WorldWideScience

Sample records for hamo sine actively

  1. High resolution Ceres HAMO atlas derived from Dawn FC images

    Science.gov (United States)

    Roatsch, Thomas; Kersten, Elke; Matz, Klaus-Dieter; Preusker, Frank; Scholten, Frank; Jaumann, Ralf; Raymond, Carol A.; Russell, Chris T.

    2016-04-01

    Introduction: NASA's Dawn spacecraft entered the orbit of dwarf planet Ceres in March 2015, and will characterize the geology, elemental and mineralogical composition, topography, shape, and internal structure of Ceres. One of the major goals of the mission is a global mapping of Ceres. Data: The Dawn mission was mapping Ceres in HAMO (High Altitude Mapping Orbit, 1475 km altitude) between August and October 2015. The framing camera took about 2,600 clear filter images with a resolution of about 140 m/pixel during these cycles. The images were taken with different viewing angles and different illumination conditions. We selected images from one cycle (cycle #1) for the mosaicking process to have similar viewing and illumination conditions. Very minor gaps in the coverage were filled with a few images from cycle #2. Data Processing: The first step of the processing chain towards the cartographic products is to ortho-rectify the images to the proper scale and map projec-tion type. This process requires detailed information of the Dawn orbit and attitude data and of the topography of the targets. Both, improved orientation and a high-resolution shape model, are provided by stereo processing (bundle block adjustment) of the HAMO stereo image dataset [3]. Ceres's HAMO shape model was used for the calculation of the ray intersection points while the map projection itself was done onto the reference sphere of Ceres with a radius of 470 km. The final step is the controlled mosaicking) of all images to a global mosaic of Ceres, the so-called basemap. Ceres map tiles: The Ceres atlas was produced in a scale of 1:750,000 and consists of 15 tiles that conform to the quadrangle scheme proposed by Greeley and Batson [4]. A map scale of 1:750,000 guarantees a mapping at the highest available Dawn resolution in HAMO. The individual tiles were extracted from the global mosaic and reprojected. Nomenclature: The Dawn team proposed 81 names for geological features. By international

  2. Anti-tumor activity of selective inhibitor of nuclear export (SINE) compounds, is enhanced in non-Hodgkin lymphoma through combination with mTOR inhibitor and dexamethasone.

    Science.gov (United States)

    Muqbil, Irfana; Aboukameel, Amro; Elloul, Sivan; Carlson, Robert; Senapedis, William; Baloglu, Erkan; Kauffman, Michael; Shacham, Sharon; Bhutani, Divaya; Zonder, Jeffrey; Azmi, Asfar S; Mohammad, Ramzi M

    2016-12-28

    In previous studies we demonstrated that targeting the nuclear exporter protein exportin-1 (CRM1/XPO1) by a selective inhibitor of nuclear export (SINE) compound is a viable therapeutic strategy against Non-Hodgkin Lymphoma (NHL). Our studies along with pre-clinical work from others led to the evaluation of the lead SINE compound, selinexor, in a phase 1 trial in patients with CLL or NHL (NCT02303392). Continuing our previous work, we studied combinations of selinexor-dexamethasone (DEX) and selinexor-everolimus (EVER) in NHL. Combination of selinexor with DEX or EVER resulted in enhanced cytotoxicity in WSU-DLCL2 and WSU-FSCCL cells which was consistent with enhanced apoptosis. Molecular analysis showed enhancement in the activation of apoptotic signaling and down-regulation of XPO1. This enhancement is consistent with the mechanism of action of these drugs in that both selinexor and DEX antagonize NF-κB (p65) and mTOR (EVER target) is an XPO1 cargo protein. SINE compounds, KPT-251 and KPT-276, showed activities similar to CHOP (cyclophosphamide-hydroxydaunorubicin-oncovin-prednisone) regimen in subcutaneous and disseminated NHL xenograft models in vivo. In both animal models the anti-lymphoma activity of selinexor is enhanced through combination with DEX or EVER. The in vivo activity of selinexor and related SINE compounds relative to 'standard of care' treatment is consistent with the objective responses observed in Phase I NHL patients treated with selinexor. Our pre-clinical data provide a rational basis for testing these combinations in Phase II NHL trials. Copyright © 2016. Published by Elsevier Ireland Ltd.

  3. The HAMO-Based Global Geologic Map of Ceres

    Science.gov (United States)

    Mest, Scott; Crown, David; Aileen Yingst, R.; Berman, Daniel; Williams, David; Buczkowski, Debra; Scully, Jennifer; Platz, Thomas; Jaumann, Ralf; Roatsch, Thomas; Preusker, Frank; Nathues, Andres; Hiesinger, Harold; Hendrik Pasckert, Jan; Raymond, Carol; Russell, Christopher

    2017-04-01

    This abstract discusses current results from the 1:2.5M-scale High Altitude Mapping Orbit (HAMO)-based global geologic mapping effort of Ceres using image, spectral and topographic data from the Dawn mission. Mapping base materials include the Dawn Framing Camera (FC) HAMO mosaic and individual images ( 140 m/pixel), the global HAMO DTM (137 m/pixel) derived from FC stereo images, and FC color mosaics (0.44-0.96 µm). These data are used to identify contacts and features, and for unit characterization. Geologic units are discriminated primarily by differences in albedo and surface texture; FC color images are used to spectrally constrain and characterize units. The map displays contacts and linear features (e.g., structures) represented by polylines, and singular features (e.g., albedo spots) represented by points. Because of map scale, only geologic units greater than 100 km2 in area, impact craters greater than 20 km in diameter, and linear features greater than 20 km in length are shown. Through geologic mapping we have defined several widespread units: cratered terrain, smooth material, and units of the Urvara/Yalode system. Cratered terrain forms the largest unit exposed on Ceres and contains rugged surfaces derived largely from the structures and deposits of impact features. This unit includes the oldest terrains exposed on Ceres, but the geologic materials likely consist of crustal materials mixed with impact materials. Smooth material forms a large deposit of nearly flat-lying to hummocky plains that fill and surround Kerwan basin, and embay the cratered terrain. Geologic materials related to the Urvara and Yalode basins consist of floor, rim, and ejecta deposits. Urvara ejecta consists of a rugged and a smooth facies; Yalode ejecta is distinguished by its smooth and rolling to stucco-like texture. Stratigraphic relations show that ejecta deposits and structures from Urvara superpose Yalode, indicating it is younger. Impact craters are the most prevalent

  4. Dawn FC2 Derived Ceres HAMO DTM SPG V1.0

    Science.gov (United States)

    Roatsch, T.; Kersten, E.; Matz, K.-D.; Preusker, F.; Scholten, F.; Elgner, S.; Schroeder, S. E.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2016-10-01

    This data set contains the Ceres digital terrain model based on the Dawn High Altitude Mapping orbit (HAMO) Framing Camera 2 (FC2) images and derived by using the stereo photo-grametric (SPG) method. The HAMO DTM covers approximately 98% of the Ceres surface (few permanently shadowed areas near the poles required interpolation). The a DTM has a lateral spacing of 136.7 m/pixel (60 pixel/degree) and a vertical accuracy of about 10 m.

  5. Genetic code for sine

    Science.gov (United States)

    Abdullah, Alyasa Gan; Wah, Yap Bee

    2015-02-01

    The computation of the approximate values of the trigonometric sines was discovered by Bhaskara I (c. 600-c.680), a seventh century Indian mathematician and is known as the Bjaskara's I's sine approximation formula. The formula is given in his treatise titled Mahabhaskariya. In the 14th century, Madhava of Sangamagrama, a Kerala mathematician astronomer constructed the table of trigonometric sines of various angles. Madhava's table gives the measure of angles in arcminutes, arcseconds and sixtieths of an arcsecond. The search for more accurate formulas led to the discovery of the power series expansion by Madhava of Sangamagrama (c.1350-c. 1425), the founder of the Kerala school of astronomy and mathematics. In 1715, the Taylor series was introduced by Brook Taylor an English mathematician. If the Taylor series is centered at zero, it is called a Maclaurin series, named after the Scottish mathematician Colin Maclaurin. Some of the important Maclaurin series expansions include trigonometric functions. This paper introduces the genetic code of the sine of an angle without using power series expansion. The genetic code using square root approach reveals the pattern in the signs (plus, minus) and sequence of numbers in the sine of an angle. The square root approach complements the Pythagoras method, provides a better understanding of calculating an angle and will be useful for teaching the concepts of angles in trigonometry.

  6. Genome-wide analysis of a recently active retrotransposon, Au SINE, in wheat: content, distribution within subgenomes and chromosomes, and gene associations.

    Science.gov (United States)

    Keidar, Danielle; Doron, Chen; Kashkush, Khalil

    2018-02-01

    Here, we show that Au SINE elements have strong associations with protein-coding genes in wheat. Most importantly Au SINE insertion within introns causes allelic variation and might induce intron retention. The impact of transposable elements (TEs) on genome structure and function is intensively studied in eukaryotes, especially in plants where TEs can reach up to 90% of the genome in some cases, such as in wheat. Here, we have performed a genome-wide in-silico analysis using the updated publicly available genome draft of bread wheat (T. aestivum), in addition to the updated genome drafts of the diploid donor species, T. urartu and Ae. tauschii, to retrieve and analyze a non-LTR retrotransposon family, termed Au SINE, which was found to be widespread in plant species. Then, we have performed site-specific PCR and realtime RT-PCR analyses to assess the possible impact of Au SINE on gene structure and function. To this end, we retrieved 133, 180 and 1886 intact Au SINE insertions from T. urartu, Ae. tauschii and T. aestivum genome drafts, respectively. The 1886 Au SINE insertions were distributed in the seven homoeologous chromosomes of T. aestivum, while ~ 67% of the insertions were associated with genes. Detailed analysis of 40 genes harboring Au SINE revealed allelic variation of those genes in the Triticum-Aegilops genus. In addition, expression analysis revealed that both regular transcripts and alternative Au SINE-containing transcripts were simultaneously amplified in the same tissue, indicating retention of Au SINE-containing introns. Analysis of the wheat transcriptome revealed that hundreds of protein-coding genes harbor Au SINE in at least one of their mature splice variants. Au SINE might play a prominent role in speciation by creating transcriptome variation.

  7. High SINE RNA Expression Correlates with Post-Transcriptional Downregulation of BRCA1

    Directory of Open Access Journals (Sweden)

    Giovanni Bosco

    2013-04-01

    Full Text Available Short Interspersed Nuclear Elements (SINEs are non-autonomous retrotransposons that comprise a large fraction of the human genome. SINEs are demethylated in human disease, but whether SINEs become transcriptionally induced and how the resulting transcripts may affect the expression of protein coding genes is unknown. Here, we show that downregulation of the mRNA of the tumor suppressor gene BRCA1 is associated with increased transcription of SINEs and production of sense and antisense SINE small RNAs. We find that BRCA1 mRNA is post-transcriptionally down-regulated in a Dicer and Drosha dependent manner and that expression of a SINE inverted repeat with sequence identity to a BRCA1 intron is sufficient for downregulation of BRCA1 mRNA. These observations suggest that transcriptional activation of SINEs could contribute to a novel mechanism of RNA mediated post-transcriptional silencing of human genes.

  8. High-resolution Ceres HAMO Atlas derived from Dawn FC Images

    Science.gov (United States)

    Roatsch, T.; Kersten, E.; Matz, K. D.; Preusker, F.; Scholten, F.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2015-12-01

    Introduction: NASA's Dawn spacecraft will orbit the dwarf planet Ceres in August and September 2015 in HAMO (High Altitude Mapping Orbit) with an altitude of about 1,500 km to characterize for instance the geology, topography, and shape of Ceres before it will be transferred to the lowest orbit. One of the major goals of this mission phase is the global mapping of Ceres. Data: The Dawn mission is equipped with a fram-ing camera (FC). The framing camera will take about 2600 clear filter images with a resolution of about 120 m/pixel and different viewing angles and different illumination conditions. Data Processing: The first step of the processing chain towards the cartographic products is to ortho-rectify the images to the proper scale and map projec-tion type. This process requires detailed information of the Dawn orbit and attitude data and of the topography of the target. Both, improved orientation and high-resolution shape models, are provided by stereo processing of the HAMO dataset. Ceres' HAMO shape model is used for the calculation of the ray intersection points while the map projection itself will be done onto a reference sphere for Ceres. The final step is the controlled mosaicking of all nadir images to a global mosaic of Ceres, the so called basemap. Ceres map tiles: The Ceres atlas will be produced in a scale of 1:750,000 and will consist of 15 tiles that conform to the quadrangle schema for small planets and medium size Icy satellites. A map scale of 1:750,000 guarantees a mapping at the highest availa-ble Dawn resolution in HAMO. Nomenclature: The Dawn team proposed to the International Astronomical Union (IAU) to use the names of gods and goddesses of agriculture and vege-tation from world mythology as names for the craters. This proposal was accepted by the IAU and the team proposed names for geological features to the IAU based on the HAMO mosaic. These feature names will be applied to the map tiles.

  9. High-Resolution Ceres HAMO Color Mosaics derived from Dawn FC Images

    Science.gov (United States)

    Matz, K. D.; Schroeder, S.; Roatsch, T.; Kersten, E.; Preusker, F.; Scholten, F.; Jaumann, R.; Raymond, C. A.; Russell, C.

    2016-12-01

    Introduction: NASA's Dawn spacecraft orbited the dwarf planet Ceres from August to October 2015 in HAMO (High Altitude Mapping Orbit) with an altitude of about 1,500 km to characterize, among others, the geology, topography, and shape of Ceres. Data: The Dawn mission is equipped with a framing camera (FC) which has one broad band clear filter and seven narrow band color filters. The FC took about 4300 color filter images in HAMO with a resolution of about 140 m/pixel. Data Processing: The first steps of the processing chain towards the mosaics are: radiometric calibration and photometric correction of the images followed by ortho-rectification to the proper scale and map projection type. These steps require detailed information of the Dawn orbit, the orientation of the spacecraft, and of the topography of the target. Both, improved orientation and a high-resolution shape model, are provided by the stereo processing of the HAMO clear filter dataset. Ceres' HAMO shape model is used for the calculation of the ray intersection points and the orientation of the surface normals, while the map projection itself is done onto a reference sphere for Ceres. The final step is the controlled mosaicking of all color images to seven global mosaics of Ceres. True color: True color was achieved by scaling FC images acquired through the red, green, and blue filters (effective wavelength 653, 555, and 438 nm) to RGB values calculated from the CIE color matching functions and a Ceres reflectance spectrum. Color ratios: Color ratio image mosaics were calculated using the images of four different narrow band filters; Red channel: 965/749 nanometers (nm); Green channel: 555/749 nm; Blue channel: 438/749 nm. The color ratio image serves to cancel out the dominant brightness variations of the scene (caused by albedo variations and topographic shading) and enhances color differences related to soil mineralogy and, possibly, maturity. Download: All color mosaics will become available to the

  10. The dynamic proliferation of CanSINEs mirrors the complex evolution of Feliforms.

    Science.gov (United States)

    Walters-Conte, Kathryn B; Johnson, Diana L E; Johnson, Warren E; O'Brien, Stephen J; Pecon-Slattery, Jill

    2014-06-20

    Repetitive short interspersed elements (SINEs) are retrotransposons ubiquitous in mammalian genomes and are highly informative markers to identify species and phylogenetic associations. Of these, SINEs unique to the order Carnivora (CanSINEs) yield novel insights on genome evolution in domestic dogs and cats, but less is known about their role in related carnivores. In particular, genome-wide assessment of CanSINE evolution has yet to be completed across the Feliformia (cat-like) suborder of Carnivora. Within Feliformia, the cat family Felidae is composed of 37 species and numerous subspecies organized into eight monophyletic lineages that likely arose 10 million years ago. Using the Felidae family as a reference phylogeny, along with representative taxa from other families of Feliformia, the origin, proliferation and evolution of CanSINEs within the suborder were assessed. We identified 93 novel intergenic CanSINE loci in Feliformia. Sequence analyses separated Feliform CanSINEs into two subfamilies, each characterized by distinct RNA polymerase binding motifs and phylogenetic associations. Subfamily I CanSINEs arose early within Feliformia but are no longer under active proliferation. Subfamily II loci are more recent, exclusive to Felidae and show evidence for adaptation to extant RNA polymerase activity. Further, presence/absence distributions of CanSINE loci are largely congruent with taxonomic expectations within Feliformia and the less resolved nodes in the Felidae reference phylogeny present equally ambiguous CanSINE data. SINEs are thought to be nearly impervious to excision from the genome. However, we observed a nearly complete excision of a CanSINEs locus in puma (Puma concolor). In addition, we found that CanSINE proliferation in Felidae frequently targeted existing CanSINE loci for insertion sites, resulting in tandem arrays. We demonstrate the existence of at least two SINE families within the Feliformia suborder, one of which is actively involved in

  11. Generalized sine-Gordon solitons

    Energy Technology Data Exchange (ETDEWEB)

    Santos, C dos [Centro de Fisica e Departamento de Fisica e Astronomia, Faculdade de Ciencias da Universidade do Porto, 4169-007 Porto (Portugal); Rubiera-Garcia, D, E-mail: cssilva@fc.up.pt, E-mail: rubieradiego@gmail.com [Departamento de Fisica, Universidad de Oviedo, Avenida Calvo Sotelo 18, 33007 Oviedo, Asturias (Spain)

    2011-10-21

    In this paper, we construct analytical self-dual soliton solutions in (1+1) dimensions for two families of models which can be seen as generalizations of the sine-Gordon system but where the kinetic term is non-canonical. For that purpose we use a projection method applied to the sine-Gordon soliton. We focus our attention on the wall and lump-like soliton solutions of these k-field models. These solutions and their potentials reduce to those of the Klein-Gordon kink and the standard lump for the case of a canonical kinetic term. As we increase the nonlinearity on the kinetic term the corresponding potentials get modified and the nature of the soliton may change, in particular, undergoing a topology modification. The procedure constructed here is shown to be a sort of generalization of the deformation method for a specific class of k-field models. (paper)

  12. PCR-based approach to SINE isolation: simple and complex SINEs.

    Science.gov (United States)

    Borodulina, Olga R; Kramerov, Dmitri A

    2005-04-11

    Highly repeated copies of short interspersed elements (SINEs) occur in eukaryotic genomes. The distribution of each SINE family is usually restricted to some genera, families, or orders. SINEs have an RNA polymerase III internal promoter, which is composed of boxes A and B. Here we propose a method for isolation of novel SINE families based on genomic DNA PCR with oligonucleotide identical to box A as a primer. Cloning of the size-heterogeneous PCR-products and sequencing of their terminal regions allow determination of SINE structure. Using this approach, two novel SINE families, Rhin-1 and Das-1, from the genomes of great horseshoe bat (Rhinolophus ferrumequinum) and nine-banded armadillo (Dasypus novemcinctus), respectively, were isolated and studied. The distribution of Rhin-1 is restricted to two of six bat families tested. Copies of this SINE are characterized by frequent internal insertions and significant length (200-270 bp). Das-1 being only 90 bp in length is one of the shortest SINEs known. Most of Das-1 nucleotide sequences demonstrate significant similarity to alanine tRNA which appears to be an evolutionary progenitor of this SINE. Together with three other known SINEs (ID, Vic-1, and CYN), Das-1 constitutes a group of simple SINEs. Interestingly, three SINE families of this group are alanine tRNA-derived. Most probably, this tRNA gave rise to short and simple but successful SINEs several times during mammalian evolution.

  13. Characterization of a novel SINE superfamily from invertebrates: "Ceph-SINEs" from the genomes of squids and cuttlefish.

    Science.gov (United States)

    Akasaki, Tetsuya; Nikaido, Masato; Nishihara, Hidenori; Tsuchiya, Kotaro; Segawa, Susumu; Okada, Norihiro

    2010-04-01

    Five tRNA-derived short interspersed repetitive elements (SINEs), named SepiaSINE, Sepioth-SINE1, Sepioth-SINE2A, Sepioth-SINE2B and OegopSINE, were isolated from the genomes of three decabrachian species [Sepia officinalis (order Sepiida), Sepiotheuthis lessoniana (suborder Myopsida), and Mastigoteuthis cordiformes (suborder Oegopsida)], by random sequencing and genome screening. In addition, two tRNA-derived SINEs, named IdioSINE1 and IdioSINE2, were further detected from EST (expressed sequence tag) data of Idiosepius paradoxus (order Idiosepiida), using a GenBank FASTA search with a conserved sequence of the SepiaSINE as the query. All the isolated SINEs had a common and unique highly conserved 149-bp sequence in their central structures (Sepioth-SINE2B and IdioSINEs, however, had a continuous 73-bp deletion in the conserved region.), and are therefore grouped as the fourth SINE superfamily "Ceph-SINEs", following the CORE-SINE, V-SINE, and DeuSINE superfamilies. Our analysis suggested that the central conserved region called the "Ceph-domain" might have originated before the diversification of cephalopods (505 myr ago). A sequence alignment of Sepioth-SINE1, Sepioth-SINE2A, and Sepioth-SINE2B demonstrated that Sepioth-SINE2A has a chimeric structure shared with two other SINEs. The above relationship suggests possible template switching in the central conserved domain during reverse transcription for the birth of Sepioth-SINE2A, providing the possibility that the presence of the conserved domain contributed to yield a variety of SINEs during evolution. Furthermore, the distributions of the isolated SINEs showed that order Sepiida, suborders Oegopsida and Myopsida, and order Idiosepiida have their own independent SINE(s), and suggest that order Sepiida can be largely separated into two groups, with clarification of the phylogenetic relatedness between subfamily Sepioteuthinae and the other loliginid squids.

  14. High-resolution XES and RIXS studies with a von Hamos Bragg crystal spectrometer

    CERN Document Server

    Hoszowska, J; 10.1016/j.elspec.2004.02.005

    2004-01-01

    The high-resolution von Hamos Bragg crystal spectrometer was constructed for the study of K X-ray emission from low-Z elements and L and M X-ray spectra of medium to high Z elements. Recently, this instrument was applied to high-resolution XES and RIXS studies using X-ray synchrotron radiation at the ID21 and BM5 beamlines at the ESRF. An outline of the spectrometer design and performance characteristics will be given. The studies deal with the energy dependent KL double photoexcitation of argon, the L3 and M1 atomic- level widths of elements 54

  15. Evolutionary applications of MIRs and SINEs

    NARCIS (Netherlands)

    Buchanan, F; Crawford, A; Strobeck, C; Palsboll, P; Plante, Y

    It is believed that short interspersed elements (SINEs) are irreversibly inserted into genomes. We use this concept to try to deduce the evolution of whales using sequence and hybridization studies. The observation that microsatellites are associated with SINEs lead us to screen sequences

  16. A plastic miniature x-ray emission spectrometer based on the cylindrical von Hamos geometry

    Science.gov (United States)

    Mattern, B. A.; Seidler, G. T.; Haave, M.; Pacold, J. I.; Gordon, R. A.; Planillo, J.; Quintana, J.; Rusthoven, B.

    2012-02-01

    We present a short working distance miniature x-ray emission spectrometer (miniXES) based on the cylindrical von Hamos geometry. We describe the general design principles for the spectrometer and detail a specific implementation that covers Kβ and valence level emission from Fe. Large spatial and angular access to the sample region provides compatibility with environmental chambers, microprobe, and pump/probe measurements. The primary spectrometer structure and optic is plastic, printed using a 3-dimensional rapid-prototype machine. The spectrometer is inexpensive to construct and is portable; it can be quickly set up at any focused beamline with a tunable narrow bandwidth monochromator. The sample clearance is over 27 mm, providing compatibility with a variety of environment chambers. An overview is also given of the calibration and data processing procedures, which are implemented by a multiplatform user-friendly software package. Finally, representative measurements are presented. Background levels are below the level of the Kβ2, 5 valence emission, the weakest diagram line in the system, and photometric analysis of count rates finds that the instrument is performing at the theoretical limit.

  17. Short interspersed transposable elements (SINEs) are excluded from imprinted regions in the human genome.

    Science.gov (United States)

    Greally, John M

    2002-01-08

    To test whether regions undergoing genomic imprinting have unique genomic characteristics, imprinted and nonimprinted human loci were compared for nucleotide and retroelement composition. Maternally and paternally expressed subgroups of imprinted genes were found to differ in terms of guanine and cytosine, CpG, and retroelement content, indicating a segregation into distinct genomic compartments. Imprinted regions have been normally permissive to L1 long interspersed transposable element retroposition during mammalian evolution but universally and significantly lack short interspersed transposable elements (SINEs). The primate-specific Alu SINEs, as well as the more ancient mammalian-wide interspersed repeat SINEs, are found at significantly low densities in imprinted regions. The latter paleogenomic signature indicates that the sequence characteristics of currently imprinted regions existed before the mammalian radiation. Transitions from imprinted to nonimprinted genomic regions in cis are characterized by a sharp inflection in SINE content, demonstrating that this genomic characteristic can help predict the presence and extent of regions undergoing imprinting. During primate evolution, SINE accumulation in imprinted regions occurred at a decreased rate compared with control loci. The constraint on SINE accumulation in imprinted regions may be mediated by an active selection process. This selection could be because of SINEs attracting and spreading methylation, as has been found at other loci. Methylation-induced silencing could lead to deleterious consequences at imprinted loci, where inactivation of one allele is already established, and expression is often essential for embryonic growth and survival.

  18. Gravity localization in sine-Gordon braneworlds

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, W.T., E-mail: wilamicruz@gmail.com [Instituto Federal de Educação, Ciência e Tecnologia do Ceará (IFCE), Campus Juazeiro do Norte, 63040-540 Juazeiro do Norte, Ceará (Brazil); Maluf, R.V., E-mail: r.v.maluf@fisica.ufc.br [Departamento de Física, Universidade Federal do Ceará (UFC), C.P. 6030, 60455-760 Fortaleza, Ceará (Brazil); Sousa, L.J.S., E-mail: luisjose@fisica.ufc.br [Instituto Federal de Educação, Ciência e Tecnologia do Ceará (IFCE), Campus Canindé, 62700-000 Canindé, Ceará (Brazil); Almeida, C.A.S., E-mail: carlos@fisica.ufc.br [Departamento de Física, Universidade Federal do Ceará (UFC), C.P. 6030, 60455-760 Fortaleza, Ceará (Brazil)

    2016-01-15

    In this work we study two types of five-dimensional braneworld models given by sine-Gordon potentials. In both scenarios, the thick brane is generated by a real scalar field coupled to gravity. We focus our investigation on the localization of graviton field and the behaviour of the massive spectrum. In particular, we analyse the localization of massive modes by means of a relative probability method in a Quantum Mechanics context. Initially, considering a scalar field sine-Gordon potential, we find a localized state to the graviton at zero mode. However, when we consider a double sine-Gordon potential, the brane structure is changed allowing the existence of massive resonant states. The new results show how the existence of an internal structure can aid in the emergence of massive resonant modes on the brane.

  19. Non-Abelian sine-Gordon solitons

    Directory of Open Access Journals (Sweden)

    Muneto Nitta

    2015-06-01

    Full Text Available We point out that non-Abelian sine-Gordon solitons stably exist in the U(N chiral Lagrangian. They also exist in a U(N gauge theory with two N by N complex scalar fields coupled to each other. One non-Abelian sine-Gordon soliton can terminate on one non-Abelian global vortex. They are relevant in chiral Lagrangian of QCD or in color-flavor locked phase of high density QCD, where the anomaly is suppressed at asymptotically high temperature or density, respectively.

  20. Dilogarithm Identities for Sine-Gordon and Reduced Sine-Gordon Y-Systems

    Directory of Open Access Journals (Sweden)

    Tomoki Nakanishi

    2010-10-01

    Full Text Available We study the family of Y-systems and T-systems associated with the sine-Gordon models and the reduced sine-Gordon models for the parameter of continued fractions with two terms. We formulate these systems by cluster algebras, which turn out to be of finite type, and prove their periodicities and the associated dilogarithm identities which have been conjectured earlier. In particular, this provides new examples of periodicities of seeds.

  1. Fourier Cosine and Sine Transform on fractal space

    OpenAIRE

    Chen, Guang-sheng

    2011-01-01

    In this paper, we establish local fractional Fourier Cosine and Sine Transforms on fractal space, considered some properties of local fractional Cosine and Sine Transforms, show applications of local fractional Fourier Cosine and Sine transform to local fractional equations with local fractional derivative.

  2. Short Interspersed Nuclear Element (SINE Sequences in the Genome of the Human Pathogenic Fungus Aspergillus fumigatus Af293.

    Directory of Open Access Journals (Sweden)

    Lakkhana Kanhayuwa

    Full Text Available Novel families of short interspersed nuclear element (SINE sequences in the human pathogenic fungus Aspergillus fumigatus, clinical isolate Af293, were identified and categorised into tRNA-related and 5S rRNA-related SINEs. Eight predicted tRNA-related SINE families originating from different tRNAs, and nominated as AfuSINE2 sequences, contained target site duplications of short direct repeat sequences (4-14 bp flanking the elements, an extended tRNA-unrelated region and typical features of RNA polymerase III promoter sequences. The elements ranged in size from 140-493 bp and were present in low copy number in the genome and five out of eight were actively transcribed. One putative tRNAArg-derived sequence, AfuSINE2-1a possessed a unique feature of repeated trinucleotide ACT residues at its 3'-terminus. This element was similar in sequence to the I-4_AO element found in A. oryzae and an I-1_AF long nuclear interspersed element-like sequence identified in A. fumigatus Af293. Families of 5S rRNA-related SINE sequences, nominated as AfuSINE3, were also identified and their 5'-5S rRNA-related regions show 50-65% and 60-75% similarity to respectively A. fumigatus 5S rRNAs and SINE3-1_AO found in A. oryzae. A. fumigatus Af293 contains five copies of AfuSINE3 sequences ranging in size from 259-343 bp and two out of five AfuSINE3 sequences were actively transcribed. Investigations on AfuSINE distribution in the fungal genome revealed that the elements are enriched in pericentromeric and subtelomeric regions and inserted within gene-rich regions. We also demonstrated that some, but not all, AfuSINE sequences are targeted by host RNA silencing mechanisms. Finally, we demonstrated that infection of the fungus with mycoviruses had no apparent effects on SINE activity.

  3. Dermatomyositis Sine Myositis with Membranoproliferative Glomerulonephritis

    Directory of Open Access Journals (Sweden)

    Mohammad Bagher Owlia

    2012-01-01

    Full Text Available Dermatomyositis (DM is an autoimmune disease that is characterized by involvement of proximal musculature and skin. We report a 52-year-old woman with a 6-year history of dermatomyositis sine myositis, who developed lower extremity edema and proteinuria. Pathological examination of renal biopsy showed membranoproliferative glomerulonephritis. She received steroid, cyclophosphamide, and mycophenolate mofetil. Over the 9 to 10 months after the beginning of treatment, the proteinuria was improved.

  4. CORE-SINEs: Eukaryotic short interspersed retroposing elements with common sequence motifs

    Science.gov (United States)

    Gilbert, Nicolas; Labuda, Damian

    1999-01-01

    A 65-bp “core” sequence is dispersed in hundreds of thousands copies in the human genome. This sequence was found to constitute the central segment of a group of short interspersed elements (SINEs), referred to as mammalian-wide interspersed repeats, that proliferated before the radiation of placental mammals. Here, we propose that the core identifies an ancient tRNA-like SINE element, which survived in different lineages such as mammals, reptiles, birds, and fish, as well as mollusks, presumably for >550 million years. This element gave rise to a number of sequence families (CORE-SINEs), including mammalian-wide interspersed repeats, whose distinct 3′ ends are shared with different families of long interspersed elements (LINEs). The evolutionary success of the generic CORE-SINE element can be related to the recruitment of the internal promoter from highly transcribed host RNA as well as to its capacity to adapt to changing retropositional opportunities by sequence exchange with actively amplifying LINEs. It reinforces the notion that the very existence of SINEs depends on the cohabitation with both LINEs and the host genome. PMID:10077603

  5. Oscillating and rotating sine-Gordon system

    DEFF Research Database (Denmark)

    Olsen, O. H.; Samuelsen, Mogens Rugholm

    1986-01-01

    The interaction between a 2π kink and the background or vacuum is investigated in the pure sine-Gordon system. For an oscillating background (i.e., the k=0 part of the phonon spectrum) the 2π kink oscillates, while for increasing or decreasing vacuum two phenomena have been observed, depending...... on the rate of change of the vacuum. For small rates a parametric excitation of standing waves is found, and for larger rates the system linearizes. In the case of oscillating vacuum a perturbation approach explains the behavior perfectly, while for small rates of increasing vacuum the system reduces...

