-01
The sine-Gordon model on the half-line with a dynamical boundary introduced by Delius and one of the authors is considered at quantum level. Classical boundary conditions associated with classical integrability are shown to be preserved at quantum level too. Non-local conserved charges are constructed explicitly in terms of the field and boundary operators. We solve the intertwining equation associated with a certain coideal subalgebra of U q (sl 2 -bar) generated by these non-local charges. The corresponding solution is shown to satisfy quantum boundary Yang-Baxter equations. Up to an exact relation between the quantization length of the boundary quantum mechanical system and the sine-Gordon coupling constant, we conjecture the soliton/antisoliton reflection matrix and bound states reflection matrices. The structure of the boundary state is then considered, and shown to be divided in two sectors. Also, depending on the sine-Gordon coupling constant a finite set of boundary bound states are identified. Taking the analytic continuation of the coupling, the corresponding boundary sinh-Gordon model is briefly discussed. In particular, the particle reflection factor enjoys weak-strong coupling duality
Coherence and chaos in the driven damped sine-Gordon equation: Measurement of the soliton spectrum
Energy Technology Data Exchange (ETDEWEB)
Overman, II, E A; McLaughlin, D W; Bishop, A R; Los Alamos National Lab., NM
1986-02-01
A numerical procedure is developed which measures the sine-Gordon soliton and radiation content of any field (PHI, PHIsub(t)) which is periodic in space. The procedure is applied to the field generated by a damped, driven sine-Gordon equation. This field can be either temporally periodic (locked to the driver) or chaotic. In either case the numerical measurement shows that the spatial structure can be described by only a few spatially localized (soliton wave-train) modes. The numerical procedure quantitatively identifies the presence, number and properties of these soliton wave-trains. For example, an increase of spatial symmetry is accompanied by the injection of additional solitons into the field. (orig.).
Persistent breather excitations in an ac-driven sine-Gordon system with loss
International Nuclear Information System (INIS)
Lomdahl, P.S.; Samuelsen, M.R.
1986-01-01
In a sine-Gordon system with loss and applied ac driver, a breather can be maintained as a persistent entrained oscillation if the driver is strong enough. The threshold field is determined by a perturbation method and compared to numerical experiments. Excellent agreement is found
Deterministic approach for multiple-source tsunami hazard assessment for Sines, Portugal
Wronna, M.; Omira, R.; Baptista, M. A.
2015-11-01
In this paper, we present a deterministic approach to tsunami hazard assessment for the city and harbour of Sines, Portugal, one of the test sites of project ASTARTE (Assessment, STrategy And Risk Reduction for Tsunamis in Europe). Sines has one of the most important deep-water ports, which has oil-bearing, petrochemical, liquid-bulk, coal, and container terminals. The port and its industrial infrastructures face the ocean southwest towards the main seismogenic sources. This work considers two different seismic zones: the Southwest Iberian Margin and the Gloria Fault. Within these two regions, we selected a total of six scenarios to assess the tsunami impact at the test site. The tsunami simulations are computed using NSWING, a Non-linear Shallow Water model wIth Nested Grids. In this study, the static effect of tides is analysed for three different tidal stages: MLLW (mean lower low water), MSL (mean sea level), and MHHW (mean higher high water). For each scenario, the tsunami hazard is described by maximum values of wave height, flow depth, drawback, maximum inundation area and run-up. Synthetic waveforms are computed at virtual tide gauges at specific locations outside and inside the harbour. The final results describe the impact at the Sines test site considering the single scenarios at mean sea level, the aggregate scenario, and the influence of the tide on the aggregate scenario. The results confirm the composite source of Horseshoe and Marques de Pombal faults as the worst-case scenario, with wave heights of over 10 m, which reach the coast approximately 22 min after the rupture. It dominates the aggregate scenario by about 60 % of the impact area at the test site, considering maximum wave height and maximum flow depth. The HSMPF scenario inundates a total area of 3.5 km2.
Retinal detachment and retinal holes in retinitis pigmentosa sine pigmento.
Csaky, K; Olk, R J; Mahl, C F; Bloom, S M
1991-01-01
Retinal detachment and retinal holes in two family members with retinitis pigmentosa sine pigmento are reported. We believe these are the first such cases reported in the literature. We describe the presenting symptoms and management, including cryotherapy, scleral buckling procedure, and sulfur hexafluoride injection (SF6), resulting in stable visual acuity in one case and retinal reattachment and improved visual acuity in the other case.
COMPETITIVENESS OF THE PORT OF SINES: THE RBV CONTRIBUTION
Azevedo, Susana; Ferreira, João
2008-01-01
The main objective of this paper is to analyze the competitiveness of the main maritime Port sited in Portugal - Port of Sines. This paper is developed under the Resource-based view approach. A literature review about the Resource-based view is presented with a special highlight on the contribution of organizations owns’ resources to the competitiveness. With this paper we intend to emphasize the applicability of a management theory to a different type of organizations which only recently st...
Multifocal amelanotic conjunctival melanoma and acquired melanosis sine pigmento.
Paridaens, A D; McCartney, A C; Hungerford, J L
1992-03-01
Clinical and histopathological features of four cases of multifocal amelanotic malignant melanoma of the conjunctiva in association with 'acquired melanosis sine pigmento' are reported. The absence of conjunctival pigmentation in this extremely rare combination of lesions prevented early diagnosis and clinical monitoring. As a result orbital exenteration was required in three cases. This multicentric non-pigmented variety of conjunctival malignant melanoma tends to present later than pigmented forms and may require exenteration of the orbit as a primary procedure.
The Influence of LINE-1 and SINE Retrotransposons on Mammalian Genomes.
Richardson, Sandra R; Doucet, Aurélien J; Kopera, Huira C; Moldovan, John B; Garcia-Perez, José Luis; Moran, John V
2015-04-01
Transposable elements have had a profound impact on the structure and function of mammalian genomes. The retrotransposon Long INterspersed Element-1 (LINE-1 or L1), by virtue of its replicative mobilization mechanism, comprises ∼17% of the human genome. Although the vast majority of human LINE-1 sequences are inactive molecular fossils, an estimated 80-100 copies per individual retain the ability to mobilize by a process termed retrotransposition. Indeed, LINE-1 is the only active, autonomous retrotransposon in humans and its retrotransposition continues to generate both intra-individual and inter-individual genetic diversity. Here, we briefly review the types of transposable elements that reside in mammalian genomes. We will focus our discussion on LINE-1 retrotransposons and the non-autonomous Short INterspersed Elements (SINEs) that rely on the proteins encoded by LINE-1 for their mobilization. We review cases where LINE-1-mediated retrotransposition events have resulted in genetic disease and discuss how the characterization of these mutagenic insertions led to the identification of retrotransposition-competent LINE-1s in the human and mouse genomes. We then discuss how the integration of molecular genetic, biochemical, and modern genomic technologies have yielded insight into the mechanism of LINE-1 retrotransposition, the impact of LINE-1-mediated retrotransposition events on mammalian genomes, and the host cellular mechanisms that protect the genome from unabated LINE-1-mediated retrotransposition events. Throughout this review, we highlight unanswered questions in LINE-1 biology that provide exciting opportunities for future research. Clearly, much has been learned about LINE-1 and SINE biology since the publication of Mobile DNA II thirteen years ago. Future studies should continue to yield exciting discoveries about how these retrotransposons contribute to genetic diversity in mammalian genomes.
Discrete mKdV and discrete sine-Gordon flows on discrete space curves
International Nuclear Information System (INIS)
Inoguchi, Jun-ichi; Kajiwara, Kenji; Matsuura, Nozomu; Ohta, Yasuhiro
2014-01-01
In this paper, we consider the discrete deformation of the discrete space curves with constant torsion described by the discrete mKdV or the discrete sine-Gordon equations, and show that it is formulated as the torsion-preserving equidistant deformation on the osculating plane which satisfies the isoperimetric condition. The curve is reconstructed from the deformation data by using the Sym–Tafel formula. The isoperimetric equidistant deformation of the space curves does not preserve the torsion in general. However, it is possible to construct the torsion-preserving deformation by tuning the deformation parameters. Further, it is also possible to make an arbitrary choice of the deformation described by the discrete mKdV equation or by the discrete sine-Gordon equation at each step. We finally show that the discrete deformation of discrete space curves yields the discrete K-surfaces. (paper)
Emotional Intelligence: The Sine Qua Non for a Clinical Leadership Toolbox
Rao, Paul R.
2006-01-01
Over the past decade, it has become increasingly clear that although IQ and technical skills are important, emotional intelligence is the Sine Qua Non of leadership. According to Goleman [Goleman, D. (1998). What makes a leader? "Harvard Business Review," 93-102] "effective leaders are alike in one crucial way: they all have a high degree of…
Stabilization of breathers in a parametrically driven sine-Gordon system with loss
DEFF Research Database (Denmark)
Grønbech-Jensen, N.; Kivshar, Yu. S.; Samuelsen, Mogens Rugholm
1991-01-01
We demonstrate that in a parametrically driven sine-Gordon system with loss, a breather, if driven, can be maintained in a steady state at half the external frequency. In the small-amplitude limit the system is described by the effective perturbed nonlinear Schrödinger equation. For an arbitrary...
International Nuclear Information System (INIS)
Faber, M.; Ivanov, A.N.
2001-01-01
We investigate the equivalence between Thirring model and sine-Gordon model in the chirally broken phase of the Thirring model. This is unlike all other available approaches where the fermion fields of the Thirring model were quantized in the chiral symmetric phase. In the path integral approach we show that the bosonized version of the massless Thirring model is described by a quantum field theory of a massless scalar field and exactly solvable, and the massive Thirring model bosonizes to the sine-Gordon model with a new relation between the coupling constants. We show that the non-perturbative vacuum of the chirally broken phase in the massless Thirring model can be described in complete analogy with the BCS ground state of superconductivity. The Mermin-Wagner theorem and Coleman's statement concerning the absence of Goldstone bosons in the 1+1-dimensional quantum field theories are discussed. We investigate the current algebra in the massless Thirring model and give a new value of the Schwinger term. We show that the topological current in the sine-Gordon model coincides with the Noether current responsible for the conservation of the fermion number in the Thirring model. This allows one to identify the topological charge in the sine-Gordon model with the fermion number. (orig.)
International Nuclear Information System (INIS)
Garbaczewski, P.
1981-01-01
Both quantum and classical sine--Gordon fields can be built out of the fundamental free neutral massive excitations, which quantally obey the Bose--Einstein statistics. At the roots of the ''boson-fermion reciprocity'' invented by Coleman, lies the spin 1/2 approximation of the underlying Bose system. By generalizing the coherent state methods to incorporate non-Fock quantum structures and to give account of the so-called boson transformation theory, we construct the carrier Hilbert space H/sub SG/ for quantum soliton operators. The h→0 limit of state expectation values of these operators among pure coherentlike states in H/sub SG/ reproduces the classical sine--Gordon field. The related (classical and quantum) spin 1/2 xyz Heisenberg model field is built out of the fundamental sine--Gordon excitations, and hence can be consistently defined on the appropriate subset of the quantum soliton Hilbert space H/sub x/yz . A correct classical limit is here shown to arise for the Heisenberg system: phase manifolds of the classical Heisenberg and sine--Gordon systems cannot be then viewed independently as a consequence of the quantum relation
Complex classical paths and the one-dimensional sine-Gordon system
International Nuclear Information System (INIS)
Millard, P.A.
1985-01-01
The semiclassical limit of the Green function for a particle in the one-dimensional sine-Gordon potential is obtained by summing over complex classical paths. The results are the same as those obtained in the less physically intuitive WKB approach. In addition to being of practical utility for solving quantum mechanical problems involving tunnelling, the classical path method may show how to deal with dense configuration of instantons. (orig.)
On sine dwell or broadband methods for modal testing
Chen, Jay-Chung; Wada, Ben K.
1987-01-01
For large, complex spacecraft structural systems, the objectives of the modal test are outlined. Based on these objectives, the comparison criteria for the modal test methods, namely, the broadband excitation and the sine dwell methods are established. Using the Galileo spacecraft modal test and the Centaur G Prime upper stage vehicle modal test as examples, the relative advantages or disadvantages of each method are examined. The usefulness or shortcoming of the methods are given from a practicing engineer's view point.
The sine method as a more accurate height predictor for hardwoods
Don C. Bragg
2007-01-01
Most hypsometers apply a mathematical technique that utilizes the tangent of angles and a horizontal distance to deliver the exact height of a tree under idealized circumstances. Unfortunately, these conditions are rarely met for hardwoods in the field. A ânewâ predictor based on sine and slope distance and discussed here does not require the same assumptions for...
Comparison of sine dwell and broadband methods for modal testing
Chen, Jay-Chung
1989-01-01
The objectives of modal tests for large complex spacecraft structural systems are outlined. The comparison criteria for the modal test methods, namely, the broadband excitation and the sine dwell methods, are established. Using the Galileo spacecraft modal test and the Centaur G Prime upper stage vehicle modal test as examples, the relative advantage or disadvantage of each method is examined. The usefulness or shortcomings of the methods are given from a practical engineering viewpoint.
Low-mode truncation methods in the sine-Gordon equation
International Nuclear Information System (INIS)
Xiong Chuyu.
1991-01-01
In this dissertation, the author studies the chaotic and coherent motions (i.e., low-dimensional chaotic attractor) in some near integrable partial differential equations, particularly the sine-Gordon equation and the nonlinear Schroedinger equation. In order to study the motions, he uses low mode truncation methods to reduce these partial differential equations to some truncated models (low-dimensional ordinary differential equations). By applying many methods available to low-dimensional ordinary differential equations, he can understand the low-dimensional chaotic attractor of PDE's much better. However, there are two important questions one needs to answer: (1) How many modes is good enough for the low mode truncated models to capture the dynamics uniformly? (2) Is the chaotic attractor in a low mode truncated model close to the chaotic attractor in the original PDE? And how close is? He has developed two groups of powerful methods to help to answer these two questions. They are the computation methods of continuation and local bifurcation, and local Lyapunov exponents and Lyapunov exponents. Using these methods, he concludes that the 2N-nls ODE is a good model for the sine-Gordon equation and the nonlinear Schroedinger equation provided one chooses a 'good' basis and uses 'enough' modes (where 'enough' depends on the parameters of the system but is small for the parameter studied here). Therefore, one can use 2N-nls ODE to study the chaos of PDE's in more depth
An Implicit Scheme of Lattice Boltzmann Method for Sine-Gordon Equation
International Nuclear Information System (INIS)
Hui-Lin, Lai; Chang-Feng, Ma
2008-01-01
We establish an implicit scheme of lattice Boltzmann method for simulating the sine-Gordon equation, which can be transformed into the explicit one, so the computation of the scheme is simple. Moreover, the parameter θ of the implicit scheme is independent of the relaxation time, which makes the model more flexible. The numerical results show that this method is very effective. (fundamental areas of phenomenology (including applications))
Renormalization group study of the multi-layer sine-gordon model
International Nuclear Information System (INIS)
Nandori, I.
2005-01-01
Complete text of publication follows. We analyze the phase structure of the system of coupled sine-Gordon (SG) type field theoric models. The 'pure,' SG model is periodic in the internal space spanned by the field variable. The central subjects of investigation is the multi-layer sine-Gordon (LSG) model, where the periodicity is broken partially by the coupling terms between the layers each of which is described by a scalar field, where the second term on the r.h.s. describes the interaction of the layers. Here, we dis- cuss the generalization of the results obtained for the two-layer sine-Gordon model found in the previous study. Besides the obvious field theoretical interest, the LSG model has been used to describe the vortex properties of high transition temperature superconductors, and the extension of the previous analysis to a general N-layer model is necessary for a description of the critical behaviour of vortices in realistic multi-layer systems. The couplings between the layers can be considered as mass terms. Since the periodicity of the LSG model has been broken only partially, the N-layer model has always a single zero mass eigenvalue. The presence of this single zero mass eigenvalue is found to be decisive with respect to the phase structure of the N-layer models. By a suitable rotation of the field variables, we identify the periodic mode (which corresponds to the zero mass eigenvalue) and N - 1 non-periodic modes (with explicit mass terms). The N - 1 non-periodic modes have a trivial IR scaling which holds independently of β which has been proven consistently using (i) the non-perturbative renormalization group study of the rotated model, (ii) the Gaussian integration about the vanishing-field saddle point. Due to the presence of the periodic mode the model undergoes a Kosterlitz-Thouless type phase transition which occurs at a coupling parameter β c 2 = 8Nπ, where N is the number of layers. The critical value β c 2 corresponds to the critical
Post-Gaussian Effective Potential of Double sine-Gordon Field
International Nuclear Information System (INIS)
Cai Weiran; Lou Senyue
2005-01-01
In the framework of the functional integral formalism, we calculate the effective potential of the double sine-Gordon (DsG) model up to the second order with an optimized expansion and the Coleman's normal-ordering prescription. Within the range of convergence, we make a comparison among the classical and the effective potential of the first and second order. The numerical analysis shows that the DsG post-Gaussian EP possesses some fine global properties and makes a substantial and a concordant quantum correction to the features of the classical potential.
Sine-Gordon 2-pi-kink dynamics in the presence of small perturbations
DEFF Research Database (Denmark)
Olsen, O. H.; Samuelsen, Mogens Rugholm
1983-01-01
The influence of external driving forces on the 2π-kink solution to the sine-Gordon equation is examined. The analysis is based on the approach that the solution to the problem can be divided into a 2π-kink part and a background or vacuum part. The behavior of the 2π kink depends strongly...
Quantum aspects of the noncommutative Sine-Gordon model
International Nuclear Information System (INIS)
Kuerkcueoglu
2007-01-01
In this talk, I will first present some of the quantum field theoretical aspects of the integrable noncommutative sine-Gordon model proposed in [hep-th/0406065] using standard semi-classical methods. In particular, I will discuss the fluctuations at quadratic order around the static kink solution using the background field method. I will argue that at 0(θ 2 ) the spectrum of fluctuations remains essentially the same as that of the corresponding commutative theory. A brief analysis of one-loop two-point functions will also be presented and it will be followed by some remarks on the obstacles in determining the noncommutativity corrections to the quantum mass of the kink. (author)
Retinitis pigmentosa sine pigmenti. Debut with macular oedema.
de la Mata Pérez, G; Ruiz-Moreno, O; Fernández-Pérez, S; Torrón Fernández-Blanco, C; Pablo-Júlvez, L
2014-09-01
A 25-year-old woman, with metamorphopsia in her left eye of one year onset. The examination revealed a bilateral cystoid macular oedema (CME) and vascular attenuation. We describe the diagnostic tests, as well as differential diagnosis and treatment response with carbonic anhydrase inhibitors. The retinitis pigmentosa sine pigment is a subtype of atypical retinitis pigmentosa characterised by the absence of pigment deposits. The night blindness is milder, and perimetric and electroretinographic impairment is lower. CME is an important cause of central vision loss, and responds to anhydrase carbonic inhibitors. Copyright © 2012 Sociedad Española de Oftalmología. Published by Elsevier Espana. All rights reserved.
Simple connection between conservation laws in the Korteweg--de Vriesand sine-Gordon systems
International Nuclear Information System (INIS)
Chodos, A.
1980-01-01
An infinite sequence of conserved quantities follows from the Lax representation in both the Korteweg--de Vries and sine-Gordon systems. We show that these two sequences are related by a simple substitution. In an appendix, two different methods of deriving conservation laws from the Lax representation are presented
Directory of Open Access Journals (Sweden)
Novak Antonin
2010-01-01
Full Text Available A new method of identification, based on an input synchronized exponential swept-sine signal, is used to analyze and synthesize nonlinear audio systems like overdrive pedals for guitar. Two different pedals are studied; the first one exhibiting a strong influence of the input signal level on its input/output law and the second one exhibiting a weak influence of this input signal level. The Synchronized Swept Sine method leads to a Generalized Polynomial Hammerstein model equivalent to the pedals under test. The behaviors of both pedals are illustrated through model-based resynthesized signals. Moreover, it is also shown that this method leads to a criterion allowing the classification of the nonlinear systems under test, according to the influence of the input signal levels on their input/output law.
On a Kubo-Martin-Schwinger state of the Sine-Gordon system
International Nuclear Information System (INIS)
Peskov, N.V.
1986-01-01
This paper considers the Sine-Gordon equation on a finite interval as a Hamiltonian system. A Gaussian measure is defined on an extension of the phase space. It is shown that the partition funciton Z employed in the statistical mechanics of the solitons is an integral with respect to this measure. An algebra of observables is defined and on it a state is constructed which satisfies the Kubo-Martin-Schwinger condition
Closed-form expressions for integrals of MKdV and sine-Gordon maps
International Nuclear Information System (INIS)
Kamp, Peter H van der; Rojas, O; Quispel, G R W
2007-01-01
We present closed-form expressions for approximately N integrals of 2N-dimensional maps. The maps are obtained by travelling wave reductions of the modified Korteweg-de Vries equation and of the sine-Gordon equation, respectively. We provide the integrating factors corresponding to the integrals. Moreover we show how the integrals and the integrating factors relate to the staircase method
Directory of Open Access Journals (Sweden)
Cheryl A London
Full Text Available The purpose of this study was to evaluate the activity of Selective Inhibitors of Nuclear Export (SINE compounds that inhibit the function of the nuclear export protein Exportin 1 (XPO1/CRM1 against canine tumor cell lines and perform a Phase I clinical trial of KPT-335 in dogs with spontaneous cancer to provide a preliminary assessment of biologic activity and tolerability.Canine tumor cell lines derived from non-Hodgkin lymphoma (NHL, mast cell tumor, melanoma and osteosarcoma exhibited growth inhibition and apoptosis in response to nanomolar concentrations of SINE compounds; NHL cells were particularly sensitive with IC50 concentrations ranging from 2-42 nM. A Phase I clinical trial of KPT-335 was performed in 17 dogs with NHL (naive or relapsed, mast cell tumor or osteosarcoma. The maximum tolerated dose was 1.75 mg/kg given orally twice/week (Monday/Thursday although biologic activity was observed at 1 mg/kg. Clinical benefit (CB including partial response to therapy (PR, n = 2 and stable disease (SD, n = 7 was observed in 9/14 dogs with NHL with a median time to progression (TTP for responders of 66 days (range 35-256 days. A dose expansion study was performed in 6 dogs with NHL given 1.5 mg/kg KPT-335 Monday/Wednesday/Friday; CB was observed in 4/6 dogs with a median TTP for responders of 83 days (range 35-354 days. Toxicities were primarily gastrointestinal consisting of anorexia, weight loss, vomiting and diarrhea and were manageable with supportive care, dose modulation and administration of low dose prednisone; hepatotoxicity, anorexia and weight loss were the dose limiting toxicities.This study provides evidence that the novel orally bioavailable XPO1 inhibitor KPT-335 is safe and exhibits activity in a relevant, spontaneous large animal model of cancer. Data from this study provides critical new information that lays the groundwork for evaluation of SINE compounds in human cancer.
Sine-square deformation of solvable spin chains and conformal field theories
International Nuclear Information System (INIS)
Katsura, Hosho
2012-01-01
We study solvable spin chains, one-dimensional massless Dirac fermions and conformal field theories (CFTs) with sine-square deformation (SSD), in which the Hamiltonian density is modulated by the function f(x) = sin 2 (πx/ℓ), where x is the position and ℓ is the length of the system. For the XY chain and the transverse field Ising chain at criticality, it is shown that the ground state of an open system with SSD is identical to that of a uniform chain with periodic boundary conditions. The same holds for the massless Dirac fermions with SSD, corresponding to the continuum limit of the gapless XY chain. For general CFTs, we find that the Hamiltonian of a system with SSD has an expression in terms of the generators of the Virasoro algebra. This allows us to show that the vacuum state is an exact eigenstate of the sine-square deformed Hamiltonian. Furthermore, for a restricted class of CFTs associated with affine Lie (Kac–Moody) algebras, including c = 1 Gaussian CFT, we prove that the vacuum is an exact ground state of the deformed Hamiltonian. This explains why the SSD has succeeded in suppressing boundary effects in one-dimensional critical systems, as observed in previous numerical studies. (paper)
Soliton scatterings by impurities in a short-length sine-Gordon chain
International Nuclear Information System (INIS)
Dikande, A.M.; Kofane, T.C.
1995-07-01
The scattering of soliton by impurities at the frontiers of a finite-length region of an infinite sine-Gordon chain is analyzed. The impurities consist of two isotopic inhomogeneities installed at the boundaries of the finite-length region. The soliton solution in the region is found in term of snoidal sine-Gordon soliton which properly takes into account the effects of the boundaries. By contrast, the soliton solutions in the neighboring sides of the region are obtained in terms of the so-called large-amplitude, localized kinks with limiting spatial extensions at x → ± ∞, which is equal ±π. Using the continuity of these soliton solutions at the frontiers as well as appropriate boundary conditions, it is shown that the soliton may be either i) reflected by the incident impurity; ii) trapped (with oscillating motions) between the two impurities (i.e. inside the infinite region); or iii) transmitted by the second impurity into the third, infinitely extended region. The threshold velocities for the reflection and transmission into different regions are found and shown to vary exponentially as a function of the length of the bounded region. The frequency of soliton oscillations between the impurities has also been calculated in some acceptable limit. (author). 28 refs, 1 fig
Grand partition function in field theory with applications to sine-Gordon field theory
International Nuclear Information System (INIS)
Samuel, S.
1978-01-01
Certain relativistic field theories are shown to be equivalent to the grand partition function of an interacting gas. Using the physical insight given by this analogy many field-theoretic results are obtained, particularly for the sine-Gordon field theory. The main results are enumerated in the summary to which the reader is referred
Sadio, S.
1989-01-01
Soils of the "Tannes region" of the Sine Saloum bassin, Senegal, are characterized by great heterogenity in morphology and physical and chemical properties. Their caracteristics are linked to topographic position, material and hydrology.
Their recent pedogenetical evolution is a
Sine-Gordon equation and its application to tectonic stress transfer
Bykov, Victor G.
2014-07-01
An overview is given on remarkable progress that has been made in theoretical studies of solitons and other nonlinear wave patterns, excited during the deformation of fault block (fragmented) geological media. The models that are compliant with the classical and perturbed sine-Gordon equations have only been chosen. In these mathematical models, the rotation angle of blocks (fragments) and their translatory displacement of the medium are used as dynamic variables. A brief description of the known models and their geophysical and geodynamic applications is given. These models reproduce the kinematic and dynamic features of the traveling deformation front (kink, soliton) generated in the fragmented media. It is demonstrated that the sine-Gordon equation is applicable to the description of series of the observed seismic data, modeling of strain waves, as well as the features related to fault dynamics and the subduction slab, including slow earthquakes, periodicity of episodic tremor and slow slip (ETS) events, and migration pattern of tremors. The study shows that simple heuristic models and analytical and numerical computations can explain triggering of seismicity by transient processes, such as stress changes associated with solitary strain waves in crustal faults. The need to develop the above-mentioned new (nonlinear) mathematical models of the deformed fault and fragmented media was caused by the reason that it is impossible to explain a lot of the observed effects, particularly, slow redistribution and migration of stresses in the lithosphere, within the framework of the linear elasticity theory.
Exact Mass-Coupling Relation for the Homogeneous Sine-Gordon Model.
Bajnok, Zoltán; Balog, János; Ito, Katsushi; Satoh, Yuji; Tóth, Gábor Zsolt
2016-05-06
We derive the exact mass-coupling relation of the simplest multiscale quantum integrable model, i.e., the homogeneous sine-Gordon model with two mass scales. The relation is obtained by comparing the perturbed conformal field theory description of the model valid at short distances to the large distance bootstrap description based on the model's integrability. In particular, we find a differential equation for the relation by constructing conserved tensor currents, which satisfy a generalization of the Θ sum rule Ward identity. The mass-coupling relation is written in terms of hypergeometric functions.
Scattering of the double sine-Gordon kinks
Gani, Vakhid A.; Marjaneh, Aliakbar Moradi; Askari, Alidad; Belendryasova, Ekaterina; Saadatmand, Danial
2018-04-01
We study the scattering of kink and antikink of the double sine-Gordon model. There is a critical value of the initial velocity v_{{cr}} of the colliding kinks, which separates different regimes of the collision. At v_{in}>v_{cr} we observe kinks reflection, while at v_{in}
[Short interspersed repetitive sequences (SINEs) and their use as a phylogenetic tool].
Kramerov, D A; Vasetskiĭ, N S
2009-01-01
The data on one of the most common repetitive elements of eukaryotic genomes, short interspersed elements (SINEs), are reviewed. Their structure, origin, and functioning in the genome are discussed. The variation and abundance of these neutral genomic markers makes them a convenient and reliable tool for phylogenetic analysis. The main methods of such analysis are presented, and the potential and limitations of this approach are discussed using specific examples.
Scattering of sine-Gordon kinks on potential wells
International Nuclear Information System (INIS)
Piette, Bernard; Zakrzewski, W J
2007-01-01
We study the scattering properties of sine-Gordon kinks on obstructions in the form of finite size potential 'wells'. We model this by making the coefficient of the cos(ψ) - 1 term in the Lagrangian position dependent. We show that when the kinks find themselves in the well they radiate and then interact with this radiation. As a result of this energy loss, the kinks become trapped for small velocities while at higher velocities they are transmitted with a loss of energy. However, the interaction with the radiation can produce 'unexpected' reflections by the well. We present two simple models which capture the gross features of this behaviour. Both involve standing waves either at the edges of the well or in the well itself
Rapid fabrication and characterization of sine wave targets
International Nuclear Information System (INIS)
Day, R.D.; Armijo, E.; Gobby, P.; Hatch, D.; Rivera, G.; Salzer, L.; Townsend, J.