  6. Transcranial magnetic stimulation with a half-sine wave pulse elicits direction-specific effects in human motor cortex

    Directory of Open Access Journals (Sweden)

    Jung Nikolai H

    2012-11-01

    Full Text Available Abstract Background Transcranial magnetic stimulation (TMS commonly uses so-called monophasic pulses where the initial rapidly changing current flow is followed by a critically dampened return current. It has been shown that a monophasic TMS pulse preferentially excites different cortical circuits in the human motor hand area (M1-HAND, if the induced tissue current has a posterior-to-anterior (PA or anterior-to-posterior (AP direction. Here we tested whether similar direction-specific effects could be elicited in M1-HAND using TMS pulses with a half-sine wave configuration. Results In 10 young participants, we applied half-sine pulses to the right M1-HAND which elicited PA or AP currents with respect to the orientation of the central sulcus. Measurements of the motor evoked potential (MEP revealed that PA half-sine stimulation resulted in lower resting motor threshold (RMT than AP stimulation. When stimulus intensity (SI was gradually increased as percentage of maximal stimulator output, the stimulus–response curve (SRC of MEP amplitude showed a leftward shift for PA as opposed to AP half-sine stimulation. Further, MEP latencies were approximately 1 ms shorter for PA relative to AP half-sine stimulation across the entire SI range tested. When adjusting SI to the respective RMT of PA and AP stimulation, the direction-specific differences in MEP latencies persisted, while the gain function of MEP amplitudes was comparable for PA and AP stimulation. Conclusions Using half-sine pulse configuration, single-pulse TMS elicits consistent direction-specific effects in M1-HAND that are similar to TMS with monophasic pulses. The longer MEP latency for AP half-sine stimulation suggests that PA and AP half-sine stimulation preferentially activates different sets of cortical neurons that are involved in the generation of different corticospinal descending volleys.

  7. Bunched soliton states in weakly coupled sine-Gordon systems

    DEFF Research Database (Denmark)

    Grønbech-Jensen, N.; Samuelsen, Mogens Rugholm; Lomdahl, P. S.

    1990-01-01

    The interaction between solitons of two weakly coupled sine-Gordon systems is considered. In particular, the stability of bunched states is investigated, and perturbation results are compared with numerical results.......The interaction between solitons of two weakly coupled sine-Gordon systems is considered. In particular, the stability of bunched states is investigated, and perturbation results are compared with numerical results....

  8. First application of the SINE (short interspersed repetitive element) method to infer phylogenetic relationships in reptiles: an example from the turtle superfamily Testudinoidea.

    Science.gov (United States)

    Sasaki, Takeshi; Takahashi, Kazuhiko; Nikaido, Masato; Miura, Seiko; Yasukawa, Yuichirou; Okada, Norihiro

    2004-04-01

    Although turtles (order Testudines) constitute one of the major reptile groups, their phylogenetic relationships remain largely unresolved. Hence, we attempted to elucidate their phylogeny using the SINE (short interspersed repetitive element) method, in which the sharing of a SINE at orthologous loci is indicative of synapomorphy. First, a detailed characterization of the tortoise polIII/SINE was conducted using 10 species from eight families of hidden-necked turtles (suborder Cryptodira). Our analysis of 382 SINE sequences newly isolated in the present study revealed two subgroups, namely Cry I and Cry II, which were distinguishable according to diagnostic nucleotides in the 3' region. Furthermore, four (IA-ID) and five (IIA-IIE) different SINE types were identified within Cry I and Cry II subgroups, respectively, based on features of insertions/deletions located in the middle of the SINE sequences. The relative frequency of occurrence of the subgroups and the types of SINEs in this family were highly variable among different lineages of turtles, suggesting active differential retroposition in each lineage. Further application of the SINE method using the most retrotranspositionally active types, namely IB and IC, challenged the established phylogenetic relationships of Bataguridae and its related families. The data for 11 orthologous loci demonstrated a close relationship between Bataguridae and Testudinidae, as well as the presence of the three clades within Bataguridae. Although the SINE method has been used to infer the phylogenies of a number of vertebrate groups, it has never been applied to reptiles. The present study represents the first application of this method to a phylogenetic analysis of this class of vertebrates, and it provides detailed information on the SINE subgroups and types. This information may be applied to the phylogenetic resolution of relevant turtle lineages.

  9. Lagrangian formulation of symmetric space sine-Gordon models

    CERN Document Server

    Bakas, Ioannis; Shin, H J; Park, Q Han

    1996-01-01

    The symmetric space sine-Gordon models arise by conformal reduction of ordinary 2-dim \\sigma-models, and they are integrable exhibiting a black-hole type metric in target space. We provide a Lagrangian formulation of these systems by considering a triplet of Lie groups F \\supset G \\supset H. We show that for every symmetric space F/G, the generalized sine-Gordon models can be derived from the G/H WZW action, plus a potential term that is algebraically specified. Thus, the symmetric space sine-Gordon models describe certain integrable perturbations of coset conformal field theories at the classical level. We also briefly discuss their vacuum structure, Backlund transformations, and soliton solutions.

  10. Sudden interaction quench in the quantum sine-Gordon model

    Energy Technology Data Exchange (ETDEWEB)

    Sabio, Javier [Instituto de Ciencia de Materiales de Madrid (CSIC), Sor Juana Ines de la Cruz 3, E-28049 Madrid (Spain); Kehrein, Stefan, E-mail: javier.sabio@icmm.csic.e [Arnold-Sommerfeld-Center for Theoretical Physics, Center for NanoSciences and Department fuer Physik, Ludwig-Maximilians-Universitaet Muenchen, Theresienstrasse 37, 80333 Muenchen (Germany)

    2010-05-15

    We study a sudden interaction quench in the weak-coupling regime of the quantum sine-Gordon model. The real time dynamics of the bosonic mode occupation numbers is calculated using the flow equation method. While we cannot prove results for the asymptotic long-time limit, we can establish the existence of an extended regime in time where the mode occupation numbers relax to twice their equilibrium values. This factor two indicates a non-equilibrium distribution and is a universal feature of weak interaction quenches. The weak-coupling quantum sine-Gordon model therefore turns out to be on the borderline between thermalization and non-thermalization.

  11. Abundant Interaction Solutions of Sine-Gordon Equation

    Directory of Open Access Journals (Sweden)

    DaZhao Lü

    2012-01-01

    Full Text Available With the help of computer symbolic computation software (e.g., Maple, abundant interaction solutions of sine-Gordon equation are obtained by means of a constructed Wronskian form expansion method. The method is based upon the forms and structures of Wronskian solutions of sine-Gordon equation, and the functions used in the Wronskian determinants do not satisfy linear partial differential equations. Such interaction solutions are difficultly obtained via other methods. And the method can be automatically carried out in computer.

  12. A SINE-based dichotomous key for primate identification.

    Science.gov (United States)

    Herke, Scott W; Xing, Jinchuan; Ray, David A; Zimmerman, Jacquelyn W; Cordaux, Richard; Batzer, Mark A

    2007-04-01

    For DNA samples or 'divorced' tissues, identifying the organism from which they were taken generally requires some type of analytical method. The ideal approach would be robust even in the hands of a novice, requiring minimal equipment, time, and effort. Genotyping SINEs (Short INterspersed Elements) is such an approach as it requires only PCR-related equipment, and the analysis consists solely of interpreting fragment sizes in agarose gels. Modern primate genomes are known to contain lineage-specific insertions of Alu elements (a primate-specific SINE); thus, to demonstrate the utility of this approach, we used members of the Alu family to identify DNA samples from evolutionarily divergent primate species. For each node of a combined phylogenetic tree (56 species; n=8 [Hominids]; 11 [New World monkeys]; 21 [Old World monkeys]; 2 [Tarsiformes]; and, 14 [Strepsirrhines]), we tested loci (>400 in total) from prior phylogenetic studies as well as newly identified elements for their ability to amplify in all 56 species. Ultimately, 195 loci were selected for inclusion in this Alu-based key for primate identification. This dichotomous SINE-based key is best used through hierarchical amplification, with the starting point determined by the level of initial uncertainty regarding sample origin. With newly emerging genome databases, finding informative retrotransposon insertions is becoming much more rapid; thus, the general principle of using SINEs to identify organisms is broadly applicable.

  13. Distribution of primary and secondary currents in sine-generated ...

    African Journals Online (AJOL)

    The influences of curvaturedriven and topography-driven secondary currents on the redistribution of primary flow in sine-generated meandering channels were examined by CCHE2D. The model is calibrated using data measured in two sets of laboratory experiments including flat-bed flow and mobile-bed flow. Analysis ...

  14. Travelling waves in a singularly perturbed sine-Gordon equation

    NARCIS (Netherlands)

    Derks, Gianne; Doelman, Arjen; van Gils, Stephanus A.; Visser, T.P.P.

    2003-01-01

    We determine the linearised stability of travelling front solutions of a perturbed sine-Gordon equation. This equation models the long Josephson junction using the RCSJ model for currents across the junction and includes surface resistance for currents along the junction. The travelling waves

  15. Aspects of sine-Gordon solitons, defects and gates

    Energy Technology Data Exchange (ETDEWEB)

    Corrigan, E; Zambon, C [Department of Mathematics, University of York, York YO10 5DD (United Kingdom)

    2004-09-17

    It was recently noted how the classical sine-Gordon theory can support discontinuities, or 'defects', and yet maintain integrability by preserving sufficiently many conservation laws. Since soliton number is not preserved by a defect, a possible application to the construction of logical gates is suggested. (letter to the editor)

  16. Distribution of primary and secondary currents in sine-generated ...

    African Journals Online (AJOL)

    1 January 2018. Published under a Creative Commons Attribution Licence. 118. Distribution of primary and secondary currents in sine-generated bends li He1*. 1Key Laboratory of Water Cycle and Related Land Surface Processes, Institute of Geographic Sciences and Natural Resources Research,. Chinese Academy of ...

  17. Emotional intelligence : Sine qua non of leadership or folderol?

    NARCIS (Netherlands)

    Walter, Frank; Cole, Michael S.; Humphrey, Ronald H.

    Emotional intelligence (EI) is a divisive topic for many individuals interested in the subject of leadership. Whereas practitioner-oriented publications have claimed that EI is the sine qua non of leadership, academics continue to discuss EI's relevance for understanding leadership emergence,

  18. Sine-wave three phase resonance inverter for operation of ...

    African Journals Online (AJOL)

    naeema

    516. Sine-wave three phase resonance inverter. MOEIN KHOSRAVI1. While these options are feasible, they suffer from some drawbacks. Firstly adding a transformer. (corresponding to the grid frequency) will add to the bulk and cost of the system and losses. Secondly, series connection of some renewable energy sources.

  19. A novel Au SINE sequence found in a gymnosperm.

    Science.gov (United States)

    Yagi, Eiki; Akita, Toru; Kawahara, Taihachi

    2011-01-01

    Although many SINE families have been identified in the animal kingdom, only a few SINE families have been identified in plants, and their distribution is somewhat limited. The Au SINE (Au) has been found discontinuously in basal angiosperms, monocots, and eudicots. In this study, we examined the presence of the Au in gymnosperms and ferns by PCR using internal primers for Au. As a result, we found Au in a gymnosperm species, Ephedra ciliata. Therefore, Au was supposed to be present in the common ancestor of angiosperms and gymnosperms. The Au in E. ciliate was 15 bp shorter than the consensus sequence, which is similar to the Au SINE found in Glycine. However, the 3'end of the Au found in E. ciliate was more similar to the 3'end of the Medicago-type Au than that of the Glycine-type Au. A phylogenetic tree indicated that the Au sequence from E. ciliate is more closely related to the sequence found in Glycine than that found in Medicago/Lotus. These results indicated that Au were present in both angiosperms and gymnosperms.

  20. Phase-frequency calibration of a sine wave oscillator using ...

    African Journals Online (AJOL)

    A method of measuring phase changes within the positive feedback loop of a sine wave oscillator without terminating the oscillations is presented. This involves the use of a reference network, outside the loop, which is an exact replica of the positive feedback network of the oscillator. Such phase changes produce new ...

  1. Selinexor, a Selective Inhibitor of Nuclear Export (SINE) compound, acts through NF-κB deactivation and combines with proteasome inhibitors to synergistically induce tumor cell death.

    Science.gov (United States)

    Kashyap, Trinayan; Argueta, Christian; Aboukameel, Amro; Unger, Thaddeus John; Klebanov, Boris; Mohammad, Ramzi M; Muqbil, Irfana; Azmi, Asfar S; Drolen, Claire; Senapedis, William; Lee, Margaret; Kauffman, Michael; Shacham, Sharon; Landesman, Yosef

    2016-11-29

    The nuclear export protein, exportin-1 (XPO1/CRM1), is overexpressed in many cancers and correlates with poor prognosis. Selinexor, a first-in-class Selective Inhibitor of Nuclear Export (SINE) compound, binds covalently to XPO1 and blocks its function. Treatment of cancer cells with selinexor results in nuclear retention of major tumor suppressor proteins and cell cycle regulators, leading to growth arrest and apoptosis. Recently, we described the selection of SINE compound resistant cells and reported elevated expression of inflammation-related genes in these cells. Here, we demonstrated that NF-κB transcriptional activity is up-regulated in cells that are naturally resistant or have acquired resistance to SINE compounds. Resistance to SINE compounds was created by knockdown of the cellular NF-κB inhibitor, IκB-α. Combination treatment of selinexor with proteasome inhibitors decreased NF-κB activity, sensitized SINE compound resistant cells and showed synergistic cytotoxicity in vitro and in vivo. Furthermore, we showed that selinexor inhibited NF-κB activity by blocking phosphorylation of the IκB-α and the NF-κB p65 subunits, protecting IκB-α from proteasome degradation and trapping IκB-α in the nucleus to suppress NF-κB activity. Therefore, combination treatment of selinexor with a proteasome inhibitor may be beneficial to patients with resistance to either single-agent.

  2. Ancient exaptation of a CORE-SINE retroposon into a highly conserved mammalian neuronal enhancer of the proopiomelanocortin gene.

    Directory of Open Access Journals (Sweden)

    Andrea M Santangelo

    2007-10-01

    Full Text Available The proopiomelanocortin gene (POMC is expressed in the pituitary gland and the ventral hypothalamus of all jawed vertebrates, producing several bioactive peptides that function as peripheral hormones or central neuropeptides, respectively. We have recently determined that mouse and human POMC expression in the hypothalamus is conferred by the action of two 5' distal and unrelated enhancers, nPE1 and nPE2. To investigate the evolutionary origin of the neuronal enhancer nPE2, we searched available vertebrate genome databases and determined that nPE2 is a highly conserved element in placentals, marsupials, and monotremes, whereas it is absent in nonmammalian vertebrates. Following an in silico paleogenomic strategy based on genome-wide searches for paralog sequences, we discovered that opossum and wallaby nPE2 sequences are highly similar to members of the superfamily of CORE-short interspersed nucleotide element (SINE retroposons, in particular to MAR1 retroposons that are widely present in marsupial genomes. Thus, the neuronal enhancer nPE2 originated from the exaptation of a CORE-SINE retroposon in the lineage leading to mammals and remained under purifying selection in all mammalian orders for the last 170 million years. Expression studies performed in transgenic mice showed that two nonadjacent nPE2 subregions are essential to drive reporter gene expression into POMC hypothalamic neurons, providing the first functional example of an exapted enhancer derived from an ancient CORE-SINE retroposon. In addition, we found that this CORE-SINE family of retroposons is likely to still be active in American and Australian marsupial genomes and that several highly conserved exonic, intronic and intergenic sequences in the human genome originated from the exaptation of CORE-SINE retroposons. Together, our results provide clear evidence of the functional novelties that transposed elements contributed to their host genomes throughout evolution.

  3. Ancient exaptation of a CORE-SINE retroposon into a highly conserved mammalian neuronal enhancer of the proopiomelanocortin gene.

    Science.gov (United States)

    Santangelo, Andrea M; de Souza, Flávio S J; Franchini, Lucía F; Bumaschny, Viviana F; Low, Malcolm J; Rubinstein, Marcelo

    2007-10-01

    The proopiomelanocortin gene (POMC) is expressed in the pituitary gland and the ventral hypothalamus of all jawed vertebrates, producing several bioactive peptides that function as peripheral hormones or central neuropeptides, respectively. We have recently determined that mouse and human POMC expression in the hypothalamus is conferred by the action of two 5' distal and unrelated enhancers, nPE1 and nPE2. To investigate the evolutionary origin of the neuronal enhancer nPE2, we searched available vertebrate genome databases and determined that nPE2 is a highly conserved element in placentals, marsupials, and monotremes, whereas it is absent in nonmammalian vertebrates. Following an in silico paleogenomic strategy based on genome-wide searches for paralog sequences, we discovered that opossum and wallaby nPE2 sequences are highly similar to members of the superfamily of CORE-short interspersed nucleotide element (SINE) retroposons, in particular to MAR1 retroposons that are widely present in marsupial genomes. Thus, the neuronal enhancer nPE2 originated from the exaptation of a CORE-SINE retroposon in the lineage leading to mammals and remained under purifying selection in all mammalian orders for the last 170 million years. Expression studies performed in transgenic mice showed that two nonadjacent nPE2 subregions are essential to drive reporter gene expression into POMC hypothalamic neurons, providing the first functional example of an exapted enhancer derived from an ancient CORE-SINE retroposon. In addition, we found that this CORE-SINE family of retroposons is likely to still be active in American and Australian marsupial genomes and that several highly conserved exonic, intronic and intergenic sequences in the human genome originated from the exaptation of CORE-SINE retroposons. Together, our results provide clear evidence of the functional novelties that transposed elements contributed to their host genomes throughout evolution.

  4. Diego de Moxena, el Liber sine nomine de Petrarca y el concilio de Constanza

    OpenAIRE

    Ruiz Arzalluz, Íñigo

    2015-01-01

    On the 9th of July in 1415, Diego de Moxena, very likely a Castilian Franciscan active in the Council of Constance, wrote a letter to Ferdinand I of Aragon in which he urged him to attend the Council and to reconsider his support to Benedict XIII. Moxena’s missive reveals a particular use of the Liber sine nomine by Petrarch, already noticed by Isaac Vázquez Janeiro, but which calls forth closer attention. The document, being quite an early testimony in the history of Petrarch’s presence in S...

  5. Reflection of sine-Gordon breathers

    DEFF Research Database (Denmark)

    Olsen, O. H.; Samuelsen, Mogens Rugholm

    1981-01-01

    the breather is almost annihilated. At an active termination the breather is reflected into a breather of increased energy possibly followed by fluxons, antifluxons, or even breathers. Journal of Applied Physics is copyrighted by The American Institute of Physics....

  6. An improved sine cosine algorithm based on levy flight

    Science.gov (United States)

    Li, Ning; Li, Gang; Deng, ZhongLiang

    2017-07-01

    Focused on the issue that the Sine Cosine Algorithm is trapped in the local minima due to premature convergence in complex nonlinear optimization problems, an improved Sine Cosine Algorithm based on Levy flight was proposed. The algorithm combines the current rank of individual fitness and its historical fitness value to mark the individuals which may fall into local minimums. The marked individuals update their position by using the variable parameters Levy flight, which enhances the algorithm's global searching ability in the exploration period and the local searching ability in the exploitation period. Five benchmark functions are used to test the performance of the algorithm. The theoretical analysis and simulation results show that the proposed algorithm performs well in the complex nonlinear optimization problem

  7. Soliton annihilation in the perturbed sine-Gordon system

    DEFF Research Database (Denmark)

    Pedersen, Niels Falsig; Samuelsen, Mogens Rugholm; Welner, D.

    1984-01-01

    Fluxon-antifluxon annihilation in the perturbed sine-Gordon equation with loss and driving terms is investigated. For the infinite line we find a simple analytic expression for the threshold driving term corresponding to annihilation. With the application of the results to a Josephson junction of...... of finite length an expression for the current voltage characteristic of a zero-field step is derived. The analytical results are in good agreement with numerical simulations. The method is extendable to other systems....

  8. On sine dwell or broadband methods for modal testing

    Science.gov (United States)

    Chen, Jay-Chung; Wada, Ben K.

    1987-01-01

    For large, complex spacecraft structural systems, the objectives of the modal test are outlined. Based on these objectives, the comparison criteria for the modal test methods, namely, the broadband excitation and the sine dwell methods are established. Using the Galileo spacecraft modal test and the Centaur G Prime upper stage vehicle modal test as examples, the relative advantages or disadvantages of each method are examined. The usefulness or shortcoming of the methods are given from a practicing engineer's view point.

  9. Comparison of sine dwell and broadband methods for modal testing

    Science.gov (United States)

    Chen, Jay-Chung

    1989-01-01

    The objectives of modal tests for large complex spacecraft structural systems are outlined. The comparison criteria for the modal test methods, namely, the broadband excitation and the sine dwell methods, are established. Using the Galileo spacecraft modal test and the Centaur G Prime upper stage vehicle modal test as examples, the relative advantage or disadvantage of each method is examined. The usefulness or shortcomings of the methods are given from a practical engineering viewpoint.

  10. The Quantum Sine-Gordon Model in Perturbative AQFT

    Science.gov (United States)

    Bahns, Dorothea; Rejzner, Kasia

    2017-08-01

    We study the Sine-Gordon model with Minkowski signature in the framework of perturbative algebraic quantum field theory. We calculate the vertex operator algebra braiding property. We prove that in the finite regime of the model, the expectation value—with respect to the vacuum or a Hadamard state—of the Epstein Glaser S-matrix and the interacting current or the field respectively converge, both given as formal power series.

  11. Advanced Sine Wave Modulation of Continuous Wave Laser System for Atmospheric CO2 Differential Absorption Measurements

    Science.gov (United States)

    Campbell, Joel F.; Lin, Bing; Nehrir, Amin R.

    2014-01-01

    NASA Langley Research Center in collaboration with ITT Exelis have been experimenting with Continuous Wave (CW) laser absorption spectrometer (LAS) as a means of performing atmospheric CO2 column measurements from space to support the Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) mission.Because range resolving Intensity Modulated (IM) CW lidar techniques presented here rely on matched filter correlations, autocorrelation properties without side lobes or other artifacts are highly desirable since the autocorrelation function is critical for the measurements of lidar return powers, laser path lengths, and CO2 column amounts. In this paper modulation techniques are investigated that improve autocorrelation properties. The modulation techniques investigated in this paper include sine waves modulated by maximum length (ML) sequences in various hardware configurations. A CW lidar system using sine waves modulated by ML pseudo random noise codes is described, which uses a time shifting approach to separate channels and make multiple, simultaneous online/offline differential absorption measurements. Unlike the pure ML sequence, this technique is useful in hardware that is band pass filtered as the IM sine wave carrier shifts the main power band. Both amplitude and Phase Shift Keying (PSK) modulated IM carriers are investigated that exibit perfect autocorrelation properties down to one cycle per code bit. In addition, a method is presented to bandwidth limit the ML sequence based on a Gaussian filter implemented in terms of Jacobi theta functions that does not seriously degrade the resolution or introduce side lobes as a means of reducing aliasing and IM carrier bandwidth.

  12. Genomic distribution of SINEs in Entamoeba histolytica strains: implication for genotyping

    Science.gov (United States)

    2013-01-01

    Background The major clinical manifestations of Entamoeba histolytica infection include amebic colitis and liver abscess. However the majority of infections remain asymptomatic. Earlier reports have shown that some E. histolytica isolates are more virulent than others, suggesting that virulence may be linked to genotype. Here we have looked at the genomic distribution of the retrotransposable short interspersed nuclear elements EhSINE1 and EhSINE2. Due to their mobile nature, some EhSINE copies may occupy different genomic locations among isolates of E. histolytica possibly affecting adjacent gene expression; this variability in location can be exploited to differentiate strains. Results We have looked for EhSINE1- and EhSINE2-occupied loci in the genome sequence of Entamoeba histolytica HM-1:IMSS and searched for homologous loci in other strains to determine the insertion status of these elements. A total of 393 EhSINE1 and 119 EhSINE2 loci were analyzed in the available sequenced strains (Rahman, DS4-868, HM1:CA, KU48, KU50, KU27 and MS96-3382. Seventeen loci (13 EhSINE1 and 4 EhSINE2) were identified where a EhSINE1/EhSINE2 sequence was missing from the corresponding locus of other strains. Most of these loci were unoccupied in more than one strain. Some of the loci were analyzed experimentally for SINE occupancy using DNA from strain Rahman. These data helped to correctly assemble the nucleotide sequence at three loci in Rahman. SINE occupancy was also checked at these three loci in 7 other axenically cultivated E. histolytica strains and 16 clinical isolates. Each locus gave a single, specific amplicon with the primer sets used, making this a suitable method for strain typing. Based on presence/absence of SINE and amplification with locus-specific primers, the 23 strains could be divided into eleven genotypes. The results obtained by our method correlated with the data from other typing methods. We also report a bioinformatic analysis of EhSINE2 copies

  13. SINE (selective inhibitor of nuclear export)--translational science in a new class of anti-cancer agents.

    Science.gov (United States)

    Gerecitano, John

    2014-10-04

    Regulation of protein trafficking between the nucleus and cytoplasm represents a novel control point for antineoplastic intervention. Several proteins involved with cellular growth and survival depend on precise and timely positioning within the cell to fulfill their functions, and the nuclear membrane defines one of the most important compartmental barriers. Chromosome Region Maintenance 1, or exportin-1 (CRM1/XPO1), is involved with the export of more than 200 nuclear proteins, and has intriguingly been shown to have an increased expression in several tumor cell types. Selinexor (KPT-330) is a first-in-class selective inhibitor of nuclear export (SINE) to be developed for clinical use. Preclinical data has demonstrated antineoplastic activity of SINE compounds in many human solid and hematologic malignancies. The clinical development of Selinexor provides an excellent model for translational research.

  14. Liouville Correspondence Between the Short-Pulse Hierarchy and the Sine-Gordon Hierarchy

    Science.gov (United States)

    Kang, Jing; Liu, Xiaochuan; Qu, Changzheng

    2016-12-01

    The Liouville correspondence between the short-pulse integrable hierarchy and the sine-Gordon integrable hierarchy is studied. It is shown that the transformation relating the short-pulse equation with the sine-Gordon equation also establishes the correspondence between their flows and Hamiltonian conservation laws in respective hierarchy. This proposes an alternative approach to derive the Hamiltonian conservation laws of the short-pulse equation from the known ones of the classical sine-Gordon equation.

  15. Recognition of sine wave modeled consonants by normal hearing and hearing-impaired individuals

    Science.gov (United States)

    Balachandran, Rupa

    Sine wave modeling is a parametric tool for representing the speech signal with a limited number of sine waves. It involves replacing the peaks of the speech spectrum with sine waves and discarding the rest of the lower amplitude components during synthesis. It has the potential to be used as a speech enhancement technique for hearing-impaired adults. The present study answers the following basic questions: (1) Are sine wave synthesized speech tokens more intelligible than natural speech tokens? (2) What is the effect of varying the number of sine waves on consonant recognition in quiet? (3) What is the effect of varying the number of sine waves on consonant recognition in noise? (4) How does sine wave modeling affect the transmission of speech feature in quiet and in noise? (5) Are there differences in recognition performance between normal hearing and hearing-impaired listeners? VCV syllables representing 20 consonants (/p/, /t/, /k/, /b/, /d/, /g/, /f/, /theta/, /s/, /∫/, /v/, /z/, /t∫/, /dy/, /j/, /w/, /r/, /l/, /m/, /n/) in three vowel contexts (/a/, /i/, /u/) were modeled with 4, 8, 12, and 16 sine waves. A consonant recognition task was performed in quiet, and in background noise (+10 dB and 0 dB SNR). Twenty hearing-impaired listeners and six normal hearing listeners were tested under headphones at their most comfortable listening level. The main findings were: (1) Recognition of unprocessed speech was better that of sine wave modeled speech. (2) Asymptotic performance was reached with 8 sine waves in quiet for both normal hearing and hearing-impaired listeners. (3) Consonant recognition performance in noise improved with increasing number of sine waves. (4) As the number of sine waves was decreased, place information was lost first, followed by manner, and finally voicing. (5) Hearing-impaired listeners made more errors then normal hearing listeners, but there were no differences in the error patterns made by both groups.

  16. Characterization and evolutionary landscape of AmnSINE1 in Amniota genomes.

    Science.gov (United States)

    Hirakawa, Mika; Nishihara, Hidenori; Kanehisa, Minoru; Okada, Norihiro

    2009-07-15

    Discovery of a large number of conserved non-coding elements (CNEs) in vertebrate genomes provides a cornerstone to elucidate molecular mechanisms of macroevolution. Extensive comparative genomics has proven that transposons such as short interspersed elements (SINEs) were an important source of CNEs. We recently characterized AmnSINE1, a SINE family in Amniota genomes, some of which are present in CNEs, and demonstrated that two AmnSINE1 loci play an important role in mammalian-specific brain development by functioning as an enhancer (Sasaki et al. Proc. Natl. Acad. Sci. USA 2008). To get more information about AmnSINE1s, we here performed a multi-species search for AmnSINE1, and revealed the distribution and evolutionary history of these SINEs in amniote genomes. The number of AmnSINE1 regions in amniotes ranged from 160 to 1200; the number in the eutherians were under 500 and the largest was that in chicken. Phylogenetic analysis established that each AmnSINE1 locus has evolved uniquely, primarily since the divergence of mammals from reptiles. These results support the notion that AmnSINE1s were amplified as an ancient retroposon in a common ancestor of Amniota and subsequently have survived for 300 Myr because of functions acquired by mutation-coupled exaptation prior mammalian radiation. On the basis of sequence homology and conserved synteny, we detected the orthologs of AmnSINE1 for candidates of further enhancer analysis, which are more conserved than two loci that were shown to have been involved in mammalian brain development. The present work provides a comprehensive data set to test the role of AmnSINE1s, many of which were exapted and contributed to mammalian macroevolution.

  17. Retinitis pigmentosa sine pigmenti. Debut with macular oedema.

    Science.gov (United States)

    de la Mata Pérez, G; Ruiz-Moreno, O; Fernández-Pérez, S; Torrón Fernández-Blanco, C; Pablo-Júlvez, L

    2014-09-01

    A 25-year-old woman, with metamorphopsia in her left eye of one year onset. The examination revealed a bilateral cystoid macular oedema (CME) and vascular attenuation. We describe the diagnostic tests, as well as differential diagnosis and treatment response with carbonic anhydrase inhibitors. The retinitis pigmentosa sine pigment is a subtype of atypical retinitis pigmentosa characterised by the absence of pigment deposits. The night blindness is milder, and perimetric and electroretinographic impairment is lower. CME is an important cause of central vision loss, and responds to anhydrase carbonic inhibitors. Copyright © 2012 Sociedad Española de Oftalmología. Published by Elsevier Espana. All rights reserved.

  18. Golden Sine Algorithm: A Novel Math-Inspired Algorithm

    Directory of Open Access Journals (Sweden)

    TANYILDIZI, E.

    2017-05-01

    Full Text Available In this study, Golden Sine Algorithm (Gold-SA is presented as a new metaheuristic method for solving optimization problems. Gold-SA has been developed as a new search algorithm based on population. This math-based algorithm is inspired by sine that is a trigonometric function. In the algorithm, random individuals are created as many as the number of search agents with uniform distribution for each dimension. The Gold-SA operator searches to achieve a better solution in each iteration by trying to bring the current situation closer to the target value. The solution space is narrowed by the golden section so that the areas that are supposed to give only good results are scanned instead of the whole solution space scan. In the tests performed, it is seen that Gold-SA has better results than other population based methods. In addition, Gold-SA has fewer algorithm-dependent parameters and operators than other metaheuristic methods, increasing the importance of this method by providing faster convergence of this new method.

  19. Standard Sine Fitting Algorithms Applied To Blade Tip Timing Data

    Directory of Open Access Journals (Sweden)

    Kaźmierczak Krzysztof

    2014-12-01

    Full Text Available Blade Tip Timing (BTT is a non-intrusive method to measure blade vibration in turbomachinery. Time of Arrival (TOA is recorded when a blade is passing a stationary sensor. The measurement data, in form of undersampled (aliased tip-deflection signal, are difficult to analyze with standard signal processing methods like digital filters or Fourier Transform. Several indirect methods are applied to process TOA sequences, such as reconstruction of aliased spectrum and Least-Squares Fitting to harmonic oscillator model. We used standard sine fitting algorithms provided by IEEE-STD-1057 to estimate blade vibration parameters. Blade-tip displacement was simulated in time domain using SDOF model, sampled by stationary sensors and then processed by the sinefit.m toolkit. We evaluated several configurations of different sensor placement, noise level and number of data. Results of the linear sine fitting, performed with the frequency known a priori, were compared with the non-linear ones. Some of non-linear iterations were not convergent. The algorithms and testing results are aimed to be used in analysis of asynchronous blade vibration.

  20. Mobile Element Evolution Playing Jigsaw - SINEs in Gastropod and Bivalve Mollusks.

    Science.gov (United States)

    Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette

    2016-01-06

    SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc-snail and SCoica-mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain-Snail-is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5' end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves-extending the distribution range of this superfamily. © The Author(s) 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  1. Mobile Element Evolution Playing Jigsaw—SINEs in Gastropod and Bivalve Mollusks

    Science.gov (United States)

    Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette

    2016-01-01

    SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc—snail and SCoica—mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain—Snail—is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5′ end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves—extending the distribution range of this superfamily. PMID:26739168

  2. Advanced sine wave modulation of continuous wave laser system for atmospheric CO(2) differential absorption measurements.

    Science.gov (United States)

    Campbell, Joel F; Lin, Bing; Nehrir, Amin R

    2014-02-10

    In this theoretical study, modulation techniques are developed to support the Active Sensing of CO2 Emissions over Nights, Days, and Seasons (ASCENDS) mission. A continuous wave (CW) lidar system using sine waves modulated by maximum length (ML) pseudo-noise (PN) codes is described for making simultaneous online/offline differential absorption measurements. Amplitude and phase-shift keying (PSK) modulated intensity modulation (IM) carriers, in addition to a hybrid-pulse technique are investigated, which exhibit optimal autocorrelation properties. A method is presented to bandwidth limit the ML sequence based on a filter implemented in terms of Jacobi theta functions, which does not significantly degrade the resolution or introduce sidelobes as a means of reducing aliasing and IM carrier bandwidth.

  3. The nullum crimen sine iure principle in contemporary International Law

    Directory of Open Access Journals (Sweden)

    Hector Olásolo Alonso

    2014-03-01

    Full Text Available This paper deals with the evolution and current content of the nullum crimen sine iure principle in international law. It analyses the development of the nullum crimen principle from its definition as a principle of justice at the end of Second World War, to its current definition as an individual right imposing a limitation upon States’ sovereignty. The article also explains that, nowadays, the nullum cri- men principle requires for the relevant conduct to be a crime at the time of its com- mission, according to any of the sources of criminal law in the relevant national or international legal system. No written law is necessarily required. As a result, accessibility and foreseability are the main elements of the nullum crimen principle in current international law.

  4. Systemic Sclerosis Sine Scleroderma in Mexican Patients. Case Reports.

    Science.gov (United States)

    Vera-Lastra, Olga; Sauceda-Casas, Christian Alexis; Domínguez, María Del Pilar Cruz; Alvarez, Sergio Alberto Mendoza; Sepulceda-Delgado, Jesús

    2017-01-03

    Systemic sclerosis sine scleroderma (ssSSc) is a form of systemic sclerosis that is characterized by Raynaud's phenomenon (RP), visceral involvement without thickening of skin and anticentromere antibodies (ACA). We studied 10 ssSsc patients with a prevalence of 2%. The clinical signs were: RP 9/10, esophageal manifestations 8/10, pulmonary arterial hypertension 4/10, interstitial lung disease 4/10, cardiac signs 3/10 and ACA 8/10. In patients with RP, esophageal dysmotility, interstitial lung disease and pulmonary arterial hypertension should be tested for ACA in order to establish a prompt diagnosis and treatment of ssSSc. Copyright © 2016 Elsevier España, S.L.U. and Sociedad Española de Reumatología y Colegio Mexicano de Reumatología. All rights reserved.

  5. Needle-array to Plate DBD Plasma Using Sine AC and Nanosecond Pulse Excitations for Purpose of Improving Indoor Air Quality

    Science.gov (United States)

    Zhang, Li; Yang, Dezheng; Wang, Wenchun; Wang, Sen; Yuan, Hao; Zhao, Zilu; Sang, Chaofeng; Jia, Li

    2016-04-01

    In this study, needle-array to plate electrode configuration was employed to generate an atmospheric air diffuse discharge using both nanosecond pulse and sine AC voltage as excitation voltage for the purpose of improving indoor air quality. Different types of voltage sources and electrode configurations are employed to optimize electrical field distribution and improve discharge stability. Discharge images, electrical characteristics, optical emission spectra, and plasma gas temperatures in both sine AC discharge and nanosecond pulse discharge were compared and the discharge stability during long operating time were discussed. Compared with the discharge excited by sine AC voltage, the nanosecond pulsed discharge is more homogenous and stable, besides, the plasma gas temperature of nanosecond pulse discharge is much lower. Using packed-bed structure, where γ- Al2O3 pellets are filled in the electrode gap, has obvious efficacy in the production of homogenous discharge. Furthermore, both sine AC discharge and nanosecond pulse discharge were used for removing formaldehyde from flowing air. It shows that nanosecond pulse discharge has a significant advantage in energy cost. And the main physiochemical processes for the generation of active species and the degradation of formaldehyde were discussed.

  6. The Influence of LINE-1 and SINE Retrotransposons on Mammalian Genomes.

    Science.gov (United States)

    Richardson, Sandra R; Doucet, Aurélien J; Kopera, Huira C; Moldovan, John B; Garcia-Perez, José Luis; Moran, John V

    2015-04-01

    Transposable elements have had a profound impact on the structure and function of mammalian genomes. The retrotransposon Long INterspersed Element-1 (LINE-1 or L1), by virtue of its replicative mobilization mechanism, comprises ∼17% of the human genome. Although the vast majority of human LINE-1 sequences are inactive molecular fossils, an estimated 80-100 copies per individual retain the ability to mobilize by a process termed retrotransposition. Indeed, LINE-1 is the only active, autonomous retrotransposon in humans and its retrotransposition continues to generate both intra-individual and inter-individual genetic diversity. Here, we briefly review the types of transposable elements that reside in mammalian genomes. We will focus our discussion on LINE-1 retrotransposons and the non-autonomous Short INterspersed Elements (SINEs) that rely on the proteins encoded by LINE-1 for their mobilization. We review cases where LINE-1-mediated retrotransposition events have resulted in genetic disease and discuss how the characterization of these mutagenic insertions led to the identification of retrotransposition-competent LINE-1s in the human and mouse genomes. We then discuss how the integration of molecular genetic, biochemical, and modern genomic technologies have yielded insight into the mechanism of LINE-1 retrotransposition, the impact of LINE-1-mediated retrotransposition events on mammalian genomes, and the host cellular mechanisms that protect the genome from unabated LINE-1-mediated retrotransposition events. Throughout this review, we highlight unanswered questions in LINE-1 biology that provide exciting opportunities for future research. Clearly, much has been learned about LINE-1 and SINE biology since the publication of Mobile DNA II thirteen years ago. Future studies should continue to yield exciting discoveries about how these retrotransposons contribute to genetic diversity in mammalian genomes.

  7. Sine Rotation Vector Method for Attitude Estimation of an Underwater Robot

    Directory of Open Access Journals (Sweden)

    Nak Yong Ko

    2016-08-01

    Full Text Available This paper describes a method for estimating the attitude of an underwater robot. The method employs a new concept of sine rotation vector and uses both an attitude heading and reference system (AHRS and a Doppler velocity log (DVL for the purpose of measurement. First, the acceleration and magnetic-field measurements are transformed into sine rotation vectors and combined. The combined sine rotation vector is then transformed into the differences between the Euler angles of the measured attitude and the predicted attitude; the differences are used to correct the predicted attitude. The method was evaluated according to field-test data and simulation data and compared to existing methods that calculate angular differences directly without a preceding sine rotation vector transformation. The comparison verifies that the proposed method improves the attitude estimation performance.

  8. SINE polymorphism reveals distinct strains of Entamoeba histolytica from North India.

    Science.gov (United States)

    Sharma, Shraddha; Banyal, Neha; Singh, Mukul; Mandal, A K; Bhattacharya, Sudha; Paul, Jaishree

    2017-04-01

    Entamoeba histolytica is an intestinal parasite causing significant morbidity and mortality in the developing world. More tools are needed to understand the epidemiology and molecular pathogenesis of amebiasis. Virulence pattern of E. histolytica could be linked with the genotype of a strain. Several loci showing insertion polymorphism of retrotransposable short interspersed nuclear elements EhSINE1 and EhSINE2 have been reported among laboratory strains of E. histolytica. The present study was undertaken to validate this observation in clinical isolates from north India. Our results indicate that the Indian samples show a different propensity of SINE retention or loss at two of the polymorphic loci compared with non-Indian samples. Statistical analysis of different loci revealed Locus 17 of EhSINE1as a potential geographical marker for distinguishing Indian isolates from non Indian isolates. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Traveling Wave Solutions of ZK-BBM Equation Sine-Cosine Method

    Directory of Open Access Journals (Sweden)

    Sadaf Bibi

    2014-03-01

    Full Text Available Travelling wave solutions are obtained by using a relatively new technique which is called sine-cosine method for ZK-BBM equations. Solution procedure and obtained results re-confirm the efficiency of the proposed scheme.

  10. Basicity of Systems of Sines with Linear Phase in Weighted Sobolev Spaces

    Directory of Open Access Journals (Sweden)

    V. F. Salmanov

    2013-01-01

    Full Text Available The perturbed systems of sines, which appear when solving some partial differential equations by the Fourier method, are considered in this paper. Basis properties of these systems in weighted Sobolev spaces of functions are studied.

  11. Perish, then publish: Thomas Harriot and the sine law of refraction.

    Science.gov (United States)

    Fishman, R S

    2000-03-01

    A talented young scientist, Thomas Harriot, wrote the first English account of the New World, "A Briefe and True Report of the New Found Land of Virginia," distinguished by its serious effort to describe and understand the American Indian. Harriot went on to make innovations in mathematics and was one of the first astronomers to use the telescope. His largely unappreciated contribution to the history of ophthalmology was the first formulation of the sine law of refraction of light, found in his unpublished papers long after his death in 1621. Willebrord Snell discovered the sine law in Holland in 1621 but also died without formally publishing it. Rene Descartes first published the sine law in 1637. The sine law of refraction became not only the prime law of all lens systems but ushered in a new world of physical laws.

  12. Pi-kinks in a parametrically driven sine-Gordon chain

    DEFF Research Database (Denmark)

    Kivshar, Yuri S.; Grønbech-Jensen, Niels; Samuelsen, Mogens Rugholm

    1992-01-01

    We consider the sine-Gordon chain driven by a high-frequency parametric force in the presence of loss. Using an analytical approach based on the method of averaging in fast oscillations, we predict that such a parametric force may support propagation of π kinks, which are unstable in the standard...... sine-Gordon model. The steady-state velocity of the π kinks is calculated, and the analytical results are in good agreement with direct numerical simulations....

  13. Extended sine-Gordon Equation Method and Its Application to Maccari's System

    Science.gov (United States)

    Song, Li-Na; Zhang, Hong-Qing

    2005-11-01

    An extended sine-Gordon equation method is proposed to construct exact travelling wave solutions to Maccari's equation based upon a generalized sine-Gordon equation. It is shown that more new travelling wave solutions can be found by this new method, which include bell-shaped soliton solutions, kink-shaped soliton solutions, periodic wave solution, and new travelling waves. The project partially supported by the National Key Basic Research Project of China under Grant No. 2004CB318000

  14. RNA-Mediated Gene Duplication and Retroposons: Retrogenes, LINEs, SINEs, and Sequence Specificity

    Directory of Open Access Journals (Sweden)

    Kazuhiko Ohshima

    2013-01-01

    Full Text Available A substantial number of “retrogenes” that are derived from the mRNA of various intron-containing genes have been reported. A class of mammalian retroposons, long interspersed element-1 (LINE1, L1, has been shown to be involved in the reverse transcription of retrogenes (or processed pseudogenes and non-autonomous short interspersed elements (SINEs. The -end sequences of various SINEs originated from a corresponding LINE. As the -untranslated regions of several LINEs are essential for retroposition, these LINEs presumably require “stringent” recognition of the -end sequence of the RNA template. However, the -ends of mammalian L1s do not exhibit any similarity to SINEs, except for the presence of -poly(A repeats. Since the -poly(A repeats of L1 and Alu SINE are critical for their retroposition, L1 probably recognizes the poly(A repeats, thereby mobilizing not only Alu SINE but also cytosolic mRNA. Many flowering plants only harbor L1-clade LINEs and a significant number of SINEs with poly(A repeats, but no homology to the LINEs. Moreover, processed pseudogenes have also been found in flowering plants. I propose that the ancestral L1-clade LINE in the common ancestor of green plants may have recognized a specific RNA template, with stringent recognition then becoming relaxed during the course of plant evolution.

  15. Nullum Crimen sine Lege in the International Criminal Court

    Directory of Open Access Journals (Sweden)

    Venus GHAREH BAGHI

    2010-10-01

    Full Text Available The Principles of legality in crimes and punishments refer to the fact that an act is not considered a crime and deserves no punishment, until the legislator determines and announces thecriminal title and its penalty. In Iranian legal system, before the Islamic Revolution and also after it, the Constitution and ordinary laws have explicitly emphasized the observance of the mentionedprinciple. When there is no text or in the case of the silence or lack of law, the criminal judge is bound to issue the verdict of innocence. According to the Rome statute the court shall exercisejurisdiction over the crime of aggressions once a provision is adopted. And, according to the article 121 and 123 defending the crime and setting out, the condition under which the Court shall exercise jurisdiction with respect to crimes such as provision shall be consisted of the head of the general principle the relevant provision of the charter of the United Nations. The principle of legality is set out in article 22 to 24 of the ICC statute. These norms are derived from the customary law and the national law. Article 15, International Covenant on Civil and Political rights, states that no one shall be found guilty of any criminal offence based on an act or omission which did not constitute a criminal offence under national or international laws at the time when it was committed. Yet, in the context of prosecuting mass atrocities, genocide, crimes against humanity, and war crimes, international criminal law appears to be resigned to such a principle, if not openly including it. fact, that it may be considered the poor cousin of nullum crimen sine lege (no crime without law which has attracted far greater consideration in scholarship and jurisprudence.

  16. SINE RNA induces severe developmental defects in Arabidopsis thaliana and interacts with HYL1 (DRB1, a key member of the DCL1 complex.

    Directory of Open Access Journals (Sweden)

    Marie-Noëlle Pouch-Pélissier

    2008-06-01

    Full Text Available The proper temporal and spatial expression of genes during plant development is governed, in part, by the regulatory activities of various types of small RNAs produced by the different RNAi pathways. Here we report that transgenic Arabidopsis plants constitutively expressing the rapeseed SB1 SINE retroposon exhibit developmental defects resembling those observed in some RNAi mutants. We show that SB1 RNA interacts with HYL1 (DRB1, a double-stranded RNA-binding protein (dsRBP that associates with the Dicer homologue DCL1 to produce microRNAs. RNase V1 protection assays mapped the binding site of HYL1 to a SB1 region that mimics the hairpin structure of microRNA precursors. We also show that HYL1, upon binding to RNA substrates, induces conformational changes that force single-stranded RNA regions to adopt a structured helix-like conformation. Xenopus laevis ADAR1, but not Arabidopsis DRB4, binds SB1 RNA in the same region as HYL1, suggesting that SINE RNAs bind only a subset of dsRBPs. Consistently, DCL4-DRB4-dependent miRNA accumulation was unchanged in SB1 transgenic Arabidopsis, whereas DCL1-HYL1-dependent miRNA and DCL1-HYL1-DCL4-DRB4-dependent tasiRNA accumulation was decreased. We propose that SINE RNA can modulate the activity of the RNAi pathways in plants and possibly in other eukaryotes.

  17. A generalized sine condition and performance comparison of Wolter type II and Wolter-Schwarzschild extreme ultraviolet telescopes

    Science.gov (United States)

    Saha, T. T.

    1984-01-01

    An equation similar to the Abbe sine condition is derived for a Wolter type II telescope. This equation and the sine condition are then combined to produce a so called generalized sine condition. Using the law of reflection, Fermat's principle, the generalized sine condition, and simple geometry the surface equations for a Wolter type II telescope and an equivalent Wolter-Schwarzschild telescope are calculated. The performances of the telescopes are compared in terms of rms blur circle radius at the Gaussian focal plane and at best focus.

  18. A novel composite retrotransposon derived from or generated independently of the SVA (SINE/VNTR/Alu) transposon has undergone proliferation in gibbon genomes.

    Science.gov (United States)

    Hara, Toru; Hirai, Yuriko; Baicharoen, Sudarath; Hayakawa, Takashi; Hirai, Hirohisa; Koga, Akihiko

    2012-01-01

    The superfamily Hominoidea (hominoids) comprises two families: Hominidae (hominids) and Hylobatidae (gibbons, also called small apes). The SVA transposon is a composite retrotransposon that occurs widely in hominoids and is considered to have been generated by stepwise fusions of three genetic elements: SINE-R, a variable number of tandem repeat (VNTR) sequence, and Alu. We identified a novel transposon whose basic structure is the same as that of SVA, with one prominent difference being the presence of part of prostaglandin reductase 2 (PTGR2) in place of SINE-R. We designate this composite transposon as PVA and propose two possible mechanisms regarding its generation. One is the derivation of PVA from SVA: the SINE-R region of SVA was replaced with a PTGR2 fragment by template switching. The other is the formation of PVA independently of SVA: a PTGR2 fragment was fused to an evolutionary intermediate comprising the VNTR and Alu regions. The nucleotide sequence of the junction between the VNTR and PTGR2 regions supports the second hypothesis. We identified PVA in the white-cheeked gibbon Nomascus leucogenys by analysis of genome sequence databases, and subsequent experimental analysis revealed its presence in all four gibbon genera. The white-cheeked gibbon harbors at least 93 PVA copies in its haploid genome. Another SVA-like composite transposon carrying parts of the LINE1 and Alu transposons in place of SINE-R, designated as LAVA, has recently been reported. The significance of the discovery of PVA is that its substituted fragment originates not from a transposon but from a single-copy gene. PVA should provide additional insights into the transposition mechanism of this type of composite transposon; the transposition activity is conferred even if the substituted fragment is not related to a transposon.

  19. Kink propagation and trapping in a two dimensional curved sine-Gordon system

    DEFF Research Database (Denmark)

    Sørensen, Mads Peter

    The sine-Gordon equation is one of the three classical nonlinear partial differential equations possessing soliton solutions in the case of one spatial dimension. Extending the sine-Gordon equation to two spatial dimensions is relevant for applications to the dynamics of large area Josephson...... junctions. In particular we have investigated Josephson waveguides consisting of two rectangular large area regions joined by a bent section of constant curvature. Transverse homogeneous and inhomogeneous Neumann boundary conditions are used. Numerical and approximate analytical tools have been used...... to investigate how kink shaped solitons of the sine-Gordon equation propagate through the bent section. We have found that the region with finite curvature acts as a potential barrier whose height and width depends on the radius of curvature of the waveguide. The kink transmission, reflection and trapping...

  20. Arbitrarily large numbers of kink internal modes in inhomogeneous sine-Gordon equations

    Energy Technology Data Exchange (ETDEWEB)

    González, J.A., E-mail: jalbertgonz@yahoo.es [Department of Physics, Florida International University, Miami, FL 33199 (United States); Department of Natural Sciences, Miami Dade College, 627 SW 27th Ave., Miami, FL 33135 (United States); Bellorín, A., E-mail: alberto.bellorin@ucv.ve [Escuela de Física, Facultad de Ciencias, Universidad Central de Venezuela, Apartado Postal 47586, Caracas 1041-A (Venezuela, Bolivarian Republic of); García-Ñustes, M.A., E-mail: monica.garcia@pucv.cl [Instituto de Física, Pontificia Universidad Católica de Valparaíso, Casilla 4059 (Chile); Guerrero, L.E., E-mail: lguerre@usb.ve [Departamento de Física, Universidad Simón Bolívar, Apartado Postal 89000, Caracas 1080-A (Venezuela, Bolivarian Republic of); Jiménez, S., E-mail: s.jimenez@upm.es [Departamento de Matemática Aplicada a las TT.II., E.T.S.I. Telecomunicación, Universidad Politécnica de Madrid, 28040-Madrid (Spain); Vázquez, L., E-mail: lvazquez@fdi.ucm.es [Departamento de Matemática Aplicada, Facultad de Informática, Universidad Complutense de Madrid, 28040-Madrid (Spain)

    2017-06-28

    We prove analytically the existence of an infinite number of internal (shape) modes of sine-Gordon solitons in the presence of some inhomogeneous long-range forces, provided some conditions are satisfied. - Highlights: • We have found exact kink solutions to the perturbed sine-Gordon equation. • We have been able to study analytically the kink stability problem. • A kink equilibrated by an exponentially-localized perturbation has a finite number of oscillation modes. • A sufficiently broad equilibrating perturbation supports an infinite number of soliton internal modes.

  1. A transmission matrix for a fused pair of integrable defects in the sine-Gordon model

    Energy Technology Data Exchange (ETDEWEB)

    Corrigan, E; Zambon, C, E-mail: edward.corrigan@durham.ac.u, E-mail: cristina.zambon@durham.ac.u [Department of Mathematical Sciences, University of Durham, Durham DH1 3LE (United Kingdom)

    2010-08-27

    Within the quantum sine-Gordon model a transmission matrix describing the scattering of a soliton with a fused pair of integrable defects is proposed. The result is consistent with the classical picture of scattering and highlights the differences between two defects located at separated points and two defects fused at the same point. Moreover, the analysis reveals how, for certain choices of parameters, both the soliton-soliton and the lightest breather-soliton S-matrices of the sine-Gordon model are embedded within the transmission matrix, supporting an interpretation in which defects may be regarded as soliton constituents.

  2. The role of pulse shape in motor cortex transcranial magnetic stimulation using full-sine stimuli

    DEFF Research Database (Denmark)

    Delvendahl, Igor; Gattinger, Norbert; Berger, Thomas

    2014-01-01

    A full-sine (biphasic) pulse waveform is most commonly used for repetitive transcranial magnetic stimulation (TMS), but little is known about how variations in duration or amplitude of distinct pulse segments influence the effectiveness of a single TMS pulse to elicit a corticomotor response. Using...... a novel TMS device, we systematically varied the configuration of full-sine pulses to assess the impact of configuration changes on resting motor threshold (RMT) as measure of stimulation effectiveness with single-pulse TMS of the non-dominant motor hand area (M1). In young healthy volunteers, we (i...

  3. A tissue-specific promoter derived from a SINE retrotransposon drives biallelic expression of PLAGL1 in human lymphocytes.

    Directory of Open Access Journals (Sweden)

    Claire E L Smith

    Full Text Available The imprinted gene PLAGL1 is an important regulator of apoptosis and cell cycle arrest. Loss of its expression has been implicated in tumorigenesis in a range of different cancers, and overexpression during fetal development causes transient neonatal diabetes mellitus (TNDM. PLAGL1 lies within an imprinted region of chromosome 6q24, and monoallelic expression from the major, differentially methylated promoter (P1 occurs in most human tissues. However, in peripheral blood leukocytes, the active promoter (P2 is non-imprinted and drives biallelic transcription. We report here a novel PLAGL1 promoter (P5 derived from the insertion of a primate-specific, MIR3 SINE retrotransposon. P5 is highly utilized in lymphocytes, particularly in T cells, and like P2, directs biallelic transcription. Our results show that it is important to consider P5 in relation to PLAGL1 function in T cells when investigating the dysregulation of this gene.

  4. Internal oscillation frequencies and anharmonic effects for the double sine-Gordon kink

    DEFF Research Database (Denmark)

    Salerno, M.; Samuelsen, Mogens Rugholm

    1989-01-01

    A simple derivation of the small oscillation frequency around 4π-kink solutions of the double sine-Gordon equation is presented. Small corrections to these frequencies due to anharmonic effects are also numerically and analytically investigated. The analysis is based on energetic considerations...

  5. Acute effect of alcohol intake on sine-wave Cartesian and polar contrast sensitivity functions.

    Science.gov (United States)

    Cavalcanti-Galdino, M K; Silva, J A da; Mendes, L C; Santos, N A da; Simas, M L B

    2014-04-01

    The aim of this study was to assess contrast sensitivity for angular frequency stimuli as well as for sine-wave gratings in adults under the effect of acute ingestion of alcohol. We measured the contrast sensitivity function (CSF) for gratings of 0.25, 1.25, 2.5, 4, 10, and 20 cycles per degree of visual angle (cpd) as well as for angular frequency stimuli of 1, 2, 4, 24, 48, and 96 cycles/360°. Twenty adults free of ocular diseases, with normal or corrected-to-normal visual acuity, and no history of alcoholism were enrolled in two experimental groups: 1) no alcohol intake (control group) and 2) alcohol ingestion (experimental group). The average concentration of alcohol in the experimental group was set to about 0.08%. We used a paradigm involving a forced-choice method. Maximum sensitivity to contrast for sine-wave gratings in the two groups occurred at 4 cpd sine-wave gratings and at 24 and 48 cycles/360° for angular frequency stimuli. Significant changes in contrast sensitivity were observed after alcohol intake compared with the control condition at spatial frequency of 4 cpd and 1, 24, and 48 cycles/360° for angular frequency stimuli. Alcohol intake seems to affect the processing of sine-wave gratings at maximum sensitivity and at the low and high frequency ends for angular frequency stimuli, both under photopic luminance conditions.

  6. Pedogenese et potentialites forestieres des sols sulfates acides sales des Tannes du Sine Saloum, Senegal

    NARCIS (Netherlands)

    Sadio, S.

    1989-01-01

    Soils of the "Tannes region" of the Sine Saloum bassin, Senegal, are characterized by great heterogenity in morphology and physical and chemical properties. Their caracteristics are linked to topographic position, material and hydrology.

    Their recent pedogenetical evolution is a

  7. Overview of multi-input frequency domain modal testing methods with an emphasis on sine testing

    Science.gov (United States)

    Rost, Robert W.; Brown, David L.

    1988-01-01

    An overview of the current state of the art multiple-input, multiple-output modal testing technology is discussed. A very brief review of the current time domain methods is given. A detailed review of frequency and spatial domain methods is presented with an emphasis on sine testing.

  8. Acute effect of alcohol intake on sine-wave Cartesian and polar contrast sensitivity functions

    Directory of Open Access Journals (Sweden)

    M.K. Cavalcanti-Galdino

    2014-04-01

    Full Text Available The aim of this study was to assess contrast sensitivity for angular frequency stimuli as well as for sine-wave gratings in adults under the effect of acute ingestion of alcohol. We measured the contrast sensitivity function (CSF for gratings of 0.25, 1.25, 2.5, 4, 10, and 20 cycles per degree of visual angle (cpd as well as for angular frequency stimuli of 1, 2, 4, 24, 48, and 96 cycles/360°. Twenty adults free of ocular diseases, with normal or corrected-to-normal visual acuity, and no history of alcoholism were enrolled in two experimental groups: 1 no alcohol intake (control group and 2 alcohol ingestion (experimental group. The average concentration of alcohol in the experimental group was set to about 0.08%. We used a paradigm involving a forced-choice method. Maximum sensitivity to contrast for sine-wave gratings in the two groups occurred at 4 cpd sine-wave gratings and at 24 and 48 cycles/360° for angular frequency stimuli. Significant changes in contrast sensitivity were observed after alcohol intake compared with the control condition at spatial frequency of 4 cpd and 1, 24, and 48 cycles/360° for angular frequency stimuli. Alcohol intake seems to affect the processing of sine-wave gratings at maximum sensitivity and at the low and high frequency ends for angular frequency stimuli, both under photopic luminance conditions.

  9. A generalized exp-function method for multiwave solutions of sine ...

    Indian Academy of Sciences (India)

    In this paper, the exp-function method is generalized to sine-Gordon (sG) equation and single-, double- and three-wave solutions are obtained. It is shown that the generalized exp-function method combined with appropriate anstaz may provide a straightforward, effective and alternative method for constructing multiwave ...

  10. Emotional Intelligence: The Sine Qua Non for a Clinical Leadership Toolbox

    Science.gov (United States)

    Rao, Paul R.

    2006-01-01

    Over the past decade, it has become increasingly clear that although IQ and technical skills are important, emotional intelligence is the Sine Qua Non of leadership. According to Goleman [Goleman, D. (1998). What makes a leader? "Harvard Business Review," 93-102] "effective leaders are alike in one crucial way: they all have a high degree of…

  11. Surfaces of Constant negative Scalar Curvature and the Correpondence between the Liouvulle and the sine-Gordon Equations

    CERN Document Server

    Belich, H; Paunov, R R

    1999-01-01

    By studying the {\\it internal} Riemannian geometry of the surfaces of constant negative scalar curvature, we obtain a natural map between the Liouville, and the sine-Gordon equations. First, considering isometric immersions into the Lobachevskian plane, we obtain an uniform expression for the general (locally defined) solution of both the equations. Second, we prove that there is a Lie-Bäcklund transformation interpolating between Liouville and sine-Gordon. Third, we use isometric immersions into the Lobachevskian plane to describe sine-Gordon N-solitons explicitly.

  12. Anthropogenic features in the Sines (Portugal and Essaouira (Morocco coastal aquifers: a comparative study of their hydrochemical evolution by a Principal Component Analysis.

    Directory of Open Access Journals (Sweden)

    Silva, M. O.

    2005-12-01

    Full Text Available Considering the effects of climatic conditions on groundwater resources salinization and quality, a comparative study was conducted on the coastal aquifers of Sines (Portugal and Essaouira (Morocco. Under the climatic and environmental conditions these two basins present different vulnerabilities to anthropogenic activities. Both aquifers correspond to sedimentary basins with similar structures and lithologies. From the available physical, chemical and piezometric data, two series of results of each area were selected corresponding to two different years that were analysed by Principal Component Analysis (PCA. Sines basin is characterised by a temperate climate. In the Sines aquifer the waterrock interaction process is the major mechanism responsible for the groundwater evolution, conferring a calcium-bicarbonate facies. Applying the PCA, punctual anthropogenic contamination was identified and linked to agricultural activities. The water resources of the Essaouira basin are characteristic of a semi-arid climate, and are severely impacted by the climate (quantity and quality. PCA allowed the evaluation of the contribution of the Tidzi diapir in the water recharge that confers to the groundwater a sodium-chloride facies. Although this statistical method did not shown a nitrate contamination input in the Essaouira multi-aquifer, this polluent presents locally high values. Also the very high evaporation and scarce precipitation activate the processes of salinization and contamination.Considerando los efectos de las condiciones climáticas sobre la calidad y la salinidad de las aguas subterráneas, se ha llevado a cabo un estudio comparativo entre los acuíferos costeros de Sines (Portugal y de Essaouira (Marruecos. Teniendo en cuenta las condiciones climáticas y el medio ambiente de estas dos cuencas, resultan distintas vulnerabilidades a las actividades antrópicas. Ambos acuíferos se localizan en cuencas sedimentarias de estructura y de litolog

  13. Generation and propagation of a sine-azimuthal wavefront modulated Gaussian beam.

    Science.gov (United States)

    Lao, Guanming; Zhang, Zhaohui; Luo, Meilan; Zhao, Daomu

    2016-07-21

    We introduce a method for modulating the Gaussian beam by means of sine-azimuthal wavefront and carry out the experimental generation. The analytical propagation formula of such a beam passing through a paraxial ABCD optical system is derived, by which the intensity properties of the sine-azimuthal wavefront modulated Gaussian (SWMG) beam are examined both theoretically and experimentally. Both of the experimental and theoretical results show that the SWMG beam goes through the process from beam splitting to a Gaussian-like profile, which is closely determined by the phase factor and the propagation distance. Appropriate phase factor and short distance are helpful for the splitting of beam. However, in the cases of large phase factor and focal plane, the intensity distributions tend to take a Gaussian form. Such unique features may be of importance in particle trapping and medical applications.

  14. STIMA DE SINE – ELEMENT IMPORTANT ÎN PROIECTAREA CARIEREI

    Directory of Open Access Journals (Sweden)

    Carolina PLATON

    2015-11-01

    Full Text Available Savanţii susţin că doar o persoană cu stimă de sine înaltă are şanse să-şi dea seama de propriul potenţial. În procesul de orientare în carieră stima de sine va ajuta persoana să ia decizii corecte, să se autoevalueze şi să acţioneze în sensul aspiraţiilor sale.SELF-ESTEEM – AN IMPORTANT ELEMENT IN THE CAREER PLANNING PROCESSThe scientists support the idea about the awakening that is happening throughout the world to the fact that a human being cannot realize his potential without a healthy self-esteem. A high self-esteem will help a person to make decisions, self-assessment and to act according to his aspirations in the career planning process.

  15. Stabilization of breathers in a parametrically driven sine-Gordon system with loss

    DEFF Research Database (Denmark)

    Grønbech-Jensen, N.; Kivshar, Yu. S.; Samuelsen, Mogens Rugholm

    1991-01-01

    We demonstrate that in a parametrically driven sine-Gordon system with loss, a breather, if driven, can be maintained in a steady state at half the external frequency. In the small-amplitude limit the system is described by the effective perturbed nonlinear Schrödinger equation. For an arbitrary ...... breather amplitude the threshold field is determined by a perturbation method and compared with direct numerical simulations. Excellent agreement is found....

  16. MLP based models to predict PM10, O3 concentrations, in Sines industrial area

    Science.gov (United States)

    Durao, R.; Pereira, M. J.