1997-01-01
The effect of surface perturbations on Inertial Confinement Fusion target performance is currently being researched at Los Alamos National Laboratory (LANL). These perturbations can cause hydrodynamic instabilities which in turn reduce the targets' yield. To systematically measure the growth of these instabilities requires targets to be produced which have perturbations of a known amplitude and spatial frequency. The authors have recently assembled hardware onto one of their diamond turning lathes which enables them to machine and measure these sine waves in about 15 minutes. This is a significant reduction in time from the two and one half hours required by the previous method. This paper discusses the hardware, how it works, and how well the system is working for them to produce these targets
Exact Travelling Solutions of Discrete sine-Gordon Equation via Extended Tanh-Function Approach
International Nuclear Information System (INIS)
Dai Chaoqing; Zhang Jiefang
2006-01-01
In this paper, we generalize the extended tanh-function approach, which was used to find new exact travelling wave solutions of nonlinear partial differential equations or coupled nonlinear partial differential equations, to nonlinear differential-difference equations. As illustration, two series of exact travelling wave solutions of the discrete sine-Gordon equation are obtained by means of the extended tanh-function approach.
Branch structures at the steps of the devil's staircase of the sine circle map
International Nuclear Information System (INIS)
Wen, H.C.; Duong-van, M.
1992-01-01
We have discovered substructures consisting of branches at each step of the devil's staircase of the sine circle map. These substructures are found to follow the hierarchy of the Farey tree. We develop a formalism to relate the rational winding number W=p/q to the number of branches in these substructures
The long (LINEs) and the short (SINEs) of it: altered methylation as a precursor to toxicity.
Carnell, Ammie N; Goodman, Jay I
2003-10-01
Although once thought of as "junk" DNA, the importance of interspersed elements in the genome has become increasingly appreciated in recent years. In a broad sense these are collectively referred to as transposable elements, which encompass both transposons and retrotransposons. The latter include long interspersed nuclear elements (LINEs) and short interspersed nuclear elements (SINEs). Expression of these elements leads to genetic instability. Therefore, it is important that they remain transcriptionally silenced, and DNA methylation plays a key role in this regard. A framework for understanding the possible interplay between altered DNA methylation, an epigenetic change, and mutational events is presented. A case is made as to how retrotransposable elements, specifically LINEs and SINEs, are likely to emerge as key players in furthering our understanding of mechanisms underlying a variety of toxicities, including carcinogenesis but not limited to this endpoint.
Overview of multi-input frequency domain modal testing methods with an emphasis on sine testing
Rost, Robert W.; Brown, David L.
1988-01-01
An overview of the current state of the art multiple-input, multiple-output modal testing technology is discussed. A very brief review of the current time domain methods is given. A detailed review of frequency and spatial domain methods is presented with an emphasis on sine testing.
Instanton contributions to the valence band of the double Sine-Gordon potential
International Nuclear Information System (INIS)
Ricotta, R.M.; Escobar, C.O.
1982-01-01
The energy dispersion relation for the valence band of the double sine-Gordon potential is calculated, approximating the tunneling amplitude by a sum of contributions of multi-instantons and anti-instatons trajectories. The interesting feature of this potential is that they have to deal with two types of instantons, as there are two different potential barriers within one period of the potential. The results with the standard WKB approximation are compared. (Author) [pt
Sine-Gordon mean field theory of a Coulomb gas
Energy Technology Data Exchange (ETDEWEB)
Diehl, Alexandre; Barbosa, Marcia C.; Levin, Yan
1997-12-31
Full text. The Coulomb gas provides a paradigm for the study of various models of critical phenomena. In particular, it is well known that the two dimensional (2 D). Coulomb gas can be directly used to study the superfluidity transition in {sup 4} He films, arrays of Josephson junctions, roughening transition, etc. Not withstanding its versatility, our full understanding of the most basic model of Coulomb gas, namely an ensemble of hard spheres carrying either positive or negative charges at their center, is still lacking. It is now well accepted that at low density the two dimensional plasma of equal number of positive and negative particles undergoes a Kosterlitz-Thouless (KT) metal insulator transition. This transition is of an infinite order and is characterized by a diverging Debye screening length. As the density of particles increases, the validity of the KT theory becomes questionable and the possibility of the KT transition being replaced by some kind of first order discontinuity has been speculated for a long time. In this work sine-Gordon field theory is used to investigate the phase diagram of a neutral Coulomb gas. A variational mean-field free energy is constructed and the corresponding phase diagrams in two and three dimensions are obtained. When analyzed in terms of chemical potential, the sine-Gordon theory predicts the phase diagram topologically identical to the Monte Carlo simulations and a recently developed Debye-Huckel-Bjerrum theory. In 2D, we find that the infinite-order Kosterlitz-Thouless line terminates in a tricritical point, after which the metal-insulator transition becomes first order. However, when the transformation from chemical potential to the density is made the whole insulating phase is mapped onto zero density. (author)
Cianciulli, Antonia; Calvello, Rosa; Panaro, Maria A
2015-04-01
In the homologous genes studied, the exons and introns alternated in the same order in mouse and human. We studied, in both species: corresponding short segments of introns, whole corresponding introns and complete homologous genes. We considered the total number of nucleotides and the number and orientation of the SINE inserts. Comparisons of mouse and human data series showed that at the level of individual relatively short segments of intronic sequences the stochastic variability prevails in the local structuring, but at higher levels of organization a deterministic component emerges, conserved in mouse and human during the divergent evolution, despite the ample re-editing of the intronic sequences and the fact that processes such as SINE spread had taken place in an independent way in the two species. Intron conservation is negatively correlated with the SINE occupancy, suggesting that virus inserts interfere with the conservation of the sequences inherited from the common ancestor. Copyright © 2015 Elsevier Ltd. All rights reserved.
Discovering Trigonometric Relationships Implied by the Law of Sines and the Law of Cosines
Skurnick, Ronald; Javadi, Mohammad
2006-01-01
The Law of Sines and The Law of Cosines are of paramount importance in the field of trigonometry because these two theorems establish relationships satisfied by the three sides and the three angles of any triangle. In this article, the authors use these two laws to discover a host of other trigonometric relationships that exist within any…
Sabirov, K.; Rakhmanov, S.; Matrasulov, D.; Susanto, H.
2018-04-01
We consider the stationary sine-Gordon equation on metric graphs with simple topologies. Exact analytical solutions are obtained for different vertex boundary conditions. It is shown that the method can be extended for tree and other simple graph topologies. Applications of the obtained results to branched planar Josephson junctions and Josephson junctions with tricrystal boundaries are discussed.
Takahashi, K; Nishida, M; Yuma, M; Okada, N
2001-01-01
Lake Malawi is home to more than 450 species of endemic cichlids, which provide a spectacular example of adaptive radiation. To clarify the phylogenetic relationships among these fish, we examined the presence and absence of SINEs (short interspersed repetitive elements) at orthologous loci. We identified six loci at which a SINE sequence had apparently been specifically inserted by retroposition in the common ancestor of all the investigated species of endemic cichlids in Lake Malawi. At another locus, unique sharing of a SINE sequence was evident among all the investigated species of endemic non-Mbuna cichlids with the exception of Rhamphochromis sp. The relationships were in good agreement with those deduced in previous studies with various different markers, demonstrating that the SINE method is useful for the elucidation of phylogenetic relationships among cichlids in Lake Malawi. We also characterized a locus that exhibited transspecies polymorphism with respect to the presence or absence of the SINE sequence among non-Mbuna species. This result suggests that incomplete lineage sorting and/or interspecific hybridization might have occurred or be occurring among the species in this group, which might potentially cause misinterpretation of phylogenetic data, in particular when a single-locus marker, such as a sequence in the mitochondrial DNA, is used for analysis.
Implementing the sine transform of fermionic modes as a tensor network
Epple, Hannes; Fries, Pascal; Hinrichsen, Haye
2017-09-01
Based on the algebraic theory of signal processing, we recursively decompose the discrete sine transform of the first kind (DST-I) into small orthogonal block operations. Using a diagrammatic language, we then second-quantize this decomposition to construct a tensor network implementing the DST-I for fermionic modes on a lattice. The complexity of the resulting network is shown to scale as 5/4 n logn (not considering swap gates), where n is the number of lattice sites. Our method provides a systematic approach of generalizing Ferris' spectral tensor network for nontrivial boundary conditions.
An equivalence between the discrete Gaussian model and a generalized Sine Gordon theory on a lattice
International Nuclear Information System (INIS)
Baskaran, G.; Gupte, N.
1983-11-01
We demonstrate an equivalence between the statistical mechanics of the discrete Gaussian model and a generalized Sine-Gordon theory on an Euclidean lattice in arbitrary dimensions. The connection is obtained by a simple transformation of the partition function and is non perturbative in nature. (author)
International Nuclear Information System (INIS)
Yusufoglu, E.; Bekir, A.; Alp, M.
2008-01-01
In this paper, we establish exact solutions for nonlinear evolution equations. The sine-cosine method is used to construct periodic and solitary wave solutions of the Kawahara and modified Kawahara equations. These solutions may be important of significance for the explanation of some practical physical problems
Quench dynamics near a quantum critical point: Application to the sine-Gordon model
International Nuclear Information System (INIS)
De Grandi, C.; Polkovnikov, A.; Gritsev, V.
2010-01-01
We discuss the quench dynamics near a quantum critical point focusing on the sine-Gordon model as a primary example. We suggest a unified approach to sudden and slow quenches, where the tuning parameter λ(t) changes in time as λ(t)∼υt r , based on the adiabatic expansion of the excitation probability in powers of υ. We show that the universal scaling of the excitation probability can be understood through the singularity of the generalized adiabatic susceptibility χ 2r+2 (λ), which for sudden quenches (r=0) reduces to the fidelity susceptibility. In turn this class of susceptibilities is expressed through the moments of the connected correlation function of the quench operator. We analyze the excitations created after a sudden quench of the cosine potential using a combined approach of form-factors expansion and conformal perturbation theory for the low-energy and high-energy sector, respectively. We find the general scaling laws for the probability of exciting the system, the density of excited quasiparticles, the entropy and the heat generated after the quench. In the two limits where the sine-Gordon model maps to hard-core bosons and free massive fermions we provide the exact solutions for the quench dynamics and discuss the finite temperature generalizations.
BPS ZN string tensions, sine law and Casimir scaling, and integrable field theories
International Nuclear Information System (INIS)
Kneipp, Marco A. C.
2007-01-01
We consider a Yang-Mills-Higgs theory with spontaneous symmetry breaking of the gauge group G→U(1) r →C G , with C G being the center of G. We study two vacua solutions of the theory which produce this symmetry breaking. We show that for one of these vacua, the theory in the Coulomb phase has the mass spectrum of particles and monopoles which is exactly the same as the mass spectrum of particles and solitons of two-dimensional affine Toda field theory, for suitable coupling constants. That result holds also for N=4 super Yang-Mills theories. On the other hand, in the Higgs phase, we show that for each of the two vacua the ratio of the tensions of the BPS Z N strings satisfy either the Casimir scaling or the sine law scaling for G=SU(N). These results are extended to other gauge groups: for the Casimir scaling, the ratios of the tensions are equal to the ratios of the quadratic Casimir constant of specific representations; for the sine law scaling, the tensions are proportional to the components of the left Perron-Frobenius eigenvector of Cartan matrix K ij and the ratios of tensions are equal to the ratios of the soliton masses of affine Toda field theories
International Nuclear Information System (INIS)
Wingate, C.A.
1978-01-01
Two major problems are studied in this thesis. The first is a numerical search for a stable oscillating mode in the Phi4 equation similar to the one that is known for the sine-Gordon equation. Starting with a widely separated soliton and anti-soliton traveling toward each other, it is observed, after a long period of time (t = 2800), that the solitons form a quasistable oscillating state. An interesting, previously unknown structure in the interaction depending on the initial velocity and initial separation is found and studied in detail. The second topic covered here is a study of the phi4, KdV and sine-Gordon equations when the coefficients vary slowly with time. A general first order solution is found for the wave equation with a non-linear potential and is applied to the phi4 and sine-Gordon potentials. In doing this it is found that the conservation of momentum is equivalent order by order to the secular conditions. Deficiencies in existing calculations for the KdV equation are pointed out through the use of adiabatic invariants and numerical calculations
Virtual sine arm kinematic mount system
International Nuclear Information System (INIS)
Xu, Z.; Randall, K.J.
1997-01-01
A novel kinematic mount system for a vertical focusing mirror of the soft x-ray spectroscopy beamline at the Advanced Photon Source is described. The system contains three points in a horizontal plane. Each point consists of two horizontal linear precision stages, a spherical ball bearing, and a vertical precision stage. The horizontal linear stages are aligned orthogonally and are conjoined by a spherical ball bearing, supported by the vertical linear stage at each point. The position of each confined horizontal stage is controlled by a motorized micrometer head by spring-loading the flat tip of the micrometer head onto a tooling ball fixing on the carriage of the stage. A virtual sine arm is formed by tilting the upstream horizontal stage down and the two downstream horizontal stages up by a small angle. The fine pitch motion is achieved by adjusting the upstream stage. This supporting structure is extremely steady due to a relatively large span across the supporting points and yields extremely high resolution on the pitch motion. With a one degree tilt and a microstepping motor, the authors achieved a 0.4 nanoradian resolution on the mirror pitch motion
Energy Technology Data Exchange (ETDEWEB)
Zhang, Luqi; Wei, Yanyu; Wang, Bing; Shen, Wenan; Xu, Jin; Gong, Yubin [National Key Laboratory of Science and Technology on Vacuum Electronics, School of Physical Electronics, University of Electronic Science and Technology of China, Chengdu 610054 (China); Park, Gun-Sik [The Department of Physics and Astronomy, Seoul National University, Seoul 151-747 (Korea, Republic of)
2016-03-15
A novel backward wave oscillator (BWO) is presented by utilizing a slotted sine waveguide with a pencil electron beam to produce the high power terahertz wave. The high frequency characteristics including dispersion properties, interaction impedances, and transmission characteristics of the slotted sine waveguide are analyzed in detail. The high frequency system including the output coupler, slow wave structure (SWS), and reflector are designed properly. A 3-D particle-in-cell mode is applied to predict the device performance of the BWO based on the novel SWS. The investigation results demonstrate that this device can generate over 8.05 W output power in the frequency range of 363.4–383.8 GHz by using a 30 mA pencil electron beam and adjusting the beam voltage from 20 kV to 32 kV.
Second order phase transition in two dimensional sine-Gordon field theory - lattice model
International Nuclear Information System (INIS)
Babu Joseph, K.; Kuriakose, V.C.
1978-01-01
Two dimensional sine-Gordon (SG) field theory on a lattice is studied using the single-site basis variational method of Drell and others. The nature of the phase transition associated with the spontaneous symmetry breakdown in a SG field system is clarified to be of second order. A generalisation is offered for a SG-type field theory in two dimensions with a potential of the form [cossup(n)((square root of lambda)/m)phi-1].(author)
Systemic Sclerosis Sine Scleroderma in Mexican Patients. Case Reports.
Vera-Lastra, Olga; Sauceda-Casas, Christian Alexis; Domínguez, María Del Pilar Cruz; Alvarez, Sergio Alberto Mendoza; Sepulceda-Delgado, Jesús
2017-01-03
Systemic sclerosis sine scleroderma (ssSSc) is a form of systemic sclerosis that is characterized by Raynaud's phenomenon (RP), visceral involvement without thickening of skin and anticentromere antibodies (ACA). We studied 10 ssSsc patients with a prevalence of 2%. The clinical signs were: RP 9/10, esophageal manifestations 8/10, pulmonary arterial hypertension 4/10, interstitial lung disease 4/10, cardiac signs 3/10 and ACA 8/10. In patients with RP, esophageal dysmotility, interstitial lung disease and pulmonary arterial hypertension should be tested for ACA in order to establish a prompt diagnosis and treatment of ssSSc. Copyright © 2016 Elsevier España, S.L.U. and Sociedad Española de Reumatología y Colegio Mexicano de Reumatología. All rights reserved.
Zero temperature landscape of the random sine-Gordon model
International Nuclear Information System (INIS)
Sanchez, A.; Bishop, A.R.; Cai, D.
1997-01-01
We present a preliminary summary of the zero temperature properties of the two-dimensional random sine-Gordon model of surface growth on disordered substrates. We found that the properties of this model can be accurately computed by using lattices of moderate size as the behavior of the model turns out to be independent of the size above certain length (∼ 128 x 128 lattices). Subsequently, we show that the behavior of the height difference correlation function is of (log r) 2 type up to a certain correlation length (ξ ∼ 20), which rules out predictions of log r behavior for all temperatures obtained by replica-variational techniques. Our results open the way to a better understanding of the complex landscape presented by this system, which has been the subject of very many (contradictory) analysis
SINEs of progress: Mobile element applications to molecular ecology.
Ray, David A
2007-01-01
Mobile elements represent a unique and under-utilized set of tools for molecular ecologists. They are essentially homoplasy-free characters with the ability to be genotyped in a simple and efficient manner. Interpretation of the data generated using mobile elements can be simple compared to other genetic markers. They exist in a wide variety of taxa and are useful over a wide selection of temporal ranges within those taxa. Furthermore, their mode of evolution instills them with another advantage over other types of multilocus genotype data: the ability to determine loci applicable to a range of time spans in the history of a taxon. In this review, I discuss the application of mobile element markers, especially short interspersed elements (SINEs), to phylogenetic and population data, with an emphasis on potential applications to molecular ecology.
Discrete cosine and sine transforms general properties, fast algorithms and integer approximations
Britanak, Vladimir; Rao, K R; Rao, K R
2006-01-01
The Discrete Cosine Transform (DCT) is used in many applications by the scientific, engineering and research communities and in data compression in particular. Fast algorithms and applications of the DCT Type II (DCT-II) have become the heart of many established international image/video coding standards. Since then other forms of the DCT and Discrete Sine Transform (DST) have been investigated in detail. This new edition presents the complete set of DCT and DST discrete trigonometric transforms, including their definitions, general mathematical properties, and relations to the optimal Karhune
Ribeiro, P.; Silva, P. F.; Moita, P.; Kratinová, Z.; Marques, F. O.; Henry, B.
2013-10-01
This study revisits the palaeomagnetism of the Sines massif (˜76 Ma) in the southwestern Iberian Margin (Portugal). The palaeomagnetic analysis was complemented by a comprehensive study of the magnetic mineralogy by means of rock magnetic measurements and petrographic observations. The overall dispersion of palaeomagnetic directions (declination ranging between ˜N0° and ˜N50°) and their migration observed during stepwise demagnetizations have revealed the superposition of remanence components. We interpret this complex palaeomagnetic behaviour as related to the regional hydrothermalism associated with the last stages of Late Cretaceous magmatic activity. This environment favoured mineralogical alteration and a partial chemical remagnetization, giving in most samples a composite magnetization, which has been erroneously interpreted as the primary one in a previous study, then leading to a questionable model for Cretaceous Iberia rotation. Nonetheless, for some samples a single component has been isolated. Interesting rock magnetic properties and microscopic observations point to a well-preserved magnetic mineralogy for these samples, with magnetite clearly of primary origin. The associated ChRM mean direction (D/I = 3.9°/46.5°, α95 = 1.7°, N = 31 samples) then represents the true primary magnetization of the Sines massif. This new palaeomagnetic direction and the corresponding palaeomagnetic pole (long = 332.0°, lat = -79.5°, A95 = 1.7°) agrees with those from the other palaeomagnetic works for the same period and region (e.g. the Sintra and Monchique massifs), yielding a lack of significant rotation of Iberia relative to stable Europe since the uppermost Late Cretaceous (Campanian-Maastrichtian).
Morphdynamics of Beaches in the Tróia-Sines Littoral Ribbon (SW Portugal)
Gama, Cristina; Andrade, César; Taborda, Rui; Freitas, Conceição
2006-01-01
In the Tróia-Sines littoral ribbon five beaches were monitored in order to evaluate morphological and textural changes. The textural analysis reveals a southward coarsening trend that reflects an increase in the wave energy. The morphodynamic data indicate that the modal stages are intermediate to reflective, and that the available beach volume increases southwards. During storm periods the volumetric changes reach 15% to 82% of the beach envelope corresponding to magnitudes of 6x10 3 to 2x10...
A Classroom Note on Generating Examples for the Laws of Sines and Cosines from Pythagorean Triangles
Sher, Lawrence; Sher, David
2007-01-01
By selecting certain special triangles, students can learn about the laws of sines and cosines without wrestling with long decimal representations or irrational numbers. Since the law of cosines requires only one of the three angles of a triangle, there are many examples of triangles with integral sides and a cosine that can be represented exactly…
Multiple sine wave excitation of a hard spring oscillator
International Nuclear Information System (INIS)
Curreri, J.R.; Bezler, P.
1976-06-01
The vibration testing of non-linear systems has not received much attention in the literature. Frequently, linear procedures are used in the hope that large differences between the linear and non-linear responses will not occur. This may be valid for certain small ranges of the non-linearity and for a single harmonic component excitation. However, for multi-component periodic inputs, there is very little guidance in the literature for even a qualitative evaluation of the probable response. With multi-component periodic inputs, it has been shown that sub-combination frequencies can occur in cubic non-linear systems. Under these conditions, large responses can develop. The critical nature of the development of the large response has not been discussed. This is the subject of this paper. The qualitative response of a two component sine wave applied to a hard spring oscillator is shown
Rocket measurements of electron density irregularities during MAC/SINE
Ulwick, J. C.
1989-01-01
Four Super Arcas rockets were launched at the Andoya Rocket Range, Norway, as part of the MAC/SINE campaign to measure electron density irregularities with high spatial resolution in the cold summer polar mesosphere. They were launched as part of two salvos: the turbulent/gravity wave salvo (3 rockets) and the EISCAT/SOUSY radar salvo (one rocket). In both salvos meteorological rockets, measuring temperature and winds, were also launched and the SOUSY radar, located near the launch site, measured mesospheric turbulence. Electron density irregularities and strong gradients were measured by the rocket probes in the region of most intense backscatter observed by the radar. The electron density profiles (8 to 4 on ascent and 4 on descent) show very different characteristics in the peak scattering region and show marked spatial and temporal variability. These data are intercompared and discussed.
Chiral vertex operators in off-conformal theory: Sine-Gordon example
International Nuclear Information System (INIS)
Chang, S.; Rajaraman, R.
1996-01-01
We study chiral vertex operators in sine-Gordon (SG) theory, viewed as an off-conformal system. We find that these operators, which would have been primary fields in the conformal limit, have interesting properties in the SG model. Some of them commute with the cosine interaction term in the Hamiltonian at a finite separation. Their Heisenberg equations of motion are local in space. An example of such vertex operators is Mandelstam close-quote s bosonic representation of the Fermi field. Another example is a set of vertex operators of topological number 2. We show how to construct conserved nonlocal currents from these operators. In the presence of the nonconformal interactions, these nonlocal currents have unique Lorentz spins. copyright 1996 The American Physical Society
Directory of Open Access Journals (Sweden)
Natanael Antonio dos Santos
2006-01-01
Full Text Available The aim of this work was to investigate the contrast sensitivity function for sine-wave gratings in the range between 0.25-2 cpd in young and older adults (20-23, 30-39, 40-49, 50-59, 60-69 years old using low luminance. All subjects were free from identifiable ocular disease and had normal acuity. We measured the contrast thresholds for 30 participants (six volunteers in each age using the psychophysical forced-choice staircase method. In this method the volunteers had to choose the stimulus containing a test frequency at low contrast (e.g., a sine-wave grating, or another neutral stimulus at mean luminance (0.7 cd/m2. The results showed significant changes of CSF for sine-wave gratings at 1 and 2 cpd for the adults 50-59 and 60-69 years old compared to the adults of 20-23 years old. These results suggest age-related changes in the CSF for sine-wave grating at low luminance levels.
Géochimie des résines et asphaltènes Geochernistry of Resins and Asphaltenes
Directory of Open Access Journals (Sweden)
Tissot B.
2006-11-01
Full Text Available Les produits lourds des huiles brutes (résines et asphaltènes jouent un rôle important dans la genèse et l'accumulation du pétrole, ainsi que dans la mise en production par des méthodes conventionnelles ou par récupération assistée. Les asphaltènes et résines sont considérés ici comme des fragments de kérogène, avec une structure d'ensemble comparable : ils peuvent constituer des intermédiaires dans la genèse de l'huile brute par dégradation thermique du kérogène. De plus, la pyrolyse des asphaltènes séparés à partir d'un pétrole biodégradé peut produire de nouveaux hydrocarbures saturés qui reproduisent la fraction saturée primitive, détruite par la dégradation ; on peut ainsi disposer d'un nouvel outil pour corréler ce type d'huiles brutes. Les produits lourds semblent défavorisés par rapport aux hydrocarbures, dans la migration de la roche-mère vers le réservoir, où les résines et asphaltènes sont proportionnellement moins abondants. La structure physique des asphaltènes et résines dans les pétroles, et en particulier l'existence d'une macrostructure du type micelles ou agrégats, est probablement responsable de la viscosité élevée des huiles lourdes. Une meilleure connaissance de cette macrostructure pourrait suggérer de nouvelles méthodes pour diminuer la viscosité et améliorer la récupération des huiles lourdes. The heavy constituents of crude oil (resins and asphaltenes play an important role in generation and accumulation of petroleum, and also in production by conventional and enhanced oil recovery processes. Asphaltenes and resins are considered here as small fragments of kerogen, with a comparable overall structure: they may act as intermediate compounds in oil generation by thermal breakdown of kerogen. Furthermore, pyrolysis of asphaltenes separated from a degraded crude oil is able to generate a new saturated hydrocarbon fraction which duplicates the original one, now degraded
Longshore sediment transport in the Tróia-Sines Littoral Ribbon (SW Portugal).
Gama, Cristina; Taborda, Rui; Andrade, César
2006-01-01
Longshore sediment transport in the Tróia-Sines litoral ribbon was evaluated by map comparison and applying energy flux method using numerical models. Results yielded a longshore transport residual rate in the order of 10 5 m3y-1 towards north. The comparison of the results with the ones obtained thought the analysis of the secular coastline evolution show that the empirical coefficient between the energy flux and the longshore drift is equal to 0.28 and is apparently independent with grain ...
International Nuclear Information System (INIS)
Ibrahim, R. S.; El-Kalaawy, O. H.
2006-01-01
The relativistic nonlinear self-consistent equations for a collisionless cold plasma with stationary ions [R. S. Ibrahim, IMA J. Appl. Math. 68, 523 (2003)] are extended to 3 and 3+1 dimensions. The resulting system of equations is reduced to the sine-Poisson equation. The truncated Painleve expansion and reduction of the partial differential equation to a quadrature problem (RQ method) are described and applied to obtain the traveling wave solutions of the sine-Poisson equation for stationary and nonstationary equations in 3 and 3+1 dimensions describing the charge-density equilibrium configuration model
Pol, F. van der; Sluyters-Rehbach, M.; Sluyters, J.H.
1975-01-01
A theoretical study is presented concerning the application of a high-frequency alternating current, amplitude modulated by a low-frequency sine wave, to a galvanic cell. Based on the correlation with the faradaic rectification technique, expressions are given for the low-frequency demodulation
The R and D of half-sine pulser for eddy-current septum magnet
International Nuclear Information System (INIS)
Fu Luxin; Han Qian; Kang Wen
2002-01-01
The SSRF requires high-amplitude half-sine pulse current (10kA) and relatively narrow pulse width (∼60μs) for its eddy-current septum magnets. Moreover the machine will need a very high level of performance from the pulsers, particularly in terms of pulse amplitude stability and regulating range. For the convenience of maintenance the pulsers will be installed in the power supply hall and cabled to their eddy-current septum magnets by RG220/U. The author presents the pulser design and R and D results
The R and D of half-sine pulser for eddy-current septum magnet
Fu Lu Xin; Kang Wen
2002-01-01
The SSRF requires high-amplitude half-sine pulse current (10kA) and relatively narrow pulse width (approx 60 mu s) for its eddy-current septum magnets. Moreover the machine will need a very high level of performance from the pulsers, particularly in terms of pulse amplitude stability and regulating range. For the convenience of maintenance the pulsers will be installed in the power supply hall and cabled to their eddy-current septum magnets by RG220/U. The author presents the pulser design and R and D results
SOLITONES KINK Y ANTIKENK EN LA ECUACIÓN DE SINE -GORDON
Directory of Open Access Journals (Sweden)
Francis Armando Segovia Chaves
2012-08-01
Full Text Available La ecuación de sine-Gordon es una ecuación diferencial no lineal, tiene grandes aplicaciones no solamente en la teoría de campos relativistas, sino también encuentra aplicación en la física del estado sólido y en el transporte de señales en la fibra óptica. En este trabajo se estudian dos soluciones que tiene esta ecuación diferencial como lo son las soluciones tipo solitón kink y soluciones tipo solitón antikink. Para obtener dichas soluciones se realiza el modelamiento matemático y se representa gráficamente su evolución espacio temporal.
The Sines industrial complex monitoring programme: A preliminary report.
Jones, M P; Catarino, F M; Sérgio, C; Bento-Pereira, F
1981-06-01
It is anticipated that the establishment of the industrial complex at Sines, Alentejo, Portugal, will have some impact on the environment. Details of the methods used in the monitoring programme are provided. Records of the epiphytic lichen vegetation in permanent quadrats have been made and changes shown in selected sites over a three year period are discussed. Material has been collected for analysis for heavy metals and the results discussed. There is considerable variation in replicates and in interspecies values. The problem of age and bio-accumulation is mentioned. Scanning electron microscopy has shown the accumulation of particulates, as yet unidentified, the quantity varying with increase in age and surface texture. A broadly based study of the local epiphytic flora is being carried out to record the present day diversity. There appears, as yet, to be no detectable influence of the industrial complex on the epiphytic flora of the permanent quadrats.
International Nuclear Information System (INIS)
Ko, T.H.