    2012-04-01

    Sines is an important Portuguese industrial area located southwest cost of Portugal with important nearby protected natural areas. The main economical activities are related with this industrial area, the deep-water port, petrochemical and thermo-electric industry. Nevertheless, tourism is also an important economic activity especially in summer time with potential to grow. The aim of this study is to develop prediction models of pollutant concentration categories (e.g. low concentration and high concentration) in order to provide early warnings to the competent authorities who are responsible for the air quality management. The knowledge in advanced of pollutant high concentrations occurrence will allow the implementation of mitigation actions and the release of precautionary alerts to population. The regional air quality monitoring network consists in three monitoring stations where a set of pollutants' concentrations are registered on a continuous basis. From this set stands out the tropospheric ozone (O3) and particulate matter (PM10) due to the high concentrations occurring in the region and their adverse effects on human health. Moreover, the major industrial plants of the region monitor SO2, NO2 and particles emitted flows at the principal chimneys (point sources), also on a continuous basis,. Therefore Artificial neuronal networks (ANN) were the applied methodology to predict next day pollutant concentrations; due to the ANNs structure they have the ability to capture the non-linear relationships between predictor variables. Hence the first step of this study was to apply multivariate exploratory techniques to select the best predictor variables. The classification trees methodology (CART) was revealed to be the most appropriate in this case.. Results shown that pollutants atmospheric concentrations are mainly dependent on industrial emissions and a complex combination of meteorological factors and the time of the year. In the second step, the Multi

  17. [Hypochondria sine materia as a psychosomatic problem: a model of hypochondriac disorders realized in the cutaneous sphere].

    Science.gov (United States)

    Smulevich, A B; Dorozhenok, I Iu; Romanov, D V; L'vov, A N

    2012-01-01

    Hypochondria sine materia is a disorder with physical complains corresponding to no any somatic diagnosis. Hypochondria sine materia is a more complicated psychopathological condition compared to hypochondria cum materia. Hypochondria sine materia could be diagnosed not only in psychiatry, but mainly in general medicine. It is especially prevalent in dermatology. As a result of analysis of hypochondriac disorders involving cutaneous sphere in patients without dermatological diseases, a binary model of psychodermatological syndromes presenting with hypochondria sine materia in dermatology was developed. The binary structure of the psychodermatological syndromes includes secondary psychiatric symptoms based on primary coenesthesiopathic phenomena. The heterogeneous psychodermatological syndromes (cutaneous organ neurosis, impulsive excoriations syndrome, circumscripta hypochondria, coenesthesiopathic paranoia) could be arranged in a continuum of consecutively worsening conditions from neurotic to psychotic severity register. The syndromes differ in clinical and social prognosis requiring different approach to diagnosis and treatment.

  18. Phonetic matching of auditory and visual speech develops during childhood: evidence from sine-wave speech.

    Science.gov (United States)

    Baart, Martijn; Bortfeld, Heather; Vroomen, Jean

    2015-01-01

    The correspondence between auditory speech and lip-read information can be detected based on a combination of temporal and phonetic cross-modal cues. Here, we determined the point in developmental time at which children start to effectively use phonetic information to match a speech sound with one of two articulating faces. We presented 4- to 11-year-olds (N=77) with three-syllabic sine-wave speech replicas of two pseudo-words that were perceived as non-speech and asked them to match the sounds with the corresponding lip-read video. At first, children had no phonetic knowledge about the sounds, and matching was thus based on the temporal cues that are fully retained in sine-wave speech. Next, we trained all children to perceive the phonetic identity of the sine-wave speech and repeated the audiovisual (AV) matching task. Only at around 6.5 years of age did the benefit of having phonetic knowledge about the stimuli become apparent, thereby indicating that AV matching based on phonetic cues presumably develops more slowly than AV matching based on temporal cues. Copyright © 2014 Elsevier Inc. All rights reserved.

  19. Gene conversion as a secondary mechanism of short interspersed element (SINE) evolution

    Energy Technology Data Exchange (ETDEWEB)

    Kass, D.H. [Louisiana State Univ. Medical Center, New Orleans, LA (United States). Dept. of Biochemistry and Molecular Biology; Batzer, M.A. [Lawrence Livermore National Lab., CA (United States); Deininger, P.L. [Louisiana State Univ. Medical Center, New Orleans, LA (United States). Dept. of Biochemistry and Molecular Biology]|[Alton Ochsner Medical Foundation, New Orleans, LA (United States). Lab. of Molecular Genetics

    1995-01-01

    The Alu repetitive family of short interspersed elements (SINEs) in primates can be subdivided into distinct subfamilies by specific diagnostic nucleotide changes. The older subfamilies are generally very abundant, while the younger subfamilies have fewer copies. Some of the youngest Alu elements are absent in the orthologous loci of nonhuman primates, indicative of recent retroposition events, the primary mode of SINE evolutions. PCR analysis of one young Alu subfamily (Sb2) member found in the low-density lipoprotein receptor gene apparently revealed the presence of this element in the green monkey, orangutan, gorilla, and chimpanzee genomes, as well as the human genome. However, sequence analysis of these genomes revealed a highly mutated, older, primate-specific Alu element was present at this position in the nonhuman primates. Comparison of the flanking DNA sequences upstream of this Alu insertion corresponded to evolution expected for standard primate phylogeny, but comparison of the Alu repeat sequences revealed that the human element departed from this phylogeny. The change in the human sequence apparently occurred by a gene conversion event only within the Alu element itself, converting it from one of the oldest to one of the youngest Alu subfamilies. Although gene conversions of Alu elements are clearly very rare, this finding shows that such events can occur and contribute to specific cases of SINE subfamily evolution.

  20. Sine jure

    OpenAIRE

    Gálvez Lozano, Joaquín Yeray

    2016-01-01

    Un recorrido a través de nuestra historia, de nuestro pasado, una mirada hacia las raíces sobre las cuales se depositan años de prejuicios, donde el paso del tiempo no ha hecho más que cimentar las ideas hoy en día maduradas en el subconsciente, floreciendo sin razón ante cualquier circunstancia, ante cualquier situación, valiendo para crear una imagen infundada de aquel del que no sabemos nada. El racismo no es cosa del hoy, ni siquiera del ayer, va más allá de los límites ...

  1. A Time-Splitting and Sine Spectral Method for Dynamics of Dipolar Bose-Einstein Condensate

    Directory of Open Access Journals (Sweden)

    Si-Qi Li

    2013-01-01

    Full Text Available A two-component Bose-Einstein condensate (BEC described by two coupled a three-dimension Gross-Pitaevskii (GP equations is considered, where one equation has dipole-dipole interaction while the other one has only the usual s-wave contact interaction, in a cigar trap. The time-splitting and sine spectral method in space is proposed to discretize the time-dependent equations for computing the dynamics of dipolar BEC. The singularity in the dipole-dipole interaction brings significant difficulties both in mathematical analysis and in numerical simulations. Numerical results are given to show the efficiency of this method.

  2. Fast Fourier transform analysis of dynamic data: sine wave stress-strain analysis of biological tissue.

    Science.gov (United States)

    Wang, L; Bert, J L; Okazawa, M; Paré, P D; Pinder, K L

    1997-03-01

    We propose an improvement to the dynamic oscillation method using as an example the measurement of the tensile stiffness of the rabbit tracheal mucosal membrane. A sine wave oscillation technique was used to study the tissue mechanical properties. A mathematical model was developed using fast Fourier analysis. After mathematically eliminating the machine response, this analysis reveals the tissue frequency response over a wide range of frequencies. This study addresses the advantages of using Fourier analysis to interpret dynamic properties of biological tissue and provides a complete description of how to obtain the pure tissue response.

  3. Diego de Moxena, el 'Liber sine nomine' de Petrarca y el concilio de Constanza

    OpenAIRE

    Ruiz Arzalluz, Íñigo

    2016-01-01

    Número monográfico dedicado a Petrarca y el humanismo en la Península Ibérica. [ES] Diego de Moxena, franciscano probablemente castellano activo en el concilio de Constanza, escribe el 9 de julio de 1415 a Fernando I de Aragón una carta en la que le insta a sumarse al concilio y reconsiderar su apoyo a Benedicto XIII. El escrito de Moxena revela un uso del 'Liber sine nomine' de Petrarca —advertido ya por Isaac Vázquez Janeiro— que resulta especialmente llamativo: además de tratarse de un ...

  4. Discrete cosine and sine transforms general properties, fast algorithms and integer approximations

    CERN Document Server

    Britanak, Vladimir; Rao, K R; Rao, K R

    2006-01-01

    The Discrete Cosine Transform (DCT) is used in many applications by the scientific, engineering and research communities and in data compression in particular. Fast algorithms and applications of the DCT Type II (DCT-II) have become the heart of many established international image/video coding standards. Since then other forms of the DCT and Discrete Sine Transform (DST) have been investigated in detail. This new edition presents the complete set of DCT and DST discrete trigonometric transforms, including their definitions, general mathematical properties, and relations to the optimal Karhune

  5. Sine-Gordon 2-pi-kink dynamics in the presence of small perturbations

    DEFF Research Database (Denmark)

    Olsen, O. H.; Samuelsen, Mogens Rugholm

    1983-01-01

    The influence of external driving forces on the 2π-kink solution to the sine-Gordon equation is examined. The analysis is based on the approach that the solution to the problem can be divided into a 2π-kink part and a background or vacuum part. The behavior of the 2π kink depends strongly on the ...... on the initial state of the vacuum. Excellent agreement between the analysis and numerical solution of representative initial-value problems is found....

  6. Implementing the sine transform of fermionic modes as a tensor network

    Science.gov (United States)

    Epple, Hannes; Fries, Pascal; Hinrichsen, Haye

    2017-09-01

    Based on the algebraic theory of signal processing, we recursively decompose the discrete sine transform of the first kind (DST-I) into small orthogonal block operations. Using a diagrammatic language, we then second-quantize this decomposition to construct a tensor network implementing the DST-I for fermionic modes on a lattice. The complexity of the resulting network is shown to scale as 5/4 n logn (not considering swap gates), where n is the number of lattice sites. Our method provides a systematic approach of generalizing Ferris' spectral tensor network for nontrivial boundary conditions.

  7. Development of a sine-dwell ground vibration test (GVT) system

    CSIR Research Space (South Africa)

    Van Zyl, Lourens H

    2006-02-27

    Full Text Available Vibration Test (GVT) System Presented at CSIR Research and Innovation Conference: 27 - 28 February 2006 DPSS Mr Louw van Zyl Mr Erik Wegman 27 February 2006 Slide 2 © CSIR 2006 www.csir.co.za Agenda • Introduction Why ground... stream_source_info VanZyl_2006.pdf.txt stream_content_type text/plain stream_size 9765 Content-Encoding UTF-8 stream_name VanZyl_2006.pdf.txt Content-Type text/plain; charset=UTF-8 Development of a Sine-Dwell Ground...

  8. Thermal sine-Gordon system in the presence of different types of dissipation

    DEFF Research Database (Denmark)

    Salerno, M.; Samuelsen, Mogens Rugholm; Svensmark, Henrik

    1988-01-01

    The effects of thermal fluctuations on solitons and phonons of the sine-Gordon system are investigated in the presence of a αφt-βφxxt dissipation. The analysis requires the assumption of a more general autocorrelation function for the noise than the one used in previous works. We verify...... that this leads to the correct results for the average kinetic energies of solitons and phonons in the system. We also evaluate the linewidth for a Josephson oscillator in the presence of both α and β dissipation, and lastly we briefly discuss the extension of the theory to more general dissipative terms....

  9. Short interspersed nuclear elements (SINEs) are abundant in Solanaceae and have a family-specific impact on gene structure and genome organization.

    Science.gov (United States)

    Seibt, Kathrin M; Wenke, Torsten; Muders, Katja; Truberg, Bernd; Schmidt, Thomas

    2016-05-01

    Short interspersed nuclear elements (SINEs) are highly abundant non-autonomous retrotransposons that are widespread in plants. They are short in size, non-coding, show high sequence diversity, and are therefore mostly not or not correctly annotated in plant genome sequences. Hence, comparative studies on genomic SINE populations are rare. To explore the structural organization and impact of SINEs, we comparatively investigated the genome sequences of the Solanaceae species potato (Solanum tuberosum), tomato (Solanum lycopersicum), wild tomato (Solanum pennellii), and two pepper cultivars (Capsicum annuum). Based on 8.5 Gbp sequence data, we annotated 82 983 SINE copies belonging to 10 families and subfamilies on a base pair level. Solanaceae SINEs are dispersed over all chromosomes with enrichments in distal regions. Depending on the genome assemblies and gene predictions, 30% of all SINE copies are associated with genes, particularly frequent in introns and untranslated regions (UTRs). The close association with genes is family specific. More than 10% of all genes annotated in the Solanaceae species investigated contain at least one SINE insertion, and we found genes harbouring up to 16 SINE copies. We demonstrate the involvement of SINEs in gene and genome evolution including the donation of splice sites, start and stop codons and exons to genes, enlargement of introns and UTRs, generation of tandem-like duplications and transduction of adjacent sequence regions. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.

  10. Use of the p-SINE1-r2 in inferring evolutionary relationships of Thai rice varieties with AA genome

    Directory of Open Access Journals (Sweden)

    Preecha Prathepha

    2006-01-01

    Full Text Available In a previous study we described the prevalence and distribution in Thailand of the retroposon p- SINE1-r2, in the intron 10 of the waxy gene in cultivated and wild rice with the AA genome. In this study, additional varieties of rice were collected and sequencing was used to further characterize p-SINE1-r2. It was found that the length of the p-SINE1-r2 nucleotide sequences was about 125 bp, flanked by identical direct repeats of a 14 bp sequence. These sequences were compared and found to be similar to the sequences of p- SINE1-r2 found in Nipponbare, a rice strain discussed in a separate study. However, when compared the 48 DNA sequences identified in this study, much dissimilarity was found within the nucleotide sequences of p- SINE1-r2, in the form of base substitution mutations. Phylogenetic relationships inferred from the nucleotide sequences of these elements in cultivated rice (O. sativa and wild rice (O. nivara. It was found that rice accessions collected from the same geographical distribution have been placed in the same clade. The phylogenetic tree supports the origin and distribution of these rice strains.

  11. Preclinical Evaluation of the Novel, Orally Bioavailable Selective Inhibitor of Nuclear Export (SINE) KPT-335 in Spontaneous Canine Cancer: Results of a Phase I Study

    Science.gov (United States)

    London, Cheryl A.; Bernabe, Luis Feo; Barnard, Sandra; Kisseberth, William C.; Borgatti, Antonella; Henson, Mike; Wilson, Heather; Jensen, Kiersten; Ito, Daisuke; Modiano, Jaime F.; Bear, Misty D.; Pennell, Michael L.; Saint-Martin, Jean-Richard; McCauley, Dilara; Kauffman, Michael; Shacham, Sharon

    2014-01-01

    Background The purpose of this study was to evaluate the activity of Selective Inhibitors of Nuclear Export (SINE) compounds that inhibit the function of the nuclear export protein Exportin 1 (XPO1/CRM1) against canine tumor cell lines and perform a Phase I clinical trial of KPT-335 in dogs with spontaneous cancer to provide a preliminary assessment of biologic activity and tolerability. Methods and Findings Canine tumor cell lines derived from non-Hodgkin lymphoma (NHL), mast cell tumor, melanoma and osteosarcoma exhibited growth inhibition and apoptosis in response to nanomolar concentrations of SINE compounds; NHL cells were particularly sensitive with IC50 concentrations ranging from 2–42 nM. A Phase I clinical trial of KPT-335 was performed in 17 dogs with NHL (naive or relapsed), mast cell tumor or osteosarcoma. The maximum tolerated dose was 1.75 mg/kg given orally twice/week (Monday/Thursday) although biologic activity was observed at 1 mg/kg. Clinical benefit (CB) including partial response to therapy (PR, n = 2) and stable disease (SD, n = 7) was observed in 9/14 dogs with NHL with a median time to progression (TTP) for responders of 66 days (range 35–256 days). A dose expansion study was performed in 6 dogs with NHL given 1.5 mg/kg KPT-335 Monday/Wednesday/Friday; CB was observed in 4/6 dogs with a median TTP for responders of 83 days (range 35–354 days). Toxicities were primarily gastrointestinal consisting of anorexia, weight loss, vomiting and diarrhea and were manageable with supportive care, dose modulation and administration of low dose prednisone; hepatotoxicity, anorexia and weight loss were the dose limiting toxicities. Conclusions This study provides evidence that the novel orally bioavailable XPO1 inhibitor KPT-335 is safe and exhibits activity in a relevant, spontaneous large animal model of cancer. Data from this study provides critical new information that lays the groundwork for evaluation of SINE compounds in human cancer

  12. Preclinical evaluation of the novel, orally bioavailable Selective Inhibitor of Nuclear Export (SINE KPT-335 in spontaneous canine cancer: results of a phase I study.

    Directory of Open Access Journals (Sweden)

    Cheryl A London

    Full Text Available The purpose of this study was to evaluate the activity of Selective Inhibitors of Nuclear Export (SINE compounds that inhibit the function of the nuclear export protein Exportin 1 (XPO1/CRM1 against canine tumor cell lines and perform a Phase I clinical trial of KPT-335 in dogs with spontaneous cancer to provide a preliminary assessment of biologic activity and tolerability.Canine tumor cell lines derived from non-Hodgkin lymphoma (NHL, mast cell tumor, melanoma and osteosarcoma exhibited growth inhibition and apoptosis in response to nanomolar concentrations of SINE compounds; NHL cells were particularly sensitive with IC50 concentrations ranging from 2-42 nM. A Phase I clinical trial of KPT-335 was performed in 17 dogs with NHL (naive or relapsed, mast cell tumor or osteosarcoma. The maximum tolerated dose was 1.75 mg/kg given orally twice/week (Monday/Thursday although biologic activity was observed at 1 mg/kg. Clinical benefit (CB including partial response to therapy (PR, n = 2 and stable disease (SD, n = 7 was observed in 9/14 dogs with NHL with a median time to progression (TTP for responders of 66 days (range 35-256 days. A dose expansion study was performed in 6 dogs with NHL given 1.5 mg/kg KPT-335 Monday/Wednesday/Friday; CB was observed in 4/6 dogs with a median TTP for responders of 83 days (range 35-354 days. Toxicities were primarily gastrointestinal consisting of anorexia, weight loss, vomiting and diarrhea and were manageable with supportive care, dose modulation and administration of low dose prednisone; hepatotoxicity, anorexia and weight loss were the dose limiting toxicities.This study provides evidence that the novel orally bioavailable XPO1 inhibitor KPT-335 is safe and exhibits activity in a relevant, spontaneous large animal model of cancer. Data from this study provides critical new information that lays the groundwork for evaluation of SINE compounds in human cancer.

  13. Some aspects of jump-defects in the quantum sine-Gordon model

    Energy Technology Data Exchange (ETDEWEB)

    Bowcock, Peter [Department of Mathematical Sciences, University of Durham, Durham DH1 3LE (United Kingdom); Corrigan, Edward [Department of Mathematics, University of York, York YO10 5DD (United Kingdom); Yukawa Institute for Theoretical Physics, University of Kyoto, Kyoto 606-8502 (Japan); Zambon, Cristina [Yukawa Institute for Theoretical Physics, University of Kyoto, Kyoto 606-8502 (Japan)

    2005-08-01

    The classical sine-Gordon model permits integrable discontinuities, or jump-defects, where the conditions relating the fields on either side of a defect are Baecklund transformations frozen at the defect location. The purpose of this article is to explore the extent to which this idea may be extended to the quantum sine-Gordon model and how the striking features of the classical model may translate to the quantum version. Assuming a positive defect parameter there are two types of defect. One type, carrying even charge, is stable, but the other type, carrying odd charge, is unstable and may be considered as a resonant bound state of a soliton and a stable defect. The scattering of solitons with defects is considered in detail, as is the scattering of breathers, and in all cases the jump-defect is purely transmitting. One surprising discovery concerns the lightest breather. Its transmission factor is independent of the bulk coupling - a property susceptible to a perturbative check, but not shared with any of the other breathers. It is argued that classical jump-defects can move and some comments are made concerning their quantum scattering matrix.

  14. Speech perception of sine-wave signals by children with cochlear implants.

    Science.gov (United States)

    Nittrouer, Susan; Kuess, Jamie; Lowenstein, Joanna H

    2015-05-01

    Children need to discover linguistically meaningful structures in the acoustic speech signal. Being attentive to recurring, time-varying formant patterns helps in that process. However, that kind of acoustic structure may not be available to children with cochlear implants (CIs), thus hindering development. The major goal of this study was to examine whether children with CIs are as sensitive to time-varying formant structure as children with normal hearing (NH) by asking them to recognize sine-wave speech. The same materials were presented as speech in noise, as well, to evaluate whether any group differences might simply reflect general perceptual deficits on the part of children with CIs. Vocabulary knowledge, phonemic awareness, and "top-down" language effects were all also assessed. Finally, treatment factors were examined as possible predictors of outcomes. Results showed that children with CIs were as accurate as children with NH at recognizing sine-wave speech, but poorer at recognizing speech in noise. Phonemic awareness was related to that recognition. Top-down effects were similar across groups. Having had a period of bimodal stimulation near the time of receiving a first CI facilitated these effects. Results suggest that children with CIs have access to the important time-varying structure of vocal-tract formants.

  15. A new compound control method for sine-on-random mixed vibration test

    Science.gov (United States)

    Zhang, Buyun; Wang, Ruochen; Zeng, Falin

    2017-09-01

    Vibration environmental test (VET) is one of the important and effective methods to provide supports for the strength design, reliability and durability test of mechanical products. A new separation control strategy was proposed to apply in multiple-input multiple-output (MIMO) sine on random (SOR) mixed mode vibration test, which is the advanced and intensive test type of VET. As the key problem of the strategy, correlation integral method was applied to separate the mixed signals which included random and sinusoidal components. The feedback control formula of MIMO linear random vibration system was systematically deduced in frequency domain, and Jacobi control algorithm was proposed in view of the elements, such as self-spectrum, coherence, and phase of power spectral density (PSD) matrix. Based on the excessive correction of excitation in sine vibration test, compression factor was introduced to reduce the excitation correction, avoiding the destruction to vibration table or other devices. The two methods were synthesized to be applied in MIMO SOR vibration test system. In the final, verification test system with the vibration of a cantilever beam as the control object was established to verify the reliability and effectiveness of the methods proposed in the paper. The test results show that the exceeding values can be controlled in the tolerance range of references accurately, and the method can supply theory and application supports for mechanical engineering.

  16. Reverberation time measurement using integrated impulse response and sweep sine excitation

    Science.gov (United States)

    Nabuco, Marco; Brando, Paulo

    2002-11-01

    As the capacity and speed of digital processing systems becomes much higher, the integrated impulsive response for reverberation time measurements by the indirect method also becomes more feasible and faster. The MLS technique to obtain the impulse response for LTI has been developed during the last several years and it is very well reported by the bibliography. Some frequency analyzers available in the market are capable to generate and process MLS to get the impulse responses very easily. Sometimes, when the room to be tested is very reverberant, sequences of higher order and a certain number of average are necessary to assure acceptable signal-to-noise ratio. The sweep sine technique or the deconvolution method to obtain impulsive responses presents many new advantages, most of them still reported in various technical documents. This paper presents the results of application of this technique to measure the reverberation time in two different reverberation rooms. Comparisons with MLS, ensemble, and reverberation time averages are presented. The sweep sine technique repeatability was verified in a reverberation chamber for a polyurethane foam sample and showed smaller standard deviations when compared with other techniques. (To be presented in Portuguese.)

  17. Inverted sine carrier for fundamental fortification in PWM inverters and FPGA based implementations

    Directory of Open Access Journals (Sweden)

    Jeevananthan S.

    2007-01-01

    Full Text Available This paper deals with a novel natural sampled pulse width modulation (PWM switching strategy for voltage source inverter through carrier modification. The proposed inverted sine carrier PWM (ISCPWM method, which uses the conventional sinusoidal reference signal and an inverted sine carrier, has a better spectral quality and a higher fundamental component compared to the conventional sinusoidal PWM (SPWM without any pulse dropping. The ISCPWM strategy enhances the fundamental output voltage particularly at lower modulation index ranges while keeping the total harmonic distortion (THD lower without involving changes in device switching losses. The presented mathematical preliminaries for both SPWM and ISCPWM give a conceptual understanding and a comparison of the strategies. The detailed comparison of the harmonic content and fundamental component of the ISCPWM output for different values of modulation index with the results obtained for the SPWM is also presented. Finally, the proposed modulator has been implemented in field programmable gate array (FPGA- Xilinx Spartan 3 and tested with the proto-type inverter.

  18. On the correct use of stepped-sine excitations for the measurement of time-varying bioimpedance.

    Science.gov (United States)

    Louarroudi, E; Sanchez, B

    2017-02-01

    When a linear time-varying (LTV) bioimpedance is measured using stepped-sine excitations, a compromise must be made: the temporal distortions affecting the data depend on the experimental time, which in turn sets the data accuracy and limits the temporal bandwidth of the system that needs to be measured. Here, the experimental time required to measure linear time-invariant bioimpedance with a specified accuracy is analyzed for different stepped-sine excitation setups. We provide simple equations that allow the reader to know whether LTV bioimpedance can be measured through repeated time- invariant stepped-sine experiments. Bioimpedance technology is on the rise thanks to a plethora of healthcare monitoring applications. The results presented can help to avoid distortions in the data while measuring accurately non-stationary physiological phenomena. The impact of the work presented is broad, including the potential of enhancing bioimpedance studies and healthcare devices using bioimpedance technology.

  19. Evidence of slope failure in the Sines Contourite Drift area (SW Portuguese Continental Margin) - preliminary results

    Science.gov (United States)

    Teixeira, Manuel; Roque, Cristina; Terrinha, Pedro; Rodrigues, Sara; Ercilla, Gemma; Casas, David

    2017-04-01

    Slope instability, expressed by landslide activity, is an important natural hazard both onshore as well as offshore. Offshore processes create great concern on coastal areas constituting one of the major and most prominent hazards, directly by the damages they generate and indirectly by the possibility of generating tsunamis, which may affect the coast line. The Southwest Portuguese Continental Margin has been identified as an area where several mass movements occurred from Late Pleistocene to Present. Recently, an area of 52 km long by 34 km wide, affected by slope failure has been recognized in the Sines contourite drift located off the Alentejo. SWIM and CONDRIBER multibeam swath bathymetry has been used for the geomorphologic analysis and for recognition of mass movement scars on the seabed. Scars' areas and volumes were calculated by reconstructing paleo-bathymetry. The net gain and net loss were calculated using both paleo and present day bathymetry. Geomorphologically, the study area presents 4 morphologic domains with landslide scars: I) Shelf and upper slope display an irregular boundary with domain II with a sharp step ( 150m - 600m); II) Smooth area with gentle slope angles making the transition from smoother area to the continental slope (scarp), with large scars, suggesting slow rate and distributed mass wasting processes over this area ( 600 - 1200m); III) Scarp with high rates of retrograding instability, where faster processes are verified and a great number of gullies is feeding downslope area (1200m - 3200m); IV) Lebre Basin where mass movements deposits accumulate (> 3200m). A total of 51 landslide scars were identified with a total affected area of 137.67 km2, with 80.9 km2 being located in the continental slope with about 59% of the disrupted area, between 1200 and 3200m, and 41% (56.6 km2) lies in the continental shelf and upper slope, on a range of depths between 150 and 800m. The mean scar area is 2.7 km2 and the maximum area recorded on a

  20. Numerical simulation of the self-pumped long Josephson junction using a modified sine-Gordon model

    DEFF Research Database (Denmark)

    Sobolev, A.; Pankratov, A.; Mygind, Jesper

    2006-01-01

    We have numerically investigated the dynamics of a long Josephson junction (flux-flow oscillator) biased by a DC current in the presence of magnetic field. The study is performed in the frame of the modified sine-Gordon model, which includes the surface losses, RC-load at both FFO ends and the self......-pumping effect. In our model the dumping parameter depends both on the spatial coordinate and the amplitude of the AC voltage. In order to find the DC FFO voltage the damping parameter has to be calculated by successive approximations and time integration of the perturbed sine-Gordon equation. The modified model...

  1. Localized structures and spatiotemporal chaos: comparison between the driven damped sine-Gordon and the Lugiato-Lefever model

    Science.gov (United States)

    Ferré, Michel A.; Clerc, Marcel G.; Coulibally, Saliya; Rojas, René G.; Tlidi, Mustapha

    2017-06-01

    Driven damped coupled oscillators exhibit complex spatiotemporal dynamics. An archetype model is the driven damped sine-Gordon equation, which can describe several physical systems such as coupled pendula, extended Josephson junction, optical systems and driven magnetic wires. Close to resonance an enveloped model in the form Lugiato-Lefever equation can be derived from the driven damped sine-Gordon equation. We compare the dynamics obtained from both models. Unexpectedly, qualitatively similar dynamical behaviors are obtained for both models including homogeneous steady states, localized structures, and pattern waves. For large forcing, both systems share similar spatiotemporal chaos.

  2. Analysis of the 227 bp short interspersed nuclear element (SINE) insertion of the promoter of the myostatin (MSTN) gene in different horse breeds.

    Science.gov (United States)

    Dall'Olio, Stefania; Scotti, Emilio; Fontanesi, Luca; Tassinari, Marco

    2014-01-01

    The myostatin (MSTN) gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus) MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE) insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs) generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot) and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81) and in the Thoroughbred (0.51), whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

  3. Analysis of the 227 bp short interspersed nuclear element (SINE insertion of the promoter of the myostatin (MSTN gene in different horse breeds

    Directory of Open Access Journals (Sweden)

    Stefania Dall'Olio

    2014-09-01

    Full Text Available The myostatin (MSTN gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic. The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81 and in the Thoroughbred (0.51, whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

  4. Detection of sub-threshold periodic signal by multiplicative and additive cross-correlated sine-Wiener noises in the FitzHugh-Nagumo neuron

    Science.gov (United States)

    Yao, Yuangen; Ma, Chengzhang; Wang, Canjun; Yi, Ming; Gui, Rong

    2018-02-01

    We study the effects of multiplicative and additive cross-correlated sine-Wiener (CCSW) noises on the performance of sub-threshold periodic signal detection in the FitzHugh-Nagumo (FHN) neuron by calculating Fourier coefficients Q for measuring synchronization between sub-threshold input signal and the response of system. CCSW noises-induced transitions of electrical activity in the FHN neuron model can be observed. Moreover, the performance of sub-threshold periodic signal detection is achieved at moderate noise strength, cross-correlation time and cross-correlation strength of CCSW noises, which indicate the occurrence of CCSW noises-induced stochastic resonance. Furthermore, the performance of sub-threshold signal detection is strongly sensitive to cross-correlation time of CCSW noises. Therefore, the performance can be effectively controlled by regulating cross-correlation time of CCSW noises. These results provide a possible mechanism for amplifying or detecting the sub-threshold signal in the nervous system.

  5. The Sine Wave Tuning method: Robust PID controller design in the frequency domain

    Directory of Open Access Journals (Sweden)

    Š. Bucz

    2015-12-01

    Full Text Available The paper presents a novel robust PID controller design method for nominal performance specified in terms of maximum overshoot and settling time. The PID controller design provides guaranteed gain margin GM. The parameter of the tuning rules is a suitably chosen point of the plant frequency response obtained by a sine-wave signal with excitation frequency ωn. Then, the designed controller moves this point into the phase crossover with the required gain margin GM. The couple (ωn;GM is specified with respect to closed-loop performance requirements in terms of ηmax (maximum overshoot and ts (settling time according to developed parabolic dependences. The new approach has been verified on a vast batch of benchmark examples; subsequently, the developed algorithm has been extended to robust PID controller design for plants with unstable zero and unstructured uncertainties.

  6. Obtaining changes in calibration-coil to seismometer output constants using sine waves

    Science.gov (United States)

    Ringler, Adam T.; Hutt, Charles R.; Gee, Lind S.; Sandoval, Leo D.; Wilson, David C.

    2013-01-01

    The midband sensitivity of a broadband seismometer is one of the most commonly used parameters from station metadata. Thus, it is critical for station operators to robustly estimate this quantity with a high degree of accuracy. We develop an in situ method for estimating changes in sensitivity using sine‐wave calibrations, assuming the calibration coil and its drive are stable over time and temperature. This approach has been used in the past for passive instruments (e.g., geophones) but has not been applied, to our knowledge, to derive sensitivities of modern force‐feedback broadband seismometers. We are able to detect changes in sensitivity to well within 1%, and our method is capable of detecting these sensitivity changes using any frequency of sine calibration within the passband of the instrument.

  7. Efficient Implementation of Complex Modulated Filter Banks Using Cosine and Sine Modulated Filter Banks

    Directory of Open Access Journals (Sweden)

    Viholainen Ari

    2006-01-01

    Full Text Available The recently introduced exponentially modulated filter bank (EMFB is a -channel uniform, orthogonal, critically sampled, and frequency-selective complex modulated filter bank that satisfies the perfect reconstruction (PR property if the prototype filter of an -channel PR cosine modulated filter bank (CMFB is used. The purpose of this paper is to present various implementation structures for the EMFBs in a unified framework. The key idea is to use cosine and sine modulated filter banks as building blocks and, therefore, polyphase, lattice, and extended lapped transform (ELT type of implementation solutions are studied. The ELT-based EMFBs are observed to be very competitive with the existing modified discrete Fourier transform filter banks (MDFT-FBs when comparing the number of multiplications/additions and the structural simplicity. In addition, EMFB provides an alternative channel stacking arrangement that could be more natural in certain subband processing applications and data transmission systems.

  8. SOLITONES KINK Y ANTIKENK EN LA ECUACIÓN DE SINE -GORDON

    OpenAIRE

    Francis Armando Segovia Chaves

    2012-01-01

    La ecuación de sine-Gordon es una ecuación diferencial no lineal, tiene grandes aplicaciones no solamente en la teoría de campos relativistas, sino también encuentra aplicación en la física del estado sólido y en el transporte de señales en la fibra óptica. En este trabajo se estudian dos soluciones que tiene esta ecuación  diferencial como lo son las soluciones tipo solitón kink y soluciones tipo solitón antikink. Para obtener dichas soluciones se realiza el modelamiento matemático y se repr...

  9. Square or Sine: Finding a Waveform with High Success Rate of Eliciting SSVEP

    Directory of Open Access Journals (Sweden)

    Fei Teng

    2011-01-01

    Full Text Available Steady state visual evoked potential (SSVEP is the brain's natural electrical potential response for visual stimuli at specific frequencies. Using a visual stimulus flashing at some given frequency will entrain the SSVEP at the same frequency, thereby allowing determination of the subject's visual focus. The faster an SSVEP is identified, the higher information transmission rate the system achieves. Thus, an effective stimulus, defined as one with high success rate of eliciting SSVEP and high signal-noise ratio, is desired. Also, researchers observed that harmonic frequencies often appear in the SSVEP at a reduced magnitude. Are the harmonics in the SSVEP elicited by the fundamental stimulating frequency or by the artifacts of the stimuli? In this paper, we compare the SSVEP responses of three periodic stimuli: square wave (with different duty cycles, triangle wave, and sine wave to find an effective stimulus. We also demonstrate the connection between the strength of the harmonics in SSVEP and the type of stimulus.

  10. Gravitropism in Arabidopsis thaliana: violation of the sine- and resultant-law

    Science.gov (United States)

    Galland, Paul

    We investigated the gravitropic bending of hypocotyls and roots of seedlings of Arabidopsis tha-liana in response to long-term centrifugal accelerations in a range of 5 x 10-3 to 4 x g. The so-cal-led resultant law of gravitropism, a corollary of the so called sine law, claims that during centri-fugation a gravitropic organ aligns itself parallel to the resultant stimulus vector. We show here that neither of the two empirical “laws” is apt to describe the complex gravitropic behaviour of seedlings of Arabidopsis. Hypocotyls obey reasonably well the resultant law while roots display a complex behaviour that is clearly at variance with it. Horizontally centrifuged seedlings sense minute accelerations acting parallel to the longitudinal axis. If the centrifugal vector points to-ward the cotyledons, then the bending of hypocotyls and roots is greatly enhanced. If the centri-fugal vector points, however, toward the root tip, then only the bending of roots is enhanced by accelerations as low as 5 x 10-3 x g (positive tonic effect). The absolute gravitropic thresholds were determined for hypocotyls and roots in a clinostat-centrifuge and found to be near 1.5 x 10-2 x g. A behavioural mutant, ehb1-2 (Knauer et al. 2011), displays a lower gravitropic threshold for roots, not however, for hypocotyls. The complex gravitropic behaviour of seedlings of Arabi-dopsis is at odds with the classical sine- as well as the resultant law and can indicates the eminent role that is played by the acceleration vector operating longitudinally to the seedling axis.

  11. Swept-sine noise-induced damage as a hearing loss model for preclinical assays

    Directory of Open Access Journals (Sweden)

    Lorena eSanz

    2015-02-01

    Full Text Available Mouse models are key tools for studying cochlear alterations in noise-induced hearing loss and for evaluating new therapies. Stimuli used to induce deafness in mice are usually white and octave band noises that include very low frequencies, considering the large mouse auditory range. We designed different sound stimuli, enriched in frequencies up to 20 kHz (violet noises to examine their impact on hearing thresholds and cochlear cytoarchitecture after short exposure. In addition, we developed a cytocochleogram to quantitatively assess the ensuing structural degeneration and its functional correlation. Finally, we used this mouse model and cochleogram procedure to evaluate the potential therapeutic effect of transforming growth factor β1 inhibitors P17 and P144 on noise-induced hearing loss. CBA mice were exposed to violet swept-sine noise with different frequency ranges (2-20 or 9-13 kHz and levels (105 or 120 dB SPL for 30 minutes. Mice were evaluated by auditory brainstem response and otoacoustic emission tests prior to and 2, 14 and 28 days after noise exposure. Cochlear pathology was assessed with gross histology; hair cell number was estimated by a stereological counting method. Our results indicate that functional and morphological changes induced by violet swept-sine noise depend on the sound level and frequency composition. Partial hearing recovery followed the exposure to 105 dB SPL, whereas permanent cochlear damage resulted from the exposure to 120 dB SPL. Exposure to 9-13 kHz noise caused an auditory threshold shift in those frequencies that correlated with hair cell loss in the corresponding areas of the cochlea that were spotted on the cytocochleogram. In summary, we present mouse models of noise-induced hearing loss, which depending on the sound properties of the noise, cause different degrees of cochlear damage, and could therefore be used to study molecules which are potential players in hearing loss protection and repair.

  12. A method for quantification of exportin-1 (XPO1) occupancy by Selective Inhibitor of Nuclear Export (SINE) compounds.

    Science.gov (United States)

    Crochiere, Marsha L; Baloglu, Erkan; Klebanov, Boris; Donovan, Scott; Del Alamo, Diego; Lee, Margaret; Kauffman, Michael; Shacham, Sharon; Landesman, Yosef

    2016-01-12

    Selective Inhibitor of Nuclear Export (SINE) compounds are a family of small-molecules that inhibit nuclear export through covalent binding to cysteine 528 (Cys528) in the cargo-binding pocket of Exportin 1 (XPO1/CRM1) and promote cancer cell death. Selinexor is the lead SINE compound currently in phase I and II clinical trials for advanced solid and hematological malignancies. In an effort to understand selinexor-XPO1 interaction and to establish whether cancer cell response is a function of drug-target engagement, we developed a quantitative XPO1 occupancy assay. Biotinylated leptomycin B (b-LMB) was utilized as a tool compound to measure SINE-free XPO1. Binding to XPO1 was quantitated from SINE compound treated adherent and suspension cells in vitro, dosed ex vivo human peripheral blood mononuclear cells (PBMCs), and PBMCs from mice dosed orally with drug in vivo. Evaluation of a panel of selinexor sensitive and resistant cell lines revealed that resistance was not attributed to XPO1 occupancy by selinexor. Administration of a single dose of selinexor bound XPO1 for minimally 72 hours both in vitro and in vivo. While XPO1 inhibition directly correlates with selinexor pharmacokinetics, the biological outcome of this inhibition depends on modulation of pathways downstream of XPO1, which ultimately determines cancer cell responsiveness.

  13. New exact solutions for fractional Sine-Gordon equation by using the new version of generalized F-expansion method

    Science.gov (United States)

    Pandir, Yusuf; Duzgun, Hasan Huseyin

    2016-06-01

    In this study, we investigate some new analytical solutions to the fractional Sine-Gordon equation by using the new version of generalized F-expansion method. The fractional derivatives are defined in the modified Riemann-Liouville context. As a result, new analytical solutions were obtained in terms Jacobi elliptic functions.

  14. The transfer of current through skin and muscle during electrical stimulation with sine, square, Russian and interferential waveforms.

    Science.gov (United States)

    Petrofsky, J; Laymon, M; Prowse, M; Gunda, S; Batt, J

    2009-01-01

    Electrical stimulation is a commonly used modality for both athletic training and physical therapy. However, there are limited objective data available to determine the waveform which provides the maximum muscle strength as well as minimizing pain. In the present investigation, two groups of subjects were examined. Group 1 was composed of six males and four females and group 2 was composed of three male and three female subjects. The first series of experiments investigated muscle strength with stimulation at currents of 20, 40 and 60 milliamps using sine, square, Russian and interferential waveforms evaluating strength production and pain as outcomes. The second phase of experiments compared the effect of the different waveforms on current dispersion in surface versus deep muscle electrodes with these same waveforms. The results of the experiments showed that sine wave stimulation produced significantly greater muscle strength and significantly less pain than square wave, Russian or interferential stimulation at that same current. The most painful stimulation was square wave. Strength production was greatest with sine wave and least with Russian and interferential. An explanation of these findings may be the filtering effect of the fat layer separating skin from muscle. The highly conductive muscle and skin dermal layers would form the plates of a capacitor separated by the subcutaneous fat layer providing an RC filter. This filtering effect, while allowing sine wave stimulation to pass to the muscle, reduced power transfer in square wave, Russian and interferential stimulation is observed.

  15. Numerical study of the process of nonlinear supratransmission in Riesz space-fractional sine-Gordon equations

    Science.gov (United States)

    Macías-Díaz, J. E.

    2017-05-01

    In this work, we consider a (1 + 1) -dimensional Riesz space-fractional damped sine-Gordon equation defined on a bounded spatial interval. Sinusoidal Dirichlet boundary data are imposed at one end of the interval and homogeneous Neumann conditions at the other. The system is initially at rest in the equilibrium position, and is discretized to simulate its complex dynamics. The method employed in this work is a finite-difference discretization of the mathematical model of interest. Our scheme is throughly validated against simulations on the dynamics of the classical and the space-fractional sine-Gordon equations, which are available in the literature. As the main result of this manuscript, we have found numerical evidence on the presence of the phenomenon of nonlinear supratransmission in Riesz space-fractional sine-Gordon systems. Simulations have been conducted in order to predict its occurrence for some values of the fractional order of the spatial derivative, and a wide range of values of the frequency of the sinusoidal perturbation at the boundary. As far as the author knows, this may be one of the first numerical reports on the existence of nonlinear supratransmission in sine-Gordon systems of Riesz space-fractional order.

  16. Seismostratigraphic model of the Sines Contourite Drift (SW Portuguese Margin) - depositional evolution, structural control and paleoceanographic implications

    Science.gov (United States)

    Rodrigues, Sara; Roque, Cristina; Terrinha, Pedro; Hernández-Molina, Francisco J.; Llave, Estefania; Ercilla, Gemma; Casas, David; Farran, Marcelli

    2017-04-01

    The Sines Contourite Drift, located in the Southwest Portuguese margin, is a distal drift of the Contourite Depositional System of the Gulf of Cadiz, built by the influence of the Mediterranean Outflow Water (MOW). This drift is located between 1000 and 2000 m water depth on the Alentejo margin continental slope. The Sines Drift is bounded by four major morphologic features, the 1.4 km high Pereira de Sousa Fault escarpment to the west, the upper continental slope to the east and the Setúbal and São Vicente canyons to the north and south, respectively. This work presents a seismic stratigraphic analysis and proposes an evolutionary model for the Sines Drift, as well as the identification of its main driving mechanisms and constraints. We used new seismic reflection lines acquired during the MOWER/CONDRIBER cruise in September-October 2014, pre-existent multichannel seismic lines and lithostratigraphic and chronological data from Site U1391 of IODP Expedition 339 carried out in 2011-2012. Three evolutionary phases are identified for the Sines Drift development: 1) a sheeted-contourite-drift phase (Portuguese margin, inherited from the Mesozoic rifting phases. The paleomorphology provided accommodation space for drift growth and conditioned its overall architecture. The N-S horsts built during the Mesozoic rifting confined drift formation and did not allow lateral migration. The formation of the Sines Drift has also been influenced, in short-term, by climatic fluctuations and sea-level changes especially during the Quaternary. The succession of sinuous paleomoats beneath the present-day moat suggests a persistent and northward flowing MOW with several phases of enhancement. It was also perceived that the São Vicente and Setúbal canyons took most of the downslope sediment supply, as well as the occurrence of mass-movement processes in the west associated with the steep gradient of the Pereira de Sousa escarpment. All these results suggest the Sines Drift had a

  17. A doubly-fed induction generator-based wind generation system with quasi-sine rotor injection

    Science.gov (United States)

    Yuvarajan, S.; Fan, Lingling

    Wind generating systems use doubly-fed induction generators (DFIGs) to achieve high conversion efficiency and to reduce the installation cost. The paper proposes and analyzes a simple DFIG-based wind generation system in which the excitation power is obtained from a photovoltaic (PV) panel and battery. The proposed scheme is suitable for small wind power systems for which a complex field orientation control is not justified. It can be used for stand-alone operation and also grid-tied operation. The rotor of the DFIG is applied with a quasi-sine wave instead of a sine wave. The operation and harmonic characteristics of the scheme are established using analysis, simulation, and experimentation. The details of the control circuit are given along with the experimental waveforms of voltages and currents and frequency spectra. The total harmonic distortion in the output current is found to be around 8%.

  18. Numerical simulation of two dimensional sine-Gordon solitons using modified cubic B-spline differential quadrature method

    Directory of Open Access Journals (Sweden)

    H. S. Shukla

    2015-01-01

    Full Text Available In this paper, a modified cubic B-spline differential quadrature method (MCB-DQM is employed for the numerical simulation of two-space dimensional nonlinear sine-Gordon equation with appropriate initial and boundary conditions. The modified cubic B-spline works as a basis function in the differential quadrature method to compute the weighting coefficients. Accordingly, two dimensional sine-Gordon equation is transformed into a system of second order ordinary differential equations (ODEs. The resultant system of ODEs is solved by employing an optimal five stage and fourth-order strong stability preserving Runge–Kutta scheme (SSP-RK54. Numerical simulation is discussed for both damped and undamped cases. Computational results are found to be in good agreement with the exact solution and other numerical results available in the literature.

  19. Comparison of local sine wave modeling with harmonic phase analysis for the assessment of myocardial strain.

    Science.gov (United States)

    Miller, Christopher A; Borg, Alex; Clark, David; Steadman, Christopher D; McCann, Gerry P; Clarysse, Patrick; Croisille, Pierre; Schmitt, Matthias

    2013-08-01

    To compare local sine-wave modeling (SinMod) with harmonic phase analysis (HARP), for assessment of left ventricular (LV) circumferential strain (εcc) from tagged cardiovascular magnetic resonance images. Mid-ventricular spatial modulation of magnetization was performed in 60 participants (15 each with hypertrophic, dilated or ischemic cardiomyopathy and 15 healthy controls) at 1.5 Tesla. Global and segmental peak transmural εcc were measured using HARP and SinMod. Repeated measurements were performed on 25% of examinations to assess observer variability. Effect of contrast was assessed in 10 additional patients. SinMod showed a high level of agreement with HARP for global εcc (mean difference -0.02, 95% limits of agreement -6.46 to 6.43%). Agreement was much lower for segmental εcc. Both methods showed excellent observer agreement for global εcc (intraclass correlation coefficient >0.75). Observer agreement for segmental εcc was also excellent with SinMod, but was significantly lower with HARP. Analysis time was significantly shorter using SinMod. Pre- and postcontrast εcc measurements were not significantly different using either technique, although postcontrast measurements showed greater variability with HARP. SinMod and HARP-based measurements of global εcc have a high level of agreement, but segmental agreement is substantially lower. SinMod has generally lower observer variability, is faster and is less affected by contrast, but requires further validation. Copyright © 2012 Wiley Periodicals, Inc.

  20. Transforming wealth: using the inverse hyperbolic sine (IHS) and splines to predict youth's math achievement.

    Science.gov (United States)

    Friedline, Terri; Masa, Rainier D; Chowa, Gina A N

    2015-01-01

    The natural log and categorical transformations commonly applied to wealth for meeting the statistical assumptions of research may not always be appropriate for adjusting for skewness given wealth's unique properties. Finding and applying appropriate transformations is becoming increasingly important as researchers consider wealth as a predictor of well-being. We present an alternative transformation-the inverse hyperbolic sine (IHS)-for simultaneously dealing with skewness and accounting for wealth's unique properties. Using the relationship between household wealth and youth's math achievement as an example, we apply the IHS transformation to wealth data from US and Ghanaian households. We also explore non-linearity and accumulation thresholds by combining IHS transformed wealth with splines. IHS transformed wealth relates to youth's math achievement similarly when compared to categorical and natural log transformations, indicating that it is a viable alternative to other transformations commonly used in research. Non-linear relationships and accumulation thresholds emerge that predict youth's math achievement when splines are incorporated. In US households, accumulating debt relates to decreases in math achievement whereas accumulating assets relates to increases in math achievement. In Ghanaian households, accumulating assets between the 25th and 50th percentiles relates to increases in youth's math achievement. Copyright © 2014 Elsevier Inc. All rights reserved.

  1. Accurate Frequency Estimation Based On Three-Parameter Sine-Fitting With Three FFT Samples

    Directory of Open Access Journals (Sweden)

    Liu Xin

    2015-09-01

    Full Text Available This paper presents a simple DFT-based golden section searching algorithm (DGSSA for the single tone frequency estimation. Because of truncation and discreteness in signal samples, Fast Fourier Transform (FFT and Discrete Fourier Transform (DFT are inevitable to cause the spectrum leakage and fence effect which lead to a low estimation accuracy. This method can improve the estimation accuracy under conditions of a low signal-to-noise ratio (SNR and a low resolution. This method firstly uses three FFT samples to determine the frequency searching scope, then – besides the frequency – the estimated values of amplitude, phase and dc component are obtained by minimizing the least square (LS fitting error of three-parameter sine fitting. By setting reasonable stop conditions or the number of iterations, the accurate frequency estimation can be realized. The accuracy of this method, when applied to observed single-tone sinusoid samples corrupted by white Gaussian noise, is investigated by different methods with respect to the unbiased Cramer-Rao Low Bound (CRLB. The simulation results show that the root mean square error (RMSE of the frequency estimation curve is consistent with the tendency of CRLB as SNR increases, even in the case of a small number of samples. The average RMSE of the frequency estimation is less than 1.5 times the CRLB with SNR = 20 dB and N = 512.

  2. Differential effects of aging on spatial contrast sensitivity to linear and polar sine-wave gratings.

    Science.gov (United States)

    Costa, T L; Nogueira, R M T B L; Pereira, A G F; Santos, N A

    2013-10-01

    Changes in visual function beyond high-contrast acuity are known to take place during normal aging. We determined whether sensitivity to linear sine-wave gratings and to an elementary stimulus preferentially processed in extrastriate areas could be distinctively affected by aging. We measured spatial contrast sensitivity twice for concentric polar (Bessel) and vertical linear gratings of 0.6, 2.5, 5, and 20 cycles per degree (cpd) in two age groups (20-30 and 60-70 years). All participants were free of identifiable ocular disease and had normal or corrected-to-normal visual acuity. Participants were more sensitive to Cartesian than to polar gratings in all frequencies tested, and the younger adult group was more sensitive to all stimuli tested. Significant differences between sensitivities of the two groups were found for linear (only 20 cpd; Ppolar gratings (all frequencies tested; P<0.01). The young adult group was significantly more sensitive to linear than to circular gratings in the 20 cpd frequency. The older adult group was significantly more sensitive to linear than to circular gratings in all spatial frequencies, except in the 20 cpd frequency. The results suggest that sensitivity to the two kinds of stimuli is affected differently by aging. We suggest that neural changes in the aging brain are important determinants of this difference and discuss the results according to current models of human aging.

  3. Emotional intelligence: the Sine Qua Non for a clinical leadership toolbox.

    Science.gov (United States)

    Rao, Paul R

    2006-01-01

    Over the past decade, it has become increasingly clear that although IQ and technical skills are important, emotional intelligence is the Sine Qua Non of leadership. According to Goleman [Goleman, D. (1998). What makes a leader? Harvard Business Review, 93-102] "effective leaders are alike in one crucial way: they all have a high degree of emotional intelligence...and can also be linked to strong performance." The original five dimensions of EIQ are described and applied to both supervisory and clinical scenarios. As a result of reading this work, you will be able to: (1) define and provide an illustration of each of the five components of emotional intelligence (EIQ); (2) outline the relationship of EIQ to success in your profession and your personal life; (3) create a strategic action plan to enhance each dimension of EIQ in your daily life; (4) list at least three real-life experiences that could have resulted a favorable outcome with an improved EIQ; (5) complete a self-evaluation of your EIQ.

  4. Quasi-integrability in deformed sine-Gordon models and infinite towers of conserved charges

    Science.gov (United States)

    Blas, Harold; Callisaya, Hector Flores

    2018-02-01

    We have studied the space-reflection symmetries of some soliton solutions of deformed sine-Gordon models in the context of the quasi-integrability concept. Considering a dual pair of anomalous Lax representations of the deformed model we compute analytically and numerically an infinite number of alternating conserved and asymptotically conserved charges through a modification of the usual techniques of integrable field theories. The charges associated to two-solitons with a definite parity under space-reflection symmetry, i.e. kink-kink (odd parity) and kink-antikink (even parity) scatterings with equal and opposite velocities, split into two infinite towers of conserved and asymptotically conserved charges. For two-solitons without definite parity under space-reflection symmetry (kink-kink and kink-antikink scatterings with unequal and opposite velocities) our numerical results show the existence of the asymptotically conserved charges only. However, we show that in the center-of-mass reference frame of the two solitons the parity symmetries and their associated set of exactly conserved charges can be restored. Moreover, the positive parity breather-like (kink-antikink bound state) solution exhibits a tower of exactly conserved charges and a subset of charges which are periodic in time. We back up our results with extensive numerical simulations which also demonstrate the existence of long lived breather-like states in these models. The time evolution has been simulated by the 4th order Runge-Kutta method supplied with non-reflecting boundary conditions.

  5. Modulational and numerical solutions for the steady discrete Sine-Gordon equation in two space dimensions

    Science.gov (United States)

    Cisneros, L. A.; Ize, J.; Minzoni, A. A.

    2009-07-01

    We develop a modulation theory based on a suitably averaged Lagrangian for steady solutions of the Sine-Gordon equation in a two dimensional lattice. These lump solutions are nonzero in circular or polygonal regions and zero elsewhere. The modulation theory gives approximate solutions away from small perturbations of the exact anti-continuum solutions for both radial and polygonal solutions. We show how the Peierls-Nabarro potential determines the shape of the boundary between excited sites and the zero solution. These solutions are compared with the corresponding numerical solutions and significant agreement is found. Moreover, we show that solutions with a large radius (more than sixteen lattice sites) can be explained using a continuous trial function for the averaged Lagrangian, while smaller polygonal solutions can be constructed using a trial function, which takes into account the angular variation of the boundary imposed by the lattice. Finally, the ideas of equivariant bifurcation theory are used to obtain a full numerical description of the solution branches as functions of the coupling parameter between neighboring sites. The results of this work can be used to study steady solutions for other types of lattice equations.

  6. Infinite-dimensional Estabrook-Wahlquist prolongations for the sine-Gordon equation

    CERN Document Server

    Finley, J D; McIver, John K

    1995-01-01

    We are looking for the universal covering algebra for all symmetries of a given pde, using the sine-Gordon equation as a typical example for a non-evolution equation. For non-evolution equations, Estabrook-Wahlquist prolongation structures for non-local symmetries depend on the choice of a specific sub-ideal, of the contact module, to define the pde. For each inequivalent such choice we determine the most general solution of the prolongation equations, as sub-algebras of the (infinite-dimensional) algebra of all vector fields over the space of non-local variables associated with the pde, in the style of Vinogradov covering spaces. We show explicitly how previously-known prolongation structures, known to lie within the Kac-Moody algebra, A_1^{(1)}, are special cases of these general solutions, although we are unable to identify the most general solutions with previously-studied algebras. We show the existence of gauge transformations between prolongation structures, viewed as determining connections over the s...

  7. Renormalization of modular invariant Coulomb gas and sine-Gordon theories, and the quantum Hall flow diagram

    Energy Technology Data Exchange (ETDEWEB)

    Carpentier, David [Laboratoire de Physique Theorique de l' Ecole Normale Superieure, Paris (France)

    1999-05-28

    Using the renormalization group (RG) we study two-dimensional electromagnetic Coulomb gas and extended sine-Gordon theories invariant under the modular group SL(2,Z). The flow diagram is established from the scaling equations, and we derive the critical behaviour at the various transition points of the diagram. Following the proposal for a SL(2,Z) duality between different quantum Hall fluids, we discuss the analogy between this flow and the global quantum Hall phase diagram. (author)

  8. Full-wave analysis of the high frequency characteristics of the sine waveguide slow-wave structure

    Science.gov (United States)

    Lei, Xia; Wei, Yanyu; Wang, Yuanyuan; Zhou, Qing; Wu, Gangxiong; Ding, Chong; Li, Qian; Zhang, Luqi; Jiang, Xuebing; Gong, Yubin; Wang, Wenxiang

    2017-08-01

    A theoretical model for calculation of the high frequency characteristics of the sine waveguide slow-wave structure (SWS) is proposed. The formulas of dispersion and interaction impedances of the hybrid modes are obtained by combining the Helmholtz equation with the appropriate boundary conditions. Using the full wave analysis method, it is proved that the periodic structures with a half-period shift followed leads to a pairwise closing of passbands characteristic of adjacent mode. The sine waveguide SWS for 0.22THz traveling wave tube (TWT) is chosen as an illustrative example to verify the validity of the theoretical model, and the calculation results of the dispersion curve and interaction impedance curve are consistent with the HFSS simulation results. In addition, the influences of dimensions of sine waveguide on the high frequency characteristics of +1st spatial harmonic wave are investigated by numerical calculation. The study indicates that the appropriate SWS parameters are helpful for improving the bandwidth and increasing output power of TWT.

  9. Full-wave analysis of the high frequency characteristics of the sine waveguide slow-wave structure

    Directory of Open Access Journals (Sweden)

    Xia Lei

    2017-08-01

    Full Text Available A theoretical model for calculation of the high frequency characteristics of the sine waveguide slow-wave structure (SWS is proposed. The formulas of dispersion and interaction impedances of the hybrid modes are obtained by combining the Helmholtz equation with the appropriate boundary conditions. Using the full wave analysis method, it is proved that the periodic structures with a half-period shift followed leads to a pairwise closing of passbands characteristic of adjacent mode. The sine waveguide SWS for 0.22THz traveling wave tube (TWT is chosen as an illustrative example to verify the validity of the theoretical model, and the calculation results of the dispersion curve and interaction impedance curve are consistent with the HFSS simulation results. In addition, the influences of dimensions of sine waveguide on the high frequency characteristics of +1st spatial harmonic wave are investigated by numerical calculation. The study indicates that the appropriate SWS parameters are helpful for improving the bandwidth and increasing output power of TWT.

  10. Analysis of the 227 bp short interspersed nuclear element (SINE) insertion of the promoter of the myostatin (MSTN) gene in different horse breeds

    OpenAIRE

    Stefania Dall'Olio; Emilio Scotti; Luca Fontanesi; Marco Tassinari

    2014-01-01

    The myostatin (MSTN) gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus) MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE) insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. T...

  11. Light redirecting system using sine-wave based panels for dense urban areas

    Science.gov (United States)

    Mohamed, Mohamed W. N.; Mashaly, Islam A.; Mohamed, Osama N.; El-Henawy, Sally I.; Galal, Ola; Taha, Iman; Nassar, Khaled; Safwat, Amr M. E.

    2014-09-01

    Cities and towns around the world are becoming more condensed due to the shrinking amount of buildable areas, which significantly reduces the amount of light that occupants have access to. This lack of natural lighting results in health, safety and quality of life degradation. This paper presents a new technique of transmitting sunlight downward into narrow alleys and streets, by using a daylighting guiding acrylic panel that is capable of changing the direction and distribution of the incident light. The core of the proposed daylight guidance system is made up of light transmission panels with high quality. The corrugations have sine wave shaped cross-section so that the panel functions as an optical diffuser perpendicular to the direction of sunlight propagation. The day lighting system consists of the corrugated panels and a lattice frame, which supports the panel. The proposed system is to be mounted on the building roof facing the sun so as to redirect the incident sunlight downward into the narrow alleys or streets. Since building sizes and orientations are different the frame is arranged such that substantially deep light penetration and high luminance level can be achieved. Simulation results show that the proposed panel improves the illuminance values by more than 200% and 400% in autumn and winter, respectively, provides fan-out angle that exceeds 80° for certain solar altitudes and the transmitted power percentage varies from 40% to 90% as the solar altitude varies from 10° to 80°. Experimental results are in a good agreement with the simulations.

  12. The light in the architecture of minimalism: Architectura sine luce nulla architectura est: Alberto Campo Baeza

    Directory of Open Access Journals (Sweden)

    Vasilski Dragana

    2010-01-01

    Full Text Available Field of interest of man is directly linked to the vision and illusion, and they again with the light. We live in an era when the light as a concept of changes is very emphasized, so it is understandable that as 'all roads lead to Rome', in architecture all roads lead to the light. We can look at an architectural history as a display of objects that are creatively adapted to the light. One focus of observation may be the connection between what people see and the construction of building. Designers rely on light and its ability to discover the form as a way of creating these links. Appropriate combinations of different types of light provide for the connoisseur, the infinite possibilities in architecture. Throughout history, the light has always been a central theme in the architecture: the oldest religious architecture dedicated to the Sun, through a combination of direct and indirect light in the Hagia Sofia, the heavy - light Romanesque or Gothic aspiration to organize the light in order to provide the spatial tension. Or through the baroque, as well as an alchemy of light and Bernini's table for measuring light, to Corbusier, Wright and Miss. There are many examples today, which show different aspects of light in architecture. If we design by light, we could ask many questions: Is light a substance in architecture? Is not the history of architecture, just a quest for understanding and domination of light? Is our time the right time when we have all the means suitable for the final domination of light? Light is treated, in the architecture of minimalism, as a matter and as a material. When one uses the axiom 'Architectura sine luce nulla architectura est', Alberto Campo Baeza, one then can say that there is no architecture that is possible without light. In this paper, through examples that follow, the author considers the different aspects of light in architecture minimalism. They are: form - geometry - lines, transparency - glass - windows

  13. Renormalization of modular invariant Coulomb gas and sine-Gordon theories, and the quantum Hall flow diagram

    Science.gov (United States)

    Carpentier, David

    1999-05-01

    Using the renormalization group (RG) we study two-dimensional electromagnetic Coulomb gas and extended sine-Gordon theories invariant under the modular group SL(2,icons/Journals/Common/BbbZ" ALT="BbbZ" ALIGN="TOP"/>). The flow diagram is established from the scaling equations, and we derive the critical behaviour at the various transition points of the diagram. Following the proposal for a SL(2,icons/Journals/Common/BbbZ" ALT="BbbZ" ALIGN="TOP"/>) duality between different quantum Hall fluids, we discuss the analogy between this flow and the global quantum Hall phase diagram.

  14. Comparisons between sine-Gordon and perturbed nonlinear Schrödinger equations for modeling light bullets beyond critical collapse

    Science.gov (United States)

    Bao, Weizhu; Dong, Xuanchun; Xin, Jack

    2010-07-01

    The sine-Gordon (SG) equation and perturbed nonlinear Schrödinger (NLS) equations are studied numerically for modeling the propagation of two space dimensional (2D) localized pulses (the so-called light bullets) in nonlinear dispersive optical media. We begin with the (2 + 1) SG equation obtained as an asymptotic reduction in the two level dissipationless Maxwell-Bloch system, followed by the review on the perturbed NLS equation in 2D for SG pulse envelopes, which is globally well posed and has all the relevant higher order terms to regularize the collapse of standard critical (cubic focusing) NLS. The perturbed NLS is approximated by truncating the nonlinearity into finite higher order terms undergoing focusing-defocusing cycles. Efficient semi-implicit sine pseudospectral discretizations for SG and perturbed NLS are proposed with rigorous error estimates. Numerical comparison results between light bullet solutions of SG and perturbed NLS as well as critical NLS are reported, which validate that the solution of the perturbed NLS as well as its finite-term truncations are in qualitative and quantitative agreement with the solution of SG for the light bullets propagation even after the critical collapse of cubic focusing NLS. In contrast, standard critical NLS is in qualitative agreement with SG only before its collapse. As a benefit of such observations, pulse propagations are studied via solving the perturbed NLS truncated by reasonably many nonlinear terms, which is a much cheaper task than solving SG equation directly.

  15. Determinism and randomness in the evolution of introns and sine inserts in mouse and human mitochondrial solute carrier and cytokine receptor genes.