2006-01-01
In the present paper, the entropy generation and optimal Reynolds number for developing forced convection in a double sine duct with various wall heat fluxes, which frequently occurs in plate heat exchangers, are studied based on the entropy generation minimization principle by analytical thermodynamic analysis as well as numerical investigation. According to the thermodynamic analysis, a very simple expression for the optimal Reynolds number for the double sine duct as a function of mass flow rate, wall heat flux, working fluid and geometric dimensions is proposed. In the numerical simulations, the investigated Reynolds number (Re) covers the range from 86 to 2000 and the wall heat flux (q'') varies as 160, 320 and 640 W/m 2 . From the numerical simulation of the developing laminar forced convection in the double sine duct, the effect of Reynolds number on entropy generation in the duct has been examined, through which the optimal Reynolds number with minimal entropy generation is detected. The optimal Reynolds number obtained from the analytical thermodynamic analysis is compared with the one from the numerical solutions and is verified to have a similar magnitude of entropy generation as the minimal entropy generation predicted by the numerical simulations. The optimal analysis provided in the present paper gives worthy information for heat exchanger design, since the thermal system could have the least irreversibility and best exergy utilization if the optimal Re can be used according to practical design conditions
International Nuclear Information System (INIS)
Li Qi; Zhang Dajun; Chen Dengyuan
2010-01-01
N-soliton solutions of the hierarchy of non-isospectral mKdV equation with self-consistent sources and the hierarchy of non-isospectral sine-Gordon equation with self-consistent sources are obtained via the inverse scattering transform. (general)
Directory of Open Access Journals (Sweden)
Robert M. Yamaleev
2013-01-01
Full Text Available The hyperbolic cosines and sines theorems for the curvilinear triangle bounded by circular arcs of three intersecting circles are formulated and proved by using the general complex calculus. The method is based on a key formula establishing a relationship between exponential function and the cross-ratio. The proofs are carried out on Euclidean plane.
The nullum crimen sine iure principle in contemporary International Law
Directory of Open Access Journals (Sweden)
Hector Olásolo Alonso
2014-03-01
Full Text Available This paper deals with the evolution and current content of the nullum crimen sine iure principle in international law. It analyses the development of the nullum crimen principle from its definition as a principle of justice at the end of Second World War, to its current definition as an individual right imposing a limitation upon States’ sovereignty. The article also explains that, nowadays, the nullum cri- men principle requires for the relevant conduct to be a crime at the time of its com- mission, according to any of the sources of criminal law in the relevant national or international legal system. No written law is necessarily required. As a result, accessibility and foreseability are the main elements of the nullum crimen principle in current international law.
Ring-shaped quasi-soliton solutions to the two-and three-dimensional Sine-Gordon equation
International Nuclear Information System (INIS)
Christiansen, P.L.; Olsen, O.H.
1979-01-01
Ring-shaped solitary wave solutions to the Sine-Gordon equation in two and three spatial dimensions are investigated by numerical computation. Each expanding wave exhibits a return effect. The reflection of the shrinking wave at the singularity at the center of the wave is investigated in a particular case. Collision experiments in numero for expanding and shrinking concentric ring waves show that the solutions possess quasisoliton properties. A Baecklund transformation for the non-symmetric three-dimensional case is given. (Auth.)
Carpentier, David
1998-01-01
Using the renormalisation group (RG) we study two dimensional electromagnetic coulomb gas and extended Sine-Gordon theories invariant under the modular group SL(2,Z). The flow diagram is established from the scaling equations, and we derive the critical behaviour at the various transition points of the diagram. Following proposal for a SL(2,Z) duality between different quantum Hall fluids, we discuss the analogy between this flow and the global quantum Hall phase diagram.
Med sjefen på Facebook: En studie av ledere som er "venner" med sine ansatte
Jensen, Anita
2014-01-01
MR690 Masteroppgave i organisasjon og ledelse - utdanningsledelse Formålet med studien er å belyse hvordan aktiv bruk av sosiale medier, i dette tilfellet Facebook, påvirker relasjoner mellom mennesker. Hva skjer når en tar i bruk en websjanger som i utgangspunktet er umiddelbar og uformell, til jobbrelatert og mer formell kommunikasjon? Er det sjangeren eller relasjonen som endres? Søkelyset rettes mot ledere som er “venner” med sine medarbeidere, og problemstillingen er...
Nonlinear response to the multiple sine wave excitation of a softening--hardening system
International Nuclear Information System (INIS)
Koplik, B.; Subudhi, M.; Curreri, J.
1979-01-01
In studying the earthquake response of the HTGR core, it was observed that the system can display softening--hardening characteristics. This is of great consequence in evaluating the structural safety aspects of the core. In order to obtain a better understanding of the governing parameters, an investigation was undertaken with a single-degree-of-freedom system having a softening--hardening spring characteristic and excited by multiple sine waves. A parametric study varying the input amplitudes and the spring characteristic was performed. Transients were introduced into the system, and the jump phenomena between the lower softening characteristics to the higher hardening curve was studied
A note on a boundary sine-Gordon model at the free-Fermion point
Murgan, Rajan
2018-02-01
We investigate the free-Fermion point of a boundary sine-Gordon model with nondiagonal boundary interactions for the ground state using auxiliary functions obtained from T - Q equations of a corresponding inhomogeneous open spin-\\frac{1}{2} XXZ chain with nondiagonal boundary terms. In particular, we obtain the Casimir energy. Our result for the Casimir energy is shown to agree with the result from the TBA approach. The analytical result for the effective central charge in the ultraviolet (UV) limit is also verified from the plots of effective central charge for intermediate values of volume.
Energy Technology Data Exchange (ETDEWEB)
Misumi, Tatsuhiro [Department of Mathematical Science, Akita University,1-1 Tegata Gakuen-machi, Akita 010-8502 (Japan); Research and Education Center for Natural Sciences,Keio University, 4-1-1 Hiyoshi, Yokohama, Kanagawa 223-8521 (Japan); Nitta, Muneto; Sakai, Norisuke [Department of Physics, and Research and Education Center for Natural Sciences,Keio University, 4-1-1 Hiyoshi, Yokohama, Kanagawa 223-8521 (Japan)
2015-09-23
We compute multi-instanton amplitudes in the sine-Gordon quantum mechanics (periodic cosine potential) by integrating out quasi-moduli parameters corresponding to separations of instantons and anti-instantons. We propose an extension of Bogomolnyi-Zinn-Justin prescription for multi-instanton configurations and an appropriate subtraction scheme. We obtain the multi-instanton contributions to the energy eigenvalue of the lowest band at the zeroth order of the coupling constant. For the configurations with only instantons (anti-instantons), we obtain unambiguous results. For those with both instantons and anti-instantons, we obtain results with imaginary parts, which depend on the path of analytic continuation. We show that the imaginary parts of the multi-instanton amplitudes precisely cancel the imaginary parts of the Borel resummation of the perturbation series, and verify that our results completely agree with those based on the uniform-WKB calculations, thus confirming the resurgence structure: divergent perturbation series combined with the nonperturbative multi-instanton contributions conspire to give unambiguous results. We also study the neutral bion contributions in the ℂP{sup N−1} model on ℝ{sup 1}×S{sup 1} with a small circumference, taking account of the relative phase moduli between the fractional instanton and anti-instanton. We find that the sign of the interaction potential depends on the relative phase moduli, and that both the real and imaginary parts resulting from quasi-moduli integral of the neutral bion get quantitative corrections compared to the sine-Gordon quantum mechanics.
Asymptotics for the Fredholm Determinant of the Sine Kernel on a Union of Intervals
Widom, Harold
1994-01-01
In the bulk scaling limit of the Gaussian Unitary Ensemble of Hermitian matrices the probability that an interval of length $s$ contains no eigenvalues is the Fredholm determinant of the sine kernel $\\sin(x-y)\\over\\pi(x-y)$ over this interval. A formal asymptotic expansion for the determinant as $s$ tends to infinity was obtained by Dyson. In this paper we replace a single interval of length $s$ by $sJ$ where $J$ is a union of $m$ intervals and present a proof of the asymptotics up to second ...
International Nuclear Information System (INIS)
Fogel, M.B.; Trullinger, S.E.; Bishop, A.R.; Krumhansl, J.A.
1976-02-01
We show that classical Sine-Gordon solitons maintain their integrity to a high degree in the presence of external perturbations. Two examples, of particular importance in condensed matter, are described in detail: (i) a model impurity is found to bind low-velocity solitons but merely phase-shift those with high-velocities, (ii) external static driving terms with damping accelerate the soliton to a terminal velocity. The importance of a translation mode is emphasized and it is concluded that the soliton behaves as a classical particle in all essential respects
Zhang, Chi; Fang, Xin; Qiu, Haopu; Li, Ning
2015-01-01
Real-time PCR amplification of mitochondria gene could not be used for DNA quantification, and that of single copy DNA did not allow an ideal sensitivity. Moreover, cross-reactions among similar species were commonly observed in the published methods amplifying repetitive sequence, which hindered their further application. The purpose of this study was to establish a short interspersed nuclear element (SINE)-based real-time PCR approach having high specificity for species detection that could be used in DNA quantification. After massive screening of candidate Sus scrofa SINEs, one optimal combination of primers and probe was selected, which had no cross-reaction with other common meat species. LOD of the method was 44 fg DNA/reaction. Further, quantification tests showed this approach was practical in DNA estimation without tissue variance. Thus, this study provided a new tool for qualitative detection of porcine component, which could be promising in the QC of meat products.
Stored polarized beams: MILES, LIMES, SMILE, sine-Bessels and SODOM2 too
International Nuclear Information System (INIS)
Mane, S.R.
2008-01-01
The fundamental theory underlying several computational algorithms for the spin dynamics of stored polarized beams is analyzed. Particular attention is paid to the consequences of the use of finite-dimensional matrices and/or Fourier series. The single resonance model with a pair of diametrically opposed nonorthogonal pointlike Siberian Snakes is analyzed in detail to clarify several points pertaining to the above algorithms, and more generally to the spin dynamics of stored polarized beams in rings with Snakes. New analytical results are also presented, e.g. for the spin tune shift in the nonorthogonal Snakes model, and the sine-Bessel functions for the orthogonal Snakes model. Many results are derived using multiple algorithms, which serves as a check on their mutual consistency
Variabilidade espacial e temporal do recrutamento de Pollicipes pollicipes na região de Sines
Mateus, David José Rodrigues
2017-01-01
Pollicipes pollicipes é um crustáceo cirrípede que habita o intertidal rochoso em locais muito expostos à ondulação. O percebe é um recurso natural com valor económico e bastante explorado em Portugal. O recrutamento é um processo chave que afeta a dinâmica populacional desta espécie. O presente trabalho realizado na região de Sines, SW de Portugal, teve como objetivos principais estudar: a variação temporal e espacial do recrutamento do percebe num substrato artificial novo (“barticle”) e...
Obtaining changes in calibration-coil to seismometer output constants using sine waves
Ringler, Adam T.; Hutt, Charles R.; Gee, Lind S.; Sandoval, Leo D.; Wilson, David C.
2013-01-01
The midband sensitivity of a broadband seismometer is one of the most commonly used parameters from station metadata. Thus, it is critical for station operators to robustly estimate this quantity with a high degree of accuracy. We develop an in situ method for estimating changes in sensitivity using sine‐wave calibrations, assuming the calibration coil and its drive are stable over time and temperature. This approach has been used in the past for passive instruments (e.g., geophones) but has not been applied, to our knowledge, to derive sensitivities of modern force‐feedback broadband seismometers. We are able to detect changes in sensitivity to well within 1%, and our method is capable of detecting these sensitivity changes using any frequency of sine calibration within the passband of the instrument.
Sine-squared shifted pulses for recoupling interactions in solid-state NMR
Jain, Mukul G.; Rajalakshmi, G.; Equbal, Asif; Mote, Kaustubh R.; Agarwal, Vipin; Madhu, P. K.
2017-06-01
Rotational-Echo DOuble-Resonance (REDOR) is a versatile experiment for measuring internuclear distance between two heteronuclear spins in solid-state NMR. At slow to intermediate magic-angle spinning (MAS) frequencies, the measurement of distances between strongly coupled spins is challenging due to rapid dephasing of magnetisation. This problem can be remedied by employing the pulse-shifted version of REDOR known as Shifted-REDOR (S-REDOR) that scales down the recoupled dipolar coupling. In this study, we propose a new variant of the REDOR sequence where the positions of the π pulses are determined by a sine-squared function. This new variant has scaling properties similar to S-REDOR. We use theory, numerical simulations, and experiments to compare the dipolar recoupling efficiencies and the experimental robustness of the three REDOR schemes. The proposed variant has advantages in terms of radiofrequency field requirements at fast MAS frequencies.
Parálisis Parcial del Nervio Oculomotor Secundaria a Zoster Sine Herpete: Reporte de Un Caso
Directory of Open Access Journals (Sweden)
Oscar L. Rueda O.
2013-12-01
Full Text Available Introducción: Herpes Zoster es la reactivación del Virus Varicela Zóster en los ganglios sensoriales y/o autonómicos, típicamente caracterizado por dolor profundo de distribución dermatómica y erupciones vesiculares en piel. De manera infrecuente, puede presentarse el Zoster Sine Herpete, condición en la cual se presenta la distribución dermatómica del dolor en ausencia de lesiones dérmicas, convirtiendo el diagnóstico en un reto clínico. Caso clínico: Hombre de 69 años con dolor periorbitario, epifora, ptosis y pérdida de la aducción del ojo derecho. Los estudios imagenológicos y de laboratorio fueron normales, descartando así las principales causas de parálisis del nervio oculomotor. Se hizo diagnóstico presuntivo de Zoster Sine Herpete y se inició prueba terapéutica con valaciclovir, observándose resolución total de la sintomatología seis semanas después. Discusión: Este caso puede ser el primero en describir una parálisis parcial dolorosa del nervio oculomotor como única manifestación clínica de la reactivación del Virus Varicela Zóster y busca alertar al personal médico sobre una enfermedad latente que hace de sus reapariciones una gama de presentaciones no siempre fáciles de identificar.
International Nuclear Information System (INIS)
Poghossian, R.H.
2000-01-01
In an angular quantization approach a perturbation theory for the Massive Thirring Model (MTM) is developed, which allows us to calculate vacuum expectation values of exponential fields in sine-Gordon theory near the free fermion point in first order of the MTM coupling constant g. The Hankel transforms play an important role when carrying out these calculations. The expression we have found coincides with that of the direct expansion over g of the exact formula conjectured by Lukyanov and Zamolodchikov
Keihani, Ahmadreza; Shirzhiyan, Zahra; Farahi, Morteza; Shamsi, Elham; Mahnam, Amin; Makkiabadi, Bahador; Haidari, Mohsen R; Jafari, Amir H
2018-01-01
Background: Recent EEG-SSVEP signal based BCI studies have used high frequency square pulse visual stimuli to reduce subjective fatigue. However, the effect of total harmonic distortion (THD) has not been considered. Compared to CRT and LCD monitors, LED screen displays high-frequency wave with better refresh rate. In this study, we present high frequency sine wave simple and rhythmic patterns with low THD rate by LED to analyze SSVEP responses and evaluate subjective fatigue in normal subjects. Materials and Methods: We used patterns of 3-sequence high-frequency sine waves (25, 30, and 35 Hz) to design our visual stimuli. Nine stimuli patterns, 3 simple (repetition of each of above 3 frequencies e.g., P25-25-25) and 6 rhythmic (all of the frequencies in 6 different sequences e.g., P25-30-35) were chosen. A hardware setup with low THD rate ( 90% for CCA and LASSO (for TWs > 1 s). High frequency rhythmic patterns group with low THD rate showed higher accuracy rate (99.24%) than simple patterns group (98.48%). Repeated measure ANOVA showed significant difference between rhythmic pattern features ( P rhythmic [3.85 ± 2.13] compared to the simple patterns group [3.96 ± 2.21], ( P = 0.63). Rhythmic group had lower within group VAS variation (min = P25-30-35 [2.90 ± 2.45], max = P35-25-30 [4.81 ± 2.65]) as well as least individual pattern VAS (P25-30-35). Discussion and Conclusion: Overall, rhythmic and simple pattern groups had higher and similar accuracy rates. Rhythmic stimuli patterns showed insignificantly lower fatigue rate than simple patterns. We conclude that both rhythmic and simple visual high frequency sine wave stimuli require further research for human subject SSVEP-BCI studies.
Geborgenheid as ’n sine qua non vir opvoedende onderwys
Directory of Open Access Journals (Sweden)
I.J. Oosthuizen
2001-08-01
Full Text Available Security as a sine qua non for education Learner security is an imperative for education. Whereas an environment of security is conducive to learning, the absence of it is destructive of effective learning. Some of the factors that are to be taken into account in order to create a sound environment of security for the learner are the following: • the physical well-being of the learner; • the mental well-being of the learner liberated from anxiety and fear and • the competence and proficiency of the teacher. In many respects contemporary South African education is characterised by an absence of security and surity. Some of the reasons for this situation are instances of physical and mental insecurity such as a prevailing culture of physical violence, drug abuse and an alarming rise of contagious diseases in schools. This article focuses on these and other factors responsible for instances of an insecure learning environment in South African education. This article also seeks to find possible solutions towards securing the learning environment of the learner.
An enhanced sine dwell method as applied to the Galileo core structure modal survey
Smith, Kenneth S.; Trubert, Marc
1990-01-01
An incremental modal survey performed in 1988 on the core structure of the Galileo spacecraft with its adapters with the purpose of assessing the dynamics of the new portions of the structure is considered. Emphasis is placed on the enhancements of the sine dwell method employed in the test. For each mode, response data is acquired at 32 frequencies in a narrow band enclosing the resonance, utilizing the SWIFT technique. It is pointed out that due to the simplicity of the data processing involved, the diagnostic and modal-parameter data is available within several minutes after data acquisition; however, compared with straight curve-fitting approaches, the method requires more time for data acquisition.
Jiang, Wen-Hao; Liu, Jian-Hong; Liu, Yin; Jin, Ge; Zhang, Jun; Pan, Jian-Wei
2017-12-01
InGaAs/InP single-photon detectors (SPDs) are the key devices for applications requiring near-infrared single-photon detection. Gating mode is an effective approach to synchronous single-photon detection. Increasing gating frequency and reducing module size are important challenges for the design of such detector system. Here we present for the first time an InGaAs/InP SPD with 1.25 GHz sine wave gating using a monolithically integrated readout circuit (MIRC). The MIRC has a size of 15 mm * 15 mm and implements the miniaturization of avalanche extraction for high-frequency sine wave gating. In the MIRC, low-pass filters and a low-noise radio frequency amplifier are integrated based on the technique of low temperature co-fired ceramic, which can effectively reduce the parasitic capacitance and extract weak avalanche signals. We then characterize the InGaAs/InP SPD to verify the functionality and reliability of MIRC, and the SPD exhibits excellent performance with 27.5 % photon detection efficiency, 1.2 kcps dark count rate, and 9.1 % afterpulse probability at 223 K and 100 ns hold-off time. With this MIRC, one can further design miniaturized high-frequency SPD modules that are highly required for practical applications.
Swept-sine noise-induced damage as a hearing loss model for preclinical assays
Directory of Open Access Journals (Sweden)
Lorena eSanz
2015-02-01
Full Text Available Mouse models are key tools for studying cochlear alterations in noise-induced hearing loss and for evaluating new therapies. Stimuli used to induce deafness in mice are usually white and octave band noises that include very low frequencies, considering the large mouse auditory range. We designed different sound stimuli, enriched in frequencies up to 20 kHz (violet noises to examine their impact on hearing thresholds and cochlear cytoarchitecture after short exposure. In addition, we developed a cytocochleogram to quantitatively assess the ensuing structural degeneration and its functional correlation. Finally, we used this mouse model and cochleogram procedure to evaluate the potential therapeutic effect of transforming growth factor β1 inhibitors P17 and P144 on noise-induced hearing loss. CBA mice were exposed to violet swept-sine noise with different frequency ranges (2-20 or 9-13 kHz and levels (105 or 120 dB SPL for 30 minutes. Mice were evaluated by auditory brainstem response and otoacoustic emission tests prior to and 2, 14 and 28 days after noise exposure. Cochlear pathology was assessed with gross histology; hair cell number was estimated by a stereological counting method. Our results indicate that functional and morphological changes induced by violet swept-sine noise depend on the sound level and frequency composition. Partial hearing recovery followed the exposure to 105 dB SPL, whereas permanent cochlear damage resulted from the exposure to 120 dB SPL. Exposure to 9-13 kHz noise caused an auditory threshold shift in those frequencies that correlated with hair cell loss in the corresponding areas of the cochlea that were spotted on the cytocochleogram. In summary, we present mouse models of noise-induced hearing loss, which depending on the sound properties of the noise, cause different degrees of cochlear damage, and could therefore be used to study molecules which are potential players in hearing loss protection and repair.
Digging into the Elusive Localised Solutions of (2+1) Dimensional sine-Gordon Equation
Radha, R.; Senthil Kumar, C.
2018-05-01
In this paper, we revisit the (2+1) dimensional sine-Gordon equation analysed earlier [R. Radha and M. Lakshmanan, J. Phys. A Math. Gen. 29, 1551 (1996)] employing the Truncated Painlevé Approach. We then generate the solutions in terms of lower dimensional arbitrary functions of space and time. By suitably harnessing the arbitrary functions present in the closed form of the solution, we have constructed dromion solutions and studied their collisional dynamics. We have also constructed dromion pairs and shown that the dynamics of the dromion pairs can be turned ON or OFF desirably. In addition, we have also shown that the orientation of the dromion pairs can be changed. Apart from the above classes of solutions, we have also generated compactons, rogue waves and lumps and studied their dynamics.
International Nuclear Information System (INIS)
Watanabe, S.; Strogatz, S.H.; van der Zant, H.S.J.; Orlando, T.P.
1995-01-01
We analyze the damped driven discrete sine-Gordon equation. For underdamped, highly discrete systems, we show that whirling periodic solutions undergo parametric instabilities at certain drive strengths. The theory predicts novel resonant steps in the current-voltage characteristics of discrete Josephson rings, occurring in the return path of the subgap region. We have observed these steps experimentally in a ring of 8 underdamped junctions. An unusual prediction, verified experimentally, is that such steps occur even if there are no vortices in the ring. Numerical simulations indicate that complex spatiotemporal behavior occurs past the onset of instability
Influence of solitons in the initial state on chaos in the driven damped sine-Gordon system
Energy Technology Data Exchange (ETDEWEB)
Bishop, A R; Fesser, K; Lomdahl, P S; Trullinger, S E
1983-01-01
The appearance of chaos in the a.c. driven, damped sine-Gordon equation is studied numerically. Several transitions from periodic to chaotic behavior are investigated in detail for flat initial conditions. Spatial structures (breather, kink) in the initial conditions smooth out many of these transitions and give rise to an interesting symbiosis of time and spatial intermittency. This symbiosis appears to be due to the competition between the background tendency towards chaos and the system's preference to maintain a spatial pattern. The way that this competition is relieved is also found to depend very strongly on symmetry in the initial conditions.
DEFF Research Database (Denmark)
Jung, Nikolai H; Delvendahl, Igor; Pechmann, Astrid
2012-01-01
Transcranial magnetic stimulation (TMS) commonly uses so-called monophasic pulses where the initial rapidly changing current flow is followed by a critically dampened return current. It has been shown that a monophasic TMS pulse preferentially excites different cortical circuits in the human motor...... hand area (M1-HAND), if the induced tissue current has a posterior-to-anterior (PA) or anterior-to-posterior (AP) direction. Here we tested whether similar direction-specific effects could be elicited in M1-HAND using TMS pulses with a half-sine wave configuration....
Critical behavior and duality in extended Sine-Gordon theories
International Nuclear Information System (INIS)
Boyanovsky, D.; Holman, R.
1991-01-01
We study the critical properties of vectorial sine-Gordon theories based on the root system of simply-laced Lie algebras. We introduce the dual operators and study the renormalization aspects of these theories. These models are identified with vectorial Coulomb gas models of electric and magnetic charges and generalized Toda field theories. We prove that these theories are consistently renormalizable for simply-laced Lie algebras, but non-renormalizable in general in the non-simply-laced case. These models provide a description for the statistical mechanics of melting in the SU(3) case. They also provide a simplified model for strings compactified on root lattices. We compute the RG beta functions to quadratic order for general simply-laced algebras and find that in general there is a Weyl singlet, self-dual fixed point. This fixed point describes a critical theory with condensates of electric and magnetic charges corresponding to tachyonic and winding modes in string language. The different phases are related by Weyl and duality symmetry. The phase structure is conjectured in the general case, and analyzed in detail for SU(3) and SO(6). We compute Zamolodchikov's c-function to cubic order in the couplings in the general case and the conformal anomaly at the self-dual fixed point for SU(N). (orig.)
Emotional intelligence: the Sine Qua Non for a clinical leadership toolbox.
Rao, Paul R
2006-01-01
Over the past decade, it has become increasingly clear that although IQ and technical skills are important, emotional intelligence is the Sine Qua Non of leadership. According to Goleman [Goleman, D. (1998). What makes a leader? Harvard Business Review, 93-102] "effective leaders are alike in one crucial way: they all have a high degree of emotional intelligence...and can also be linked to strong performance." The original five dimensions of EIQ are described and applied to both supervisory and clinical scenarios. As a result of reading this work, you will be able to: (1) define and provide an illustration of each of the five components of emotional intelligence (EIQ); (2) outline the relationship of EIQ to success in your profession and your personal life; (3) create a strategic action plan to enhance each dimension of EIQ in your daily life; (4) list at least three real-life experiences that could have resulted a favorable outcome with an improved EIQ; (5) complete a self-evaluation of your EIQ.
Bethe ansatz approach to quantum sine Gordon thermodynamics and finite temperature excitations
International Nuclear Information System (INIS)
Zotos, X.
1982-01-01
Takahashi and Suzuki (TS) using the Bethe ansatz method developed a formalism for the thermodynamics of the XYZ spin chain. Translating their formalism to the quantum sine-Gordon system, the thermodynamics and finite temperature elementary excitations are analyzed. Criteria imposed by TS on the allowed states simply correspond to the condition of normalizability of the wave functions. A set of coupled nonlinear integral equations for the thermodynamic equilibrium densities for particular values of the coupling constant in the attractive regime is derived. Solving numerically these Bethe ansatz equations, curves of the specific heat as a function of temperature are obtained. The soliton contribution peaks at a temperature of about 0.4 soliton masses shifting downward as the classical limit is approached. The weak coupling regime is analyzed by deriving the Bethe ansatz equations including the charged vacuum excitations. It is shown that they are necessary for a consistent presentation of the thermodynamics
Collective coordinates theory for discrete soliton ratchets in the sine-Gordon model
Sánchez-Rey, Bernardo; Quintero, Niurka R.; Cuevas-Maraver, Jesús; Alejo, Miguel A.
2014-10-01
A collective coordinate theory is developed for soliton ratchets in the damped discrete sine-Gordon model driven by a biharmonic force. An ansatz with two collective coordinates, namely the center and the width of the soliton, is assumed as an approximated solution of the discrete nonlinear equation. The dynamical equations of these two collective coordinates, obtained by means of the generalized travelling wave method, explain the mechanism underlying the soliton ratchet and capture qualitatively all the main features of this phenomenon. The numerical simulation of these equations accounts for the existence of a nonzero depinning threshold, the nonsinusoidal behavior of the average velocity as a function of the relative phase between the harmonics of the driver, the nonmonotonic dependence of the average velocity on the damping, and the existence of nontransporting regimes beyond the depinning threshold. In particular, it provides a good description of the intriguing and complex pattern of subspaces corresponding to different dynamical regimes in parameter space.
Yaşar, Elif; Yıldırım, Yakup; Yaşar, Emrullah
2018-06-01
This paper devotes to conformable fractional space-time perturbed Gerdjikov-Ivanov (GI) equation which appears in nonlinear fiber optics and photonic crystal fibers (PCF). We consider the model with full nonlinearity in order to give a generalized flavor. The sine-Gordon equation approach is carried out to model equation for retrieving the dark, bright, dark-bright, singular and combined singular optical solitons. The constraint conditions are also reported for guaranteeing the existence of these solitons. We also present some graphical simulations of the solutions for better understanding the physical phenomena of the behind the considered model.
Hatta, M; Hayasaka, S; Kato, T; Kadoi, C
2000-01-01
A 14-year-old girl complained of a sudden decrease in right visual acuity. The patient had night blindness, a mottled retina but no pigments, extinguished scotopic electroretinographic response, central scotoma in the right eye and rhegmatogenous retinal detachment. She had initially received laser photocoagulation around the retinal tear and then corticosteroid therapy, cryoretinopexy and segmental buckling. Her right visual acuity increased to 1.0. The association of retinitis pigmentosa sine pigmento, retrobulbar optic neuritis and rhegmatogenous retinal detachment, as demonstrated in our patient, may be uncommon. Copyright 2000 S. Karger AG, Basel
Directory of Open Access Journals (Sweden)
Michaela Wiedmer
2016-02-01
Full Text Available We observed a hereditary phenotype in Alaskan Huskies that was characterized by polyneuropathy with ocular abnormalities and neuronal vacuolation (POANV. The affected dogs developed a progressive severe ataxia, which led to euthanasia between 8 and 16 months of age. The pedigrees were consistent with a monogenic autosomal recessive inheritance. We localized the causative genetic defect to a 4 Mb interval on chromosome 19 by a combined linkage and homozygosity mapping approach. Whole genome sequencing of one affected dog, an obligate carrier, and an unrelated control revealed a 218-bp SINE insertion into exon 7 of the RAB3GAP1 gene. The SINE insertion was perfectly associated with the disease phenotype in a cohort of 43 Alaskan Huskies, and it was absent from 541 control dogs of diverse other breeds. The SINE insertion induced aberrant splicing and led to a transcript with a greatly altered exon 7. RAB3GAP1 loss-of-function variants in humans cause Warburg Micro Syndrome 1 (WARBM1, which is characterized by additional developmental defects compared to canine POANV, whereas Rab3gap1-deficient mice have a much milder phenotype than either humans or dogs. Thus, the RAB3GAP1 mutant Alaskan Huskies provide an interesting intermediate phenotype that may help to better understand the function of RAB3GAP1 in development. Furthermore, the identification of the presumed causative genetic variant will enable genetic testing to avoid the nonintentional breeding of affected dogs.
International Nuclear Information System (INIS)
Boyd, John P.; Rangan, C.; Bucksbaum, P.H.
2003-01-01
The Fourier-sine-with-mapping pseudospectral algorithm of Fattal et al. [Phys. Rev. E 53 (1996) 1217] has been applied in several quantum physics problems. Here, we compare it with pseudospectral methods using Laguerre functions and rational Chebyshev functions. We show that Laguerre and Chebyshev expansions are better suited for solving problems in the interval r in R set of [0,∞] (for example, the Coulomb-Schroedinger equation), than the Fourier-sine-mapping scheme. All three methods give similar accuracy for the hydrogen atom when the scaling parameter L is optimum, but the Laguerre and Chebyshev methods are less sensitive to variations in L. We introduce a new variant of rational Chebyshev functions which has a more uniform spacing of grid points for large r, and gives somewhat better results than the rational Chebyshev functions of Boyd [J. Comp. Phys. 70 (1987) 63
Energy Technology Data Exchange (ETDEWEB)
Cryns, Jackson W.; Hatchell, Brian K.; Santiago-Rojas, Emiliano; Silvers, Kurt L.
2013-07-01
Formal journal article Experimental analysis of a piezoelectric energy harvesting system for harmonic, random, and sine on random vibration Abstract: Harvesting power with a piezoelectric vibration powered generator using a full-wave rectifier conditioning circuit is experimentally compared for varying sinusoidal, random and sine on random (SOR) input vibration scenarios. Additionally, the implications of source vibration characteristics on harvester design are discussed. Studies in vibration harvesting have yielded numerous alternatives for harvesting electrical energy from vibrations but piezoceramics arose as the most compact, energy dense means of energy transduction. The rise in popularity of harvesting energy from ambient vibrations has made piezoelectric generators commercially available. Much of the available literature focuses on maximizing harvested power through nonlinear processing circuits that require accurate knowledge of generator internal mechanical and electrical characteristics and idealization of the input vibration source, which cannot be assumed in general application. In this manuscript, variations in source vibration and load resistance are explored for a commercially available piezoelectric generator. We characterize the source vibration by its acceleration response for repeatability and transcription to general application. The results agree with numerical and theoretical predictions for in previous literature that load optimal resistance varies with transducer natural frequency and source type, and the findings demonstrate that significant gains are seen with lower tuned transducer natural frequencies for similar source amplitudes. Going beyond idealized steady state sinusoidal and simplified random vibration input, SOR testing allows for more accurate representation of real world ambient vibration. It is shown that characteristic interactions from more complex vibrational sources significantly alter power generation and power processing
Designing a Sine-Coil for Measurement of Plasma Displacements in IR-T1 Tokamak
International Nuclear Information System (INIS)
Khorshid, Pejman; Razavi, M.; Molaii, M.; Ghoranneviss, M.; TalebiTaher, A.; Arvin, R.; Mohammadi, S.; NikMohammadi, A.
2008-01-01
A method for the measurement of the plasma position in the IR-T1 tokamak in toroidal coordinates is developed. A sine-coil, which is a Rogowski coil with a variable wiring density is designed and fabricated for this purpose. An analytic solution of the Biot-Savart law, which is used to calculate magnetic fields created by toroidal plasma current, is presented. Results of calculations are compared with the experimental data obtained in no-plasma shots with a toroidal current-carrying coil positioned inside the vessel to simulate the plasma movements. The results are shown a good linear behavior of plasma position measurements. The error is less than 2.5% and it is compared with other methods of measurements of the plasma position. This method will be used in the feedback position control system and tests of feedback controller parameters are ongoing
Transcriptional activity of transposable elements in coelacanth.
Forconi, Mariko; Chalopin, Domitille; Barucca, Marco; Biscotti, Maria Assunta; De Moro, Gianluca; Galiana, Delphine; Gerdol, Marco; Pallavicini, Alberto; Canapa, Adriana; Olmo, Ettore; Volff, Jean-Nicolas
2014-09-01
The morphological stasis of coelacanths has long suggested a slow evolutionary rate. General genomic stasis might also imply a decrease of transposable elements activity. To evaluate the potential activity of transposable elements (TEs) in "living fossil" species, transcriptomic data of Latimeria chalumnae and its Indonesian congener Latimeria menadoensis were compared through the RNA-sequencing mapping procedures in three different organs (liver, testis, and muscle). The analysis of coelacanth transcriptomes highlights a significant percentage of transcribed TEs in both species. Major contributors are LINE retrotransposons, especially from the CR1 family. Furthermore, some particular elements such as a LF-SINE and a LINE2 sequences seem to be more expressed than other elements. The amount of TEs expressed in testis suggests possible transposition burst in incoming generations. Moreover, significant amount of TEs in liver and muscle transcriptomes were also observed. Analyses of elements displaying marked organ-specific expression gave us the opportunity to highlight exaptation cases, that is, the recruitment of TEs as new cellular genes, but also to identify a new Latimeria-specific family of Short Interspersed Nuclear Elements called CoeG-SINEs. Overall, transcriptome results do not seem to be in line with a slow-evolving genome with poor TE activity. © 2013 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Yair Zarmi
Full Text Available The (1+1-dimensional Sine-Gordon equation passes integrability tests commonly applied to nonlinear evolution equations. Its kink solutions (one-dimensional fronts are obtained by a Hirota algorithm. In higher space-dimensions, the equation does not pass these tests. Although it has been derived over the years for quite a few physical systems that have nothing to do with Special Relativity, the Sine-Gordon equation emerges as a non-linear relativistic wave equation. This opens the way for exploiting the tools of the Theory of Special Relativity. Using no more than the relativistic kinematics of tachyonic momentum vectors, from which the solutions are constructed through the Hirota algorithm, the existence and classification of N-moving-front solutions of the (1+2- and (1+3-dimensional equations for all N ≥ 1 are presented. In (1+2 dimensions, each multi-front solution propagates rigidly at one velocity. The solutions are divided into two subsets: Solutions whose velocities are lower than a limiting speed, c = 1, or are greater than or equal to c. To connect with concepts of the Theory of Special Relativity, c will be called "the speed of light." In (1+3-dimensions, multi-front solutions are characterized by spatial structure and by velocity composition. The spatial structure is either planar (rotated (1+2-dimensional solutions, or genuinely three-dimensional--branes. Planar solutions, propagate rigidly at one velocity, which is lower than, equal to, or higher than c. Branes must contain clusters of fronts whose speed exceeds c = 1. Some branes are "hybrids": different clusters of fronts propagate at different velocities. Some velocities may be lower than c but some must be equal to, or exceed, c. Finally, the speed of light cannot be approached from within the subset of slower-than-light solutions in both (1+2 and (1+3 dimensions.
Directory of Open Access Journals (Sweden)
Viholainen Ari
2006-01-01
Full Text Available The recently introduced exponentially modulated filter bank (EMFB is a -channel uniform, orthogonal, critically sampled, and frequency-selective complex modulated filter bank that satisfies the perfect reconstruction (PR property if the prototype filter of an -channel PR cosine modulated filter bank (CMFB is used. The purpose of this paper is to present various implementation structures for the EMFBs in a unified framework. The key idea is to use cosine and sine modulated filter banks as building blocks and, therefore, polyphase, lattice, and extended lapped transform (ELT type of implementation solutions are studied. The ELT-based EMFBs are observed to be very competitive with the existing modified discrete Fourier transform filter banks (MDFT-FBs when comparing the number of multiplications/additions and the structural simplicity. In addition, EMFB provides an alternative channel stacking arrangement that could be more natural in certain subband processing applications and data transmission systems.
International Nuclear Information System (INIS)
Razavi, M.; Mollai, M.; Khorshid, P.; Nedzelskiy, I.; Ghoranneviss, M.
2010-01-01
The modified Rogowski sine-coil (MRSC) has been designed and implemented for the plasma column horizontal displacement measurements on small IR-T1 tokamak. MRSC operation has been examined on test assembly and tokamak. Obtained results show high sensitivity to the plasma column horizontal displacement and negligible sensitivity to the vertical displacement; linearity in wide, ±0.1 m, range of the displacements; and excellent, 1.5%, agreement with the results of numerical solution of Biot-Savart and magnetic flux equations.
The sine-Gordon model and the small κ+ region of light- cone perturbation theory
International Nuclear Information System (INIS)
Griffin, P.A.
1992-01-01
The non-perturbative ultraviolet divergence of the sine-Gordon model is used to study the k + = 0 region of light-cone perturbation theory. The light-cone vacuum is shown to be unstable at the non- perturbative β 2 = 8π critical point by a light-cone version of Coleman's variational method. Vacuum bubbles, which are k + = 0 diagram in light-cone field theory and are individually finite and non-vanishing for all β, conspire to generate ultraviolet divergences of the light-cone energy density. The k + = 0 region of momentum also contributed to connected Green's functions: the connected two point function will not diverge, as it should, at the critical point unless diagrams which contribute only at k + = 0 are properly included. This analysis shows in a simple way how the k + = 0 region cannot be ignored even for connected diagrams. This phenomenon is expected to occur in higher dimensional gauge theories starting at two loop order in light-cone perturbation theory
Directory of Open Access Journals (Sweden)
Ahmadreza Keihani
2018-05-01
Full Text Available Background: Recent EEG-SSVEP signal based BCI studies have used high frequency square pulse visual stimuli to reduce subjective fatigue. However, the effect of total harmonic distortion (THD has not been considered. Compared to CRT and LCD monitors, LED screen displays high-frequency wave with better refresh rate. In this study, we present high frequency sine wave simple and rhythmic patterns with low THD rate by LED to analyze SSVEP responses and evaluate subjective fatigue in normal subjects.Materials and Methods: We used patterns of 3-sequence high-frequency sine waves (25, 30, and 35 Hz to design our visual stimuli. Nine stimuli patterns, 3 simple (repetition of each of above 3 frequencies e.g., P25-25-25 and 6 rhythmic (all of the frequencies in 6 different sequences e.g., P25-30-35 were chosen. A hardware setup with low THD rate (<0.1% was designed to present these patterns on LED. Twenty two normal subjects (aged 23–30 (25 ± 2.1 yrs were enrolled. Visual analog scale (VAS was used for subjective fatigue evaluation after presentation of each stimulus pattern. PSD, CCA, and LASSO methods were employed to analyze SSVEP responses. The data including SSVEP features and fatigue rate for different visual stimuli patterns were statistically evaluated.Results: All 9 visual stimuli patterns elicited SSVEP responses. Overall, obtained accuracy rates were 88.35% for PSD and > 90% for CCA and LASSO (for TWs > 1 s. High frequency rhythmic patterns group with low THD rate showed higher accuracy rate (99.24% than simple patterns group (98.48%. Repeated measure ANOVA showed significant difference between rhythmic pattern features (P < 0.0005. Overall, there was no significant difference between the VAS of rhythmic [3.85 ± 2.13] compared to the simple patterns group [3.96 ± 2.21], (P = 0.63. Rhythmic group had lower within group VAS variation (min = P25-30-35 [2.90 ± 2.45], max = P35-25-30 [4.81 ± 2.65] as well as least individual pattern VAS (P25
Directory of Open Access Journals (Sweden)
John Karijolich
Full Text Available Short interspersed nuclear elements (SINEs are highly abundant, RNA polymerase III-transcribed noncoding retrotransposons that are silenced in somatic cells but activated during certain stresses including viral infection. How these induced SINE RNAs impact the host-pathogen interaction is unknown. Here we reveal that during murine gammaherpesvirus 68 (MHV68 infection, rapidly induced SINE RNAs activate the antiviral NF-κB signaling pathway through both mitochondrial antiviral-signaling protein (MAVS-dependent and independent mechanisms. However, SINE RNA-based signaling is hijacked by the virus to enhance viral gene expression and replication. B2 RNA expression stimulates IKKβ-dependent phosphorylation of the major viral lytic cycle transactivator protein RTA, thereby enhancing its activity and increasing progeny virion production. Collectively, these findings suggest that SINE RNAs participate in the innate pathogen response mechanism, but that herpesviruses have evolved to co-opt retrotransposon activation for viral benefit.
Experimental Results on the Level Crossing Intervals of the Phase of Sine Wave Plus Noise
Youssef, Neji; Munakata, Tsutomu; Mimaki, Tadashi
1993-03-01
Experimental study was made on the level crossing intervals of a phase process of a sine wave plus narrow-band Gaussian noise. Since successive level crossings of phase do not necessarily occur alternately in the upward and downward direction due to the phase jump beyond 2π, the usual definitions of the probability densities of the level crossing intervals for continuous random processes are not applicable in the case of the phase process. Therefore, the probability densities of level crossing intervals of phase process are newly defined. Measurements of these densities were performed for noise having lowpass spectra of Gaussian and 7th order Butterworth types. Results are given for various values of the signal-to-noise power ratio and of the crossing level, and compared with corresponding approximation developed under the assumption of quasi-independence. The validity of the assumption depends on the spectrum shape of the noise.
Directory of Open Access Journals (Sweden)
Natanael Antonio dos Santos
2006-01-01
Full Text Available O objetivo deste trabalho foi investigar a função de sensibilidade ao contraste (FSC de adultos e idosos (20-23, 30-39, 40-49, 50-59, 60-69 anos para grades senoidais de 0,25 a 2 cpg em luminância baixa. Todos os participantes apresentavam acuidade visual normal e se encontravam livres de doenças oculares identificáveis. Foram estimados limiares de contraste para 30 participantes (seis em cada faixa etária utilizando o método psicofísico da escolha forçada. Neste método, os participantes tinham que escolher um estímulo contendo uma freqüência de teste (grade senoidal em baixo contraste ou um estímulo neutro com luminância média de 0,7 cd/m². Os resultados mostraram que os grupos de 50-59 e 60-69 anos apresentaram prejuízos significativos na FSC nas freqüências espaciais de 1 e 2 cpg comparados ao grupo de 20-23 anos. Estes resultados sugerem alterações relacionadas à idade na FSC de freqüências espaciais em níveis baixos de luminância.The aim of this work was to investigate the contrast sensitivity function for sine-wave gratings in the range between 0.25-2 cpd in young and older adults (20-23, 30-39, 40-49, 50-59, 60-69 years old using low luminance. All subjects were free from identifiable ocular disease and had normal acuity. We measured the contrast thresholds for 30 participants (six volunteers in each age using the psychophysical forced-choice staircase method. In this method the volunteers had to choose the stimulus containing a test frequency at low contrast (e.g., a sine-wave grating, or another neutral stimulus at mean luminance (0.7 cd/m². The results showed significant changes of CSF for sine-wave gratings at 1 and 2 cpd for the adults 50-59 and 60-69 years old compared to the adults of 20-23 years old. These results suggest age-related changes in the CSF for sine-wave grating at low luminance levels.
Stirbys, Petras
2017-01-01
The Brugada syndrome (BrS) is associated with increased risk of ventricular arrhythmias and sudden cardiac death. It generates genetically mediated arrhythmias posing a true pathophysiological challenge. In search of the similarities between BrS and long QT syndrome some novel insights are suggested. In patients with BrS the duration of QT interval is usually normal. Some investigators have found prolonged QT interval in the syndrome's natural course or the duration of QT segment have been extended by provocative tests unmasking BrS. Thus, BrS might be characterized as "long QT sine long QT" syndrome. The existence of two functional types of myocites is suspected. Regarding structure and function the majority of ventricular myocardium is probably mostly healthy. The rest of myocardium (preferably the subepicardium of right ventricular outflow tract) due to its genotypic peculiarities demonstrates no negative influence on ventricular performance until early adulthood is reached and/or other unstable preconditions are fulfilled (nocturnal time, fever, specific drugs, etc.). Based on published findings of positive outcomes, following the epicardial ablation of the right ventricular outflow tract region, a new hypothetical concept suggesting the presence of specific, genetically affected "Brugada's myocells" is proposed. These cells as a suitable arrhythmogenic substrate reside intramurally within the subepicardial region of the outflow tract of right ventricle. In the daytime these cells likely are dormant but at rest their nocturnal proarrhythmic behavior is activated occasionally. Presumptions regarding the pathophysiology of BrS might be the focus of further discussion.
Nullum Crimen sine Lege in the International Criminal Court
Directory of Open Access Journals (Sweden)
Venus GHAREH BAGHI
2010-10-01
Full Text Available The Principles of legality in crimes and punishments refer to the fact that an act is not considered a crime and deserves no punishment, until the legislator determines and announces thecriminal title and its penalty. In Iranian legal system, before the Islamic Revolution and also after it, the Constitution and ordinary laws have explicitly emphasized the observance of the mentionedprinciple. When there is no text or in the case of the silence or lack of law, the criminal judge is bound to issue the verdict of innocence. According to the Rome statute the court shall exercisejurisdiction over the crime of aggressions once a provision is adopted. And, according to the article 121 and 123 defending the crime and setting out, the condition under which the Court shall exercise jurisdiction with respect to crimes such as provision shall be consisted of the head of the general principle the relevant provision of the charter of the United Nations. The principle of legality is set out in article 22 to 24 of the ICC statute. These norms are derived from the customary law and the national law. Article 15, International Covenant on Civil and Political rights, states that no one shall be found guilty of any criminal offence based on an act or omission which did not constitute a criminal offence under national or international laws at the time when it was committed. Yet, in the context of prosecuting mass atrocities, genocide, crimes against humanity, and war crimes, international criminal law appears to be resigned to such a principle, if not openly including it. fact, that it may be considered the poor cousin of nullum crimen sine lege (no crime without law which has attracted far greater consideration in scholarship and jurisprudence.
American Society for Testing and Materials. Philadelphia
2010-01-01
1.1 This practice describes a general procedure for using the process compensated resonance testing (PCRT) via swept sine input method to identify metallic and non-metallic parts’ resonant pattern differences that can be used to indentify parts with anomalies causing deficiencies in the expected performance of the part in service. This practice is intended for use with instruments capable of exciting, measuring, recording, and analyzing multiple whole body mechanical vibration resonant frequencies within parts exhibiting acoustical ringing in the audio, or ultrasonic, resonant frequency ranges, or both. PCRT is used in the presence of manufacturing process variance to distinguish acceptable parts from those containing significant anomalies in physical characteristics expected to significantly alter the performance. Such physical characteristics include, but are not limited to, cracks, voids, porosity, shrink, inclusions, discontinuities, grain and crystalline structure differences, density related anomalies...
Kevrekidis, Panayotis; Williams, Floyd
2014-01-01
The sine-Gordon model is a ubiquitous model of Mathematical Physics with a wide range of applications extending from coupled torsion pendula and Josephson junction arrays to gravitational and high-energy physics models. The purpose of this book is to present a summary of recent developments in this field, incorporating both introductory background material, but also with a strong view towards modern applications, recent experiments, developments regarding the existence, stability, dynamics and asymptotics of nonlinear waves that arise in the model. This book is of particular interest to a wide range of researchers in this field, but serves as an introductory text for young researchers and students interested in the topic. The book consists of well-selected thematic chapters on diverse mathematical and physical aspects of the equation carefully chosen and assigned.
Random demodulation for structural health monitoring excited by the five-cycle sine burst
Directory of Open Access Journals (Sweden)
Li Xing
2017-01-01
Full Text Available Nowadays, the Structural Health Monitoring (SHM has been paid more and more attention. The five-cycle sine burst is widely used as the exciting signal in SHM and the sensors’ responded signals are analyzed to research the damage. In the sensor network, there will be many sensors which mean many responded signals will be sampled, restored and sometimes transferred. In the traditional way which is known as Nyquist sampling theorem, the sampling rate must be more than twice the highest rate of the original signal. In this way, the amount of data will be huge. As the result, the costs will be very expensive and the equipment may be huge and heavy, which is especially unaccepted in the aircraft. It is necessary to do some research to compress the signal. The Compressing Sensing (CS theory provides new methods to compress the signals. The Random Demodulation (RD is a specific method which can accomplish the physical implementation of CS theory. In this paper, according to the structure of RD, we chose some chips to build a RD system. And we did some experiments to verify the method through the system. We chose the Orthogonal Matching Pursuit (OMP as the construct algorithm to recover the signal.
Asymptotics for the Fredholm determinant of the sine kernel on a union of intervals
Widom, Harold
1995-07-01
In the bulk scaling limit of the Gaussian Unitary Ensemble of hermitian matrices the probability that an interval of length s contains no eigenvalues is the Fredholm determinant of the sine kernel{sin (x - y)}/{π (x - y)} over this interval. A formal asymptotic expansion for the determinant as s tends to infinity was obtained by Dyson. In this paper we replace a single interval of length s by sJ, where J is a union of m intervals and present a proof of the asymptotics up to second order. The logarithmic derivative with respect to s of the determinant equals a constant (expressible in terms of hyperelliptic integrals) times s, plus a bounded oscillatory function of s (zero if m=1, periodic if m=2, and in general expressible in terms of the solution of a Jacobi inversion problem), plus o(1). Also determined are the asymptotics of the trace of the resolvent operator, which is the ratio in the same model of the probability that the set contains exactly one eigenvalue to the probability that it contains none. The proofs use ideas from orthogonal polynomial theory.
International Nuclear Information System (INIS)
Yamaguchi, Hiroshi; Zhang, Xin-Rong; Niu, Xiao-Dong
2010-01-01
The damping characteristics and flow behaviors of ER fluids inside a piston–cylinder viscous damper subjected to external electric fields are studied based on experiment, theoretical analysis and numerical simulation. The viscous damper is a closed system with an inner piston and an outer cylinder, which is designed and constructed in our laboratory. In the experiment, the test ER fluid is enclosed in the gap of a piston–cylinder system. To examine the damping characteristics of the test ER fluid, a piston sine vibration experiment is performed with accompanying theoretical analyses. In addition, in order to investigate the ER flow behaviors inside the damper, a numerical simulation is carried out. The present study discloses the damping characteristics and the fluid mechanism of the ER fluid in the piston–cylinder damper with an applied external electric field
International Nuclear Information System (INIS)
Nandori, I.; Jentschura, U.D.; Soff, G.; Sailer, K.
2004-01-01
Renormalization-group (RG) flow equations have been derived for the generalized sine-Gordon model (GSGM) and the Coulomb gas (CG) in d≥3 of dimensions by means of the Wegner-Houghton method, and by way of the real-space RG approach. The UV scaling laws determined by the leading-order terms of the flow equations are in qualitative agreement for all dimensions d≥3, independent of the dimensionality, and in sharp contrast to the special case d=2. For the 4-dimensional GSGM it is demonstrated explicitly (by numerical calculations) that the blocked potential tends to a constant effective potential in the infrared limit, satisfying the requirements of periodicity and convexity. The comparison of the RG flows for the three-dimensional GSGM, the CG, and the vortex-loop gas reveals a significant dependence on the renormalization schemes and the approximations used
Internal tide transformation across a continental slope off Cape Sines, Portugal
Small, Justin
2002-04-01
During the INTIFANTE 99 experiment in July 1999, observations were made of a prominent internal undular bore off Cape Sines, Portugal. The feature was always present and dominant in a collection of synthetic aperture radar (SAR) images of the area covering the period before, during and after the trial. During the trial, rapid dissemination of SAR data to the survey ship enabled assessment of the progression of the feature, and the consequent planning of a survey of the bore coincident with a new SAR image. Large amplitude internal waves of 50 m amplitude in 250 m water depth, and 40 m in 100 m depth, were observed. The images show that the position of the feature is linked to the phase of the tide, suggesting an internal tide origin. The individual packets of internal waves contain up to seven waves with wavelengths in the range of 500-1500 m, and successive packets are separated by internal tide distances of typically 16-20 km, suggesting phase speeds of 0.35-0.45 m s -1. The internal waves were coherent over crest lengths of between 15 and 70 km, the longer wavefronts being due to the merging of packets. This paper uses the SAR data to detail the transformation of the wave packet as it passes across the continental slope and approaches the coast. The generation sites for the feature are discussed and reasons for its unusually large amplitude are hypothesised. It is concluded that generation at critical slopes of the bathymetry and non-linear interactions are the likely explanations for the large amplitudes.
Directory of Open Access Journals (Sweden)
Mourier Tobias
2011-09-01
Full Text Available Abstract Background Piwi-associated RNAs (piRNAs bind transcripts from retrotransposable elements (RTE in mouse germline cells and seemingly act as guides for genomic methylation, thereby repressing the activity of RTEs. It is currently unknown if and how Piwi proteins distinguish RTE transcripts from other cellular RNAs. During germline development, the main target of piRNAs switch between different types of RTEs. Using the piRNA targeting of RTEs as an indicator of RTE activity, and considering the entire population of genomic RTE loci along with their age and location, this study aims at further elucidating the dynamics of RTE activity during mouse germline development. Results Due to the inherent sequence redundancy between RTE loci, assigning piRNA targeting to specific loci is problematic. This limits the analysis, although certain features of piRNA targeting of RTE loci are apparent. As expected, young RTEs display a much higher level of piRNA targeting than old RTEs. Further, irrespective of age, RTE loci near protein-coding coding genes are targeted to a greater extent than RTE loci far from genes. During development, a shift in piRNA targeting is observed, with a clear increase in the relative piRNA targeting of RTEs residing within boundaries of protein-coding gene transcripts. Conclusions Reanalyzing published piRNA sequences and taking into account the features of individual RTE loci provide novel insight into the activity of RTEs during development. The obtained results are consistent with some degree of proportionality between what transcripts become substrates for Piwi protein complexes and the level by which the transcripts are present in the cell. A transition from active transcription of RTEs to passive co-transcription of RTE sequences residing within protein-coding transcripts appears to take place in postnatal development. Hence, the previously reported increase in piRNA targeting of SINEs in postnatal testis development
Crunteanu, D. E.; Constantinescu, S. G.; Niculescu, M. L.
2013-10-01
The wind energy is deemed as one of the most durable energetic variants of the future because the wind resources are immense. Furthermore, one predicts that the small wind turbines will play a vital role in the urban environment. Unfortunately, the complexity and the price of pitch regulated small horizontal-axis wind turbines represent ones of the main obstacles to widespread the use in populated zones. In contrast to these wind turbines, the Darrieus wind turbines are simpler and their price is lower. Unfortunately, their blades run at high variations of angles of attack, in stall and post-stall regimes, which can induce significant vibrations, fatigue and even the wind turbine failure. For this reason, the present paper deals with a blade with sine variation of chord length along the height because it has better behavior in stall and post-stall regimes than the classic blade with constant chord length.
Accurate Frequency Estimation Based On Three-Parameter Sine-Fitting With Three FFT Samples
Directory of Open Access Journals (Sweden)
Liu Xin
2015-09-01
Full Text Available This paper presents a simple DFT-based golden section searching algorithm (DGSSA for the single tone frequency estimation. Because of truncation and discreteness in signal samples, Fast Fourier Transform (FFT and Discrete Fourier Transform (DFT are inevitable to cause the spectrum leakage and fence effect which lead to a low estimation accuracy. This method can improve the estimation accuracy under conditions of a low signal-to-noise ratio (SNR and a low resolution. This method firstly uses three FFT samples to determine the frequency searching scope, then – besides the frequency – the estimated values of amplitude, phase and dc component are obtained by minimizing the least square (LS fitting error of three-parameter sine fitting. By setting reasonable stop conditions or the number of iterations, the accurate frequency estimation can be realized. The accuracy of this method, when applied to observed single-tone sinusoid samples corrupted by white Gaussian noise, is investigated by different methods with respect to the unbiased Cramer-Rao Low Bound (CRLB. The simulation results show that the root mean square error (RMSE of the frequency estimation curve is consistent with the tendency of CRLB as SNR increases, even in the case of a small number of samples. The average RMSE of the frequency estimation is less than 1.5 times the CRLB with SNR = 20 dB and N = 512.
International Nuclear Information System (INIS)
Lashkevich, Michael; Pugai, Yaroslav
2013-01-01
We continue the study of form factors of descendant operators in the sinh- and sine-Gordon models in the framework of the algebraic construction proposed in [1]. We find the algebraic construction to be related to a particular limit of the tensor product of the deformed Virasoro algebra and a suitably chosen Heisenberg algebra. To analyze the space of local operators in the framework of the form factor formalism we introduce screening operators and construct singular and cosingular vectors in the Fock spaces related to the free field realization of the obtained algebra. We show that the singular vectors are expressed in terms of the degenerate Macdonald polynomials with rectangular partitions. We study the matrix elements that contain a singular vector in one chirality and a cosingular vector in the other chirality and find them to lead to the resonance identities already known in the conformal perturbation theory. Besides, we give a new derivation of the equation of motion in the sinh-Gordon theory, and a new representation for conserved currents
Light redirecting system using sine-wave based panels for dense urban areas
Mohamed, Mohamed W. N.; Mashaly, Islam A.; Mohamed, Osama N.; El-Henawy, Sally I.; Galal, Ola; Taha, Iman; Nassar, Khaled; Safwat, Amr M. E.
2014-09-01
Cities and towns around the world are becoming more condensed due to the shrinking amount of buildable areas, which significantly reduces the amount of light that occupants have access to. This lack of natural lighting results in health, safety and quality of life degradation. This paper presents a new technique of transmitting sunlight downward into narrow alleys and streets, by using a daylighting guiding acrylic panel that is capable of changing the direction and distribution of the incident light. The core of the proposed daylight guidance system is made up of light transmission panels with high quality. The corrugations have sine wave shaped cross-section so that the panel functions as an optical diffuser perpendicular to the direction of sunlight propagation. The day lighting system consists of the corrugated panels and a lattice frame, which supports the panel. The proposed system is to be mounted on the building roof facing the sun so as to redirect the incident sunlight downward into the narrow alleys or streets. Since building sizes and orientations are different the frame is arranged such that substantially deep light penetration and high luminance level can be achieved. Simulation results show that the proposed panel improves the illuminance values by more than 200% and 400% in autumn and winter, respectively, provides fan-out angle that exceeds 80° for certain solar altitudes and the transmitted power percentage varies from 40% to 90% as the solar altitude varies from 10° to 80°. Experimental results are in a good agreement with the simulations.