    Science.gov (United States)

    Cianciulli, Antonia; Calvello, Rosa; Panaro, Maria A

    2015-04-01

    In the homologous genes studied, the exons and introns alternated in the same order in mouse and human. We studied, in both species: corresponding short segments of introns, whole corresponding introns and complete homologous genes. We considered the total number of nucleotides and the number and orientation of the SINE inserts. Comparisons of mouse and human data series showed that at the level of individual relatively short segments of intronic sequences the stochastic variability prevails in the local structuring, but at higher levels of organization a deterministic component emerges, conserved in mouse and human during the divergent evolution, despite the ample re-editing of the intronic sequences and the fact that processes such as SINE spread had taken place in an independent way in the two species. Intron conservation is negatively correlated with the SINE occupancy, suggesting that virus inserts interfere with the conservation of the sequences inherited from the common ancestor. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Estimation of channel mismatches in time-interleaved analog-to-digital converters based on fractional delay and sine curve fitting.

    Science.gov (United States)

    Guo, Lianping; Tian, Shulin; Jiang, Jun

    2015-03-01

    This paper proposes an algorithm to estimate the channel mismatches in time-interleaved analog-to-digital converter (TIADC) based on fractional delay (FD) and sine curve fitting. Choose one channel as the reference channel and apply FD to the output samples of reference channel to obtain the ideal samples of non-reference channels with no mismatches. Based on least square method, the sine curves are adopted to fit the ideal and the actual samples of non-reference channels, and then the mismatch parameters can be estimated by comparing the ideal sine curves and the actual ones. The principle of this algorithm is simple and easily understood. Moreover, its implementation needs no extra circuits, lowering the hardware cost. Simulation results show that the estimation accuracy of this algorithm can be controlled within 2%. Finally, the practicability of this algorithm is verified by the measurement results of channel mismatch errors of a two-channel TIADC prototype.

  17. Sine-Gordon modulation solutions: application to macroscopic friction, regular and slow earthquakes and fault dynamics

    Science.gov (United States)

    Gershenzon, Naum; Bambakidis, Gust

    2014-05-01

    The Frenkel-Kontorova (FK) model and its continuum approximation, the sine-Gordon (SG) equation, are widely used for modeling various phenomena. In many practical applications the wave-train solution, which includes many solitons, is required. In such cases the system of Whitham's modulation equations, superimposed on the SG equation, provides such a solution. Here we consider several applications which use the SG modulation solutions [1-3]. Fault dynamics in the earth's crust, i.e. the nucleation and development of regular and slow earthquakes, is a complicated multidisciplinary problem which has been investigated using diverse approaches. Our approach, inspired by dislocation dynamics in crystals, is based on the FK model introduced to describe plasticity. In the model we propose, sliding occurs due to the movement of defects of a certain type (i.e. areas on the frictional surface with locally stressed material, known as a macroscopic dislocation or slip pulse) nucleated by shear stress in the presence of asperities. The spatial translation of a dislocation requires only a small fraction of the stress necessary for the uniform relative displacement of frictional surfaces. This is a fundamental distinction between our approach to macroscopic dry friction and those of others such as the Burridge-Knopoff and rate-and-state types of models. We show how this model can be applied to the qualitative and quantitative description of fault dynamics in general, and slow and regular earthquakes in particular. The three fundamental speeds of plate movement, earthquake migration, and seismic waves are shown to be connected in the FK model. The velocity of nonelastic stress propagation along faults is a function of accumulated stress. It changes from a few km/s during earthquakes to a few dozen km per day, month, or year during afterslip and inter-earthquake periods. The distribution of aftershocks in this model is consistent with both the Omori law for temporal distribution

  18. Géochimie des résines et asphaltènes Geochernistry of Resins and Asphaltenes

    Directory of Open Access Journals (Sweden)

    Tissot B.

    2006-11-01

    Full Text Available Les produits lourds des huiles brutes (résines et asphaltènes jouent un rôle important dans la genèse et l'accumulation du pétrole, ainsi que dans la mise en production par des méthodes conventionnelles ou par récupération assistée. Les asphaltènes et résines sont considérés ici comme des fragments de kérogène, avec une structure d'ensemble comparable : ils peuvent constituer des intermédiaires dans la genèse de l'huile brute par dégradation thermique du kérogène. De plus, la pyrolyse des asphaltènes séparés à partir d'un pétrole biodégradé peut produire de nouveaux hydrocarbures saturés qui reproduisent la fraction saturée primitive, détruite par la dégradation ; on peut ainsi disposer d'un nouvel outil pour corréler ce type d'huiles brutes. Les produits lourds semblent défavorisés par rapport aux hydrocarbures, dans la migration de la roche-mère vers le réservoir, où les résines et asphaltènes sont proportionnellement moins abondants. La structure physique des asphaltènes et résines dans les pétroles, et en particulier l'existence d'une macrostructure du type micelles ou agrégats, est probablement responsable de la viscosité élevée des huiles lourdes. Une meilleure connaissance de cette macrostructure pourrait suggérer de nouvelles méthodes pour diminuer la viscosité et améliorer la récupération des huiles lourdes. The heavy constituents of crude oil (resins and asphaltenes play an important role in generation and accumulation of petroleum, and also in production by conventional and enhanced oil recovery processes. Asphaltenes and resins are considered here as small fragments of kerogen, with a comparable overall structure: they may act as intermediate compounds in oil generation by thermal breakdown of kerogen. Furthermore, pyrolysis of asphaltenes separated from a degraded crude oil is able to generate a new saturated hydrocarbon fraction which duplicates the original one, now degraded

  19. Aerodynamic study of a blade with sine variation of chord length along the height for Darrieus wind turbine

    Science.gov (United States)

    Crunteanu, D. E.; Constantinescu, S. G.; Niculescu, M. L.

    2013-10-01

    The wind energy is deemed as one of the most durable energetic variants of the future because the wind resources are immense. Furthermore, one predicts that the small wind turbines will play a vital role in the urban environment. Unfortunately, the complexity and the price of pitch regulated small horizontal-axis wind turbines represent ones of the main obstacles to widespread the use in populated zones. In contrast to these wind turbines, the Darrieus wind turbines are simpler and their price is lower. Unfortunately, their blades run at high variations of angles of attack, in stall and post-stall regimes, which can induce significant vibrations, fatigue and even the wind turbine failure. For this reason, the present paper deals with a blade with sine variation of chord length along the height because it has better behavior in stall and post-stall regimes than the classic blade with constant chord length.

  20. Parálisis Parcial del Nervio Oculomotor Secundaria a Zoster Sine Herpete: Reporte de Un Caso

    Directory of Open Access Journals (Sweden)

    Oscar L. Rueda O.

    2013-12-01

    Full Text Available Introducción: Herpes Zoster es la reactivación del Virus Varicela Zóster en los ganglios sensoriales y/o autonómicos, típicamente caracterizado por dolor profundo de distribución dermatómica y erupciones vesiculares en piel. De manera infrecuente, puede presentarse el Zoster Sine Herpete, condición en la cual se presenta la distribución dermatómica del dolor en ausencia de lesiones dérmicas, convirtiendo el diagnóstico en un reto clínico. Caso clínico: Hombre de 69 años con dolor periorbitario, epifora, ptosis y pérdida de la aducción del ojo derecho. Los estudios imagenológicos y de laboratorio fueron normales, descartando así las principales causas de parálisis del nervio oculomotor. Se hizo diagnóstico presuntivo de Zoster Sine Herpete y se inició prueba terapéutica con valaciclovir, observándose resolución total de la sintomatología seis semanas después. Discusión: Este caso puede ser el primero en describir una parálisis parcial dolorosa del nervio oculomotor como única manifestación clínica de la reactivación del Virus Varicela Zóster y busca alertar al personal médico sobre una enfermedad latente que hace de sus reapariciones una gama de presentaciones no siempre fáciles de identificar.

  1. Derivation of a generalized double-sine-Gordon equation describing ultrashort-soliton propagation in optical media composed of multilevel atoms

    Science.gov (United States)

    Leblond, Hervé; Triki, Houria; Mihalache, Dumitru

    2012-12-01

    We consider the propagation of ultrashort optical solitons in media described by a general Hamiltonian of multilevel atoms. Assuming that all transition frequencies of the medium are well below the typical wave frequency, i.e., only the contribution of infrared transitions is taken into account, we use a short-wave approximation and a rigorous application of the reductive perturbation formalism to derive a cumbersome coupled system of nonlinear partial differential equations describing ultrashort soliton evolution in such systems. The rather complicated set of coupled equations can be simplified to a generic double-sine-Gordon equation for a special case of identical three-level atoms, whereas for a special case of identical four-level atoms the system of coupled equations can be reduced to a generalized double-sine-Gordon equation. Numerical simulations showing the formation of robust breather-type solutions of both the standard double-sine-Gordon and of the generalized double-sine-Gordon equations from sinusoidal inputs with Gaussian envelopes are also presented.

  2. Geostatistical uncertainty of assessing air quality using high-spatial-resolution lichen data: A health study in the urban area of Sines, Portugal.

    Science.gov (United States)

    Ribeiro, Manuel C; Pinho, P; Branquinho, C; Llop, Esteve; Pereira, Maria J

    2016-08-15

    In most studies correlating health outcomes with air pollution, personal exposure assignments are based on measurements collected at air-quality monitoring stations not coinciding with health data locations. In such cases, interpolators are needed to predict air quality in unsampled locations and to assign personal exposures. Moreover, a measure of the spatial uncertainty of exposures should be incorporated, especially in urban areas where concentrations vary at short distances due to changes in land use and pollution intensity. These studies are limited by the lack of literature comparing exposure uncertainty derived from distinct spatial interpolators. Here, we addressed these issues with two interpolation methods: regression Kriging (RK) and ordinary Kriging (OK). These methods were used to generate air-quality simulations with a geostatistical algorithm. For each method, the geostatistical uncertainty was drawn from generalized linear model (GLM) analysis. We analyzed the association between air quality and birth weight. Personal health data (n=227) and exposure data were collected in Sines (Portugal) during 2007-2010. Because air-quality monitoring stations in the city do not offer high-spatial-resolution measurements (n=1), we used lichen data as an ecological indicator of air quality (n=83). We found no significant difference in the fit of GLMs with any of the geostatistical methods. With RK, however, the models tended to fit better more often and worse less often. Moreover, the geostatistical uncertainty results showed a marginally higher mean and precision with RK. Combined with lichen data and land-use data of high spatial resolution, RK is a more effective geostatistical method for relating health outcomes with air quality in urban areas. This is particularly important in small cities, which generally do not have expensive air-quality monitoring stations with high spatial resolution. Further, alternative ways of linking human activities with their

  3. Towards mitigating the effect of sine-Gaussian noise transients on searches for gravitational waves from compact binary coalescences

    Science.gov (United States)

    Bose, Sukanta; Dhurandhar, Sanjeev; Gupta, Anuradha; Lundgren, Andrew

    2016-12-01

    Gravitational wave signals were recently detected directly by LIGO from the coalescences of two stellar mass black hole pairs. These detections have strengthened our long held belief that compact binary coalescences (CBCs) are the most promising gravitational wave detection prospects accessible to ground-based interferometric detectors. For detecting CBC signals, it is of vital importance to characterize and identify non-Gaussian and nonstationary noise in these detectors. In this work, we model two important classes of transient artifacts that contribute to this noise and adversely affect the detector sensitivity to CBC signals. One of them is the sine-Gaussian "glitch," characterized by a central frequency f0 and a quality factor Q and the other is the chirping sine-Gaussian glitch, which is characterized by f0, Q as well as a chirp parameter. We study the response that a bank of compact binary inspiral templates has to these two families of glitches when they are used to match filter data containing any of these glitches. Two important characteristics of this response are the distributions of the signal-to-noise ratio and the time lag (i.e., how long after the occurrence of a glitch the signal-to-noise ratio of a trigger arises from its matched filtering by a template peaks) of individual templates. We show how these distributions differ from those when the detector data has a real CBC signal instead of a glitch. We argue that these distinctions can be utilized to develop useful signal-artifact discriminators that add negligibly to the computational cost of a CBC search. Specifically, we show how the central frequency of a glitch can be used to set adaptive time windows around it so that any template trigger occurring in that window can be quarantined for further vetting of its supposed astrophysical nature. Second, we recommend focusing efforts on reducing the incidence of glitches with low central-frequency values because they create CBC triggers with the

  4. On the efficiency of the image encryption and decryption by using logistic-sine chaotic system and logistic-tent chaotic system

    Science.gov (United States)

    Chiun, Lee Chia; Mandangan, Arif; Daud, Muhamad Azlan; Hussin, Che Haziqah Che

    2017-04-01

    We may secure the content of text, audio, image and video during their transmission from one party to another party via an open channel such as the internet by using cryptograph. Logistic-Sine System (LSS) is a combination on two 1D chaotic maps which are Logistic Map and Sine Map. By applying the LSS into cryptography, the image encryption and decryption can be performed. This study is focusing on the performance test of the image encryption and decryption processes by using the LSS. For comparison purpose, we compare the performance of the encryption and decryption by using two different chaotic systems, which are the LSS and Logistic-Tent System (LTS). The result shows that system with LSS is less efficient than LTS in term of encryption time but both systems have similar efficiency in term of decryption time.

  5. Multifrequency and edge breathers in the discrete sine-Gordon system via subharmonic driving: Theory, computation and experiment

    Energy Technology Data Exchange (ETDEWEB)

    Palmero, F. [Grupo de Física No Lineal, Departamento de Física Aplicada I, ETSI Informática, Universidad de Sevilla, Avda. Reina Mercedes, s/n, 41012 Sevilla (Spain); Department of Physics and Astronomy, Dickinson College, Carlisle, PA 17013 (United States); Han, J. [Department of Physics and Astronomy, Dickinson College, Carlisle, PA 17013 (United States); English, L.Q., E-mail: englishl@dickinson.edu [Department of Physics and Astronomy, Dickinson College, Carlisle, PA 17013 (United States); Alexander, T.J. [School of Physical, Environmental and Mathematical Sciences, UNSW Canberra, 2610 (Australia); Kevrekidis, P.G. [Department of Mathematics and Statistics, University of Massachusetts, Amherst, MA 01003-4515 (United States); Center for Nonlinear Studies and Theoretical Division, Los Alamos National Laboratory, Los Alamos, NM 87544 (United States)

    2016-01-28

    We consider a chain of torsionally-coupled, planar pendula shaken horizontally by an external sinusoidal driver. It has been known that in such a system, theoretically modeled by the discrete sine-Gordon equation, intrinsic localized modes, also known as discrete breathers, can exist. Recently, the existence of multifrequency breathers via subharmonic driving has been theoretically proposed and numerically illustrated by Xu et al. (2014) [21]. In this paper, we verify this prediction experimentally. Comparison of the experimental results to numerical simulations with realistic system parameters (including a Floquet stability analysis), and wherever possible to analytical results (e.g. for the subharmonic response of the single driven–damped pendulum), yields good agreement. Finally, we report the period-1 and multifrequency edge breathers which are localized at the open boundaries of the chain, for which we have again found good agreement between experiments and numerical computations. - Highlights: • We have confirmed experimentally the existence of subharmonic ILM/breather structures in a chain of coupled torsion pendula. • Experiments are in line with our theoretical analysis and numerical computations. • We have also revealed surface breather modes in this chain, both experimentally and numerically.

  6. c-function and central charge of the sine-Gordon model from the non-perturbative renormalization group flow

    Directory of Open Access Journals (Sweden)

    V. Bacsó

    2015-12-01

    Full Text Available In this paper we study the c-function of the sine-Gordon model taking explicitly into account the periodicity of the interaction potential. The integration of the c-function along trajectories of the non-perturbative renormalization group flow gives access to the central charges of the model in the fixed points. The results at vanishing frequency β2, where the periodicity does not play a role, are retrieved and the independence on the cutoff regulator for small frequencies is discussed. Our findings show that the central charge obtained integrating the trajectories starting from the repulsive low-frequencies fixed points (β2<8π to the infra-red limit is in good quantitative agreement with the expected Δc=1 result. The behavior of the c-function in the other parts of the flow diagram is also discussed. Finally, we point out that including also higher harmonics in the renormalization group treatment at the level of local potential approximation is not sufficient to give reasonable results, even if the periodicity is taken into account. Rather, incorporating the wave-function renormalization (i.e. going beyond local potential approximation is crucial to get sensible results even when a single frequency is used.

  7. Application of a sine transform method to experiments of single-photon-decay spectroscopy: Single exponential decay signals

    Science.gov (United States)

    López, R. J.; González, F.; Moreno, F.

    1992-06-01

    In this article we present as an experiment in single-photon-decay spectroscopy an alternative method to that based on the measurement of the probability distribution function, Pf(t), of the time intervals for the time of arrival of the first photon after the excitation pulse. We propose the measurement of the sine transform of Pf(t), which gives a maximum when the fluorescence signal is of the single exponential decay type. The existence of this maximum allows us to determine very accurately the value of the decay constant using a number of measurements which is lower than that required to establish a Pf(t) that is accurate enough to draw the same conclusions. A theoretical model of the error is studied and is compared by means of a computer simulation with the usual method of measuring Pf(t). An experiment is performed using a TMMC crystal to verify the validity of the theoretical predictions and of the simulation results.

  8. Crisis, unstable dimension variability, and bifurcations in a system with high-dimensional phase space: coupled sine circle maps.

    Science.gov (United States)

    Das, Alaka; Gupte, Neelima

    2013-04-01

    The phenomenon of crisis in systems evolving in high-dimensional phase space can show unexpected and interesting features. We study this phenomenon in the context of a system of coupled sine circle maps. We establish that the origins of this crisis lie in a tangent bifurcation in high dimensions, and identify the routes that lead to the crisis. Interestingly, multiple routes to crisis are seen depending on the initial conditions of the system, due to the high dimensionality of the space in which the system evolves. The statistical behavior seen in the phase diagram of the system is also seen to change due to the dynamical phenomenon of crisis, which leads to transitions from nonspreading to spreading behavior across an infection line in the phase diagram. Unstable dimension variability is seen in the neighborhood of the infection line. We characterize this crisis and unstable dimension variability using dynamical characterizers, such as finite-time Lyapunov exponents and their distributions. The phase diagram also contains regimes of spatiotemporal intermittency and spatial intermittency, where the statistical quantities scale as power laws. We discuss the signatures of these regimes in the dynamic characterizers, and correlate them with the statistical characterizers and bifurcation behavior. We find that it is necessary to look at both types of correlators together to build up an accurate picture of the behavior of the system.

  9. Supersymmetric quantum mechanics and solitons of the sine-Gordon and nonlinear Schrödinger equations.

    Science.gov (United States)

    Koller, Andrew; Olshanii, Maxim

    2011-12-01

    We present a case demonstrating the connection between supersymmetric quantum mechanics (SUSYQM), reflectionless scattering, and soliton solutions of integrable partial differential equations. We show that the members of a class of reflectionless Hamiltonians, namely, Akulin's Hamiltonians, are connected via supersymmetric chains to a potential-free Hamiltonian, explaining their reflectionless nature. While the reflectionless property in question has been mentioned in the literature for over two decades, the enabling algebraic mechanism was previously unknown. Our results indicate that the multisoliton solutions of the sine-Gordon and nonlinear Schrödinger equations can be systematically generated via the supersymmetric chains connecting Akulin's Hamiltonians. Our findings also explain a well-known but little-understood effect in laser physics: when a two-level atom, initially in the ground state, is subjected to a laser pulse of the form V(t) = (nh/τ)/cosh(t/τ), with n being an integer and τ being the pulse duration, it remains in the ground state after the pulse has been applied, for any choice of the laser detuning.

  10. The Interaction among Microbiota, Immunity, and Genetic and Dietary Factors Is the Condicio Sine Qua Non Celiac Disease Can Develop

    Directory of Open Access Journals (Sweden)

    D. Pagliari

    2015-01-01

    Full Text Available Celiac disease (CD is an immune-mediated enteropathy, triggered by dietary wheat gluten and similar proteins of barley and rye in genetically susceptible individuals. This is a complex disorder involving both environmental and immune-genetic factors. The major genetic risk factor for CD is determined by HLA-DQ genes. Dysfunction of the innate and adaptive immune systems can conceivably cause impairment of mucosal barrier function and development of localized or systemic inflammatory and autoimmune processes. Exposure to gluten is the main environmental trigger responsible for the signs and symptoms of the disease, but exposure to gluten does not fully explain the manifestation of CD. Thus, both genetic determination and environmental exposure to gluten are necessary for the full manifestation of CD; neither of them is sufficient alone. Epidemiological and clinical data suggest that other environmental factors, including infections, alterations in the intestinal microbiota composition, and early feeding practices, might also play a role in disease development. Thus, this interaction is the condicio sine qua non celiac disease can develop. The breakdown of the interaction among microbiota, innate immunity, and genetic and dietary factors leads to disruption of homeostasis and inflammation; and tissue damage occurs. Focusing attention on this interaction and its breakdown may allow a better understanding of the CD pathogenesis and lead to novel translational avenues for preventing and treating this widespread disease.

  11. Estrogen-dependent expression of sine oculis homeobox 1 in the mouse uterus during the estrous cycle

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Sijeong [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Kwon, Hwang [Fertility Center of CHA Bundang Medical Center, Seongnam-si, Gyeonggi-do 13496 (Korea, Republic of); Yoon, Hyemin [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Park, Miseon [Fertility Center of CHA Gangnam Medical Center, Seoul 06135 (Korea, Republic of); Kim, Hye-Ryun; Song, Haengseok [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Hong, Kwonho, E-mail: kwonho.hong@dankook.ac.kr [Department of Nanobiomedical Science & BK21 PLUS NBM Global Research Center for Regenerative Medicine, Dankook University, Cheonan-si, Chungcheongnam-do 31116 (Korea, Republic of); Choi, Youngsok, E-mail: youngsokchoi@cha.ac.kr [Department of Biomedical Science, CHA University, Seongnam-si, Gyeonggi-do 13488 (Korea, Republic of); Fertility Center of CHA Gangnam Medical Center, Seoul 06135 (Korea, Republic of)

    2016-04-08

    The sine oculis homeobox 1 (SIX1) is a member of the Six gene family. SIX1 is involved in tissue development by regulating proliferation, apoptosis, and differentiation. However, function of SIX1 in the uterus remains unknown. Here, we found that Six1 expression is regulated along the estrous cycle in mouse uterus. Six1 expression was significantly increased at estrus stage and decreased at the rest of stages. SIX1 is detected in the luminal and glandular epithelium of uterine endometrium at the estrus stage. Estrogen injection increased Six1 expression in the ovariectomized mouse uterus, whereas progesterone had no effect on its expression. Estrogen receptor antagonist inhibited estrogen-induced Six1 expression. Our findings imply that SIX1 may play a role as an important regulator to orchestrate the dynamic of uterine endometrium in response to estrogen level during the estrous cycle. These results will give us a better understanding of uterine biology. - Highlights: • Six1 expression is regulated during the estrous cycle in mouse uterus. • Six1 is highly expressed at the estrus stage of estrous cycle. • SIX1 is detected in luminal/glandular epithelium of the uterus at the estrus stage. • Estrogen stimulates Six1 expression in an estrogen receptor-dependent manner.

  12. Type I integrable defects and finite-gap solutions for KdV and sine-Gordon models

    Science.gov (United States)

    Corrigan, E.; Parini, R.

    2017-07-01

    The main purpose of this paper is to extend results, which have been obtained previously to describe the classical scattering of solitons with integrable defects of type I, to include the much larger and intricate collection of finite-gap solutions defined in terms of generalised theta functions. In this context, it is generally not feasible to adopt a direct approach, via ansätze for the fields to either side of the defect tuned to satisfy the defect sewing conditions. Rather, essential use is made of the fact that the defect sewing conditions themselves are intimately related to Bäcklund transformations in order to set up a strategy to enable the calculation of the field on one side by suitably transforming the field on the other side. The method is implemented using Darboux transformations and illustrated in detail for the sine-Gordon and KdV models. An exception, treatable by both methods, indirect and direct, is provided by the genus 1 solutions. These can be expressed in terms of Jacobi elliptic functions, which satisfy a number of useful identities of relevance to this problem. There are new features to the solutions obtained in the finite-gap context but, in all cases, if a (multi)soliton limit is taken within the finite-gap solutions previously known results are recovered.

  13. bilingualism in the english of tertiary students: a sine-qua-non for ...

    African Journals Online (AJOL)

    REV YOUNG EZENWA OBIOHA

    thoughts, inner feelings, personal psychological experiences and business entrepreneurial activities. Thus bilingualism promotes mentorship and entrepreneurial skills in the life of the tertiary student. Nwachukwu (2007:15) opines that. English has remained the primary language of education right from the colonial era. The.

  14. A RAB3GAP1 SINE Insertion in Alaskan Huskies with Polyneuropathy, Ocular Abnormalities, and Neuronal Vacuolation (POANV Resembling Human Warburg Micro Syndrome 1 (WARBM1

    Directory of Open Access Journals (Sweden)

    Michaela Wiedmer

    2016-02-01

    Full Text Available We observed a hereditary phenotype in Alaskan Huskies that was characterized by polyneuropathy with ocular abnormalities and neuronal vacuolation (POANV. The affected dogs developed a progressive severe ataxia, which led to euthanasia between 8 and 16 months of age. The pedigrees were consistent with a monogenic autosomal recessive inheritance. We localized the causative genetic defect to a 4 Mb interval on chromosome 19 by a combined linkage and homozygosity mapping approach. Whole genome sequencing of one affected dog, an obligate carrier, and an unrelated control revealed a 218-bp SINE insertion into exon 7 of the RAB3GAP1 gene. The SINE insertion was perfectly associated with the disease phenotype in a cohort of 43 Alaskan Huskies, and it was absent from 541 control dogs of diverse other breeds. The SINE insertion induced aberrant splicing and led to a transcript with a greatly altered exon 7. RAB3GAP1 loss-of-function variants in humans cause Warburg Micro Syndrome 1 (WARBM1, which is characterized by additional developmental defects compared to canine POANV, whereas Rab3gap1-deficient mice have a much milder phenotype than either humans or dogs. Thus, the RAB3GAP1 mutant Alaskan Huskies provide an interesting intermediate phenotype that may help to better understand the function of RAB3GAP1 in development. Furthermore, the identification of the presumed causative genetic variant will enable genetic testing to avoid the nonintentional breeding of affected dogs.

  15. Mathematical modelling of tsunami impacts on critical infrastructures: exposure and severity associated with debris transport at Sines port, Portugal.

    Science.gov (United States)

    Conde, Daniel; Baptista, Maria Ana; Sousa Oliveira, Carlos; Ferreira, Rui M. L.

    2015-04-01

    Global energy production is still significantly dependant on the coal supply chain, justifying huge investments on building infrastructures, capable of stocking very large quantities of this natural resource. Most of these infrastructures are located at deep-sea ports and are therefore exposed to extreme coastal hazards, such as tsunami impacts. The 2011 Tohoku tsunami is reported to have inflicted severe damage to Japan's coal-fired power stations and related infrastructure. Sines, located in the Portuguese coast, hosts a major commercial port featuring an exposed coal stockpile area extending over more than 24 ha and a container terminal currently under expansion up to 100ha. It is protected against storm surges but tsunamis have not been considered in the design criteria. The dominant wind-generated wave direction is N to NW, while the main tsunamigenic faults are located S to SW of the port. This configuration potentially exposes sensitive facilities, such as the new terminal container and the coal stockpile area. According to a recent revision of the national tsunami catalogue (Baptista, 2009), Portugal has been affected by numerous major tsunamis over the last two millennia, with the most notorious event being the Great Lisbon Earthquake and Tsunami occurred on the 1st November 1755. The aim of this work is to simulate the open ocean propagation and overland impact of a tsunami on the Sines port, similar to the historical event of 1755, based on the different tsunamigenic faults and magnitudes proposed in the current literature. Open ocean propagation was modelled with standard simulation tools like TUNAMI and GeoClaw. Near-shore and overland propagation was carried out using a recent 2DH mathematical model for solid-fluid flows, STAV-2D from CERIS-IST (Ferreira et al., 2009; Canelas, 2013). STAV-2D is particularly suited for tsunami propagation over complex and morphodynamic geometries, featuring a discretization scheme based on a finite-volume method using

  16. Epidermolytic Ichthyosis Sine Epidermolysis.

    Science.gov (United States)

    Eskin-Schwartz, Marina; Drozhdina, Marianna; Sarig, Ofer; Gat, Andrea; Jackman, Tomer; Isakov, Ofer; Shomron, Noam; Samuelov, Liat; Malchin, Natalia; Peled, Alon; Vodo, Dan; Hovnanian, Alain; Ruzicka, Thomas; Koshkin, Sergei; Harmon, Robert M; Koetsier, Jennifer L; Green, Kathleen J; Paller, Amy S; Sprecher, Eli

    2017-06-01

    Epidermolytic ichthyosis (EI) is a rare disorder of cornification caused by mutations in KRT1 and KRT10, encoding two suprabasal epidermal keratins. Because of the variable clinical features and severity of the disease, histopathology is often required to correctly direct the molecular analysis. EI is characterized by hyperkeratosis and vacuolar degeneration of the upper epidermis, also known as epidermolytic hyperkeratosis, hence the name of the disease. In the current report, the authors describe members of 2 families presenting with clinical features consistent with EI. The patients were shown to carry classical mutations in KRT1 or KRT10, but did not display epidermolytic changes on histology. These observations underscore the need to remain aware of the limitations of pathological features when considering a diagnosis of EI.

  17. Funktionelle Charakterisierung trimerer Autotransporteradhäsine von Neisseria meningitidis (NadA) und Yersinia enterocolitica (YadA)

    OpenAIRE

    Nägele, Virginie

    2010-01-01

    Die Untersuchung des Neisseria meningitidis Adhäsins NadA in Meningokokken ist durch die Anwesenheit diverser Adhäsine erschwert. Daher wurde Y. enterocolitica als Modellorganismus für die funktionelle Charakterisierung des NadA verwendet, und lieferte neue Einblicke in die Interaktion von NadA mit Epithel- und Immunzellen, mit Komplementfaktoren, sowie in die Rolle von NadA bei der Mausvirulenz. Zusätzlich konnte eine spezifische Interaktion von NadA mit humanen β1 und β3 Integrinen nachgewi...

  18. Towards low-latency mitigation of the effect of sine-Gaussian noise transients on searches for gravitational waves from compact binary coalescences

    CERN Document Server

    Bose, Sukanta; Gupta, Anuradha; Lundgren, Andrew

    2016-01-01

    Gravitational wave (GW) signals were recently detected directly by LIGO from the coalescences of two stellar mass black hole pairs. These detections have strengthened our long held belief that compact binary coalescences (CBCs) are the most promising GW detection prospects accessible to ground-based interferometric detectors. For detecting CBC signals it is of vital importance to characterize and identify non-Gaussian and non-stationary noise in these detectors. In this work we model two important classes of transient artifacts that contribute to this noise and adversely affect the detector sensitivity to CBC signals. One of them is the sine-Gaussian "glitch", characterized by a central frequency $f_0$ and a quality factor $Q$ and the other is the chirping sine-Gaussian glitch, which is characterized by $f_0$, $Q$ as well as a chirp parameter. We study the response a bank of compact binary inspiral templates has to these two families of glitches when they are used to match-filter data containing any of these ...

  19. Design and Operation of 6-bit, 0.25-mVpp Quasi-sine Voltage Waveform Generator based on SFQ Pulse-frequency Modulation

    Science.gov (United States)

    Takahashi, Yoshitaka; Shimada, Hiroshi; Maezawa, Masaaki; Mizugaki, Yoshinao

    A digital-to-analogue converter (DAC) consisting of single-flux-quantum (SFQ) circuitry is known to generate accurate analogue voltages defined by the Josephson relationship. We have been developing SFQ-DACs of the pulse-frequency modulation (PFM) type. Toward voltage standard applications of SFQ-DACs, we have set the target values for the voltage amplitude and resolution at 20 mVpp and 10 bits, respectively. So far, we have reported a 5-bit, 10-μVpp quasi-sine voltage waveform generator comprising a PFM-type SFQ-DAC integrated with an on-chip digital code generator. Its small peak-to-peak voltage amplitude was due to the lack of an on-chip voltage multiplier (VM). In this paper, we present a 6-bit, 0.25-mVpp quasi-sine voltage waveform generator integrated with a 10-fold VM. The resolution is improved by introducing efficient logic sequences into the SFQ-DAC.

  20. Receiver Signal to Noise Ratios for IPDA Lidars Using Sine-wave and Pulsed Laser Modulation and Direct Detections

    Science.gov (United States)

    Sun, Xiaoli; Abshire, James B.

    2011-01-01

    seeder lasers, one on-line and one offline that are intensity modulated by two different frequency sine-waves signals before being amplified by a common laser amplifier. The receiver uses narrowband amplitude demodulation, or lock-in, Signal processing at the given laser modulation frequencies [3,4]. The laser transmitter operates in a quasi CW mode with the peak power equal to twice the average power. The on-line and off-line lasers can be transmitted at the same time without interference. Another direct detection technique uses a low duty cycle pulsed laser modulation [5,6] with the laser wavelengths alternating between on-line and off-line on successive pulses. The receiver uses time resolved detection and can also provide simultaneous target range measurement. With a lower laser duty cycle it requires a much higher peak laser power for the same average power.