Measurement of instantaneous rotational speed using double-sine-varying-density fringe pattern
Zhong, Jianfeng; Zhong, Shuncong; Zhang, Qiukun; Peng, Zhike
2018-03-01
Fast and accurate rotational speed measurement is required both for condition monitoring and faults diagnose of rotating machineries. A vision- and fringe pattern-based rotational speed measurement system was proposed to measure the instantaneous rotational speed (IRS) with high accuracy and reliability. A special double-sine-varying-density fringe pattern (DSVD-FP) was designed and pasted around the shaft surface completely and worked as primary angular sensor. The rotational angle could be correctly obtained from the left and right fringe period densities (FPDs) of the DSVD-FP image sequence recorded by a high-speed camera. The instantaneous angular speed (IAS) between two adjacent frames could be calculated from the real-time rotational angle curves, thus, the IRS also could be obtained accurately and efficiently. Both the measurement principle and system design of the novel method have been presented. The influence factors on the sensing characteristics and measurement accuracy of the novel system, including the spectral centrobaric correction method (SCCM) on the FPD calculation, the noise sources introduce by the image sensor, the exposure time and the vibration of the shaft, were investigated through simulations and experiments. The sampling rate of the high speed camera could be up to 5000 Hz, thus, the measurement becomes very fast and the change in rotational speed was sensed within 0.2 ms. The experimental results for different IRS measurements and characterization of the response property of a servo motor demonstrated the high accuracy and fast measurement of the proposed technique, making it attractive for condition monitoring and faults diagnosis of rotating machineries.
Heun equation in a 5D sine-Gordon brane-world model with dilaton
International Nuclear Information System (INIS)
Cunha, M.S.; Christiansen, H.
2011-01-01
Full text: In a brane-world scenario we find the propagation modes of the gauge field in a five-dimensional space-time. We adopt warping factors of the Randall-Sundrum type which are appropriate to regularize the hierarchy problem without imposing finite compactified extra dimensions. The existence and localization of gauge particles in the ordinary four-dimensional world is studied in detail on a thick brane derived out from the equations of motion of an action with a sine-Gordon potential contribution. Maxwell zero modes together with torsion effective fields are then obtained in a gravity-dilaton background inspired in close string theories. The dilaton plays a crucial role in order that the gauge field gets localized in a conformally invariant context. Kaluza-Klein massive states are also computed and, depending on certain parameters like dilaton coupling constant and asymptotic curvature, we are able to do it fully analytically. In a general approach we find that the solutions are of the Heun type. In some specific cases we can show that the Heun general solutions can be transformed into hypergeometric functions. In others, confluent Heun solutions can be transformed into simpler functions like Mathieu functions. Exact mass spectra are found in several cases. In others, we performed numerical calculations that show a well behaved phenomenology as well. In all the cases, Kaluza-Klein modes are strongly suppressed on the brane in the effective four-dimensional theory. (author)
MLP based models to predict PM10, O3 concentrations, in Sines industrial area
Durao, R.; Pereira, M. J.
2012-04-01
Sines is an important Portuguese industrial area located southwest cost of Portugal with important nearby protected natural areas. The main economical activities are related with this industrial area, the deep-water port, petrochemical and thermo-electric industry. Nevertheless, tourism is also an important economic activity especially in summer time with potential to grow. The aim of this study is to develop prediction models of pollutant concentration categories (e.g. low concentration and high concentration) in order to provide early warnings to the competent authorities who are responsible for the air quality management. The knowledge in advanced of pollutant high concentrations occurrence will allow the implementation of mitigation actions and the release of precautionary alerts to population. The regional air quality monitoring network consists in three monitoring stations where a set of pollutants' concentrations are registered on a continuous basis. From this set stands out the tropospheric ozone (O3) and particulate matter (PM10) due to the high concentrations occurring in the region and their adverse effects on human health. Moreover, the major industrial plants of the region monitor SO2, NO2 and particles emitted flows at the principal chimneys (point sources), also on a continuous basis,. Therefore Artificial neuronal networks (ANN) were the applied methodology to predict next day pollutant concentrations; due to the ANNs structure they have the ability to capture the non-linear relationships between predictor variables. Hence the first step of this study was to apply multivariate exploratory techniques to select the best predictor variables. The classification trees methodology (CART) was revealed to be the most appropriate in this case.. Results shown that pollutants atmospheric concentrations are mainly dependent on industrial emissions and a complex combination of meteorological factors and the time of the year. In the second step, the Multi
Friedline, Terri; Masa, Rainier D; Chowa, Gina A N
2015-01-01
The natural log and categorical transformations commonly applied to wealth for meeting the statistical assumptions of research may not always be appropriate for adjusting for skewness given wealth's unique properties. Finding and applying appropriate transformations is becoming increasingly important as researchers consider wealth as a predictor of well-being. We present an alternative transformation-the inverse hyperbolic sine (IHS)-for simultaneously dealing with skewness and accounting for wealth's unique properties. Using the relationship between household wealth and youth's math achievement as an example, we apply the IHS transformation to wealth data from US and Ghanaian households. We also explore non-linearity and accumulation thresholds by combining IHS transformed wealth with splines. IHS transformed wealth relates to youth's math achievement similarly when compared to categorical and natural log transformations, indicating that it is a viable alternative to other transformations commonly used in research. Non-linear relationships and accumulation thresholds emerge that predict youth's math achievement when splines are incorporated. In US households, accumulating debt relates to decreases in math achievement whereas accumulating assets relates to increases in math achievement. In Ghanaian households, accumulating assets between the 25th and 50th percentiles relates to increases in youth's math achievement. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Baron, H.E.; Zakrzewski, W.J.
2016-01-01
We investigate the validity of collective coordinate approximations to the scattering of two solitons in several classes of (1+1) dimensional field theory models. We consider models which are deformations of the sine-Gordon (SG) or the nonlinear Schrödinger (NLS) model which posses soliton solutions (which are topological (SG) or non-topological (NLS)). Our deformations preserve their topology (SG), but change their integrability properties, either completely or partially (models become ‘quasi-integrable’). As the collective coordinate approximation does not allow for the radiation of energy out of a system we look, in some detail, at how the approximation fares in models which are ‘quasi-integrable’ and therefore have asymptotically conserved charges (i.e. charges Q(t) for which Q(t→−∞)=Q(t→∞)). We find that our collective coordinate approximation, based on geodesic motion etc, works amazingly well in all cases where it is expected to work. This is true for the physical properties of the solitons and even for their quasi-conserved (or not) charges. The only time the approximation is not very reliable (and even then the qualitative features are reasonable, but some details are not reproduced well) involves the processes when the solitons come very close together (within one width of each other) during their scattering.
Directory of Open Access Journals (Sweden)
Barbara Jusiak
2014-12-01
Full Text Available The eye of the fruit fly Drosophila melanogaster provides a highly tractable genetic model system for the study of animal development, and many genes that regulate Drosophila eye formation have homologs implicated in human development and disease. Among these is the homeobox gene sine oculis (so, which encodes a homeodomain transcription factor (TF that is both necessary for eye development and sufficient to reprogram a subset of cells outside the normal eye field toward an eye fate. We have performed a genome-wide analysis of So binding to DNA prepared from developing Drosophila eye tissue in order to identify candidate direct targets of So-mediated transcriptional regulation, as described in our recent article [20]. The data are available from NCBI Gene Expression Omnibus (GEO with the accession number GSE52943. Here we describe the methods, data analysis, and quality control of our So ChIP-seq dataset.
SINE DIE SUSPENSION OF LAW ENFORCEMENT - REASON FOR THE CESSATION OF ITS EXISTENCE?
Directory of Open Access Journals (Sweden)
Corina Arsenie-Scarlat
2016-11-01
Full Text Available The successive suspensions of aid payments from 2011 and to date, as provided by the framework Law 284/2010- Annex ,7 for uniform pay, amended, section 3, have caused serious damage to property observance, as guaranteed by Art. 1 of Protocol no. 1, additional to the European Convention on Human Rights. ”Invoking the country's economic and financial situation by the legislator, in order to restrict the exercise of a fundamental right springing from a law that is still in force, is not sufficient, but that restriction must meet all the requirements specified in Art. 53 of the Constituti on”. The rules that have the effect of "sine die" suspending the rights of former employees, now retired, restrict and limit forcedly their rights guaranteed by law and cannot be considered democratic measures, as long as successive suspensions can affect the very existence of the law. Research methods used: direct documenting through case studies from personal law practice and not only, as well as from primary and secondary bibliographic documentation. Results and implications of the study: the impact of these rules that defer the payment of aids to former employees is significant, in that they bring material losses, but also that it violates the constitutional principle of the rule of law. Sue petitions pending lawsuit in courts have been formulated, whereby admitting the application of these rights and compelling former employers to pay the ”aids” given by the law, and largely the courts upheld these claims.
Luchetti, Andrea; Mantovani, Barbara
2011-02-01
Short INterspersed Elements (SINEs) in invertebrates, and especially in animal inbred genomes such that of termites, are poorly known; in this paper we characterize three new SINE families (Talub, Taluc and Talud) through the analyses of 341 sequences, either isolated from the Reticulitermes lucifugus genome or drawn from EST Genbank collection. We further add new data to the only isopteran element known so far, Talua. These SINEs are tRNA-derived elements, with an average length ranging from 258 to 372 bp. The tails are made up by poly(A) or microsatellite motifs. Their copy number varies from 7.9 × 10(3) to 10(5) copies, well within the range observed for other metazoan genomes. Species distribution, age and target site duplication analysis indicate Talud as the oldest, possibly inactive SINE originated before the onset of Isoptera (~150 Myr ago). Taluc underwent to substantial sequence changes throughout the evolution of termites and data suggest it was silenced and then re-activated in the R. lucifugus lineage. Moreover, Taluc shares a conserved sequence block with other unrelated SINEs, as observed for some vertebrate and cephalopod elements. The study of genomic environment showed that insertions are mainly surrounded by microsatellites and other SINEs, indicating a biased accumulation within non-coding regions. The evolutionary dynamics of Talu~ elements is explained through selective mechanisms acting in an inbred genome; in this respect, the study of termites' SINEs activity may provide an interesting framework to address the (co)evolution of mobile elements and the host genome.
Conventional methanotrophs are responsible for atmospheric methane oxidation in paddy soils
Cai, Yuanfeng; Yan, Zheng; Bodelier, P.L.E.; Conrad, R.; Jia, Zhongjun
2016-01-01
Soils serve as the biological sink of the potent greenhouse gas methane with exceptionally low concentrations of ~1.84 p.p.m.v. in the atmosphere. The as-yet-uncultivated methane-consuming bacteria have long been proposed to be responsible for this ‘high-affinity’ methane oxidation (HAMO). Here we
Directory of Open Access Journals (Sweden)
Jackson W. Cryns
2013-01-01
Full Text Available Harvesting power with a piezoelectric vibration powered generator using a full-wave rectifier conditioning circuit is experimentally compared for varying sinusoidal, random, and sine on random (SOR input vibration scenarios; the implications of source vibration characteristics on harvester design are discussed. The rise in popularity of harvesting energy from ambient vibrations has made compact, energy dense piezoelectric generators commercially available. Much of the available literature focuses on maximizing harvested power through nonlinear processing circuits that require accurate knowledge of generator internal mechanical and electrical characteristics and idealization of the input vibration source, which cannot be assumed in general application. Variations in source vibration and load resistance are explored for a commercially available piezoelectric generator. The results agree with numerical and theoretical predictions in the previous literature for optimal power harvesting in sinusoidal and flat broadband vibration scenarios. Going beyond idealized steady-state sinusoidal and flat random vibration input, experimental SOR testing allows for more accurate representation of real world ambient vibration. It is shown that characteristic interactions from more complex vibration sources significantly alter power generation and processing requirements by varying harvested power, shifting optimal conditioning impedance, inducing voltage fluctuations, and ultimately rendering idealized sinusoidal and random analyses incorrect.
Estrogen-dependent expression of sine oculis homeobox 1 in the mouse uterus during the estrous cycle
Energy Technology Data Exchange (ETDEWEB)
Bae, Sijeong [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Kwon, Hwang [Fertility Center of CHA Bundang Medical Center, Seongnam-si, Gyeonggi-do 13496 (Korea, Republic of); Yoon, Hyemin [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Park, Miseon [Fertility Center of CHA Gangnam Medical Center, Seoul 06135 (Korea, Republic of); Kim, Hye-Ryun; Song, Haengseok [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Hong, Kwonho, E-mail: kwonho.hong@dankook.ac.kr [Department of Nanobiomedical Science & BK21 PLUS NBM Global Research Center for Regenerative Medicine, Dankook University, Cheonan-si, Chungcheongnam-do 31116 (Korea, Republic of); Choi, Youngsok, E-mail: youngsokchoi@cha.ac.kr [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Fertility Center of CHA Gangnam Medical Center, Seoul 06135 (Korea, Republic of)
2016-04-08
The sine oculis homeobox 1 (SIX1) is a member of the Six gene family. SIX1 is involved in tissue development by regulating proliferation, apoptosis, and differentiation. However, function of SIX1 in the uterus remains unknown. Here, we found that Six1 expression is regulated along the estrous cycle in mouse uterus. Six1 expression was significantly increased at estrus stage and decreased at the rest of stages. SIX1 is detected in the luminal and glandular epithelium of uterine endometrium at the estrus stage. Estrogen injection increased Six1 expression in the ovariectomized mouse uterus, whereas progesterone had no effect on its expression. Estrogen receptor antagonist inhibited estrogen-induced Six1 expression. Our findings imply that SIX1 may play a role as an important regulator to orchestrate the dynamic of uterine endometrium in response to estrogen level during the estrous cycle. These results will give us a better understanding of uterine biology. - Highlights: • Six1 expression is regulated during the estrous cycle in mouse uterus. • Six1 is highly expressed at the estrus stage of estrous cycle. • SIX1 is detected in luminal/glandular epithelium of the uterus at the estrus stage. • Estrogen stimulates Six1 expression in an estrogen receptor-dependent manner.
Huang, Xiaoxia; Deng, Xuewei; Zhou, Wei; Hu, Dongxia; Guo, Huaiwen; Wang, Yuancheng; Zhao, Bowang; Zhong, Wei; Deng, Wu
2018-02-01
We report on frequency to amplitude modulation (FM-to-AM) conversion induced by a weak residual reflection stack of sine-modulated pulses in a complex laser system. Theoretical and experimental investigations reveal that when weak residual reflected pulses stack on the main pulse, the spectral intensity changes in the stacked region, which then converts to obvious AM. This kind of FM-to-AM effect often occurs in the tail of the pulse and cannot be eliminated by common compensation methods, which even enhance the modulation depth. Furthermore, the actual intensity modulation frequency and depth induced by the residual reflection stack are much higher and deeper than observed on the oscilloscope, which is harmful for safe operation of the laser facility and the driving power balance during inertial confinement fusion. To eliminate this kind of FM-to-AM effect, any possible on-axis and near-axis residual reflection in laser systems must be avoided.
Directory of Open Access Journals (Sweden)
V. Bacsó
2015-12-01
Full Text Available In this paper we study the c-function of the sine-Gordon model taking explicitly into account the periodicity of the interaction potential. The integration of the c-function along trajectories of the non-perturbative renormalization group flow gives access to the central charges of the model in the fixed points. The results at vanishing frequency β2, where the periodicity does not play a role, are retrieved and the independence on the cutoff regulator for small frequencies is discussed. Our findings show that the central charge obtained integrating the trajectories starting from the repulsive low-frequencies fixed points (β2<8π to the infra-red limit is in good quantitative agreement with the expected Δc=1 result. The behavior of the c-function in the other parts of the flow diagram is also discussed. Finally, we point out that including also higher harmonics in the renormalization group treatment at the level of local potential approximation is not sufficient to give reasonable results, even if the periodicity is taken into account. Rather, incorporating the wave-function renormalization (i.e. going beyond local potential approximation is crucial to get sensible results even when a single frequency is used.
Système de traiement d'eaux de regémération de résines pour l'élimination du cuivre
Karademir, Aynur
2005-01-01
Des cartouches de résines échangeuses d’ions sont utilisées pour le maintien de la qualité de l’eau déminéralisée nécessaire pour le refroidissement des accélérateurs du CERN. Les eaux issues de la régénération de ces cartouches contiennent des teneurs en cuivre trop élevées pour permettre leur rejet dans les réseaux d’eaux claires ou même usées. Le projet d’un système de traitement pour abattre la concentration de cuivre, basé sur une méthode simple, avec un rendement élevé, satisfaisant du point de vue de la sécurité, de l’impact environnemental et aussi économique, fait l’objet de ce travail.
International Nuclear Information System (INIS)
Cule, D.; Shapir, Y.
1995-01-01
The dynamics of the random-phase sine-Gordon model, which describes two-dimensional vortex-glass arrays and crystalline surfaces on disordered substrates, is investigated using the self-consistent Hartree approximation. The fluctuation-dissipation theorem is violated below the critical temperature T c for large time t>t * where t * diverges in the thermodynamic limit. While above T c the averaged autocorrelation function diverges as Tln(t), for T c it approaches a finite value q * ∼1/(T c -T) as q(t)=q * -c(t/t * ) -ν (for t→t * ) where ν is a temperature-dependent exponent. On larger time scales t>t * the dynamics becomes nonergodic. The static correlations behave as ∼Tln|rvec x| for T>T c and for T c when x * with ξ * ∼exp{A/(T c -T)}. For scales x>ξ * , they behave as ∼m -1 Tln|rvec x| where m∼T/T c near T c , in general agreement with the variational replica-symmetry breaking approach and with recent simulations of the disordered-substrate surface. For strong coupling the transition becomes first order
Cowley, Michael; de Burca, Anna; McCole, Ruth B; Chahal, Mandeep; Saadat, Ghazal; Oakey, Rebecca J; Schulz, Reiner
2011-04-20
Genomic imprinting is a form of gene dosage regulation in which a gene is expressed from only one of the alleles, in a manner dependent on the parent of origin. The mechanisms governing imprinted gene expression have been investigated in detail and have greatly contributed to our understanding of genome regulation in general. Both DNA sequence features, such as CpG islands, and epigenetic features, such as DNA methylation and non-coding RNAs, play important roles in achieving imprinted expression. However, the relative importance of these factors varies depending on the locus in question. Defining the minimal features that are absolutely required for imprinting would help us to understand how imprinting has evolved mechanistically. Imprinted retrogenes are a subset of imprinted loci that are relatively simple in their genomic organisation, being distinct from large imprinting clusters, and have the potential to be used as tools to address this question. Here, we compare the repeat element content of imprinted retrogene loci with non-imprinted controls that have a similar locus organisation. We observe no significant differences that are conserved between mouse and human, suggesting that the paucity of SINEs and relative abundance of LINEs at imprinted loci reported by others is not a sequence feature universally required for imprinting.
Directory of Open Access Journals (Sweden)
Michael Cowley
2011-04-01
Full Text Available Genomic imprinting is a form of gene dosage regulation in which a gene is expressed from only one of the alleles, in a manner dependent on the parent of origin. The mechanisms governing imprinted gene expression have been investigated in detail and have greatly contributed to our understanding of genome regulation in general. Both DNA sequence features, such as CpG islands, and epigenetic features, such as DNA methylation and non-coding RNAs, play important roles in achieving imprinted expression. However, the relative importance of these factors varies depending on the locus in question. Defining the minimal features that are absolutely required for imprinting would help us to understand how imprinting has evolved mechanistically. Imprinted retrogenes are a subset of imprinted loci that are relatively simple in their genomic organisation, being distinct from large imprinting clusters, and have the potential to be used as tools to address this question. Here, we compare the repeat element content of imprinted retrogene loci with non-imprinted controls that have a similar locus organisation. We observe no significant differences that are conserved between mouse and human, suggesting that the paucity of SINEs and relative abundance of LINEs at imprinted loci reported by others is not a sequence feature universally required for imprinting.
Rebillat, Marc; Schoukens, Maarten
2018-05-01
Linearity is a common assumption for many real-life systems, but in many cases the nonlinear behavior of systems cannot be ignored and must be modeled and estimated. Among the various existing classes of nonlinear models, Parallel Hammerstein Models (PHM) are interesting as they are at the same time easy to interpret as well as to estimate. One way to estimate PHM relies on the fact that the estimation problem is linear in the parameters and thus that classical least squares (LS) estimation algorithms can be used. In that area, this article introduces a regularized LS estimation algorithm inspired on some of the recently developed regularized impulse response estimation techniques. Another mean to estimate PHM consists in using parametric or non-parametric exponential sine sweeps (ESS) based methods. These methods (LS and ESS) are founded on radically different mathematical backgrounds but are expected to tackle the same issue. A methodology is proposed here to compare them with respect to (i) their accuracy, (ii) their computational cost, and (iii) their robustness to noise. Tests are performed on simulated systems for several values of methods respective parameters and of signal to noise ratio. Results show that, for a given set of data points, the ESS method is less demanding in computational resources than the LS method but that it is also less accurate. Furthermore, the LS method needs parameters to be set in advance whereas the ESS method is not subject to conditioning issues and can be fully non-parametric. In summary, for a given set of data points, ESS method can provide a first, automatic, and quick overview of a nonlinear system than can guide more computationally demanding and precise methods, such as the regularized LS one proposed here.
Simier, M.; Blanc, L.; Aliaume, C.; Diouf, P. S.; Albaret, J. J.
2004-01-01
As a consequence of the Sahelian drought, the Sine Saloum, a large estuarine system located in Senegal (West Africa), has become an "inverse estuary" since the late sixties, i.e. salinity increases upstream and reaches 100 in some places. To study the fish assemblages of such a modified system, a survey was conducted in 1992, collecting fish every two months with a purse seine at eight sites spread over the three main branches of the estuary. A total of 73 species belonging to 35 families were identified. Eight species comprised 97% of the total numbers of fish. The predominant species was a small clupeid, Sardinella maderensis, representing more than half of the total biomass and nearly 70% of the total number of fish. The spatio-temporal structure of the fish assemblages was studied using the STATIS-CoA method, which combines the multitable approach with the correspondence analysis method. Whatever the season, a strong spatial organization of fish assemblages was observed, mainly related to depth and salinity. Three types of assemblages were identified. In shallow water areas, fish assemblages were dominated by Mugilidae, Gerreidae and Cichlidae and were stable with time. In open water areas, large fluctuations in the species composition were observed, due to the occasional presence of large schools of pelagic species: in the southern area, where salinity and water transparency were the lowest, the main species were Ilisha africana, Brachydeuterus auritus and Chloroscombrus chrysurus, associated with a few Sciaenidae and Tetraodontidae, while the poorest areas were characterized by only two dominant species, S. maderensis and Scomberomorus tritor.
Endogenous Cortical Oscillations Constrain Neuromodulation by Weak Electric Fields
Schmidt, Stephen L.; Iyengar, Apoorva K.; Foulser, A. Alban; Boyle, Michael R.; Fröhlich, Flavio
2014-01-01
Background Transcranial alternating current stimulation (tACS) is a non-invasive brain stimulation modality that may modulate cognition by enhancing endogenous neocortical oscillations with the application of sine-wave electric fields. Yet, the role of endogenous network activity in enabling and shaping the effects of tACS has remained unclear. Objective We combined optogenetic stimulation and multichannel slice electrophysiology to elucidate how the effect of weak sine-wave electric field depends on the ongoing cortical oscillatory activity. We hypothesized that the structure of the response to stimulation depended on matching the stimulation frequency to the endogenous cortical oscillation. Methods We studied the effect of weak sine-wave electric fields on oscillatory activity in mouse neocortical slices. Optogenetic control of the network activity enabled the generation of in vivo like cortical oscillations for studying the temporal relationship between network activity and sine-wave electric field stimulation. Results Weak electric fields enhanced endogenous oscillations but failed to induce a frequency shift of the ongoing oscillation for stimulation frequencies that were not matched to the endogenous oscillation. This constraint on the effect of electric field stimulation imposed by endogenous network dynamics was limited to the case of weak electric fields targeting in vivo-like network dynamics. Together, these results suggest that the key mechanism of tACS may be enhancing but not overriding of intrinsic network dynamics. Conclusion Our results contribute to understanding the inconsistent tACS results from human studies and propose that stimulation precisely adjusted in frequency to the endogenous oscillations is key to rational design of non-invasive brain stimulation paradigms. PMID:25129402
Conde, Daniel; Baptista, Maria Ana; Sousa Oliveira, Carlos; Ferreira, Rui M. L.
2015-04-01
Global energy production is still significantly dependant on the coal supply chain, justifying huge investments on building infrastructures, capable of stocking very large quantities of this natural resource. Most of these infrastructures are located at deep-sea ports and are therefore exposed to extreme coastal hazards, such as tsunami impacts. The 2011 Tohoku tsunami is reported to have inflicted severe damage to Japan's coal-fired power stations and related infrastructure. Sines, located in the Portuguese coast, hosts a major commercial port featuring an exposed coal stockpile area extending over more than 24 ha and a container terminal currently under expansion up to 100ha. It is protected against storm surges but tsunamis have not been considered in the design criteria. The dominant wind-generated wave direction is N to NW, while the main tsunamigenic faults are located S to SW of the port. This configuration potentially exposes sensitive facilities, such as the new terminal container and the coal stockpile area. According to a recent revision of the national tsunami catalogue (Baptista, 2009), Portugal has been affected by numerous major tsunamis over the last two millennia, with the most notorious event being the Great Lisbon Earthquake and Tsunami occurred on the 1st November 1755. The aim of this work is to simulate the open ocean propagation and overland impact of a tsunami on the Sines port, similar to the historical event of 1755, based on the different tsunamigenic faults and magnitudes proposed in the current literature. Open ocean propagation was modelled with standard simulation tools like TUNAMI and GeoClaw. Near-shore and overland propagation was carried out using a recent 2DH mathematical model for solid-fluid flows, STAV-2D from CERIS-IST (Ferreira et al., 2009; Canelas, 2013). STAV-2D is particularly suited for tsunami propagation over complex and morphodynamic geometries, featuring a discretization scheme based on a finite-volume method using
Zhou, Zhiyi; Bernard, Melanie R; Bonds, A B
2008-04-02
Spatiotemporal relationships among contour segments can influence synchronization of neural responses in the primary visual cortex. We performed a systematic study to dissociate the impact of spatial and temporal factors in the signaling of contour integration via synchrony. In addition, we characterized the temporal evolution of this process to clarify potential underlying mechanisms. With a 10 x 10 microelectrode array, we recorded the simultaneous activity of multiple cells in the cat primary visual cortex while stimulating with drifting sine-wave gratings. We preserved temporal integrity and systematically degraded spatial integrity of the sine-wave gratings by adding spatial noise. Neural synchronization was analyzed in the time and frequency domains by conducting cross-correlation and coherence analyses. The general association between neural spike trains depends strongly on spatial integrity, with coherence in the gamma band (35-70 Hz) showing greater sensitivity to the change of spatial structure than other frequency bands. Analysis of the temporal dynamics of synchronization in both time and frequency domains suggests that spike timing synchronization is triggered nearly instantaneously by coherent structure in the stimuli, whereas frequency-specific oscillatory components develop more slowly, presumably through network interactions. Our results suggest that, whereas temporal integrity is required for the generation of synchrony, spatial integrity is critical in triggering subsequent gamma band synchronization.
Optimisation of active suspension control inputs for improved performance of active safety systems
Čorić, Mirko; Deur, Joško; Xu, Li; Tseng, H. Eric; Hrovat, Davor
2018-01-01
A collocation-type control variable optimisation method is used to investigate the extent to which the fully active suspension (FAS) can be applied to improve the vehicle electronic stability control (ESC) performance and reduce the braking distance. First, the optimisation approach is applied to the scenario of vehicle stabilisation during the sine-with-dwell manoeuvre. The results are used to provide insights into different FAS control mechanisms for vehicle performance improvements related to responsiveness and yaw rate error reduction indices. The FAS control performance is compared to performances of the standard ESC system, optimal active brake system and combined FAS and ESC configuration. Second, the optimisation approach is employed to the task of FAS-based braking distance reduction for straight-line vehicle motion. Here, the scenarios of uniform and longitudinally or laterally non-uniform tyre-road friction coefficient are considered. The influences of limited anti-lock braking system (ABS) actuator bandwidth and limit-cycle ABS behaviour are also analysed. The optimisation results indicate that the FAS can provide competitive stabilisation performance and improved agility when compared to the ESC system, and that it can reduce the braking distance by up to 5% for distinctively non-uniform friction conditions.
Gambling and the need for new responses in Public Health with an addiction "sine substantia".
Crusco, M; Massoni, F; Luzi, E; Ricci, P; Pelosi, M; Corbosiero, P; Rapp-Ricciardi, M; Ricci, S
2016-01-01
The Gambling Disorder (GD) was recently defined as a behavioral addiction by the "The Diagnostic and Statistical Manual of Mental Disorders IV"( DSM-V) since the clinical, neurobiological and psychopathological similarities led it to be defined it as an addiction "sine substantia". The aim of this study is to formulate an "identikit" of the gambler, to evaluate a possible association between GD / emotional specific factors and the correlation between GD / substance abuse, GD / suicide. In the study, 41 subjects were included (31 males and 10 females) and all were diagnosed with GD. A questionnaire was distributed containing 24 questions deriving from South Oaks Gambling Screen and the DSM-IVTR. The study showed that 51% of the respondents makes use of alcohol and / or drugs; that 73% of the patients started playing in order to relieve feelings of dysphoria and suffering consequences on work as well as family life (51%). A great deal of the respondents were indebted (39%) to the extent of needing to ask for loans from usurer (17%). Furthermore, 41% of the respondents in the sample showed that GD could be transformed into an alarming risk of suicide. The correlation between GD and drug abuse may depend on the brain function and the neural circuits that support impulsive behavior and the gratification mechanisms. Emotional experiences (stress, low level of education, divorce, poor social support) could constitute a possible risk factor that increases the GD. The committed offenses related to gambling could be explained by "loss of control". The results of the present study contributes to the body of knowledge regarding the size of phenomenon from a statistical and epidemiological point of view, suggesting the necessity for targeted information on the risks connected to GD in order to capture early warning signs which enables the intervention with suitable strategies.
Schwichtenberg, Katrin; Wenke, Torsten; Zakrzewski, Falk; Seibt, Kathrin M; Minoche, André; Dohm, Juliane C; Weisshaar, Bernd; Himmelbauer, Heinz; Schmidt, Thomas
2016-01-01
Short interspersed nuclear elements (SINEs) are non-autonomous non-long terminal repeat retrotransposons which are widely distributed in eukaryotic organisms. While SINEs have been intensively studied in animals, only limited information is available about plant SINEs. We analysed 22 SINE families from seven genomes of the Amaranthaceae family and identified 34 806 SINEs, including 19 549 full-length copies. With the focus on sugar beet (Beta vulgaris), we performed a comparative analysis of the diversity, genomic and chromosomal organization and the methylation of SINEs to provide a detailed insight into the evolution and age of Amaranthaceae SINEs. The lengths of consensus sequences of SINEs range from 113 nucleotides (nt) up to 224 nt. The SINEs show dispersed distribution on all chromosomes but were found with higher incidence in subterminal euchromatic chromosome regions. The methylation of SINEs is increased compared with their flanking regions, and the strongest effect is visible for cytosines in the CHH context, indicating an involvement of asymmetric methylation in the silencing of SINEs. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.
Short interspersed DNA elements and miRNAs: a novel hidden gene regulation layer in zebrafish?
Scarpato, Margherita; Angelini, Claudia; Cocca, Ennio; Pallotta, Maria M; Morescalchi, Maria A; Capriglione, Teresa
2015-09-01
In this study, we investigated by in silico analysis the possible correlation between microRNAs (miRNAs) and Anamnia V-SINEs (a superfamily of short interspersed nuclear elements), which belong to those retroposon families that have been preserved in vertebrate genomes for millions of years and are actively transcribed because they are embedded in the 3' untranslated region (UTR) of several genes. We report the results of the analysis of the genomic distribution of these mobile elements in zebrafish (Danio rerio) and discuss their involvement in generating miRNA gene loci. The computational study showed that the genes predicted to bear V-SINEs can be targeted by miRNAs with a very high hybridization E-value. Gene ontology analysis indicates that these genes are mainly involved in metabolic, membrane, and cytoplasmic signaling pathways. Nearly all the miRNAs that were predicted to target the V-SINEs of these genes, i.e., miR-338, miR-9, miR-181, miR-724, miR-735, and miR-204, have been validated in similar regulatory roles in mammals. The large number of genes bearing a V-SINE involved in metabolic and cellular processes suggests that V-SINEs may play a role in modulating cell responses to different stimuli and in preserving the metabolic balance during cell proliferation and differentiation. Although they need experimental validation, these preliminary results suggest that in the genome of D. rerio, as in other TE families in vertebrates, the preservation of V-SINE retroposons may also have been favored by their putative role in gene network modulation.
Directory of Open Access Journals (Sweden)
D. Pagliari
2015-01-01
Full Text Available Celiac disease (CD is an immune-mediated enteropathy, triggered by dietary wheat gluten and similar proteins of barley and rye in genetically susceptible individuals. This is a complex disorder involving both environmental and immune-genetic factors. The major genetic risk factor for CD is determined by HLA-DQ genes. Dysfunction of the innate and adaptive immune systems can conceivably cause impairment of mucosal barrier function and development of localized or systemic inflammatory and autoimmune processes. Exposure to gluten is the main environmental trigger responsible for the signs and symptoms of the disease, but exposure to gluten does not fully explain the manifestation of CD. Thus, both genetic determination and environmental exposure to gluten are necessary for the full manifestation of CD; neither of them is sufficient alone. Epidemiological and clinical data suggest that other environmental factors, including infections, alterations in the intestinal microbiota composition, and early feeding practices, might also play a role in disease development. Thus, this interaction is the condicio sine qua non celiac disease can develop. The breakdown of the interaction among microbiota, innate immunity, and genetic and dietary factors leads to disruption of homeostasis and inflammation; and tissue damage occurs. Focusing attention on this interaction and its breakdown may allow a better understanding of the CD pathogenesis and lead to novel translational avenues for preventing and treating this widespread disease.
Gning, Ndombour; Le Loc'h, François; Thiaw, Omar T.; Aliaume, Catherine; Vidy, Guy
2010-03-01
The Flagfin mojarra, Eucinostomus melanopterus, is a marine spawner whose young individuals are common in the Sine Saloum inverse estuary (Senegal). The species offers the opportunity to study both the use of the estuarine nursery resources and the impact of the particular environment of the inverse estuary on these resources. This will lead to a better understanding of the functioning of the nursery. We investigated the resources used by juvenile Flagfin mojarra by coupling stomach contents and stable isotopes methods. Young Flagfin mojarra feed on a wide range of invertebrates. Diet changed from copepods in the smallest size class (10-40 mm), to a range of invertebrates including amphipods, insect larvae, polychaetes and mollusc in the medium size class (up to 60 mm) and mainly polychaetes for individuals >60 mm in size. In mangrove habitats with moderate salinity, the diet was dominated by polychaetes and decapod larvae (crabs) whereas in habitats with higher salinity, diet was dominated by amphipods. In very hypersaline areas with scarce mangroves, diet comprised benthic copepods, chironomid larvae and ostracods. This agreed with a clear change in δ13C measured in fish sampled at downstream or upstream sites. Comparison with signatures of primary producers suggested that the local food web exploited by young Flagfin mojarra is mainly based on phytoplankton in the downstream mangrove area, and mainly on benthic microalgae in the upstream hypersaline area. As in many studies considering the food webs in mangrove, mangrove was not identified as a major contributor to the food web exploited by E. melanopterus. This needs further investigation particularly because the exportation of estuarine materials to the sea is limited in an inverse estuary.
Angeli, Andrea; Cornelis, Bram; Troncossi, Marco
2018-03-01
In many real life environments, mechanical and electronic systems are subjected to vibrations that may induce dynamic loads and potentially lead to an early failure due to fatigue damage. Thus, qualification tests by means of shakers are advisable for the most critical components in order to verify their durability throughout the entire life cycle. Nowadays the trend is to tailor the qualification tests according to the specific application of the tested component, considering the measured field data as reference to set up the experimental campaign, for example through the so called "Mission Synthesis" methodology. One of the main issues is to define the excitation profiles for the tests, that must have, besides the (potentially scaled) frequency content, also the same damage potential of the field data despite being applied for a limited duration. With this target, the current procedures generally provide the test profile as a stationary random vibration specified by a Power Spectral Density (PSD). In certain applications this output may prove inadequate to represent the nature of the reference signal, and the procedure could result in an unrealistic qualification test. For instance when a rotating part is present in the system the component under analysis may be subjected to Sine-on-Random (SoR) vibrations, namely excitations composed of sinusoidal contributions superimposed to random vibrations. In this case, the synthesized test profile should preserve not only the induced fatigue damage but also the deterministic components of the environmental vibration. In this work, the potential advantages of a novel procedure to synthesize SoR profiles instead of PSDs for qualification tests are presented and supported by the results of an experimental campaign.
Ribeiro, Manuel C; Pinho, P; Branquinho, C; Llop, Esteve; Pereira, Maria J
2016-08-15
In most studies correlating health outcomes with air pollution, personal exposure assignments are based on measurements collected at air-quality monitoring stations not coinciding with health data locations. In such cases, interpolators are needed to predict air quality in unsampled locations and to assign personal exposures. Moreover, a measure of the spatial uncertainty of exposures should be incorporated, especially in urban areas where concentrations vary at short distances due to changes in land use and pollution intensity. These studies are limited by the lack of literature comparing exposure uncertainty derived from distinct spatial interpolators. Here, we addressed these issues with two interpolation methods: regression Kriging (RK) and ordinary Kriging (OK). These methods were used to generate air-quality simulations with a geostatistical algorithm. For each method, the geostatistical uncertainty was drawn from generalized linear model (GLM) analysis. We analyzed the association between air quality and birth weight. Personal health data (n=227) and exposure data were collected in Sines (Portugal) during 2007-2010. Because air-quality monitoring stations in the city do not offer high-spatial-resolution measurements (n=1), we used lichen data as an ecological indicator of air quality (n=83). We found no significant difference in the fit of GLMs with any of the geostatistical methods. With RK, however, the models tended to fit better more often and worse less often. Moreover, the geostatistical uncertainty results showed a marginally higher mean and precision with RK. Combined with lichen data and land-use data of high spatial resolution, RK is a more effective geostatistical method for relating health outcomes with air quality in urban areas. This is particularly important in small cities, which generally do not have expensive air-quality monitoring stations with high spatial resolution. Further, alternative ways of linking human activities with their
Wenke, Torsten; Döbel, Thomas; Sörensen, Thomas Rosleff; Junghans, Holger; Weisshaar, Bernd; Schmidt, Thomas
2011-09-01
Short interspersed nuclear elements (SINEs) are non-long terminal repeat retrotransposons that are highly abundant, heterogeneous, and mostly not annotated in eukaryotic genomes. We developed a tool designated SINE-Finder for the targeted discovery of tRNA-derived SINEs. We analyzed sequence data of 16 plant genomes, including 13 angiosperms and three gymnosperms and identified 17,829 full-length and truncated SINEs falling into 31 families showing the widespread occurrence of SINEs in higher plants. The investigation focused on potato (Solanum tuberosum), resulting in the detection of seven different SolS SINE families consisting of 1489 full-length and 870 5' truncated copies. Consensus sequences of full-length members range in size from 106 to 244 bp depending on the SINE family. SolS SINEs populated related species and evolved separately, which led to some distinct subfamilies. Solanaceae SINEs are dispersed along chromosomes and distributed without clustering but with preferred integration into short A-rich motifs. They emerged more than 23 million years ago and were species specifically amplified during the radiation of potato, tomato (Solanum lycopersicum), and tobacco (Nicotiana tabacum). We show that tobacco TS retrotransposons are composite SINEs consisting of the 3' end of a long interspersed nuclear element integrated downstream of a nonhomologous SINE family followed by successfully colonization of the genome. We propose an evolutionary scenario for the formation of TS as a spontaneous event, which could be typical for the emergence of SINE families.
Wenke, Torsten; Döbel, Thomas; Sörensen, Thomas Rosleff; Junghans, Holger; Weisshaar, Bernd; Schmidt, Thomas
2011-01-01
Short interspersed nuclear elements (SINEs) are non-long terminal repeat retrotransposons that are highly abundant, heterogeneous, and mostly not annotated in eukaryotic genomes. We developed a tool designated SINE-Finder for the targeted discovery of tRNA-derived SINEs. We analyzed sequence data of 16 plant genomes, including 13 angiosperms and three gymnosperms and identified 17,829 full-length and truncated SINEs falling into 31 families showing the widespread occurrence of SINEs in higher plants. The investigation focused on potato (Solanum tuberosum), resulting in the detection of seven different SolS SINE families consisting of 1489 full-length and 870 5′ truncated copies. Consensus sequences of full-length members range in size from 106 to 244 bp depending on the SINE family. SolS SINEs populated related species and evolved separately, which led to some distinct subfamilies. Solanaceae SINEs are dispersed along chromosomes and distributed without clustering but with preferred integration into short A-rich motifs. They emerged more than 23 million years ago and were species specifically amplified during the radiation of potato, tomato (Solanum lycopersicum), and tobacco (Nicotiana tabacum). We show that tobacco TS retrotransposons are composite SINEs consisting of the 3′ end of a long interspersed nuclear element integrated downstream of a nonhomologous SINE family followed by successfully colonization of the genome. We propose an evolutionary scenario for the formation of TS as a spontaneous event, which could be typical for the emergence of SINE families. PMID:21908723
Rescuing Alu: recovery of new inserts shows LINE-1 preserves Alu activity through A-tail expansion.
Directory of Open Access Journals (Sweden)
Bradley J Wagstaff
Full Text Available Alu elements are trans-mobilized by the autonomous non-LTR retroelement, LINE-1 (L1. Alu-induced insertion mutagenesis contributes to about 0.1% human genetic disease and is responsible for the majority of the documented instances of human retroelement insertion-induced disease. Here we introduce a SINE recovery method that provides a complementary approach for comprehensive analysis of the impact and biological mechanisms of Alu retrotransposition. Using this approach, we recovered 226 de novo tagged Alu inserts in HeLa cells. Our analysis reveals that in human cells marked Alu inserts driven by either exogenously supplied full length L1 or ORF2 protein are indistinguishable. Four percent of de novo Alu inserts were associated with genomic deletions and rearrangements and lacked the hallmarks of retrotransposition. In contrast to L1 inserts, 5' truncations of Alu inserts are rare, as most of the recovered inserts (96.5% are full length. De novo Alus show a random pattern of insertion across chromosomes, but further characterization revealed an Alu insertion bias exists favoring insertion near other SINEs, highly conserved elements, with almost 60% landing within genes. De novo Alu inserts show no evidence of RNA editing. Priming for reverse transcription rarely occurred within the first 20 bp (most 5' of the A-tail. The A-tails of recovered inserts show significant expansion, with many at least doubling in length. Sequence manipulation of the construct led to the demonstration that the A-tail expansion likely occurs during insertion due to slippage by the L1 ORF2 protein. We postulate that the A-tail expansion directly impacts Alu evolution by reintroducing new active source elements to counteract the natural loss of active Alus and minimizing Alu extinction.
Mzighani, Semvua I; Nikaido, Masato; Takeda, Miyuki; Seehausen, Ole; Budeba, Yohana L; Ngatunga, Benjamin P; Katunzi, Egid F B; Aibara, Mitsuto; Mizoiri, Shinji; Sato, Tetsu; Tachida, Hidenori; Okada, Norihiro
2010-01-15
More than 500 endemic haplochromine cichlid species inhabit Lake Victoria. This striking species diversity is a classical example of recent explosive adaptive radiation thought to have happened within the last approximately 15,000 years. In this study, we examined the population structure and historical demography of 3 pelagic haplochromine cichlid species that resemble in morphology and have similar niche, Haplochromis (Yssichromis) laparogramma, Haplochromis (Y.) pyrrhocephalus, and Haplochromis (Y.) sp. "glaucocephalus". We investigated the sequences of the mitochondrial DNA control region and the insertion patterns of short interspersed elements (SINEs) of 759 individuals. We show that sympatric forms are genetically differentiated in 4 of 6 cases, but we also found apparent weakening of the genetic differentiation in areas with turbid water. We estimated the timings of population expansion and species divergence to coincide with the refilling of the lake at the Pleistocene/Holocene boundary. We also found that estimates can be altered significantly by the choice of the shape of the molecular clock. If we employ the nonlinear clock model of evolutionary rates in which the rates are higher towards the recent, the population expansion was dated at around the event of desiccation of the lake ca. 17,000 YBP. Thus, we succeeded in clarifying the species and population structure of closely related Lake Victoria cichlids and in showing the importance of applying appropriate clock calibrations in elucidating recent evolutionary events.
Barghini, Elena; Mascagni, Flavia; Natali, Lucia; Giordani, Tommaso; Cavallini, Andrea
2017-02-01
Short Interspersed Nuclear Elements (SINEs) are nonautonomous retrotransposons in the genome of most eukaryotic species. While SINEs have been intensively investigated in humans and other animal systems, SINE identification has been carried out only in a limited number of plant species. This lack of information is apparent especially in non-model plants whose genome has not been sequenced yet. The aim of this work was to produce a specific bioinformatics pipeline for analysing second generation sequence reads of a non-model species and identifying SINEs. We have identified, for the first time, 227 putative SINEs of the olive tree (Olea europaea), that constitute one of the few sets of such sequences in dicotyledonous species. The identified SINEs ranged from 140 to 362 bp in length and were characterised with regard to the occurrence of the tRNA domain in their sequence. The majority of identified elements resulted in single copy or very lowly repeated, often in association with genic sequences. Analysis of sequence similarity allowed us to identify two major groups of SINEs showing different abundances in the olive tree genome, the former with sequence similarity to SINEs of Scrophulariaceae and Solanaceae and the latter to SINEs of Salicaceae. A comparison of sequence conservation between olive SINEs and LTR retrotransposon families suggested that SINE expansion in the genome occurred especially in very ancient times, before LTR retrotransposon expansion, and presumably before the separation of the rosids (to which Oleaceae belong) from the Asterids. Besides providing data on olive SINEs, our results demonstrate the suitability of the pipeline employed for SINE identification. Applying this pipeline will favour further structural and functional analyses on these relatively unknown elements to be performed also in other plant species, even in the absence of a reference genome, and will allow establishing general evolutionary patterns for this kind of repeats in
Instrument to synchronize Thomson scattering diagnostic measurements with MHD acitivity in a tokamak
International Nuclear Information System (INIS)
Wintenberg, A.L.
1985-04-01
An instrument to synchronize the firing of a ruby laser for a Thomson scattering diagnostic with plasma oscillations was designed, developed, and evaluated. The instrument will fire the laser at a user-selected phase of an input sine or sawtooth wave with an accuracy of +-15 0 . Allowable frequencies range from 20 to 500 Hz for a sawtooth and from 1 to 30 kHz for a sine wave. The instrument also allows synchronization with a sine wave to be enabled by a preselected sawtooth phase. The instrument uses analog signal processing circuits to separate the signal components, remove unwanted components, and produce zero-phase synchronization pulses. The instrument measures the period between zero-phase pulses in order to produce phase synchronization pulses delayed a fraction of the period from the zero-phase pulses. The laser is fired by the phase synchronization pulse. Unwanted signal components are attenuated by bandpass filters. A digitally controlled self-adjusting bandpass filter for sine processing. The instrument was used to investigate the variation of the electron temperature profile with the phase of the x-ray signal from an Impurity Studies Experiment (ISX-B) plasma exhibiting magnetohydrodynamic (MHD) activity
Liu, Dong; Zhu, Guoli; Tang, Wenqiao; Yang, Jinquan; Guo, Hongyi
2012-01-01
Short interspersed nucleotide elements (SINEs), a type of retrotransposon, are widely distributed in various genomes with multiple copies arranged in different orientations, and cause changes to genes and genomes during evolutionary history. This can provide the basis for determining genome diversity, genetic variation and molecular phylogeny, etc. SINE DNA is transcribed into RNA by polymerase III from an internal promoter, which is composed of two conserved boxes, box A and box B. Here we present an approach to isolate novel SINEs based on these promoter elements. Box A of a SINE is obtained via PCR with only one primer identical to box B (B-PCR). Box B and its downstream sequence are acquired by PCR with one primer corresponding to box A (A-PCR). The SINE clone produced by A-PCR is selected as a template to label a probe with biotin. The full-length SINEs are isolated from the genomic pool through complex capture using the biotinylated probe bound to magnetic particles. Using this approach, a novel SINE family, Cn-SINE, from the genomes of Coilia nasus, was isolated. The members are 180-360 bp long. Sequence homology suggests that Cn-SINEs evolved from a leucine tRNA gene. This is the first report of a tRNA(Leu)-related SINE obtained without the use of a genomic library or inverse PCR. These results provide new insights into the origin of SINEs.
Directory of Open Access Journals (Sweden)
Dong Liu
2012-02-01
Full Text Available Short interspersed nucleotide elements (SINEs, a type of retrotransposon, are widely distributed in various genomes with multiple copies arranged in different orientations, and cause changes to genes and genomes during evolutionary history. This can provide the basis for determining genome diversity, genetic variation and molecular phylogeny, etc. SINE DNA is transcribed into RNA by polymerase III from an internal promoter, which is composed of two conserved boxes, box A and box B. Here we present an approach to isolate novel SINEs based on these promoter elements. Box A of a SINE is obtained via PCR with only one primer identical to box B (B-PCR. Box B and its downstream sequence are acquired by PCR with one primer corresponding to box A (A-PCR. The SINE clone produced by A-PCR is selected as a template to label a probe with biotin. The full-length SINEs are isolated from the genomic pool through complex capture using the biotinylated probe bound to magnetic particles. Using this approach, a novel SINE family, Cn-SINE, from the genomes of Coilia nasus, was isolated. The members are 180–360 bp long. Sequence homology suggests that Cn-SINEs evolved from a leucine tRNA gene. This is the first report of a tRNALeu-related SINE obtained without the use of a genomic library or inverse PCR. These results provide new insights into the origin of SINEs.
Alternating multivariate trigonometric functions and corresponding Fourier transforms
International Nuclear Information System (INIS)
Klimyk, A U; Patera, J
2008-01-01
We define and study multivariate sine and cosine functions, symmetric with respect to the alternating group A n , which is a subgroup of the permutation (symmetric) group S n . These functions are eigenfunctions of the Laplace operator. They determine Fourier-type transforms. There exist three types of such transforms: expansions into corresponding sine-Fourier and cosine-Fourier series, integral sine-Fourier and cosine-Fourier transforms, and multivariate finite sine and cosine transforms. In all these transforms, alternating multivariate sine and cosine functions are used as a kernel
Shimoji, Koki; Takahashi, Norio; Nishio, Yasuyuki; Koyanagi, Mika; Aida, Sumihisa
2007-01-01
Objectives. Newly developed bidirectional modulated sine waves (BMW) might provide some derived benefit to patients with low back pain. Pain relief by transcutaneous electric nerve stimulation (TENS) with BMWs was tested. Materials and Methods. Analgesic effects of BMWs and conventional bidirectional pulsed waves on chronic back pain in 28 patients were compared, and effects of repeated TENS using BMWs on chronic back pain were investigated in 21 patients by means of a randomized double-blind, sham-controlled, parallel-group method. Pain intensity was assessed using numerical rating scale (NRS). Results. There was significant immediate reduction in NRS in patients receiving BMWs, and 60 min after treatment compared to sham TENS. Weekly repeated treatments using massage and TENS with BMWs for 5 weeks resulted in a decrease of NRS, but there were no significant differences between the TENS plus massage and sham TENS plus massage groups. Conclusions. This study shows that TENS with BMWs significantly inhibits chronic back pain, and treatment effects are attained within a day. The results also suggest that there were no statistically significant long-term effects of TENS with BMW in the repeated treatment.
Jiang, Wen-Hao; Liu, Jian-Hong; Liu, Yin; Jin, Ge; Zhang, Jun; Pan, Jian-Wei
2017-12-15
InGaAs/InP single-photon detectors (SPDs) are the key devices for applications requiring near-infrared single-photon detection. The gating mode is an effective approach to synchronous single-photon detection. Increasing gating frequency and reducing the module size are important challenges for the design of such a detector system. Here we present for the first time, to the best of our knowledge, an InGaAs/InP SPD with 1.25 GHz sine wave gating (SWG) using a monolithically integrated readout circuit (MIRC). The MIRC has a size of 15 mm×15 mm and implements the miniaturization of avalanche extraction for high-frequency SWG. In the MIRC, low-pass filters and a low-noise radio frequency amplifier are integrated based on the technique of low temperature co-fired ceramic, which can effectively reduce the parasitic capacitance and extract weak avalanche signals. We then characterize the InGaAs/InP SPD to verify the functionality and reliability of the MIRC, and the SPD exhibits excellent performance with 27.5% photon detection efficiency, a 1.2 kcps dark count rate, and 9.1% afterpulse probability at 223 K and 100 ns hold-off time. With this MIRC, one can further design miniaturized high-frequency SPD modules that are highly required for practical applications.
Directory of Open Access Journals (Sweden)
Li Ma
2013-08-01
Full Text Available AIM: To screen mutations in the retinitis pigmentosa 1 (RP1 gene and the rhodopsin (RHO gene in Chinese patients with retinitis pigmentosa sine pigmento (RPSP and describe the genotype-phenotype relationship of the mutations.METHODS:Twenty affected, unrelated Chinese individuals with RPSP (4 autosomal dominant RPSP, 12 autosomal recessive RPSP and 4 unknown inheritance pattern were recruited between 2009 and 2012. The clinical features were determined by complete ophthalmologic examinations. Polymerase chain reaction (PCR and direct DNA sequencing were used to screen the entire coding region and splice junctions of the RP1 gene and the RHO gene. The cosegregation analysis and population frequency studies were performed for patients with identified mutations.RESULTS: Five variants in the RP1 gene and one in the RHO gene were detected in 20 probands. Four missense changes (rs444772, rs446227, rs414352, rs441800 and one non-coding variant (rs56340615 were common SNPs and none of them showed a significant relationship with RPSP. A missense mutation p.R1443W was identified in the RP1 gene in three affected individuals from a family with autosomal dominant RPSP and was found to cosegregate with the phenotype in this family, suggestive of pathogenic. In addition, population frequency analysis showed the p.R1443W mutation was absent in 300 healthy controls.CONCLUSION: The identification of p.R1443W mutation cosegregating in a family with autosomal dominant RPSP highlights an atypical phenotype of the RP1 gene mutation, while RHO gene is not associated with the pathogenesis of RPSP in this study. To our knowledge, this is the fist mutation identified to associate with RPSP.
Ma, Li; Sheng, Xun-Lun; Li, Hui-Ping; Zhang, Fang-Xia; Liu, Ya-Ni; Rong, Wei-Ning; Zhang, Jian-Ling
2013-01-01
To screen mutations in the retinitis pigmentosa 1 (RP1) gene and the rhodopsin (RHO) gene in Chinese patients with retinitis pigmentosa sine pigmento (RPSP) and describe the genotype-phenotype relationship of the mutations. Twenty affected, unrelated Chinese individuals with RPSP (4 autosomal dominant RPSP, 12 autosomal recessive RPSP and 4 unknown inheritance pattern) were recruited between 2009 and 2012. The clinical features were determined by complete ophthalmologic examinations. Polymerase chain reaction (PCR) and direct DNA sequencing were used to screen the entire coding region and splice junctions of the RP1 gene and the RHO gene. The cosegregation analysis and population frequency studies were performed for patients with identified mutations. Five variants in the RP1 gene and one in the RHO gene were detected in 20 probands. Four missense changes (rs444772, rs446227, rs414352, rs441800) and one non-coding variant (rs56340615) were common SNPs and none of them showed a significant relationship with RPSP. A missense mutation p.R1443W was identified in the RP1 gene in three affected individuals from a family with autosomal dominant RPSP and was found to cosegregate with the phenotype in this family, suggestive of pathogenic. In addition, population frequency analysis showed the p.R1443W mutation was absent in 300 healthy controls. The identification of p.R1443W mutation cosegregating in a family with autosomal dominant RPSP highlights an atypical phenotype of the RP1 gene mutation, while RHO gene is not associated with the pathogenesis of RPSP in this study. To our knowledge, this is the fist mutation identified to associate with RPSP.
Active Control Does Not Eliminate Motion-Induced Illusory Displacement
Directory of Open Access Journals (Sweden)
Ian M. Thornton
2011-05-01
Full Text Available When the sine-wave grating of a Gabor patch drifts to the left or right, the perceived position of the entire object is shifted in the direction of local motion. In the current work we explored whether active control of the physical position of the patch overcomes such motion induced illusory displacement. In Experiment 1 we created a simple computer game and asked participants to continuously guide a Gabor patch along a randomly curving path using a joystick. When the grating inside the Gabor patch was stationary, participants could perform this task without error. When the grating drifted to either left or right, we observed systematic errors consistent with previous reports of motion-induced illusory displacement. In Experiment 2 we created an iPad application where the built-in accelerometer tilt control was used to steer the patch through as series of “gates”. Again, we observed systematic guidance errors that depended on the direction and speed of local motion. In conclusion, we found no evidence that participants could adapt or compensate for illusory displacement given active control of the target.
Muramoto, Hiroki; Yagi, Shintaro; Hirabayashi, Keiji; Sato, Shinya; Ohgane, Jun; Tanaka, Satoshi; Shiota, Kunio
2010-08-01
Embryonic stem cells (ESCs) have a distinctive epigenome, which includes their genome-wide DNA methylation modification status, as represented by the ESC-specific hypomethylation of tissue-dependent and differentially methylated regions (T-DMRs) of Pou5f1 and Nanog. Here, we conducted a genome-wide investigation of sequence characteristics associated with T-DMRs that were differentially methylated between ESCs and somatic cells, by focusing on transposable elements including short interspersed elements (SINEs), long interspersed elements (LINEs) and long terminal repeats (LTRs). We found that hypomethylated T-DMRs were predominantly present in SINE-rich/LINE-poor genomic loci. The enrichment for SINEs spread over 300 kb in cis and there existed SINE-rich genomic domains spreading continuously over 1 Mb, which contained multiple hypomethylated T-DMRs. The characterization of sequence information showed that the enriched SINEs were relatively CpG rich and belonged to specific subfamilies. A subset of the enriched SINEs were hypomethylated T-DMRs in ESCs at Dppa3 gene locus, although SINEs are overall methylated in both ESCs and the liver. In conclusion, we propose that SINE enrichment is the genomic property of regions harboring hypomethylated T-DMRs in ESCs, which is a novel aspect of the ESC-specific epigenomic information.
"»Saa at jeg har efterlevet en Historieskrivers uden at overtræde en Borgers Pligt«
DEFF Research Database (Denmark)
Olden-Jørgensen, Sebastian
2012-01-01
Ifølge sine egne idealer for god historieskrivning måtte Ludvig Holberg afbalancere sine pligter som borger (= politiske hensyn) med sine pligter som historieskriver (= videnskabelige hensyn). Denne potentielle konflikt kan studeres de steder i hans historiske forfatterskab, hvor han behandler en...
Active Control of Separation From the Flap of a Supercritical Airfoil
Melton, LaTunia Pack; Yao, Chung-Sheng; Seifert, Avi
2006-01-01
Zero-mass-flux periodic excitation was applied at several regions on a simplified high-lift system to delay the occurrence of flow separation. The NASA Energy Efficient Transport (EET) supercritical airfoil was equipped with a 15% chord simply hinged leading edge flap and a 25% chord simply hinged trailing edge flap. Detailed flow features were measured in an attempt to identify optimal actuator placement. The measurements included steady and unsteady model and tunnel wall pressures, wake surveys, arrays of surface hot-films, flow visualization, and particle image velocimetry (PIV). The current paper describes the application of active separation control at several locations on the deflected trailing edge flap. High frequency (F(+) approximately equal to 10) and low frequency amplitude modulation (F(+) sub AM approximately equal to 1) of the high frequency excitation were used for control. It was noted that the same performance gains were obtained with amplitude modulation and required only 30% of the momentum input required by pure sine excitation.