  1. Nulla aesthetica sine ethica: los retos de una nueva, solidaria y colaborativa formación artística superior.

    Directory of Open Access Journals (Sweden)

    Álvaro Zaldívar Gracia

    2015-07-01

    Full Text Available Este artículo se centra en la exigencia, propia del Espacio Europeo de la Educación Superior, de buscar nuevos perfiles profesionales acercando las a veces demasiado abstractas propuestas académicas a las necesidades sociales reales, sin olvidar la necesidad de buscar colaboraciones y mecenazgos privados que apoyen también a la enseñanza pública, y resaltando ante todo el imperativo de hacer que los jóvenes artistas, cuando salgan de nuestros centros superiores, además de excelentes en cuanto tales, tengan la amplia formación humana y esa profunda orientación solidaria que resulta imprescindible (nulla aesthetica sine ethica en un mundo como el actual, complejo e injusto, pero lleno de nuevas e ilusionantes posibilidades de mejora.

  2. Genome-wide DNA binding pattern of the homeodomain transcription factor Sine oculis (So in the developing eye of Drosophila melanogaster

    Directory of Open Access Journals (Sweden)

    Barbara Jusiak

    2014-12-01

    Full Text Available The eye of the fruit fly Drosophila melanogaster provides a highly tractable genetic model system for the study of animal development, and many genes that regulate Drosophila eye formation have homologs implicated in human development and disease. Among these is the homeobox gene sine oculis (so, which encodes a homeodomain transcription factor (TF that is both necessary for eye development and sufficient to reprogram a subset of cells outside the normal eye field toward an eye fate. We have performed a genome-wide analysis of So binding to DNA prepared from developing Drosophila eye tissue in order to identify candidate direct targets of So-mediated transcriptional regulation, as described in our recent article [20]. The data are available from NCBI Gene Expression Omnibus (GEO with the accession number GSE52943. Here we describe the methods, data analysis, and quality control of our So ChIP-seq dataset.

  3. Lineage-specific SoxR-mediated Regulation of an Endoribonuclease Protects Non-enteric Bacteria from Redox-active Compounds.

    Science.gov (United States)

    Kim, Jisun; Park, Chulwoo; Imlay, James A; Park, Woojun

    2017-01-06

    Bacteria use redox-sensitive transcription factors to coordinate responses to redox stress. The [2Fe-2S] cluster-containing transcription factor SoxR is particularly tuned to protect cells against redox-active compounds (RACs). In enteric bacteria, SoxR is paired with a second transcription factor, SoxS, that activates downstream effectors. However, SoxS is absent in non-enteric bacteria, raising questions as to how SoxR functions. Here, we first show that SoxR of Acinetobacter oleivorans displayed similar activation profiles in response to RACs as did its homolog from Escherichia coli but controlled a different set of target genes, including sinE, which encodes an endoribonuclease. Expression, gel mobility shift, and mutational analyses indicated that sinE is a direct target of SoxR. Redox potentials and permeability of RACs determined optimal sinE induction. Bioinformatics suggested that only a few γ- and β-proteobacteria might have SoxR-regulated sinE Purified SinE, in the presence of Mg(2+) ions, degrades rRNAs, thus inhibiting protein synthesis. Similarly, pretreatment of cells with RACs demonstrated a role for SinE in promoting persistence in the presence of antibiotics that inhibit protein synthesis. Our data improve our understanding of the physiology of soil microorganisms by suggesting that both non-enteric SoxR and its target SinE play protective roles in the presence of RACs and antibiotics. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  4. A SINE Insertion in ATP1B2 in Belgian Shepherd Dogs Affected by Spongy Degeneration with Cerebellar Ataxia (SDCA2

    Directory of Open Access Journals (Sweden)

    Nico Mauri

    2017-08-01

    Full Text Available Spongy degeneration with cerebellar ataxia (SDCA is a genetically heterogeneous neurodegenerative disorder with autosomal recessive inheritance in Malinois dogs, one of the four varieties of the Belgian Shepherd breed. Using a combined linkage and homozygosity mapping approach we identified an ∼10.6 Mb critical interval on chromosome 5 in a Malinois family with four puppies affected by cerebellar dysfunction. Visual inspection of the 10.6 Mb interval in whole-genome sequencing data from one affected puppy revealed a 227 bp SINE insertion into the ATP1B2 gene encoding the β2 subunit of the Na+/K+-ATPase holoenzyme (ATP1B2:c.130_131insLT796559.1:g.50_276. The SINE insertion caused aberrant RNA splicing. Immunohistochemistry suggested a reduction of ATP1B2 protein expression in the central nervous system of affected puppies. Atp1b2 knockout mice had previously been reported to show clinical and neurohistopathological findings similar to the affected Malinois puppies. Therefore, we consider ATP1B2:c.130_131ins227 the most likely candidate causative variant for a second subtype of SDCA in Malinois dogs, which we propose to term spongy degeneration with cerebellar ataxia subtype 2 (SDCA2. Our study further elucidates the genetic and phenotypic complexity underlying cerebellar dysfunction in Malinois dogs and provides the basis for a genetic test to eradicate one specific neurodegenerative disease from the breeding population in Malinois and the other varieties of the Belgian Shepherd breed. ATP1B2 thus represents another candidate gene for human inherited cerebellar ataxias, and SDCA2-affected Malinois puppies may serve as a naturally occurring animal model for this disorder.

  5. A SINE Insertion in ATP1B2 in Belgian Shepherd Dogs Affected by Spongy Degeneration with Cerebellar Ataxia (SDCA2).

    Science.gov (United States)

    Mauri, Nico; Kleiter, Miriam; Dietschi, Elisabeth; Leschnik, Michael; Högler, Sandra; Wiedmer, Michaela; Dietrich, Joëlle; Henke, Diana; Steffen, Frank; Schuller, Simone; Gurtner, Corinne; Stokar-Regenscheit, Nadine; O'Toole, Donal; Bilzer, Thomas; Herden, Christiane; Oevermann, Anna; Jagannathan, Vidhya; Leeb, Tosso

    2017-08-07

    Spongy degeneration with cerebellar ataxia (SDCA) is a genetically heterogeneous neurodegenerative disorder with autosomal recessive inheritance in Malinois dogs, one of the four varieties of the Belgian Shepherd breed. Using a combined linkage and homozygosity mapping approach we identified an ∼10.6 Mb critical interval on chromosome 5 in a Malinois family with four puppies affected by cerebellar dysfunction. Visual inspection of the 10.6 Mb interval in whole-genome sequencing data from one affected puppy revealed a 227 bp SINE insertion into the ATP1B2 gene encoding the β2 subunit of the Na+/K+-ATPase holoenzyme (ATP1B2:c.130_131insLT796559.1:g.50_276). The SINE insertion caused aberrant RNA splicing. Immunohistochemistry suggested a reduction of ATP1B2 protein expression in the central nervous system of affected puppies. Atp1b2 knockout mice had previously been reported to show clinical and neurohistopathological findings similar to the affected Malinois puppies. Therefore, we consider ATP1B2:c.130_131ins227 the most likely candidate causative variant for a second subtype of SDCA in Malinois dogs, which we propose to term spongy degeneration with cerebellar ataxia subtype 2 (SDCA2). Our study further elucidates the genetic and phenotypic complexity underlying cerebellar dysfunction in Malinois dogs and provides the basis for a genetic test to eradicate one specific neurodegenerative disease from the breeding population in Malinois and the other varieties of the Belgian Shepherd breed. ATP1B2 thus represents another candidate gene for human inherited cerebellar ataxias, and SDCA2-affected Malinois puppies may serve as a naturally occurring animal model for this disorder. Copyright © 2017 Mauri et al.

  6. Sine-Gordon Equation in (1+2 and (1+3 dimensions: Existence and Classification of Traveling-Wave Solutions.

    Directory of Open Access Journals (Sweden)

    Yair Zarmi

    Full Text Available The (1+1-dimensional Sine-Gordon equation passes integrability tests commonly applied to nonlinear evolution equations. Its kink solutions (one-dimensional fronts are obtained by a Hirota algorithm. In higher space-dimensions, the equation does not pass these tests. Although it has been derived over the years for quite a few physical systems that have nothing to do with Special Relativity, the Sine-Gordon equation emerges as a non-linear relativistic wave equation. This opens the way for exploiting the tools of the Theory of Special Relativity. Using no more than the relativistic kinematics of tachyonic momentum vectors, from which the solutions are constructed through the Hirota algorithm, the existence and classification of N-moving-front solutions of the (1+2- and (1+3-dimensional equations for all N ≥ 1 are presented. In (1+2 dimensions, each multi-front solution propagates rigidly at one velocity. The solutions are divided into two subsets: Solutions whose velocities are lower than a limiting speed, c = 1, or are greater than or equal to c. To connect with concepts of the Theory of Special Relativity, c will be called "the speed of light." In (1+3-dimensions, multi-front solutions are characterized by spatial structure and by velocity composition. The spatial structure is either planar (rotated (1+2-dimensional solutions, or genuinely three-dimensional--branes. Planar solutions, propagate rigidly at one velocity, which is lower than, equal to, or higher than c. Branes must contain clusters of fronts whose speed exceeds c = 1. Some branes are "hybrids": different clusters of fronts propagate at different velocities. Some velocities may be lower than c but some must be equal to, or exceed, c. Finally, the speed of light cannot be approached from within the subset of slower-than-light solutions in both (1+2 and (1+3 dimensions.

  7. Putative regulation mechanism for the MSTN gene by a CpG island generated by the SINE marker Ins227bp.

    Science.gov (United States)

    van den Hoven, René; Gür, Emre; Schlamanig, Manuela; Hofer, Martin; Onmaz, Ali Cesur; Steinborn, Ralf

    2015-06-23

    A single nucleotide polymorphism (SNP) in the first intron of the myostatin gene (MSTN) is associated with aptness of elite Thoroughbreds to race over sprint, middle or long distances. This intronic marker (g.66493737 T ≻ C), a short interspersed nuclear element (SINE) of 227 bp (Ins227bp) insertion polymorphism in the MSTN promoter, and the adjacent SNP BIEC2-417495 have not been studied for their association with racing aptness of the average Thoroughbreds raced in countries with lower status of the racing industry. This study investigated these markers regarding their prevalence and association with performance in common race horses. Markers were genotyped by amplification refractory mutation system-quantitative PCR (ARMS-qPCR) or amplicon melting. Furthermore, we asked whether the Ins227bp marker might theoretically regulate the expression of myostatin by generating a novel target for DNA methylation or by changing binding sites for transcription factors. Putative sites for DNA methylation or binding of transcription factors were predicted by MethPrimer and by the softwares JASPAR, MatInspector and UniPROBE, respectively. Pairwise linkage disequilibrium between g.66493737 T ≻ C and Ins227bp was high (r (2) = 0.93). A lower linkage was determined for g.66493737 T ≻ C and BIEC2-417495 (r (2) = 0.69) as well as for BIEC2-417495 and Ins227bp (r (2) = 0.76). The estimated frequencies for the presence of Ins227bp (I) indel and the C alleles at g.66493737 T ≻ C and BIEC2-417495 were 0.46, 0.47 and 0.43, respectively. Heterozygotes represented the most abundant genotype at each locus. The best racing distance (BRD) was significantly different between the homozygotes of each SNP (p = 0.01 to 0.03). C allele homozygotes at BIEC2-417495 or g.66493737 T ≻ C, as well as Ins227bp homozygotes earned most money on a mean distance ranging from 1211 to 1230 m. Heterozygotes earned most money on races over 1690 to 1709 m. The BRD for the T/T carriers at both SNP loci

  8. Akdeniz Meyve Sineğinin Feromon Tuzaklarla (Ceratitis capitata Wied.) (Diptera: Tephritidae)’nin Nar ve Hurmadaki Populasyon Takibi ve Zarar Oranının Tespiti

    OpenAIRE

    KASAP, Aziz; ASLAN, Mahmut

    2016-01-01

    ÖZET: Bu çalışma 2015 yılında Adana ilinde trabzon hurma (Rojo brillante) çeşidi ve nar (Acco) çeşidinin bulunduğu bahçelerde yürütülmüştür. Çalışmada; Akdeniz meyve sineği (Ceratitis capitata Wied.) (Diptera: Tephritidae)’nin nar ve trabzon hurması çeşidindeki popülasyon gelişimleri ve meyvedeki zarar oranının belirlenmesi amaçlanmıştır. Akdeniz meyve sineğinin popülasyon gelişimi SEDQ sarı tuzak+feromon (cezbedici+insektisit) kullanılarak yapılmıştır. Popülasyon takibi sonucu tuzaklarda yak...

  9. An Intronic SINE insertion in FAM161A that causes exon-skipping is associated with progressive retinal atrophy in Tibetan Spaniels and Tibetan Terriers.

    Directory of Open Access Journals (Sweden)

    Louise M Downs

    Full Text Available Progressive retinal atrophy (PRA in dogs is characterised by the degeneration of the photoreceptor cells of the retina, resulting in vision loss and eventually complete blindness. The condition affects more than 100 dog breeds and is known to be genetically heterogeneous between breeds. Around 19 mutations have now been identified that are associated with PRA in around 49 breeds, but for the majority of breeds the mutation(s responsible have yet to be identified. Using genome-wide association with 22 Tibetan Spaniel PRA cases and 10 controls, we identified a novel PRA locus, PRA3, on CFA10 (p(raw = 2.01 × 10(-5, p(genome = 0.014, where a 3.8 Mb region was homozygous within 12 cases. Using targeted next generation sequencing, a short interspersed nuclear element insertion was identified near a splice acceptor site in an intron of a provocative gene, FAM161A. Analysis of mRNA from an affected dog revealed that the SINE causes exon skipping, resulting in a frame shift, leading to a downstream premature termination codon and possibly a truncated protein product. This mutation segregates with the disease in 22 out of 35 cases tested (63%. Of the PRA controls, none are homozygous for the mutation, 15% carry the mutation and 85% are homozygous wildtype. This mutation was also identified in Tibetan Terriers, although our results indicate that PRA is genetically heterogeneous in both Tibetan Spaniels and Tibetan Terriers.

  10. 1.25  GHz sine wave gating InGaAs/InP single-photon detector with a monolithically integrated readout circuit.

    Science.gov (United States)

    Jiang, Wen-Hao; Liu, Jian-Hong; Liu, Yin; Jin, Ge; Zhang, Jun; Pan, Jian-Wei

    2017-12-15

    InGaAs/InP single-photon detectors (SPDs) are the key devices for applications requiring near-infrared single-photon detection. The gating mode is an effective approach to synchronous single-photon detection. Increasing gating frequency and reducing the module size are important challenges for the design of such a detector system. Here we present for the first time, to the best of our knowledge, an InGaAs/InP SPD with 1.25 GHz sine wave gating (SWG) using a monolithically integrated readout circuit (MIRC). The MIRC has a size of 15  mm×15  mm and implements the miniaturization of avalanche extraction for high-frequency SWG. In the MIRC, low-pass filters and a low-noise radio frequency amplifier are integrated based on the technique of low temperature co-fired ceramic, which can effectively reduce the parasitic capacitance and extract weak avalanche signals. We then characterize the InGaAs/InP SPD to verify the functionality and reliability of the MIRC, and the SPD exhibits excellent performance with 27.5% photon detection efficiency, a 1.2 kcps dark count rate, and 9.1% afterpulse probability at 223 K and 100 ns hold-off time. With this MIRC, one can further design miniaturized high-frequency SPD modules that are highly required for practical applications.

  11. Système de traiement d'eaux de regémération de résines pour l'élimination du cuivre

    CERN Document Server

    Karademir, Aynur

    2005-01-01

    Des cartouches de résines échangeuses d’ions sont utilisées pour le maintien de la qualité de l’eau déminéralisée nécessaire pour le refroidissement des accélérateurs du CERN. Les eaux issues de la régénération de ces cartouches contiennent des teneurs en cuivre trop élevées pour permettre leur rejet dans les réseaux d’eaux claires ou même usées. Le projet d’un système de traitement pour abattre la concentration de cuivre, basé sur une méthode simple, avec un rendement élevé, satisfaisant du point de vue de la sécurité, de l’impact environnemental et aussi économique, fait l’objet de ce travail.

  12. Color image encryption by using Yang-Gu mixture amplitude-phase retrieval algorithm in gyrator transform domain and two-dimensional Sine logistic modulation map

    Science.gov (United States)

    Sui, Liansheng; Liu, Benqing; Wang, Qiang; Li, Ye; Liang, Junli

    2015-12-01

    A color image encryption scheme is proposed based on Yang-Gu mixture amplitude-phase retrieval algorithm and two-coupled logistic map in gyrator transform domain. First, the color plaintext image is decomposed into red, green and blue components, which are scrambled individually by three random sequences generated by using the two-dimensional Sine logistic modulation map. Second, each scrambled component is encrypted into a real-valued function with stationary white noise distribution in the iterative amplitude-phase retrieval process in the gyrator transform domain, and then three obtained functions are considered as red, green and blue channels to form the color ciphertext image. Obviously, the ciphertext image is real-valued function and more convenient for storing and transmitting. In the encryption and decryption processes, the chaotic random phase mask generated based on logistic map is employed as the phase key, which means that only the initial values are used as private key and the cryptosystem has high convenience on key management. Meanwhile, the security of the cryptosystem is enhanced greatly because of high sensitivity of the private keys. Simulation results are presented to prove the security and robustness of the proposed scheme.

  13. Assessment of oral ivermectin versus shampoo in the treatment of pediculosis (head lice infestation) in rural areas of Sine-Saloum, Senegal.

    Science.gov (United States)

    Leulmi, Hamza; Diatta, Georges; Sokhna, Cheikh; Rolain, Jean-Marc; Raoult, Didier

    2016-12-01

    Reports of treatment failure and the emergence of resistance to topical head lice treatments have become increasingly common, driving the need for continued development of new therapeutic options for pediculosis. Ivermectin has been proposed as a potential alternative for the treatment of pediculosis but has not been sufficiently evaluated. In this study, the effectiveness of oral ivermectin versus shampoo in the treatment of pediculosis in Senegal was compared. The study was conducted in two neighbouring villages of Sine-Saloum, Senegal: Dielmo (ivermectin trial group; 201 female participants) and Ndiop (shampoo trial group; 239 female participants). In the ivermectin group, patients received two doses of oral ivermectin (400 µg/kg body weight; Mectizan ® ) 7 days apart. In contrast, the shampoo group received a shampoo treatment based on d-phenothrin (0.23%; Hégor ® ). At the beginning of the study, 70 (34.8%) of 201 participants in the ivermectin group were infested by head lice versus 145 (60.7%) of 239 participants in the shampoo group. At Day 15 post-treatment, the efficacy of the treatment against head lice reached 41/53 (77.4%) in the ivermectin group (53 patients were tested in this group) versus 42/130 (32.3%) in the shampoo group (130 patients were tested in this group) (P shampoo, but also suggests that ivermectin resistance may emerge during treatment. Copyright © 2016 Elsevier B.V. and International Society of Chemotherapy. All rights reserved.

  14. Effects of Different Waveforms on the Performance of Active Capillary Dielectric Barrier Discharge Ionization Mass Spectrometry.

    Science.gov (United States)

    Dumlao, Morphy C; Xiao, Dan; Zhang, Daming; Fletcher, John; Donald, William A

    2017-04-01

    Active capillary dielectric barrier discharge ionization (DBDI) is emerging as a compact, low-cost, and robust method to form intact ions of small molecules for detection in near real time by portable mass spectrometers. Here, we demonstrate that by using a 10 kHz, ~2.5 kV p-p high-voltage square-wave alternating current plasma, active capillary DBDI can consume less than 1 μW of power. In contrast, the power consumed using a sine and triangle alternating current waveform is more than two orders of magnitude higher than that for the square waveform to obtain a similar voltage for plasma generation. Moreover, the plasma obtained using a square waveform can be significantly more homogenous than that obtained using sine and triangle waveforms. Protonated dimethyl methylphosphonate (DMMP) and deprotonated perfluorooctanoic acid (PFOA) can be detected at about the same or higher abundances using square-wave DBDI mass spectrometry compared with the use of sine and triangle waveforms. By use of benzylammonium thermometer ions, the extent of internal energy deposition using square, sine, or triangle waveform excited plasmas are essentially the same at the optimum voltages for ion detection. Using an H-bridge circuit driving a transformer optimized to reduce losses, square-wave active capillary DBDI can be continuously powered for ~50 h by common 9 V-battery (PP3). Graphical Abstract ᅟ.

  15. Movens sine motione: Espacio y acción en la poesía de Sulpicia

    Directory of Open Access Journals (Sweden)

    Agustín Ávila

    2017-08-01

    The poems of the Sulpician cycle, included at the end of the third book of the Corpus Tibullianum, remain a matter of discussion today. There are those who claim that it is the only testimony of feminine writing from the Late Republic and, on the other hand, those who prefer to deem them the work of a male poet who assumes, like Propertius and Ovid did before, a feminine persona. This paper analyzes sorne traits existing in Sulpicia's poetry concerning the space of the Roman woman and her activity, in order to contribute to the hypothesis of feminine authorship (Parker, 1994; Stevenson, 2005. It is centered in the examination of carmen 111. 9, but it also establishes significant relationships within the rest of the cycle and the texts of her Greek and Latin precedents and contemporaries, which expose sorne characteristic outlines of feminine writing. Keywords: Sulpicia; feminine writing; Corpus Tibullianum; domus; Women in Rome; Genre

  16. Pharmacological treatment with inhibitors of nuclear export enhances the antitumor activity of docetaxel in human prostate cancer.

    Science.gov (United States)

    Gravina, Giovanni Luca; Mancini, Andrea; Colapietro, Alessandro; Marampon, Francesco; Sferra, Roberta; Pompili, Simona; Biordi, Leda Assunta; Iorio, Roberto; Flati, Vincenzo; Argueta, Christian; Landesman, Yosef; Kauffman, Michael; Shacham, Sharon; Festuccia, Claudio

    2017-12-19

    Docetaxel (DTX) modestly increases patient survival of metastatic castration-resistant prostate cancer (mCRPC) due to insurgence of pharmacological resistance. Deregulation of Chromosome Region Maintenance (CRM-1)/ exportin-1 (XPO-1)-mediated nuclear export may play a crucial role in this phenomenon. Here, we evaluated the effects of two Selective Inhibitor of Nuclear Export (SINE) compounds, selinexor (KPT-330) and KPT-251, in association with DTX by using 22rv1, PC3 and DU145 cell lines with their. DTX resistant derivatives. We show that DTX resistance may involve overexpression of β-III tubulin (TUBB3) and P-glycoprotein as well as increased cytoplasmic accumulation of Foxo3a. Increased levels of XPO-1 were also observed in DTX resistant cells suggesting that SINE compounds may modulate DTX effectiveness in sensitive cells as well as restore the sensitivity to DTX in resistant ones. Pretreatment with SINE compounds, indeed, sensitized to DTX through increased tumor shrinkage and apoptosis by preventing DTX-induced cell cycle arrest. Basally SINE compounds induce FOXO3a activation and nuclear accumulation increasing the expression of FOXO-responsive genes including p21, p27 and Bim causing cell cycle arrest. SINE compounds-catenin and survivin supporting apoptosis. βdown-regulated Cyclin D1, c-myc, Nuclear sequestration of p-Foxo3a was able to reduce ABCB1 and TUBB3 H2AX levels, prolonged γ expression. Selinexor treatment increased DTX-mediated double strand breaks (DSB), and reduced the levels of DNA repairing proteins including DNA PKc and Topo2A. Our results provide supportive evidence for the therapeutic use of SINE compounds in combination with DTX suggesting their clinical use in mCRPC patients.

  17. Molecular analysis of utility of a retrotransposon, p-SINE1-r2 in the Asian wild rice and weedy rice populations.

    Science.gov (United States)

    Prathepha, Preecha

    2009-02-01

    The distribution of a retrotransposon, p-SINE1-r2 located at the waxy locus was analyzed by the PCR assay in the perennial wild rice (Oryza rufipogon) which inhabited in four isolated and six disturbed populations and in the weedy rice population. The level of clonality of the wild rice species was determined in populations subject to level of water supply and another disturbance. The results showed that all four isolated populations carried the genotype (-/-) and (-/+), while three genotypes (-/-), (-/+) and (+/+) was found on the six populations which grown near by rice fields. This finding was strongly supported the idea that the original wild rice populations of O. rufipogon exhibited prominent genotype (-/-) and (-/+) and mainly propagated by vegetative reproduction and the allele (+) which found in the wild rice plant with the genotype (+/+) may originated from gene flow from cultivated rice to wild rice. Weedy rice accessions used in this study showed the three genotypes based on this DNA locus. The distribution of this DNA locus in wild rice and weedy rice populations were deviated from the Hardy-Weinberg equilibrium. The perennial wild rice populations were annually under season drought (March to May of the year in Thailand, Laos and Cambodia), they tended to have small size clones with relatively high clonal diversity (i.e., number of genotypes), except for the population from Cambodia, which carried only the genotype (-/+). Although DNA maker used to detect genetic variation at population levels is too small, but this locus is very sensitive enough to be a useful indicator for genetic variation at the population level.

  18. A comparison of 15 Hz sine on-line and off-line magnetic stimulation affecting the voltage-gated sodium channel currents of prefrontal cortex pyramidal neurons

    Science.gov (United States)

    Zheng, Yu; Dong, Lei; Gao, Yang; Dou, Jun-Rong; Li, Ze-yan

    2016-10-01

    Combined with the use of patch-clamp techniques, repetitive transcranial magnetic stimulation (rTMS) has proven to be a noninvasive neuromodulation tool that can inhibit or facilitate excitability of neurons after extensive research. The studies generally focused on the method: the neurons are first stimulated in an external standard magnetic exposure device, and then moved to the patch-clamp to record electrophysiological characteristics (off-line magnetic exposure). Despite its universality, real-time observation of the effects of magnetic stimulation on the neurons is more effective (on-line magnetic stimulation). In this study, we selected a standard exposure device for magnetic fields acting on mouse prefrontal cortex pyramidal neurons, and described a new method that a patch-clamp setup was modified to allow on-line magnetic stimulation. By comparing the off-line exposure and on-line stimulation of the same magnetic field intensity and frequency affecting the voltage-gated sodium channel currents, we succeeded in proving the feasibility of the new on-line stimulation device. We also demonstrated that the sodium channel currents of prefrontal cortex pyramidal neurons increased significantly under the 15 Hz sine 1 mT, and 2 mT off-line magnetic field exposure and under the 1 mT and 2 mT on-line magnetic stimulation, and the rate of acceleration was most significant on 2 mT on-line magnetic stimulation. This study described the development of a new on-line magnetic stimulator and successfully demonstrated its practicability for scientific stimulation of neurons.

  19. Preclinical activity of a novel CRM1 inhibitor in acute myeloid leukemia

    Science.gov (United States)

    Ranganathan, Parvathi; Yu, Xueyan; Na, Caroline; Santhanam, Ramasamy; Shacham, Sharon; Kauffman, Michael; Walker, Alison; Klisovic, Rebecca; Blum, William; Caligiuri, Michael; Croce, Carlo M.; Marcucci, Guido

    2012-01-01

    Chromosome maintenance protein 1 (CRM1) is a nuclear export receptor involved in the active transport of tumor suppressors (eg, p53 and nucleophosmin) whose function is altered in cancer because of increased expression and overactive transport. Blocking CRM1-mediated nuclear export of such proteins is a novel therapeutic strategy to restore tumor suppressor function. Orally bioavailable selective inhibitors of nuclear export (SINE) that irreversibly bind to CRM1 and block the function of this protein have been recently developed. Here we investigated the antileukemic activity of KPT-SINE (KPT-185 and KPT-276) in vitro and in vivo in acute myeloid leukemia (AML). KPT-185 displayed potent antiproliferative properties at submicromolar concentrations (IC50 values; 100-500nM), induced apoptosis (average 5-fold increase), cell-cycle arrest, and myeloid differentiation in AML cell lines and patient blasts. A strong down-regulation of the oncogene FLT3 after KPT treatment in both FLT3-ITD and wild-type cell lines was observed. Finally, using the FLT3-ITD–positive MV4-11 xenograft murine model, we show that treatment of mice with oral KPT-276 (analog of KPT-185 for in vivo studies) significantly prolongs survival of leukemic mice (P < .01). In summary, KPT-SINE are highly potent in vitro and in vivo in AML. The preclinical results reported here support clinical trials of KPT-SINE in AML. PMID:22677130

  20. Radioreklamen skal finde sine ben

    Directory of Open Access Journals (Sweden)

    Sigurd Bennike

    1989-08-01

    Full Text Available Den 1. august 1988 startede radioreklamerne i Danmark uden nævneværdig opmærksomhed fra hverken pressen eller medieforskerne. Annoncørerne, reklamebureauerne og de store radiostationer har haft lidt svært ved at finde hinanden. Og heller ikke nemt ved at finde ud af, hvem der skulle producere reklamerne og hvordan sådan nogle skal lyde på dansk. Som det indirekte fremgår af denne artikel, så er det svært at få tal ud af branchen. - Men et kvalificeret gæt lyder på, at der er omsat for mellem 20 og 40 millioner kroner på de første måneder, koncentreret på mindre end 50 af de 237 nærradiosendetilladelser. De radiostationer der vælger at sende reklamer, skal betale 10% af deres omsætning til en særlig radiofond, hvis midler deles ud til de græsrodsradioer, som ikke kan eller vil skaffe sig reklameindtægter.

  1. Skjemabasert eller fri samtale? Ein studie om barselkvinner sine erfaringar med å bruke The Edinburgh Postnatal Depression Scale (EPDS) i møtet med helsesøster

    OpenAIRE

    Andenes, Ellen

    2016-01-01

    Samandrag: Introduksjon: Psykiske vanskar er eit aukande samfunnsproblem. 10-15% av alle barselkvinner får symptom på barseldepresjon i større eller mindre grad. Nybakte mødre si psykiske helse er eit av mange tema i helsestasjonsarbeidet. Dei siste åra har over 200 av landet sine helsestasjonar teke i bruk the Edinburgh Postnatal Deppresion Scale (EPDS) for å førebygge og oppdage barseldepresjon. EPDS er eit spørjeskjema som kvinna skal fylle ut på 6-vekers konsultasjonen på h...

  2. Contrast sensitivity of deaf and hearing children for sine-wave gratings in mesopic conditions / Sensibilidade ao contraste de crianças surdas e ouvintes para grades senoidais em condições mesópicas

    Directory of Open Access Journals (Sweden)

    Natanael Antonio dos Santos

    2009-01-01

    Full Text Available The aim of this study was to compare the contrast sensitivity (CSF of deaf children and hearing children to spatial frequency of 0.25 to 2.0 cpd (cycles per degree of visual angle at mesopic luminance level (0.7 cd/m2, using the psychophysical forced-choice method. Twenty children (7-12 years old participated in this research, ten with prelingual deafness and ten with normal hearing. All participants had normal or corrected visual acuity. The ANOVA showed significant difference between the two groups [F(1, 238 = 15.487; p 0.05. The results suggest alterations in CSF to sine-wave gratings stimuli of deaf children at mesopic luminance level.

  3. Antileukemic activity of nuclear export inhibitors that spare normal hematopoietic cells.

    Science.gov (United States)

    Etchin, J; Sun, Q; Kentsis, A; Farmer, A; Zhang, Z C; Sanda, T; Mansour, M R; Barcelo, C; McCauley, D; Kauffman, M; Shacham, S; Christie, A L; Kung, A L; Rodig, S J; Chook, Y M; Look, A T

    2013-01-01

    Drugs that target the chief mediator of nuclear export, chromosome region maintenance 1 protein (CRM1) have potential as therapeutics for leukemia, but existing CRM1 inhibitors show variable potencies and a broad range of cytotoxic effects. Here, we report the structural analysis and antileukemic activity of a new generation of small-molecule inhibitors of CRM1. Designated selective inhibitors of nuclear export (SINE), these compounds were developed using molecular modeling to screen a small virtual library of compounds against the nuclear export signal (NES) groove of CRM1. The 2.2-Å crystal structure of the CRM1-Ran-RanBP1 complex bound to KPT-251, a representative molecule of this class of inhibitors, shows that the drug occupies part of the groove in CRM1 that is usually occupied by the NES, but penetrates much deeper into the groove and blocks CRM1-directed protein export. SINE inhibitors exhibit potent antileukemic activity, inducing apoptosis at nanomolar concentrations in a panel of 14 human acute myeloid leukemia (AML) cell lines representing different molecular subtypes of the disease. When administered orally to immunodeficient mice engrafted with human AML cells, KPT-251 had potent antileukemic activity with negligible toxicity to normal hematopoietic cells. Thus, KPT-SINE CRM1 antagonists represent a novel class of drugs that warrant further testing in AML patients.

  4. A versatile, highly-efficient, high-resolution von Hamos Bragg crystal x-ray spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Vane, C.R.; Smith, M.S.; Raman, S.