Dicty_cDB: Contig-U14333-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available isikxnisnitcdgfd*ECEIQGNSTXFTVDYTAVYHVNSNPISKYYNRKVCIKSVP YGTYLSNNNGVIEMSEKLRKYEEWFIERAATGPNSLDTDIYIFR*nixqifnl*sines...xisikxnisnitcdgfd*ECEIQGNSTXFTVDYTAVYHVNSNPISKYYNRKVCIKSVP YGTYLSNNNGVIEMSEKLRKYEEWFIERAATGPNSLDTDIYIFR*nixqifnl*sines
Slawyk, Gerd; Coste, Bernard; Collos, Yves; Rodier, Martine
1997-01-01
Using measurements of 15N uptake and activities of nitrate reductase and glutamine synthetase, the utilization of nitrogenous nutrients by microplankton in the Portuguese upwelling area was investigated. During this cruise the euphotic zone of coastal waters was in most cases bisected by a nitracline forming two layers. Total inorganic nitrogen uptake rates (NH 4+ + NO 3-) in the upper mixed and nitrate-impoverished layer ranged from 0.1 to 0.8 nM h -1 and were primarily supported by regenerated (ammonium) nitrogen (62-97%), whereas they varied between 0.9 and 10.4 nM h -1 in the deep nitrate-rich layer and were mainly driven by new (nitrate) nitrogen (52-82%). Depth profiles of Chl a-specific uptake rates for ammonium and nitrate paralleled those of absolute uptake rates, i.e. values of VNH 4+Chl were highest (up to 16.1 nmol μg -1 h -1) in nitrate-poor surface waters while values of VNO 3-Chl were maximum (up to 8.4 nmol μg -1 h -1)within the nitracline. This latter vertical ordering of planktonic nitrogen nutrition was consistent with an aged upwelling situation. However, applying several indices of cell metabolism and nutritional status, such as 15N uptake/enzyme activity, surge uptake internally controlled uptake, and V maxChl/K t ratios, we were able to demonstrate that the phytoplankton assemblages inhabiting the nutrient-impoverished upper layer still bore the signature of physically mediated nitrogen (nitrate) supply generated by active upwelling that had occurred during the week before our visit to the area. This signature was the most evident in samples from the station furthest inshore and faded with distance from shore as a result of the deepening of the nitrate isopleths (weakening of upwelling activity), which showed the same offshore trend. The appearance of nitrate-rich waters at the surface, after a strong pulse of upwelling favourable winds just before the end of the cruise, led to a five-fold increase in average (over the euphotic zone
International Nuclear Information System (INIS)
Burton, J.C.
1977-01-01
Utilities are required by the Nuclear Regulatory Commission to document that seismic vibration will not adversely affect critical electrical equipment. Seismic testing should be designed to determine the malfunction level (fragility testing). Input possibilities include a continuous sine, a decaying sine, a sine beat, random vibrations, and combinations of random vibrations and sine beat. The sine beat most accurately simulates a seismic event. Test frequencies have a broad range in order to accommodate a variety of relay types and cabinet mounting. Simulation of motion along three axes offers several options, but is best achieved by three in-phase single-axis vibration machines that are less likely to induce testing fatigue failure. Consensus on what constitutes relay failure favors a maximum two microsecond discontinuity. Performance tests should be conducted for at least two of the following: (1) nonoperating modes, (2) operating modes, or (3) the transition above the two modes, with the monitoring mode documented for all three. Results should specify a capability curve of maximum safe seismic acceleration and a graph plotting acceleration with sine-beat frequency
Low diversity, activity, and density of transposable elements in five avian genomes.
Gao, Bo; Wang, Saisai; Wang, Yali; Shen, Dan; Xue, Songlei; Chen, Cai; Cui, Hengmi; Song, Chengyi
2017-07-01
In this study, we conducted the activity, diversity, and density analysis of transposable elements (TEs) across five avian genomes (budgerigar, chicken, turkey, medium ground finch, and zebra finch) to explore the potential reason of small genome sizes of birds. We found that these avian genomes exhibited low density of TEs by about 10% of genome coverages and low diversity of TEs with the TE landscapes dominated by CR1 and ERV elements, and contrasting proliferation dynamics both between TE types and between species were observed across the five avian genomes. Phylogenetic analysis revealed that CR1 clade was more diverse in the family structure compared with R2 clade in birds; avian ERVs were classified into four clades (alpha, beta, gamma, and ERV-L) and belonged to three classes of ERV with an uneven distributed in these lineages. The activities of DNA and SINE TEs were very low in the evolution history of avian genomes; most LINEs and LTRs were ancient copies with a substantial decrease of activity in recent, with only LTRs and LINEs in chicken and zebra finch exhibiting weak activity in very recent, and very few TEs were intact; however, the recent activity may be underestimated due to the sequencing/assembly technologies in some species. Overall, this study demonstrates low diversity, activity, and density of TEs in the five avian species; highlights the differences of TEs in these lineages; and suggests that the current and recent activity of TEs in avian genomes is very limited, which may be one of the reasons of small genome sizes in birds.
Directory of Open Access Journals (Sweden)
Bernasconi C.
2006-11-01
Full Text Available Une réponse possible au problème de la déstabilisation par démixtion des mélanges supercarburant-alcools est l'abaissement de leur teneur en eau par adsorption physique. La forte affinité pour l'eau des résines échangeuses d'ions de type polystyrène sulfonate permet d'envisager leur utilisation dans ce cas spécifique d'application. Le principal intérêt de ce nouveau matériau adsorbant est de pouvoir se régénérer avec des calories de bas niveau (100-120°C. Nous avons donc étudié, du point de vue capacité d'adsorption et cinétique d'adsorption, le comportement de cet adsorbant et comparé ses performances à celles d'adsorbants plus classiques tels que le silicagel, l'alumine et le tamis moléculaire 3 Å. Les formes ioniques de la résine mises en oeuvre sont les formes : K+, Na+ et Mg2+. Sur le plan de la capacité totale d'adsorption, la résine, quelle que soit sa forme ionique, présente des performances supérieures à celles de l'alumine et du silicagel. Seule la forme Mg2+ adsorbe autant d'eau que le tamis moléculaire. L'efficacité de la résine est sensible à la nature de l'alcool du mélange considéré et augmente selon la séquence méthanol A possible answer to the problem of destabilization by the segregation of premium-fuel/alcohol blends lies in decreasing their water content by physical adsorption. The strong affinity of water for ion-exchange resins of the polystyrene sulfonate type suggests their use for this specific application. The main advantage of this newadsorbent material is that it can be regenerated with low-level heat (100-120°C. We thus investigated the behavior of this adsorbent from the standpoint of its adsorption capacity and adsorption kinetics. Its performances were compared to those of more conventional adsorbents, such as silicagel, alumina and a 3Å molecular sieve. The ionic forms of the resin used are in the form of K+, Na+ and Mg2+. From the standpoint of total adsorption capacity
Gallus, S; Kumar, V; Bertelsen, M F; Janke, A; Nilsson, M A
2015-10-25
Ruminantia, the ruminating, hoofed mammals (cow, deer, giraffe and allies) are an unranked artiodactylan clade. Around 50-60 million years ago the BovB retrotransposon entered the ancestral ruminantian genome through horizontal gene transfer. A survey genome screen using 454-pyrosequencing of the Java mouse deer (Tragulus javanicus) and the lesser kudu (Tragelaphus imberbis) was done to investigate and to compare the landscape of transposable elements within Ruminantia. The family Tragulidae (mouse deer) is the only representative of Tragulina and phylogenetically important, because it represents the earliest divergence in Ruminantia. The data analyses show that, relative to other ruminantian species, the lesser kudu genome has seen an expansion of BovB Long INterspersed Elements (LINEs) and BovB related Short INterspersed Elements (SINEs) like BOVA2. In comparison the genome of Java mouse deer has fewer BovB elements than other ruminants, especially Bovinae, and has in addition a novel CHR-3 SINE most likely propagated by LINE-1. By contrast the other ruminants have low amounts of CHR SINEs but high numbers of actively propagating BovB-derived and BovB-propagated SINEs. The survey sequencing data suggest that the transposable element landscape in mouse deer (Tragulina) is unique among Ruminantia, suggesting a lineage specific evolutionary trajectory that does not involve BovB mediated retrotransposition. This shows that the genomic landscape of mobile genetic elements can rapidly change in any lineage. Copyright © 2015 Elsevier B.V. All rights reserved.
Secuencia genética y dinámica de excitaciones no lineales de ADN
Cuenda Cuenda, Sara
2007-01-01
La memoria se divide en tres partes: la que se refiere al modelo de sine-Gordon continuo; la segunda, relativa al modelo de sine-Gordon discreto; y la última, que trata el modelo de Peyrard-Bishop aplicado al ADN. La primera parte engloba los capítulos 2 y 3. El segundo capítulo es puramente introductorio, y trata del modelo de sine-Gordon homogéneo y continuo. En él se hace un repaso de la ecuación de sine-Gordon en coordenadas características en la geometría diferencial y ...
Retrotransposons as regulators of gene expression.
Elbarbary, Reyad A; Lucas, Bronwyn A; Maquat, Lynne E
2016-02-12
Transposable elements (TEs) are both a boon and a bane to eukaryotic organisms, depending on where they integrate into the genome and how their sequences function once integrated. We focus on two types of TEs: long interspersed elements (LINEs) and short interspersed elements (SINEs). LINEs and SINEs are retrotransposons; that is, they transpose via an RNA intermediate. We discuss how LINEs and SINEs have expanded in eukaryotic genomes and contribute to genome evolution. An emerging body of evidence indicates that LINEs and SINEs function to regulate gene expression by affecting chromatin structure, gene transcription, pre-mRNA processing, or aspects of mRNA metabolism. We also describe how adenosine-to-inosine editing influences SINE function and how ongoing retrotransposition is countered by the body's defense mechanisms. Copyright © 2016, American Association for the Advancement of Science.
Directory of Open Access Journals (Sweden)
Chaowu Jin
2016-01-01
Full Text Available At present, the stiffness and damping identification for active magnetic bearings (AMBs are still in the stage of theoretical analysis. The theoretical analysis indicates that if the mechanical structure and system parameters are determined, AMBs stiffness and damping are only related to frequency characteristic of control system, ignoring operating condition. More importantly, few verification methods are proposed. Considering the shortcomings of the theoretical identification, this paper obtains these coefficients from the experiment by using the magnetic bearing as a sine exciter. The identification results show that AMBs stiffness and damping have a great relationship with the control system and rotating speed. Specifically, at low rotating speed, the stiffness and damping can be obtained from the rotor static suspension by adding the same excitation frequency. However, at high speed, different from the static suspension situation, the AMBs supporting coefficients are not only related to the frequency characteristics of control system, but also related to the system operating conditions.
An integrodifferential Dirac equation with quantized charge in one space dimension
International Nuclear Information System (INIS)
Ranada, A.F.
1985-01-01
An integrodifferential Dirac equation in one space dimension is proposed, such that there is a close correspondence between its solutions and a subset of those of the sine-Gordon equation. It has solitonic solutions, quantized charge and positive definite energy density, so that it can be considered a spinorial version of sine-Gordon. Accordingly, it could be named the sine-Dirac equation. (orig.)
On non-equilibrium states in QFT model with boundary interaction
International Nuclear Information System (INIS)
Bazhanov, Vladimir V.; Lukyanov, Sergei L.; Zamolodchikov, Alexander B.
1999-01-01
We prove that certain non-equilibrium expectation values in the boundary sine-Gordon model coincide with associated equilibrium-state expectation values in the systems which differ from the boundary sine-Gordon in that certain extra boundary degrees of freedom (q-oscillators) are added. Applications of this result to actual calculation of non-equilibrium characteristics of the boundary sine-Gordon model are also discussed
Directory of Open Access Journals (Sweden)
Tobias Mourier
Full Text Available BACKGROUND: Eukaryotic genomes are scattered with retroelements that proliferate through retrotransposition. Although retroelements make up around 40 percent of the human genome, large regions are found to be completely devoid of retroelements. This has been hypothesised to be a result of genomic regions being intolerant to insertions of retroelements. The inadvertent transcriptional activity of retroelements may affect neighbouring genes, which in turn could be detrimental to an organism. We speculate that such retroelement transcription, or transcriptional interference, is a contributing factor in generating and maintaining retroelement-free regions in the human genome. METHODOLOGY/PRINCIPAL FINDINGS: Based on the known transcriptional properties of retroelements, we expect long interspersed elements (LINEs to be able to display a high degree of transcriptional interference. In contrast, we expect short interspersed elements (SINEs to display very low levels of transcriptional interference. We find that genomic regions devoid of long interspersed elements (LINEs are enriched for protein-coding genes, but that this is not the case for regions devoid of short interspersed elements (SINEs. This is expected if genes are subject to selection against transcriptional interference. We do not find microRNAs to be associated with genomic regions devoid of either SINEs or LINEs. We further observe an increased relative activity of genes overlapping LINE-free regions during early embryogenesis, where activity of LINEs has been identified previously. CONCLUSIONS/SIGNIFICANCE: Our observations are consistent with the notion that selection against transcriptional interference has contributed to the maintenance and/or generation of retroelement-free regions in the human genome.
Chen, Zhuo; Xu, Shixia; Zhou, Kaiya; Yang, Guang
2011-10-27
A diversity of hypotheses have been proposed based on both morphological and molecular data to reveal phylogenetic relationships within the order Cetacea (dolphins, porpoises, and whales), and great progress has been made in the past two decades. However, there is still some controversy concerning relationships among certain cetacean taxa such as river dolphins and delphinoid species, which needs to be further addressed with more markers in an effort to address unresolved portions of the phylogeny. An analysis of additional SINE insertions and SINE-flanking sequences supported the monophyly of the order Cetacea as well as Odontocete, Delphinoidea (Delphinidae + Phocoenidae + Mondontidae), and Delphinidae. A sister relationship between Delphinidae and Phocoenidae + Mondontidae was supported, and members of classical river dolphins and the genera Tursiops and Stenella were found to be paraphyletic. Estimates of divergence times revealed rapid divergences of basal Odontocete lineages in the Oligocene and Early Miocene, and a recent rapid diversification of Delphinidae in the Middle-Late Miocene and Pliocene within a narrow time frame. Several novel SINEs were found to differentiate Delphinidae from the other two families (Monodontidae and Phocoenidae), whereas the sister grouping of the latter two families with exclusion of Delphinidae was further revealed using the SINE-flanking sequences. Interestingly, some anomalous PCR amplification patterns of SINE insertions were detected, which can be explained as the result of potential ancestral SINE polymorphisms and incomplete lineage sorting. Although a few loci were potentially anomalous, this study demonstrated that the SINE-based approach is a powerful tool in phylogenetic studies. Identifying additional SINE elements that resolve the relationships in the superfamily Delphinoidea and family Delphinidae will be important steps forward in completely resolving cetacean phylogenetic relationships in the future.
Directory of Open Access Journals (Sweden)
Zhou Kaiya
2011-10-01
Full Text Available Abstract Background A diversity of hypotheses have been proposed based on both morphological and molecular data to reveal phylogenetic relationships within the order Cetacea (dolphins, porpoises, and whales, and great progress has been made in the past two decades. However, there is still some controversy concerning relationships among certain cetacean taxa such as river dolphins and delphinoid species, which needs to be further addressed with more markers in an effort to address unresolved portions of the phylogeny. Results An analysis of additional SINE insertions and SINE-flanking sequences supported the monophyly of the order Cetacea as well as Odontocete, Delphinoidea (Delphinidae + Phocoenidae + Mondontidae, and Delphinidae. A sister relationship between Delphinidae and Phocoenidae + Mondontidae was supported, and members of classical river dolphins and the genera Tursiops and Stenella were found to be paraphyletic. Estimates of divergence times revealed rapid divergences of basal Odontocete lineages in the Oligocene and Early Miocene, and a recent rapid diversification of Delphinidae in the Middle-Late Miocene and Pliocene within a narrow time frame. Conclusions Several novel SINEs were found to differentiate Delphinidae from the other two families (Monodontidae and Phocoenidae, whereas the sister grouping of the latter two families with exclusion of Delphinidae was further revealed using the SINE-flanking sequences. Interestingly, some anomalous PCR amplification patterns of SINE insertions were detected, which can be explained as the result of potential ancestral SINE polymorphisms and incomplete lineage sorting. Although a few loci were potentially anomalous, this study demonstrated that the SINE-based approach is a powerful tool in phylogenetic studies. Identifying additional SINE elements that resolve the relationships in the superfamily Delphinoidea and family Delphinidae will be important steps forward in completely resolving
Resonant X-ray Raman scattering for Al, Si and their oxides
International Nuclear Information System (INIS)
Szlachetko, J.; Berset, M.; Dousse, J.-Cl.; Fennane, K.; Szlachetko, M.; Barrett, R.; Hoszowska, J.; Kubala-Kukus, A.; Pajek, M.
2005-01-01
High-resolution measurements of the resonant X-ray Raman scattering (RRS) of Al and Si and their oxides were performed at the European Synchrotron Radiation Facility (ESRF) in Grenoble, France, using a von Hamos Bragg-type curved crystal spectrometer. To probe the influence of chemical effects on the RRS X-ray spectra, Al 2 O 3 and SiO 2 samples were also investigated. The X-ray RRS spectra were measured at different photon beam energies tuned below the K-absorption edge. The measured spectra are compared to results of RRS calculations based on the second-order perturbation theory within the Kramers-Heisenberg approach
Kβ spectra of heliumlike chromium from an electron-beam ion trap
International Nuclear Information System (INIS)
Decaux, V.; Beiersdorfer, P.; Elliott, S.; Osterheld, A.
1993-01-01
Kβ spectra of heliumlike chromium have been recorded using the Livermore electron-beam ion trap (EBIT) with a high-resolution Bragg crystal spectrometer in the von Hamos configuration, in the wavelong range from 1.870 Angstrom. Measurements have been made both for direct excitation at an electron beam energy of 8 k and dielectronic recombination around the KLM resonance energy of 5 keV. In order to evaluate the resonance strength the lithiumlike dielectronic satellites, we used a data routine technique to accumulate spectra at 15 different beam energies between 4.96 and 5.28 keV. Results are compared to theoretical calculations using the multiconfiguration parametric potential method
International Nuclear Information System (INIS)
Kong, Qingzhao; Song, Gangbing; Hou, Shuang; Ji, Qing; Mo, Y L
2013-01-01
Very early age (0–20 h) concrete hydration is a complicated chemical reaction. During the very early age period, the concrete condition dramatically changes from liquid state to solid state. This paper presents the authors’ recent research on monitoring very early age concrete hydration characterization by using piezoceramic based smart aggregates. The smart aggregate (SA) transducer is designed as a sandwich structure using two marble blocks and a pre-soldered lead zirconate titanate (PZT) patch. Based on the electromechanical property of piezo materials, the PZT patches function as both actuators and sensors. In addition, the marble blocks provide reliable protection to the fragile PZT patch and develop the SA into a robust embedded actuator or sensor in the structure. The active-sensing approach, which involved a pair of smart aggregates with one as an actuator and the other one as a sensor, was applied in this paper’s experimental investigation of concrete hydration characterization monitoring. In order to completely understand the hydration condition of the inhomogeneous, over-cluttering, high-scattering characteristics of concrete (specifically of very early concrete), a swept sine wave and several constant frequency sine waves were chosen and produced by a function generator to excite the embedded actuating smart aggregate. The PZT vibration induced ultrasonic wave propagated through the concrete and was sent to the other smart aggregate sensor. The electrical signal transferred from the smart aggregate sensor was recorded during the test. As the concrete hydration reaction was occurring, the characteristic of the electrical signal continuously changed. This paper describes the successful investigation of the three states (the fluid state, the transition state, and the hardened state) of very early age concrete hydration based on classification of the received electrical signal. Specifically, the amplitude and frequency response of the electrical
Ma, Xinbo; Wong, Pak Kin; Zhao, Jing; Xie, Zhengchao
2016-01-01
Active front steering (AFS) is an emerging technology to improve the vehicle cornering stability by introducing an additional small steering angle to the driver’s input. This paper proposes an AFS system with a variable gear ratio steering (VGRS) actuator which is controlled by using the sliding mode control (SMC) strategy to improve the cornering stability of vehicles. In the design of an AFS system, different sensors are considered to measure the vehicle state, and the mechanism of the AFS system is also modelled in detail. Moreover, in order to improve the cornering stability of vehicles, two dependent objectives, namely sideslip angle and yaw rate, are considered together in the design of SMC strategy. By evaluating the cornering performance, Sine with Dwell and accident avoidance tests are conducted, and the simulation results indicate that the proposed SMC strategy is capable of improving the cornering stability of vehicles in practice. PMID:28036037
The world trade organisation and Human Rights: The role of ...
African Journals Online (AJOL)
This contribution attempts to make clear what these activities are and how they may affect the protection of human rights. The implementation of good governance principles in international organisations can be considered a sine qua non for the realisation of human rights. Therefore, it will be examined what role the ...
Geodatabase model for global geologic mapping: concept and implementation in planetary sciences
Nass, Andrea
2017-04-01
One aim of the NASA Dawn mission is to generate global geologic maps of the asteroid Vesta and the dwarf planet Ceres. To accomplish this, the Dawn Science Team followed the technical recommendations for cartographic basemap production. The geological mapping campaign of Vesta was completed and published, but mapping of the dwarf planet Ceres is still ongoing. The tiling schema for the geological mapping is the same for both planetary bodies and for Ceres it is divided into two parts: four overview quadrangles (Survey Orbit, 415 m/pixel) and 15 more detailed quadrangles (High Altitude Mapping HAMO, 140 m/pixel). The first global geologic map was based on survey images (415 m/pixel). The combine 4 Survey quadrangles completed by HAMO data served as basis for generating a more detailed view of the geologic history and also for defining the chronostratigraphy and time scale of the dwarf planet. The most detailed view can be expected within the 15 mapping quadrangles based on HAMO resolution and completed by the Low Altitude Mapping (LAMO) data with 35 m/pixel. For the interpretative mapping process of each quadrangle one responsible mapper was assigned. Unifying the geological mapping of each quadrangle and bringing this together to regional and global valid statements is already a very time intensive task. However, another challenge that has to be accomplished is to consider how the 15 individual mappers can generate one homogenous GIS-based project (w.r.t. geometrical and visual character) thus produce a geologically-consistent final map. Our approach this challenge was already discussed for mapping of Vesta. To accommodate the map requirements regarding rules for data storage and database management, the computer-based GIS environment used for the interpretative mapping process must be designed in a way that it can be adjusted to the unique features of the individual investigation areas. Within this contribution the template will be presented that uses standards
Naceri, A.; Vautrin, A.
2005-05-01
L'objet de cet article est de proposer une géométrie d'éprouvette pour la caractérisation de la réponse mécanique d'un composite constitué de 12 plis de tissus de fibres de verre noyé dans une résine époxyde. Des essais de traction uniaxiale en rampe monotone réalisés sur différentes configurations géométriques d'éprouvettes avec différentes vitesses d'essais et le calcul numérique par éléments finis de la répartition des contraintes dans la zone centrale du modèle expérimental proposé, nous ont permis de justifier le choix d'une éprouvette profilée avec un rayon de 1000 mm qui présente une section réduite au centre et pour laquelle la rupture survient dans la zone centrale sans chute notable des caractéristiques mécaniques ultimes par rapport à l'éprouvette de forme parallélépipédique.
"'The Natural World Is the Most Universal of Languages'
DEFF Research Database (Denmark)
Bjerre, Thomas Ærvold
2007-01-01
Interview med den amerikanske forfatter Ron Rash. Rash taler bl.a. om de forskellige temaer i sine værker, om forholdet til naturen, og regionale fordomme i USA og om sine skrivevaner. Udgivelsesdato: Winter...
International Nuclear Information System (INIS)
Lee, J. P.; Kim, H. G.; Han, S. C.
2012-01-01
In this paper, we designed Active Magnetic Bearing (AMB) for large scale Superconductor Flywheel Energy Storage System (SFESS) and PD controller for AMB. And we experimentally evaluated SFESS including hybrid type AMB. The radial AMB was designed to provide force slew rate that was sufficient for the unbalance disturbances at the maximum operating speed. The thrust AMB is a hybrid type where a permanent magnet carries the weight of the flywheel and an electromagnetic actuator generates the dynamic control force. We evaluated the design performance of the manufactured AMB through comparison of FEM analysis and the results of experimental force measurement. In order to obtain gains of PD controller and design a notch filter, the system identification was performed through measuring frequency response including dynamics for the AMBs, a power amp and a sensor using a sine swept test method after levitating the flywheel. Through measuring the current input of the AMBs and the orbit of a flywheel according to rotational speed, we verified excellent control performance of the AMBs with small amount current for the large scale SFESS.
Wagstaff, Bradley J; Kroutter, Emily N; Derbes, Rebecca S; Belancio, Victoria P; Roy-Engel, Astrid M
2013-01-01
Non-long terminal repeat retroelements continue to impact the human genome through cis-activity of long interspersed element-1 (LINE-1 or L1) and trans-mobilization of Alu. Current activity is dominated by modern subfamilies of these elements, leaving behind an evolutionary graveyard of extinct Alu and L1 subfamilies. Because Alu is a nonautonomous element that relies on L1 to retrotranspose, there is the possibility that competition between these elements has driven selection and antagonistic coevolution between Alu and L1. Through analysis of synonymous versus nonsynonymous codon evolution across L1 subfamilies, we find that the C-terminal ORF2 cys domain experienced a dramatic increase in amino acid substitution rate in the transition from L1PA5 to L1PA4 subfamilies. This observation coincides with the previously reported rapid evolution of ORF1 during the same transition period. Ancestral Alu sequences have been previously reconstructed, as their short size and ubiquity have made it relatively easy to retrieve consensus sequences from the human genome. In contrast, creating constructs of extinct L1 copies is a more laborious task. Here, we report our efforts to recreate and evaluate the retrotransposition capabilities of two ancestral L1 elements, L1PA4 and L1PA8 that were active ~18 and ~40 Ma, respectively. Relative to the modern L1PA1 subfamily, we find that both elements are similarly active in a cell culture retrotransposition assay in HeLa, and both are able to efficiently trans-mobilize Alu elements from several subfamilies. Although we observe some variation in Alu subfamily retrotransposition efficiency, any coevolution that may have occurred between LINEs and SINEs is not evident from these data. Population dynamics and stochastic variation in the number of active source elements likely play an important role in individual LINE or SINE subfamily amplification. If coevolution also contributes to changing retrotransposition rates and the progression of
78 FR 49121 - Changes in Flood Elevation Determinations
2013-08-13
..., 2011; June Mr. Raymond E. Sines, July 01, 2011 390771 of Lake County (10- 21, 2011; The News President.... Sines, December 16, 2011 390771 of Lake County (11- August 18, 2011; President, Lake County 05-2150P...
African Journals Online (AJOL)
PC1
control. In western Senegal Sine Saloum Region, lowlands salinity is due to sea contact. ... et Gestion des Ressources Naturelles au Sine-. Saloum ...... en mesure de dire que : - les sols des bas ... determinants of irrigated rice performance in.
On the prolongation structure and Backlund transformation for new non-linear Klein-Gordon equations
International Nuclear Information System (INIS)
Roy Chowdhury, A.; Mukherjee, J.
1986-07-01
We have considered the complete integrability of two nonlinear equations which are some kind of extensions of usual Sine-Gordon and Sinh-Gordon equations. The first one is of non-autonomous version of Sinh-Gordon system and the second is closely related to the usual Sine-Gordon theory. The first problem indicates how (x,t) dependent non-linear equations can be treated in the prolongation theory and how a Backlund map can be constructed. The second one is a variation of the usual Sine-Gordon equation and suggests that there may be other equations (similar to Sine-Gordon) which are completely integrable. In both cases we have been able to construct the Lax pair. We then construct an auto-Backlund map by following the idea of Konno and Wadati, for the generation of multisolution states. (author)
Iron Toxicity in the Retina Requires Alu RNA and the NLRP3 Inflammasome
Directory of Open Access Journals (Sweden)
Bradley D. Gelfand
2015-06-01
Full Text Available Excess iron induces tissue damage and is implicated in age-related macular degeneration (AMD. Iron toxicity is widely attributed to hydroxyl radical formation through Fenton’s reaction. We report that excess iron, but not other Fenton catalytic metals, induces activation of the NLRP3 inflammasome, a pathway also implicated in AMD. Additionally, iron-induced degeneration of the retinal pigmented epithelium (RPE is suppressed in mice lacking inflammasome components caspase-1/11 or Nlrp3 or by inhibition of caspase-1. Iron overload increases abundance of RNAs transcribed from short interspersed nuclear elements (SINEs: Alu RNAs and the rodent equivalent B1 and B2 RNAs, which are inflammasome agonists. Targeting Alu or B2 RNA prevents iron-induced inflammasome activation and RPE degeneration. Iron-induced SINE RNA accumulation is due to suppression of DICER1 via sequestration of the co-factor poly(C-binding protein 2 (PCBP2. These findings reveal an unexpected mechanism of iron toxicity, with implications for AMD and neurodegenerative diseases associated with excess iron.
A Note on Jordan, Adamović-Mitrinović, and Cusa Inequalities
Directory of Open Access Journals (Sweden)
Zhen-Hang Yang
2014-01-01
Full Text Available We improve the Jordan, Adamović-Mitrinović, and Cusa inequalities. As applications, several new Shafer-Fink type inequalities for inverse sine function and bivariate means inequalities are established, and a new estimate for sine integral is given.
One-dimensional field theories with odd-power self-interactions
International Nuclear Information System (INIS)
Fullin, W.C.
1978-01-01
Classical solutions to nonlinear field theories are considered as model particles. Two fields are examined here, the lambdaphi 3 field and a generalization of the sine-Gordon system. Each of these fields is in one space dimension and quantization is accomplished using the WKB method. Static solutions to the lambdaphi 3 field are shown to represent objects with an internal structure resembling a dumbbell. The quantum mass of these objects is computed in the weak-coupling limit and an approximate expression for the classical force between two of these objects is obtained. This force seems to be attractive and constant at large separations. In the case of the generalized sine-Gordon field it is shown that classical solutions to the field equation may be obtained by a transformation from known solutions to the sine-Gordon equation. The behavior of this field is therefore similar to that of the sine-Gordon field
Effect of various periodic forces on Duffing oscillator
Indian Academy of Sciences (India)
Bifurcations and chaos in the ubiquitous Duffing oscillator equation with different external periodic forces are studied numerically. The external periodic forces considered are sine wave, square wave, rectified sine wave, symmetric saw-tooth wave, asymmetric saw-tooth wave, rectangular wave with amplitude-dependent ...
Directory of Open Access Journals (Sweden)
Miléo J. -C.
2006-11-01
Full Text Available Le procédé de séchage des peintures et vernis par irradiation électronique est analysé sous son aspect chimique. On passe en revue les différents modes de synthèse permettant d'obtenir les résines radiodurcissables qui font l'objet, sur le plan des brevets, d'une abondante littérature. Ces résines sont classées suivant la nature des insaturations réactives qu'elles contiennent - insaturations de type « ester maléique », - esters et amides (méthacryliques simples; - esters (méthacryliques à enchaînements uréthanes ; - esters (méthacryliques (p-hydroxylés, leurs esters (insaturés et autres dérivés, - siloxanes; - maléimides; - insaturations « allyliques » ; - résines saturées. The process of drying points and varnishes by electron irradiation is analyzed from the chemical standpoint. A review is mode of the different synthesis methods of pro ducing radiation-curable resins that have resulted in abundant patent literature. These resins are classified according ta the nature of the reactive unsaturations they contain - unsaturations of the « maleic ester » type; - simple (methacrylic esters and amides ; - 3-hydroxyl (methacrylic esters, their (unsaturated esters and other derivatives ; - siloxanes ; - maleimides ; - « allylic » unsaturations ; - saturated resins
Optical analog transmission device
International Nuclear Information System (INIS)
Ikawa, Shinji.
1994-01-01
The present invention concerns a device such as electro-optical conversion elements, optoelectric-electric elements and optical transmission channel, not undergoing deleterious effects on the efficiency of conversion and transmission due to temperature, and aging change. That is, a sine wave superposing means superposes, on a detector signal to be transmitted, a sine-wave signal having a predetermined amplitude and at a frequency lower than that of the detector signal. An optoelectric conversion means converts the electric signal as the signal of the sine-wave signal superposing means into an optical signal and outputs the same to an optical transmitting channel. The optoelectric conversion means converts the transmitted signal to an electric signal. A discriminating means discriminates the electric signal into a detector signal and a sine-wave signal. A calculating means calculates an optical transmitting efficiency of the transmitting channel based on the amplitude of the discriminated sine-wave signal. A processing means compensates an amplitude value of the detector signals discriminated by the discriminating means based on the optical transmission efficiency. As a result, an optical analog transmission device can be attained, which conducts optical transmission at a high accuracy without undergoing the defective effects of the optical transmission efficiency. (I.S.)
Quantum restoration of broken symmetry in onedimensional loop ...
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 82; Issue 6. Quantum restoration of broken symmetry in ... Keywords. Non-local transformation; broken symmetry; sine-Gordon; sech interaction. ... A specific type of classically broken symmetry is restored in quantum theory. One-dimensional sine-Gordon system and ...
A Nuclear Attack on Traumatic Brain Injury: Sequestration of Cell Death in the Nucleus.
Tajiri, Naoki; De La Peña, Ike; Acosta, Sandra A; Kaneko, Yuji; Tamir, Sharon; Landesman, Yosef; Carlson, Robert; Shacham, Sharon; Borlongan, Cesar V
2016-04-01
Exportin 1 (XPO1/CRM1) plays prominent roles in the regulation of nuclear protein export. Selective inhibitors of nuclear export (SINE) are small orally bioavailable molecules that serve as drug-like inhibitors of XPO1, with potent anti-cancer properties. Traumatic brain injury (TBI) presents with a secondary cell death characterized by neuroinflammation that is putatively regulated by nuclear receptors. Here, we report that the SINE compounds (KPT-350 or KPT-335) sequestered TBI-induced neuroinflammation-related proteins (NF-(k)B, AKT, FOXP1) within the nucleus of cultured primary rat cortical neurons, which coincided with protection against TNF-α (20 ng/mL)-induced neurotoxicity as shown by at least 50% and 100% increments in preservation of cell viability and cellular enzymatic activity, respectively, compared to non-treated neuronal cells (P's nucleus as an efficacious treatment for TBI. © 2016 John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Tiziani, Stefano; Lodi, Alessia; Ludwig, Christian; Parsons, Helen M.; Viant, Mark R.
2008-01-01
Two dimensional (2D) homonuclear 1 H J-resolved (JRES) nuclear magnetic resonance spectroscopy is increasingly used in metabolomics. This approach visualises metabolite chemical shifts and scalar couplings along different spectral dimensions, thereby increasing peak dispersion and facilitating spectral assignments and accurate quantification. Here, we optimise the processing of 2D JRES spectra by evaluating different window functions, a traditional sine-bell (SINE) and a combined sine-bell-exponential (SEM) function. Furthermore, we evaluate different projection methods for generating 1D projected spectra (pJRES). Spectra were recorded from three disparate types of biological samples and evaluated in terms of sensitivity, reproducibility and resolution. Overall, the SEM window function yielded considerably higher sensitivity and comparable spectral reproducibility and resolution compared to SINE, for both 1D pJRES and 2D JRES datasets. Furthermore, for pJRES spectra, the highest spectral quality was obtained using SEM combined with skyline projection. These improvements lend further support to utilising 2D J-resolved spectroscopy in metabolomics
Liflyand, E.
2012-01-01
We study an extension to Fourier transforms of the old problem on absolute convergence of the re-expansion in the sine (cosine) Fourier series of an absolutely convergent cosine (sine) Fourier series. The results are obtained by revealing certain relations between the Fourier transforms and their Hilbert transforms.
Characterization of the past and current duplication activities in the human 22q11.2 region
Directory of Open Access Journals (Sweden)
Morrow Bernice
2011-01-01
Full Text Available Abstract Background Segmental duplications (SDs on 22q11.2 (LCR22, serve as substrates for meiotic non-allelic homologous recombination (NAHR events resulting in several clinically significant genomic disorders. Results To understand the duplication activity leading to the complicated SD structure of this region, we have applied the A-Bruijn graph algorithm to decompose the 22q11.2 SDs to 523 fundamental duplication sequences, termed subunits. Cross-species syntenic analysis of primate genomes demonstrates that many of these LCR22 subunits emerged very recently, especially those implicated in human genomic disorders. Some subunits have expanded more actively than others, and young Alu SINEs, are associated much more frequently with duplicated sequences that have undergone active expansion, confirming their role in mediating recombination events. Many copy number variations (CNVs exist on 22q11.2, some flanked by SDs. Interestingly, two chromosome breakpoints for 13 CNVs (mean length 65 kb are located in paralogous subunits, providing direct evidence that SD subunits could contribute to CNV formation. Sequence analysis of PACs or BACs identified extra CNVs, specifically, 10 insertions and 18 deletions within 22q11.2; four were more than 10 kb in size and most contained young AluYs at their breakpoints. Conclusions Our study indicates that AluYs are implicated in the past and current duplication events, and moreover suggests that DNA rearrangements in 22q11.2 genomic disorders perhaps do not occur randomly but involve both actively expanded duplication subunits and Alu elements.
Sun, Xiaoli; Abshire, James B.
2011-01-01
seeder lasers, one on-line and one offline that are intensity modulated by two different frequency sine-waves signals before being amplified by a common laser amplifier. The receiver uses narrowband amplitude demodulation, or lock-in, Signal processing at the given laser modulation frequencies [3,4]. The laser transmitter operates in a quasi CW mode with the peak power equal to twice the average power. The on-line and off-line lasers can be transmitted at the same time without interference. Another direct detection technique uses a low duty cycle pulsed laser modulation [5,6] with the laser wavelengths alternating between on-line and off-line on successive pulses. The receiver uses time resolved detection and can also provide simultaneous target range measurement. With a lower laser duty cycle it requires a much higher peak laser power for the same average power.
Visible Color and Photometry of Bright Materials on Vesta
Schroder, S. E.; Li, J. Y.; Mittlefehldt, D. W.; Pieters, C. M.; De Sanctis, M. C.; Hiesinger, H.; Blewett, D. T.; Russell, C. T.; Raymond, C. A.; Keller, H. U.
2012-01-01
The Dawn Framing Camera (FC) collected images of the surface of Vesta at a pixel scale of 70 m in the High Altitude Mapping Orbit (HAMO) phase through its clear and seven color filters spanning from 430 nm to 980 nm. The surface of Vesta displays a large diversity in its brightness and colors, evidently related to the diverse geology [1] and mineralogy [2]. Here we report a detailed investigation of the visible colors and photometric properties of the apparently bright materials on Vesta in order to study their origin. The global distribution and the spectroscopy of bright materials are discussed in companion papers [3, 4], and the synthesis results about the origin of Vestan bright materials are reported in [5].
Energy Technology Data Exchange (ETDEWEB)
Larrauri, E.; Miguel, R.; Arnaiz, S.; Robertson, C.; Smallwood, J.; Coit, J.; Kohnlecher, R.; Ufer, R.; Evangelou, M.; Karapatakis, S.; Kasi, M.
1998-12-31
Development of automated separation technology is essential in increasing recovery rates, particularly from highly mixed and dirty sources such municipal solid wastes, and in reducing recycling costs. This frame moved Gaiker Technological Centre (Spain), Era Technology Ltd. (United Kingdom), Hamos GmbH (Germany) and Komotini Paper Mill (Grecia) to be involved and collaborate with several European partners in the development of generic automated separation and grading of solid materials based on electrostatic techniques. Results derived from this original work are now being successfully applied by the industry to the pilot scale separation and grading of paper and plastic from mixed input streams. Electrostatic separation developed devices are protected under European patents. The European Commission has financed this work under the Brite Euram Program. (Author) 5 refs.
Wenzig, E M; Widowitz, U; Kunert, O; Chrubasik, S; Bucar, F; Knauder, E; Bauer, R
2008-10-01
The aim of the present study was to compare powdered rose hip with and without fruits (Rosae pseudofructus cum/sine fructibus, Rosa canina L., Rosaceae) with regard to their phytochemical profile and their in vitro anti-inflammatory and radical-scavenging properties. The two powders were subsequently extracted with solvents of increasing polarity and tested for inhibition of cyclooxygenase (COX-1, COX-2) and of 5-LOX-mediated leukotriene B(4) (LTB(4)) formation as well as for DPPH-radical-scavenging capacity. While the water and methanol extracts were inactive in the COX-1, COX-2 and LTB(4) inhibition assays, the n-hexane and the dichloromethane extracts inhibited all three enzymes. In the active extracts, the triterpenoic acids ursolic acid, oleanolic acid and betulinic acid were identified, although only in minute amounts. Furthermore, oleic, linoleic and alpha-linolenic acid were identified apart from several saturated fatty acids. Even though unsaturated fatty acids are known to be good inhibitors of COX-1, COX-2 and LT formation, no clear correlation between their concentration in the extracts and their activity was found. We suggest that other, yet unidentified, lipophilic constituents might play a more important role for the observed in vitro inhibitory activity on arachidonic acid metabolism. Some of the extracts also showed considerable DPPH radical scavenging activity, the methanolic extracts being most potent. The radical scavenging activity of the extracts correlated very well with their total phenolic content, while ascorbic acid contributes only little to the radical-scavenging activity due to its low concentration present in the extracts. In summary, extracts derived from powdered rose hip without fruits were more effective in all assays carried out compared with extracts derived from powdered rose hip with fruits.
DEFF Research Database (Denmark)
Dickson, Thomas
1999-01-01
Der burde i langt højere grad være mulighed for at man kan kombinere sine arkitektstudier med andre fag. Prøv at forestille sig, at man kunne kombinere sine srkitekturstudier med journalistik, kunsthistorie, ergonomi, økonomi, kunstpædagogik, akustik, sociologi, antropologi, historie eller et helt...
Et episk sus for læsere i alle aldre
DEFF Research Database (Denmark)
Davidsen-Nielsen, Niels
2014-01-01
Eftertanken. Ligesom Charles Dickens udgav Alexandre Dumas sine værker som avisføljetoner, og deres værker holder den dag i dag.......Eftertanken. Ligesom Charles Dickens udgav Alexandre Dumas sine værker som avisføljetoner, og deres værker holder den dag i dag....
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
We wish to report the occurrence of vibrational resonance in certain discrete systems like sine square map and sine circle map, in a unique fashion, comprising of multiple resonant peaks which pave the way for enrichment. As the systems of our choice are capable of exhibiting vibrational resonance behaviour unlike the ...
ECO-CASTING OF AEOLIAN BLADES AND SOLAR PANELS WITH ...
African Journals Online (AJOL)
closed mould manufacturing process that takes into account environment preservation and health protection besides ... procédé RTM (Resin Transfer Moulding = moulage par transfert de résine) sur lequel nous focaliserons notre ... Etape 3 : injection de la résine et imprégnation progressive du renfort jusqu'au remplissage.
Fourier transform and its application to 1D and 2D NMR
International Nuclear Information System (INIS)
Canet, D.
1988-01-01
In this review article, the following points are developed: Pulsed NMR and Fourier transform; Fourier transform and two-dimensional spectroscopy; Mathematical properties of Fourier transform; Fourier transform of a sine function- one dimensional NMR; Fourier transform of a product of sine functions - two-dimensional NMR; Data manipulations in the time domain; Numerical Fourier transform [fr
Detecting Disease in Radiographs with Intuitive Confidence
Directory of Open Access Journals (Sweden)
Stefan Jaeger
2015-01-01
Full Text Available This paper argues in favor of a specific type of confidence for use in computer-aided diagnosis and disease classification, namely, sine/cosine values of angles represented by points on the unit circle. The paper shows how this confidence is motivated by Chinese medicine and how sine/cosine values are directly related with the two forces Yin and Yang. The angle for which sine and cosine are equal (45° represents the state of equilibrium between Yin and Yang, which is a state of nonduality that indicates neither normality nor abnormality in terms of disease classification. The paper claims that the proposed confidence is intuitive and can be readily understood by physicians. The paper underpins this thesis with theoretical results in neural signal processing, stating that a sine/cosine relationship between the actual input signal and the perceived (learned input is key to neural learning processes. As a practical example, the paper shows how to use the proposed confidence values to highlight manifestations of tuberculosis in frontal chest X-rays.
Removal of Stationary Sinusoidal Noise from Random Vibration Signals.
Energy Technology Data Exchange (ETDEWEB)
Johnson, Brian; Cap, Jerome S.
2018-02-01
In random vibration environments, sinusoidal line noise may appear in the vibration signal and can affect analysis of the resulting data. We studied two methods which remove stationary sine tones from random noise: a matrix inversion algorithm and a chirp-z transform algorithm. In addition, we developed new methods to determine the frequency of the tonal noise. The results show that both of the removal methods can eliminate sine tones in prefabricated random vibration data when the sine-to-random ratio is at least 0.25. For smaller ratios down to 0.02 only the matrix inversion technique can remove the tones, but the metrics to evaluate its effectiveness also degrade. We also found that using fast Fourier transforms best identified the tonal noise, and determined that band-pass-filtering the signals prior to the process improved sine removal. When applied to actual vibration test data, the methods were not as effective at removing harmonic tones, which we believe to be a result of mixed-phase sinusoidal noise.
Chromaticity tracking using a phase modulation technique
International Nuclear Information System (INIS)
Tan, C.Y.; Fermilab
2007-01-01
In the classical chromaticity measurement technique, chromaticity is measured by measuring the change in betatron tune as the RF frequency is varied. This paper will describe a novel way of measuring chromaticity: we will phase modulate the RF with a known sine wave and then phase demodulate the betatron frequency. The result is a line in Fourier space which corresponds to the frequency of our sine wave modulation. The peak of this sine wave is proportional to chromaticity. For this technique to work, a tune tracker PLL system is required because it supplies the betatron carrier frequency. This method has been tested in the Tevatron and we will show the results here
Memory and convulsive stimulation: effects of stimulus waveform.
Spanis, C W; Squire, L R
1981-09-01
Electrical stimulation with brief pulses can produce a seizure requiring less energy than conventional sine-wave stimulation, and it has been suggested that brief-pulse stimulation might reduce the memory loss associated with electroconvulsive therapy (ECT). The authors evaluated the effects of electroconvulsive shock (ECS) on memory in mice by using various waveforms, current intensities, training-ECS intervals, pulse widths, and stimulus durations. When equated for ability to produce seizures, low-energy, brief-pulse stimulation caused as much amnesia as sine-wave stimulation and sometimes more. In the absence of comparisons of the amnesic effects of brief-pulse and sine-wave stimulation in humans, the use of brief pulses for administering ECT is unwarranted.
DEFF Research Database (Denmark)
Vaaben, Nana Katrine
2001-01-01
som både Claude Levi-Strauss lægger op til i sine klassiske studier af "den vilde tanke", og som Jean Baudrillard siden har lagt op til i sine analyser af samlere som en slags ekstreme forbrugere, der er i færd med at komplettere deres identitet gennem besiddelser af genstande. Imidlertid tillægger...
DEFF Research Database (Denmark)
Pedersen, Jens Olaf Pepke
2017-01-01
Multivers. Er der kun ét, eller er der utallige universer med hver sine naturlove? Det er emnet for en nyoversat bog af fysikeren Stephen Hawking og forfatteren Leonard Mlodinow.......Multivers. Er der kun ét, eller er der utallige universer med hver sine naturlove? Det er emnet for en nyoversat bog af fysikeren Stephen Hawking og forfatteren Leonard Mlodinow....
Lindqvist, U; Gudbjornsson, B; Iversen, L; Laasonen, L; Ejstrup, L; Ternowitz, T; Ståhle, M
2017-11-01
To describe the social status and health-related quality of life of patients with psoriatic arthritis mutilans (PAM) in the Nordic countries. Patients with at least one mutilated joint confirmed by radiology were studied. Disease activity involving joints and skin, physician-assessed disease activity, and patient's education and work status were recorded. Data from the 36-item Short Form Health Survey, Health Assessment Questionnaire and Dermatology Life Quality Index questionnaire were gathered and correlated with disease duration, pain, and general well-being (visual analogue scale). The controls were 58 Swedish patients with long-standing psoriatic arthritis sine PAM. Sixty-seven patients were included. Patients with PAM had a protracted disease history (33 ± 14 years) and disease onset at a relatively early age (30 ± 12 years). Overall inflammatory activity at inclusion was mild to moderate. The mean number of mutilated joints was 8.2 and gross deformity was found in 16% of patients. Forty per cent were treated with biological and 32% with conventional synthetic disease-modifying anti-rheumatic drugs. Forty-two per cent had retired early or were on sick leave. Impaired functional capacity with little or no ability to perform self-care or everyday tasks was reported by 21% of the patients. Patients between 45 and 60 years of age reported the most impaired quality of life in comparison to the control group. PAM seriously affects social functioning. Whether early recognition of PAM and new forms of therapy can improve disease outcome and quality of life remains to be studied.
Multiphase averaging of periodic soliton equations
International Nuclear Information System (INIS)
Forest, M.G.
1979-01-01
The multiphase averaging of periodic soliton equations is considered. Particular attention is given to the periodic sine-Gordon and Korteweg-deVries (KdV) equations. The periodic sine-Gordon equation and its associated inverse spectral theory are analyzed, including a discussion of the spectral representations of exact, N-phase sine-Gordon solutions. The emphasis is on physical characteristics of the periodic waves, with a motivation from the well-known whole-line solitons. A canonical Hamiltonian approach for the modulational theory of N-phase waves is prescribed. A concrete illustration of this averaging method is provided with the periodic sine-Gordon equation; explicit averaging results are given only for the N = 1 case, laying a foundation for a more thorough treatment of the general N-phase problem. For the KdV equation, very general results are given for multiphase averaging of the N-phase waves. The single-phase results of Whitham are extended to general N phases, and more importantly, an invariant representation in terms of Abelian differentials on a Riemann surface is provided. Several consequences of this invariant representation are deduced, including strong evidence for the Hamiltonian structure of N-phase modulational equations
On k-string tensions and domain walls in N=1 gluodynamics
International Nuclear Information System (INIS)
Armoni, A.; Shifman, M.
2003-01-01
We discuss the k-dependence of the k-string tension σ k in SU(N) supersymmetric gluodynamics. As is well known, at large N the k-string consists, to leading order, of k noninteracting fundamental strings, so that σ k =kσ 1 . We argue, both from field-theory and string-theory side, that subleading corrections to this formula run in powers of 1/N 2 rather than 1/N, thus excluding the Casimir scaling. We suggest a heuristic model allowing one to relate the k-string tension in four-dimensional gluodynamics with the tension of the BPS domain walls (k-walls). In this model the domain walls are made of a net of strings connected to each other by baryon vertices. The relation emerging in this way leads to the sine formula σ k ∼Λ 2 Nsinπk/N. We discuss possible corrections to the sine law, and present arguments that they are suppressed by 1/k factors. We explain why the sine law does not hold in two dimensions. Finally, we discuss the applicability of the sine formula for non-supersymmetric orientifold field theories
Experimental and Numerical Evaluation of Rock Dynamic Test with Split-Hopkinson Pressure Bar
Directory of Open Access Journals (Sweden)
Kang Peng
2017-01-01
Full Text Available Feasibility of rock dynamic properties by split-Hopkinson pressure bar (SHPB was experimentally and numerically evaluated with ANSYS/LS-DYNA. The effects of different diameters, different loading rates, and different propagation distances on wave dispersion of input bars in SHPB with rectangle and half-sine wave loadings were analyzed. The results show that the dispersion effect on the diameter of input bar, loading rate, and propagation distance under half-sine waveform loading is ignorable compared with the rectangle wave loading. Moreover, the degrees of stress uniformity under rectangle and half-sine input wave loadings are compared in SHPB tests, and the time required for stress uniformity is calculated under different above-mentioned loadings. It is confirmed that the stress uniformity can be realized more easily using the half-sine pulse loading compared to the rectangle pulse loading, and this has significant advantages in the dynamic test of rock-like materials. Finally, the Holmquist-Johnson-Concrete constitutive model is introduced to simulate the failure mechanism and failure and fragmentation characteristics of rock under different strain rates. And the numerical results agree with that obtained from the experiment, which confirms the effectiveness of the model and the method.
Isoplanatic systems in mesooptics
International Nuclear Information System (INIS)
Soroko, L.M.
1989-01-01
The problem of the coma aberration suppression in optics. holography and mesooptics is discussed. A short review of the Abbe sine condition in the holography is given. Then the problem of the isoplanatic system construction in mesooptics is formulated. Its solution in the form of the generalized Abbe sine condition and the Welford theorem concerning the form of the holagram backing is presented. 16 refs.; 13 figs
Radioreklamen skal finde sine ben
Directory of Open Access Journals (Sweden)
Sigurd Bennike
1989-08-01
Full Text Available Den 1. august 1988 startede radioreklamerne i Danmark uden nævneværdig opmærksomhed fra hverken pressen eller medieforskerne. Annoncørerne, reklamebureauerne og de store radiostationer har haft lidt svært ved at finde hinanden. Og heller ikke nemt ved at finde ud af, hvem der skulle producere reklamerne og hvordan sådan nogle skal lyde på dansk. Som det indirekte fremgår af denne artikel, så er det svært at få tal ud af branchen. - Men et kvalificeret gæt lyder på, at der er omsat for mellem 20 og 40 millioner kroner på de første måneder, koncentreret på mindre end 50 af de 237 nærradiosendetilladelser. De radiostationer der vælger at sende reklamer, skal betale 10% af deres omsætning til en særlig radiofond, hvis midler deles ud til de græsrodsradioer, som ikke kan eller vil skaffe sig reklameindtægter.
Udenlandsk ejerskab har sine fordele
DEFF Research Database (Denmark)
Thomsen, Steen
2011-01-01
Det er formentlig rigtigt, at multinationale selskaber er mindre sentimentale med hensyn til at nedlægge danske selskaber, men der er også fordele ved at være en del af en udenlandsk koncern, for eksempel med hensyn til finansiering og markedsadgang....
Reflection of sine-Gordon breathers
DEFF Research Database (Denmark)
Olsen, O. H.; Samuelsen, Mogens Rugholm
1981-01-01
The influence of a boundary on a breather traveling in a Josephson line cavity is examined by means of numerical computations. For a passive termination the breather is reflected into a breather of less energy; when the characteristic impedance of the line equals the external load resistor the br...
Coops bank kan flytte milliard-omsætning
DEFF Research Database (Denmark)
Østergaard Jacobsen, Per
2013-01-01
Coop Danmark har med sine bank-planer flere udfordringer at overvinde i de kommende år, men på sigt kan Coops bank være med til at flytte en milliard-omsætning.......Coop Danmark har med sine bank-planer flere udfordringer at overvinde i de kommende år, men på sigt kan Coops bank være med til at flytte en milliard-omsætning....
Evaluation of Mammalian Interspersed Repeats to investigate the goat genome
Directory of Open Access Journals (Sweden)
P. Mariani
2010-01-01
Full Text Available Among the repeated sequences present in most eukaryotic genomes, SINEs (Short Interspersed Nuclear Elements are widely used to investigate evolution in the mammalian order (Buchanan et al., 1999. One family of these repetitive sequences, the MIR (Mammalian Interspersed Repeats; Jurka et al., 1995, is ubiquitous in all mammals.MIR elements are tRNA-derived SINEs and are identifiable by a conserved core region of about 70 nucleotides.
Puri, Anu; Sine,Jessica; Urban,Cordula; Charron,Heather; Valim,Niksa; Tata,Darrell; Schiff,Rachel; Joshi,Amit; Blumenthal,Robert; Thayer,Derek
2014-01-01
Jessica Sine,1,* Cordula Urban,2,* Derek Thayer,1 Heather Charron,2 Niksa Valim,2 Darrell B Tata,3 Rachel Schiff,4 Robert Blumenthal,1 Amit Joshi,2 Anu Puri1 1Membrane Structure and Function Section, Basic Research Laboratory, Center for Cancer Research, National Cancer Institute – Frederick, Frederick, MD, USA; 2Department of Radiology, Baylor College of Medicine, Houston, TX, USA; 3US Food and Drug Administration, CDRH/OSEL/Division of Physics, White Oak Campus, MD, USA; 4Lester ...
International Nuclear Information System (INIS)
Goetz, G.
1988-01-01
It is shown that the plane-wave solutions for the equations governing the motion of a self-gravitating isothermal fluid in Newtonian hydrodynamics are generated by a sine-Gordon equation which is solvable by an 'inverse scattering' transformation. A transformation procedure is outlined by means of which one can construct solutions of the gravity system out of a pair of solutions of the sine-Gordon equation, which are interrelated via an auto-Baecklund transformation. In general the solutions to the gravity system are obtained in a parametric representation in terms of characteristic coordinates. All solutions of the gravity system generated by the one-and two-soliton solutions of the sine-Gordon equation can be constructed explicitly. These might provide models for the evolution of flat structures as they are predicted to arise in the process of galaxy formation. (author)
What is the Essence of Hypnosis?
Dell, Paul F
2017-01-01
The author explores the nature of hypnosis, which he characterizes as a motivated mode of neural functioning that enables most humans to alter, to varying degrees, their experience of body, self, actions, and world. The essence of hypnosis is not to be found in hetero-hypnosis; instead, it lies in the spontaneous self-activation of that mode of neural functioning. The hypnosis field has substantially lost sight of spontaneous self-activation, because the word hypnosis is usually used to mean hetero-hypnosis. Self-activation of this mode of neural functioning is the necessary sine qua non of hypnotic psychopathology. Moreover, self-activation of trance is the characteristic hypnotic behavior of a distinct subset of highly hypnotizable individuals.
Et overflødighedshorn af overraskende kortslutninger
DEFF Research Database (Denmark)
Larsen, Peter Stein
2015-01-01
Den engelsk-amerikanske digter T. S. Eliot skrev i et af sine berømte essays " The Metaphysical Poets" (1923) om, hvad der er det særlige ved den store digter sammenlignet med andre mennesker.......Den engelsk-amerikanske digter T. S. Eliot skrev i et af sine berømte essays " The Metaphysical Poets" (1923) om, hvad der er det særlige ved den store digter sammenlignet med andre mennesker....
B-spline goal-oriented error estimators for geometrically nonlinear rods
2011-04-01
respectively, for the output functionals q2–q4 (linear and nonlinear with the trigonometric functions sine and cosine) in all the tests considered...of the errors resulting from the linear, quadratic and nonlinear (with trigonometric functions sine and cosine) outputs and for p = 1, 2. If the... Portugal . References [1] A.T. Adams. Sobolev Spaces. Academic Press, Boston, 1975. [2] M. Ainsworth and J.T. Oden. A posteriori error estimation in
International Nuclear Information System (INIS)
Michette, A G; Pfauntsch, S J; Sahraei, S; Shand, M; Morrison, G R; Hart, D; Vojnovic, B; Stevenson, T; Parkes, W; Dunare, C; Willingale, R; Feldman, C; Button, T; Zhang, D; Rodriguez-Sanmartin, D; Wang, H
2009-01-01
This paper describes reflective adaptive/active optics for applications including studies of biological radiation damage. The optics work on the polycapillary principle, but use arrays of channels in thin silicon. For optimum performance the x-rays should reflect once off a channel wall in each of two successive arrays. This reduces aberrations since then the Abbe sine condition is approximately satisfied. Adaptivity is achieved by flexing the arrays via piezo actuation, providing further aberration reduction and controllable focal length.
Influence of Waveform and Current Direction on Short-Interval Intracortical Facilitation
DEFF Research Database (Denmark)
Delvendahl, Igor; Lindemann, Hannes; Jung, Nikolai H
2014-01-01
-posterior (AP) current direction (AP-AP or PA-PA), whereas current direction was reversed between first and second pulse for half-sine paired-pulse stimulation (PA-AP and AP-PA). RESULTS: Monophasic AP-AP stimulation resulted in stronger early SICF at 1.4 ms relative to late SICF at 2.8 and 4.4 ms, whereas...... monophasic PA-PA stimulation produced SICF of comparable size at all three peaks. With half-sine stimulation the third SICF peak was reduced for PA-AP current orientation compared with AP-PA. CONCLUSION: SICF elicited using monophasic as well as half-sine pulses is affected by current direction at clearly......BACKGROUND: Transcranial magnetic stimulation (TMS) of the human primary motor hand area (M1-HAND) can produce multiple descending volleys in fast-conducting corticospinal neurons, especially so-called indirect waves (I-waves) resulting from trans-synaptic excitation. Facilitatory interaction...