    1988-01-01

    An efficient, high-resolution, vertical-focusing, Bragg crystal x-ray spectrometer has been specifically designed and constructed for use in measurements of x rays produced in collisions of energetic heavy ions. In this report the design and resulting operational characteristics of the final instrument are fully described. A wide variety of sample data is also included to illustrate the utility of this device in several areas of research. 14 refs., 38 figs.

  5. Synergistic Myeloma Cell Death via Novel Intracellular Activation of Caspase-10-Dependent Apoptosis by Carfilzomib and Selinexor.

    Science.gov (United States)

    Rosebeck, Shaun; Alonge, Mattina M; Kandarpa, Malathi; Mayampurath, Anoop; Volchenboum, Samuel L; Jasielec, Jagoda; Dytfeld, Dominik; Maxwell, Sean P; Kraftson, Stephanie J; McCauley, Dilara; Shacham, Sharon; Kauffman, Michael; Jakubowiak, Andrzej J

    2016-01-01

    Exportin1 (XPO1; also known as chromosome maintenance region 1, or CRM1) controls nucleo-cytoplasmic transport of most tumor suppressors and is overexpressed in many cancers, including multiple myeloma, functionally impairing tumor suppressive function via target mislocalization. Selective inhibitor of nuclear export (SINE) compounds block XPO1-mediated nuclear escape by disrupting cargo protein binding, leading to retention of tumor suppressors, induction of cancer cell death, and sensitization to other drugs. Combined treatment with the clinical stage SINE compound selinexor and the irreversible proteasome inhibitor (PI) carfilzomib induced synergistic cell death of myeloma cell lines and primary plasma cells derived from relapsing/refractory myeloma patients and completely impaired the growth of myeloma cell line-derived tumors in mice. Investigating the details of SINE/PI-induced cell death revealed (i) reduced Bcl-2 expression and cleavage and inactivation of Akt, two prosurvival regulators of apoptosis and autophagy; (ii) intracellular membrane-associated aggregation of active caspases, which depended on caspase-10 protease activity; and (iii) novel association of caspase-10 and autophagy-associated proteins p62 and LC3 II, which may prime activation of the caspase cascade. Overall, our findings provide novel mechanistic rationale behind the potent cell death induced by combining selinexor with carfilzomib and support their use in the treatment of relapsed/refractory myeloma and potentially other cancers. ©2015 American Association for Cancer Research.

  6. Invited Commentary: Gene × Lifestyle Interactions and Complex Disease Traits—Inferring Cause and Effect From Observational Data, Sine Qua Non

    OpenAIRE

    Franks, Paul W.; Nettleton, Jennifer A.

    2010-01-01

    Observational epidemiology has made outstanding contributions to the discovery and elucidation of relations between lifestyle factors and common complex diseases such as type 2 diabetes. Recent major advances in the understanding of the human genetics of this disease have inspired studies that seek to determine whether the risk conveyed by bona fide risk loci might be modified by lifestyle factors such as diet composition and physical activity levels. A major challenge is to determine which o...

  7. sines et asphaltènes : évolution en fonction des types de matière organique et de leur enfouissement Resins and Asphaltenes: Evolution As a Function of Organic-Matter Type and Burial

    Directory of Open Access Journals (Sweden)

    Castex H.

    2006-11-01

    Full Text Available 151 résines et 175 asphaltènes d'extraits de roche de plusieurs bassins ont été étudiés par analyse élémentaire. On montre que : - les résines ont des valeurs moyennes en carbone et en hydrogène plus élevées ainsi qu'un rapport C/H plus faible que celui des asphaltènes; elles présentent donc une structure plus aliphatique et/ou plus alicyclique. Par contre, les asphaltènes contiennent plus de soufre, d'oxygène et d'azote ; - le soufre et l'oxygène sont des paramètres permettant de différencier des bassins ; - différents types de matière organique sont mis en évidence sur un diagramme H/C, O/C ; leur évolution chimique avec l'enfouissement est caractérisée par une décroissance des teneurs en hydrogène, oxygène et soufre. La résonance magnétique nucléaire du proton et la spectroscopie infrarouge ont été utilisées pour suivre l'évolution structurale des résines et asphaltènes provenant de différents types de matière organique (algaire, marine et terrestre enfouie à des profondeurs croissantes. La résonance magnétique nucléaire permet de calculer plusieurs paramètres structuraux tels que l'aromaticité FA et le degré de substitution sigma du système aromatique. Le facteur FA semble augmenter en fonction de l'enfouissement et du type de matière organique tandis que sigma semble décroître. La spectroscopie infrarouge compléte ces informations. Les surfaces de bandes correspondant aux fonctions suivantes ont été calculées : - OH dans la région 3700-2700 cm-1 - C=O carbonyl vers 1700 cm-1 - C-H aliphatiques à 2900, 1455 et 1380 cm-1 - C=C aromatique à 1610 cm-1. Les variations d'intensité des bandes : - décroissance des C-H aliphatiques, des fonctions C=O ; - augmentation des C-H et C=C aromatiques sont en relation d'une part avec le type de matière organique, d'autre part avec sa catagénèse. Elemental analysis was used to investigate 151 resins and 175 asphaltenes extracted from rocks from

  8. Disease activity in and quality of life of patients with psoriatic arthritis mutilans

    DEFF Research Database (Denmark)

    Lindqvist, U; Gudbjornsson, B; Iversen, L

    2017-01-01

    -assessed disease activity, and patient’s education and work status were recorded. Data from the 36-item Short Form Health Survey, Health Assessment Questionnaire and Dermatology Life Quality Index questionnaire were gathered and correlated with disease duration, pain, and general well-being (visual analogue scale......). The controls were 58 Swedish patients with long-standing psoriatic arthritis sine PAM. Results: Sixty-seven patients were included. Patients with PAM had a protracted disease history (33 ± 14 years) and disease onset at a relatively early age (30 ± 12 years). Overall inflammatory activity at inclusion was mild...

  9. The Second-Generation Exportin-1 Inhibitor KPT-8602 Demonstrates Potent Activity against Acute Lymphoblastic Leukemia.

    Science.gov (United States)

    Vercruysse, Thomas; De Bie, Jolien; Neggers, Jasper E; Jacquemyn, Maarten; Vanstreels, Els; Schmid-Burgk, Jonathan L; Hornung, Veit; Baloglu, Erkan; Landesman, Yosef; Senapedis, William; Shacham, Sharon; Dagklis, Antonis; Cools, Jan; Daelemans, Dirk

    2017-05-15

    Purpose: Human exportin-1 (XPO1) is the key nuclear-cytoplasmic transport protein that exports different cargo proteins out of the nucleus. Inducing nuclear accumulation of these proteins by inhibiting XPO1 causes cancer cell death. First clinical validation of pharmacological inhibition of XPO1 was obtained with the Selective Inhibitor of Nuclear Export (SINE) compound selinexor (KPT-330) demonstrating activity in phase-II/IIb clinical trials when dosed 1 to 3 times weekly. The second-generation SINE compound KPT-8602 shows improved tolerability and can be dosed daily. Here, we investigate and validate the drug-target interaction of KPT-8602 and explore its activity against acute lymphoblastic leukemia (ALL).Experimental Design: We examined the effect of KPT-8602 on XPO1 function and XPO1-cargo as well as on a panel of leukemia cell lines. Mutant XPO1 leukemia cells were designed to validate KPT-8602's drug-target interaction. In vivo, anti-ALL activity was measured in a mouse ALL model and patient-derived ALL xenograft models.Results: KPT-8602 induced caspase-dependent apoptosis in a panel of leukemic cell lines in vitro Using CRISPR/Cas9 genome editing, we demonstrated the specificity of KPT-8602 for cysteine 528 in the cargo-binding groove of XPO1 and validated the drug target interaction. In vivo, KPT-8602 showed potent anti-leukemia activity in a mouse ALL model as well as in patient-derived T- and B-ALL xenograft models without affecting normal hematopoiesis.Conclusions: KPT-8602 is highly specific for XPO1 inhibition and demonstrates potent anti-leukemic activity supporting clinical application of the second-generation SINE compound for the treatment of ALL. Clin Cancer Res; 23(10); 2528-41. ©2016 AACR. ©2016 American Association for Cancer Research.

  10. SINE CULPA? VATICAN II AND INCULPABLE IGNORANCE

    National Research Council Canada - National Science Library

    Stephen Bullivant

    2011-01-01

    ...] of the Gospel of Christ and his Church. " This article examines (1) Vatican II's understanding of such "inculpable ignorance" and its relationship to the traditional concept "invincible ignorance" and (2...

  11. [Molecular variability in the commom shrew Sorex araneus L. from European Russia and Siberia inferred from the length polymorphism of DNA regions flanked by short interspersed elements (Inter-SINE PCR) and the relationships between the Moscow and Seliger chromosome races].

    Science.gov (United States)

    Bannikova, A A; Bulatova, N Sh; Kramerov, D A

    2006-06-01

    Genetic exchange among chromosomal races of the common shrew Sorex araneus and the problem of reproductive barriers have been extensively studied by means of such molecular markers as mtDNA, microsatellites, and allozymes. In the present study, the interpopulation and interracial polymorphism in the common shrew was derived, using fingerprints generated by amplified DNA regions flanked by short interspersed repeats (SINEs)-interSINE PCR (IS-PCR). We used primers, complementary to consensus sequences of two short retroposons: mammalian element MIR and the SOR element from the genome of Sorex araneus. Genetic differentiation among eleven populations of the common shrew from eight chromosome races was estimated. The NP and MJ analyses, as well as multidimensional scaling showed that all samples examined grouped into two main clusters, corresponding to European Russia and Siberia. The bootstrap support of the European Russia cluster in the NJ and MP analyses was respectively 76 and 61%. The bootstrap index for the Siberian cluster was 100% in both analyses; the Tomsk race, included into this cluster, was separated with the bootstrap support of NJ/MP 92/95%.

  12. sines époxy réticulées par des polyamines : structure et propriétés Epoxy Resins Crosslinked with Polyamines: Structure and Properties

    Directory of Open Access Journals (Sweden)

    Barrere C.

    2006-12-01

    Full Text Available Cet article fait le point sur l'état actuel des connaissances concernant les résines époxy réticulées par des polyamines, et plus particulièrement sur : - la réticulation ; - la structure et la morphologie des systèmes réticulés et les paramètres qui les influencent; - les relations entre la structure et les propriétés sur une très large gamme de températures. Malgré les nombreuses études réalisées, beaucoup de points apparaissent encore controversés, notamment en ce qui concerne les relations structure/propriétés dans le domaine des températures d'utilisation, c'est-à-dire entre la transition secondaire ß et la transition alpha (transition vitreuse. S'il est maintenant admis que le module à l'état vitreux est gouverné par l'importance des mouvements des séquences hydroxypropyléther formées lors de la réticulation, les résultats concernant les propriétés mécaniques aux grandes déformations (allongement et contrainte à rupture, énergie de propagation de fissures sont beaucoup plus discutés. Les tendances obtenues semblent dépendre de la manière utilisée pour faire varier la densité de réticulation (cuisson, proportions du mélange, extenseurs de mailles, prépolymères de différentes longueurs, etc. , du système ou encore de l'auteur. Les désaccords entre chercheurs pourraient provenir des conditions de préparation des échantillons, notamment de la vitesse de refroidissement en fin de cuisson et des conditions dans lesquelles sont réalisés les essais mécaniques, comme la vitesse de déformation. This paper sums up the current state-of-the-art on epoxy resins crosslinked with polyamines, and more particularly on:- the crosslinking reactions;- the structure and morphology of crosslinked systems and the parameters that influence them;- the relationships between structure and properties over a wide range of temperatures. In spite of numerous studies devoted to these polymers, many points remain

  13. The minimal active human SVA retrotransposon requires only the 5'-hexamer and Alu-like domains.

    Science.gov (United States)

    Hancks, Dustin C; Mandal, Prabhat K; Cheung, Ling E; Kazazian, Haig H

    2012-11-01

    RNA-based duplication mediated by reverse transcriptase (RT), a process termed retrotransposition, is ongoing in humans and is a source of significant inter- and perhaps intraindividual genomic variation. The long interspersed element 1 (LINE-1 or L1) ORF2 protein is the genomic source for RT activity required for mobilization of its own RNA in cis and other RNAs, such as SINE/variable-number tandem-repeat (VNTR)/Alu (SVA) elements, in trans. SVA elements are ~2-kb hominid-specific noncoding RNAs that have resulted in single-gene disease in humans through insertional mutagenesis or aberrant mRNA splicing. Here, using an SVA retrotransposition cell culture assay in U2OS cells, we investigated SVA domains important in L1-mediated SVA retrotransposition. Partial- and whole-domain deletions revealed that removal of either the Alu-like or SINE-R domain in the context of a full-length SVA has little to no effect, whereas removal of the CT hexamer or the VNTR domain can result in a 75% decrease in activity. Additional experiments demonstrate that the Alu-like fragment alone can retrotranspose at low levels while the addition of the CT hexamer can enhance activity as much as 2-fold compared to that of the full-length SVA. These results suggest that no SVA domain is essential for retrotransposition in U2OS cells and that the 5' end of SVA (hexamer and Alu-like domain) is sufficient for retrotransposition.

  14. Amélioration de la dispersion des nanotubes de carbone dans une résine époxyde à l'aide de copolymères à bloc = Improvement of the dispersion of carbon nanotube in epoxy resin using block copolymers

    OpenAIRE

    Courbaron, Anne-Claude; Derail, Christophe; Billon, Laurent; Péré, Eve; El Bounia, Nour-Eddine

    2009-01-01

    National audience; Avec un module de Young proche du TPa, les nanotubes de carbone (NTC) semblent des charges idéales pour l'amélioration des propriétés mécaniques d'une résine époxyde. Cependant, une bonne dispersion des nanotubes dans la matrice ne suffit pas à obtenir une augmentation des propriétés mécaniques. La nature de l'interface nanotube-matrice doit être modifiée pour assurer une bonne adhésion entre les deux composants. Pour cela, des copolymères à bloc « polyacide acrylique - pol...

  15. Adsorption de l'eau dissoute dans les mélanges supercarburant-alcools en vue de leur stabilisation. Comparaison entre adsorbants classiques et résines échangeuses d'ions Adsorption of Dissolved Water in Premium-Fuel/Alcohol Blends with a View to Their Stabilization. Comparison Between Conventional Adsorbents and Ion-Exchange Resins

    Directory of Open Access Journals (Sweden)

    Bernasconi C.

    2006-11-01

    Full Text Available Une réponse possible au problème de la déstabilisation par démixtion des mélanges supercarburant-alcools est l'abaissement de leur teneur en eau par adsorption physique. La forte affinité pour l'eau des résines échangeuses d'ions de type polystyrène sulfonate permet d'envisager leur utilisation dans ce cas spécifique d'application. Le principal intérêt de ce nouveau matériau adsorbant est de pouvoir se régénérer avec des calories de bas niveau (100-120°C. Nous avons donc étudié, du point de vue capacité d'adsorption et cinétique d'adsorption, le comportement de cet adsorbant et comparé ses performances à celles d'adsorbants plus classiques tels que le silicagel, l'alumine et le tamis moléculaire 3 Å. Les formes ioniques de la résine mises en oeuvre sont les formes : K+, Na+ et Mg2+. Sur le plan de la capacité totale d'adsorption, la résine, quelle que soit sa forme ionique, présente des performances supérieures à celles de l'alumine et du silicagel. Seule la forme Mg2+ adsorbe autant d'eau que le tamis moléculaire. L'efficacité de la résine est sensible à la nature de l'alcool du mélange considéré et augmente selon la séquence méthanol A possible answer to the problem of destabilization by the segregation of premium-fuel/alcohol blends lies in decreasing their water content by physical adsorption. The strong affinity of water for ion-exchange resins of the polystyrene sulfonate type suggests their use for this specific application. The main advantage of this newadsorbent material is that it can be regenerated with low-level heat (100-120°C. We thus investigated the behavior of this adsorbent from the standpoint of its adsorption capacity and adsorption kinetics. Its performances were compared to those of more conventional adsorbents, such as silicagel, alumina and a 3Å molecular sieve. The ionic forms of the resin used are in the form of K+, Na+ and Mg2+. From the standpoint of total adsorption capacity

  16. XPO1 (CRM1) inhibition represses STAT3 activation to drive a survivin-dependent oncogenic switch in triple negative breast cancer

    Science.gov (United States)

    Cheng, Yan; Holloway, Michael P; Nguyen, Kevin; McCauley, Dilara; Landesman, Yosef; Kauffman, Michael G; Shacham, Sharon; Altura, Rachel A

    2014-01-01

    Inhibition of XPO1 (CRM1)-mediated nuclear export of multiple tumor suppressor proteins has been proposed as a novel cancer therapeutic strategy to turn off oncogenic signals and enhance tumor suppression. Survivin is a multifunctional protein with oncogenic properties when expressed in the cytoplasm that requires the XPO1-RanGTP complex for its nuclear export. We investigated the anti-tumor mechanisms of the drug-like selective inhibitors of nuclear export (SINE) XPO1 antagonists, KPT-185, KPT-251 KPT-276, and KPT-330 in estrogen-receptor positive and triple negative breast cancer (TNBC) cell lines and xenograft models of human breast tumors. KPT compounds significantly inhibited breast cancer cell growth and induced tumor cell death, both in vitro and in vivo. These drugs initially promoted survivin accumulation within tumor cell nuclei. However, their major in vitro effect was to decrease survivin cytoplasmic protein levels, correlating with the onset of apoptosis. XPO1 inhibition repressed Survivin transcription by inhibiting CBP-mediated STAT3 acetylation, and blocking STAT3 binding to the Survivin promoter. Additionally, caspase-3 was activated to cleave survivin, rendering it unavailable to bind XIAP and block the caspase cascade. Collectively, these data demonstrate that XPO1 inhibition by SINE compounds represses STAT3 transactivation to block the selective oncogenic properties of survivin and supports their clinical use in triple negative breast tumors. PMID:24431073

  17. Material and physical model for evaluation of deep brain activity contribution to EEG recordings

    Science.gov (United States)

    Ye, Yan; Li, Xiaoping; Wu, Tiecheng; Li, Zhe; Xie, Wenwen

    2015-12-01

    Deep brain activity is conventionally recorded with surgical implantation of electrodes. During the neurosurgery, brain tissue damage and the consequent side effects to patients are inevitably incurred. In order to eliminate undesired risks, we propose that deep brain activity should be measured using the noninvasive scalp electroencephalography (EEG) technique. However, the deeper the neuronal activity is located, the noisier the corresponding scalp EEG signals are. Thus, the present study aims to evaluate whether deep brain activity could be observed from EEG recordings. In the experiment, a three-layer cylindrical head model was constructed to mimic a human head. A single dipole source (sine wave, 10 Hz, altering amplitudes) was embedded inside the model to simulate neuronal activity. When the dipole source was activated, surface potential was measured via electrodes attached on the top surface of the model and raw data were recorded for signal analysis. Results show that the dipole source activity positioned at 66 mm depth in the model, equivalent to the depth of deep brain structures, is clearly observed from surface potential recordings. Therefore, it is highly possible that deep brain activity could be observed from EEG recordings and deep brain activity could be measured using the noninvasive scalp EEG technique.

  18. Perturbation analysis of a parametrically changed sine-Gordon equation

    DEFF Research Database (Denmark)

    Sakai, S.; Samuelsen, Mogens Rugholm; Olsen, O. H.

    1987-01-01

    with soliton size, transmission or reflection of the soliton is described using a simple energy analysis. Next, the soliton propagation is solved on the basis of a perturbation theory constructed by McLaughlin and Scott. Radiation as well as soliton trajectories are presented numerically. Agreement between...... such solutions and the results of direct numerical integration by means of a finite-difference method is excellent....

  19. Nonlinear dynamics of a parametrically driven sine-Gordon system

    DEFF Research Database (Denmark)

    Grønbech-Jensen, Niels; Kivshar, Yuri S.; Samuelsen, Mogens Rugholm

    1993-01-01

    . For an arbitrary frequency of the applied field the threshold field for the breather stabilization is determined by a perturbation method and it is compared to direct numerical simulations. We also analyze the variation of the breather parameters in the stationary regime and calculate the frequency...

  20. ENVIRONMENTAL EDUCATION: A SINE-QUA-NON FOR ...

    African Journals Online (AJOL)

    JONATHAN

    Inferential and descriptive statistics ... homeless. Bosah (2013) documents about Millennium Ecosystem Assessment (2005) pointing to a factor of 400-800% increase in waste water loading within the next four decades over ... Natural Resources (ICUN) state that environmental education is a must as conservation of nature.

  1. Statistical dynamics of parametrically perturbed sine-square map

    Indian Academy of Sciences (India)

    For this purpose, a hybrid optical bistable system, which is a nonlinear ... In general, the perturbation techniques employed in recent times have shown both constructive and destructive impacts on ... report that the transition from conventional period doubling scenario to completely chaotic scenario are intervened by a few ...

  2. Quantitative Reasoning and the Sine Function: The Case of Zac

    Science.gov (United States)

    Moore, Kevin C.

    2014-01-01

    A growing body of literature has identified quantitative and covariational reasoning as critical for secondary and undergraduate student learning, particularly for topics that require students to make sense of relationships between quantities. The present study extends this body of literature by characterizing an undergraduate precalculus…

  3. Rockets and spacecraft: Sine qua non of space science

    Science.gov (United States)

    1980-01-01

    The evolution of the national launch vehicle stable is presented along with lists of launch vehicles used in NASA programs. A partial list of spacecraft used throughout the world is also given. Scientific spacecraft costs are presented along with an historial overview of project development and funding in NASA.

  4. Radial sine-Gordon kinks as sources of fast breathers

    DEFF Research Database (Denmark)

    Caputo, Jean Guy; Sørensen, Mads Peter

    2013-01-01

    all outgoing radiation. As the kink shrinks toward r, before the collision, its motion is well described by a simple law derived from the conservation of energy. In two dimensions for r ≤ 2, the collision disintegrates the kink into a fast breather, while for r ≥ 4 we obtain a kink-breather metastable...

  5. Sine-wave three phase resonance inverter for operation of ...

    African Journals Online (AJOL)

    naeema

    greenhouse gases (Gh Gs) and global climate change have ... paper, a new three phase voltage source inverter (VSI) has been proposed, in ... out of phase by . As a matter of fact, the relationship with. & can be rewrite, just by changing to . Finally, the voltage gain, for the boost inverter, can be derived as follows. ) 1(. 1. 2. 1.

  6. Government Expenditure in Nigeria: A Sine Qua Non for Economic ...

    African Journals Online (AJOL)

    This paper analyzes the implications of government spending on the growth of Nigeria economy over the period 1980 – 2009. Using Johansen Cointegration, unit root test and error correction model, it was discovered that total capital expenditure, inflation rate, degree of openness and current government revenue are ...

  7. Statistical dynamics of parametrically perturbed sine-square map

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 75; Issue 3. Statistical ... Keywords. Transient; critical attractor; power-law; scaling exponent; weak and strong chaos; probability distribution. ... We show that the emergence of new attractors is responsible for transients in many trajectories obeying power-law decay.

  8. Sine-wave three phase resonance inverter for operation of ...

    African Journals Online (AJOL)

    This paper proposes a high performance single-stage three phase inverter topology for the autonomous operation of renewable energy systems. The proposed configuration can boost the low voltage of renewable energy systems such as photo voltaic systems, fuel cells, and etc can also convert the output dc power, into ...

  9. Sine ars scientia nihil est: Leonardo da Vinci and beyond.

    Science.gov (United States)

    Kickhöfel, Eduardo H P

    2009-01-01

    The aim of this article is to reflect on the relationship between art and science so far as it concerns a symposium on neurosciences. We undertake a historical overview of that relationship, paying particular attention to the sui generis case of Leonardo da Vinci, who very often is regarded as the man who worked on art and science with equal ease. We then explain why his idea of merging these two forms of knowledge failed, considering the clear-cut distinction between art and science in his time. With this clarification, we explore the matter today. We look at Raphael's The Transfiguration, in which the representation of the possessed boy is seen by neuroscientists as indicative of an epileptic seizure. We also look at the ideas of neuroscientists Semir Zeki and Vilayanur Ramachandran, who study particular aspects of brain function and suggest a new merging of art and science.

  10. Nicanor Abelardo: Tagapagbunsod ng Modernismo sa Sining Musika sa Pilipinas

    Directory of Open Access Journals (Sweden)

    Ramon P. Santos

    2001-12-01

    Full Text Available The twentieth century has borne witness to some of the great changes in the musical art of Europe and the West. The historical events of the past century in economics and education, the speedy spread of intellectualization and the achievements in science all contributed to the creation of new perspectives in culture and the arts. These perspectives, which were reactions to the aesthetics of the time and to the accepted styles of expression, led to a major movement called "modernism." The various directions and views which formed the major characteristics of modernism in music came together under the aegis of freedom, freedom from the old ways. This freedom was seen as a departure from emotion and sentimentalism as well as emancipation from the long imprisonment in the system of tonal harmony, which in turn suppressed emotional breadth and human thought. While studying in America, Nicanor Abelardo embraced contemporary philosophy and techniques. This brought about a modern quality to his works during his last years. This article is an initial study of this rapid and dramatic metamorphosis in the art of NIcanor Abelardo.

  11. The Minimal Active Human SVA Retrotransposon Requires Only the 5′-Hexamer and Alu-Like Domains

    Science.gov (United States)

    Hancks, Dustin C.; Mandal, Prabhat K.; Cheung, Ling E.

    2012-01-01

    RNA-based duplication mediated by reverse transcriptase (RT), a process termed retrotransposition, is ongoing in humans and is a source of significant inter- and perhaps intraindividual genomic variation. The long interspersed element 1 (LINE-1 or L1) ORF2 protein is the genomic source for RT activity required for mobilization of its own RNA in cis and other RNAs, such as SINE/variable-number tandem-repeat (VNTR)/Alu (SVA) elements, in trans. SVA elements are ∼2-kb hominid-specific noncoding RNAs that have resulted in single-gene disease in humans through insertional mutagenesis or aberrant mRNA splicing. Here, using an SVA retrotransposition cell culture assay in U2OS cells, we investigated SVA domains important in L1-mediated SVA retrotransposition. Partial- and whole-domain deletions revealed that removal of either the Alu-like or SINE-R domain in the context of a full-length SVA has little to no effect, whereas removal of the CT hexamer or the VNTR domain can result in a 75% decrease in activity. Additional experiments demonstrate that the Alu-like fragment alone can retrotranspose at low levels while the addition of the CT hexamer can enhance activity as much as 2-fold compared to that of the full-length SVA. These results suggest that no SVA domain is essential for retrotransposition in U2OS cells and that the 5′ end of SVA (hexamer and Alu-like domain) is sufficient for retrotransposition. PMID:23007156

  12. Active Control Does Not Eliminate Motion-Induced Illusory Displacement

    Directory of Open Access Journals (Sweden)

    Ian M. Thornton

    2011-05-01

    Full Text Available When the sine-wave grating of a Gabor patch drifts to the left or right, the perceived position of the entire object is shifted in the direction of local motion. In the current work we explored whether active control of the physical position of the patch overcomes such motion induced illusory displacement. In Experiment 1 we created a simple computer game and asked participants to continuously guide a Gabor patch along a randomly curving path using a joystick. When the grating inside the Gabor patch was stationary, participants could perform this task without error. When the grating drifted to either left or right, we observed systematic errors consistent with previous reports of motion-induced illusory displacement. In Experiment 2 we created an iPad application where the built-in accelerometer tilt control was used to steer the patch through as series of “gates”. Again, we observed systematic guidance errors that depended on the direction and speed of local motion. In conclusion, we found no evidence that participants could adapt or compensate for illusory displacement given active control of the target.

  13. Comparison of Excitation Signals in Active Magnetic Bearing System Identification

    Directory of Open Access Journals (Sweden)

    Jouni Vuojolainen

    2017-07-01

    Full Text Available Active magnetic bearings (AMBs offer frictionless suspension, vibration insulation, programmable stiffness, and damping, among other advantages, in levitated rotor applications. However, AMBs are inherently unstable and require accurate system models for the high-performance model-based multi-input multi-output control of rotor position. Control electronics with high calculation capacity and accurate sensors of AMBs provide an opportunity to implement various identification schemes. A variety of artificial excitation signal-based identification methods can thus be achieved with no additional hardware. In this paper, a selection of excitation signals, namely the pseudorandom binary sequence (PRBS, chirp signal, multisine, and stepped sine are presented, applied, and compared with the AMB system identification. From the identification experiments, the rotor-bearing system, the inner current control loop, and values of position and current stiffness are identified. Unlike recently published works considering excitation-based identification of AMB rotor systems, it is demonstrated that identification of the rotor system dynamics can be carried out using various well-established excitation signals. Application and feasibility of these excitation signals in AMB rotor systems are analyzed based on experimental results.

  14. Multi-Objective Sliding Mode Control on Vehicle Cornering Stability with Variable Gear Ratio Actuator-Based Active Front Steering Systems

    Directory of Open Access Journals (Sweden)

    Xinbo Ma

    2016-12-01

    Full Text Available Active front steering (AFS is an emerging technology to improve the vehicle cornering stability by introducing an additional small steering angle to the driver’s input. This paper proposes an AFS system with a variable gear ratio steering (VGRS actuator which is controlled by using the sliding mode control (SMC strategy to improve the cornering stability of vehicles. In the design of an AFS system, different sensors are considered to measure the vehicle state, and the mechanism of the AFS system is also modelled in detail. Moreover, in order to improve the cornering stability of vehicles, two dependent objectives, namely sideslip angle and yaw rate, are considered together in the design of SMC strategy. By evaluating the cornering performance, Sine with Dwell and accident avoidance tests are conducted, and the simulation results indicate that the proposed SMC strategy is capable of improving the cornering stability of vehicles in practice.

  15. Anti-tumor activity of selective inhibitors of XPO1/CRM1-mediated nuclear export in diffuse malignant peritoneal mesothelioma: the role of survivin

    Science.gov (United States)

    Doldi, Valentina; Lopergolo, Alessia; Deraco, Marcello; Gandellini, Paolo; Friedlander, Sharon; Landesman, Yosef; Kauffman, Michael G.; Shacham, Sharon

    2015-01-01

    Survivin, which is highly expressed and promotes cell survival in diffuse malignant peritoneal mesothelioma (DMPM), exclusively relies on exportin 1 (XPO1/CRM1) to be shuttled into the cytoplasm and perform its anti-apoptotic function. Here, we explored the efficacy of Selective Inhibitors of Nuclear Export (SINE), KPT-251, KPT-276 and the orally available, clinical stage KPT-330 (selinexor), in DMPM preclinical models. Exposure to SINE induced dose-dependent inhibition of cell growth, cell cycle arrest at G1-phase and caspase-dependent apoptosis, which were consequent to a decrease of XPO1/CRM1 protein levels and the concomitant nuclear accumulation of its cargo proteins p53 and CDKN1a. Cell exposure to SINE led to a time-dependent reduction of cytoplasmic survivin levels. In addition, after an initial accumulation, the nuclear protein abundance progressively decreased, as a consequence of an enhanced ubiquitination and proteasome-dependent degradation. SINE and the survivin inhibitor YM155 synergistically cooperated in reducing DMPM cell proliferation. Most importantly, orally administered SINE caused a significant anti-tumor effect in subcutaneous and orthotopic DMPM xenografts without appreciable toxicity. Overall, we have demonstrated a marked efficacy of SINE in DMPM preclinical models that may relay on the interference with survivin intracellular distribution and function. Our study suggests SINE-mediated XPO1/CRM1 inhibition as a novel therapeutic option for DMPM. PMID:25948791

  16. Get Active

    Science.gov (United States)

    ... try getting active more often. What kinds of activity should I do? To get all the health ... Health Benefits What are the benefits of physical activity? Physical activity increases your chances of living longer. ...

  17. Active Control of Separation From the Flap of a Supercritical Airfoil

    Science.gov (United States)

    Melton, LaTunia Pack; Yao, Chung-Sheng; Seifert, Avi

    2006-01-01

    Zero-mass-flux periodic excitation was applied at several regions on a simplified high-lift system to delay the occurrence of flow separation. The NASA Energy Efficient Transport (EET) supercritical airfoil was equipped with a 15% chord simply hinged leading edge flap and a 25% chord simply hinged trailing edge flap. Detailed flow features were measured in an attempt to identify optimal actuator placement. The measurements included steady and unsteady model and tunnel wall pressures, wake surveys, arrays of surface hot-films, flow visualization, and particle image velocimetry (PIV). The current paper describes the application of active separation control at several locations on the deflected trailing edge flap. High frequency (F(+) approximately equal to 10) and low frequency amplitude modulation (F(+) sub AM approximately equal to 1) of the high frequency excitation were used for control. It was noted that the same performance gains were obtained with amplitude modulation and required only 30% of the momentum input required by pure sine excitation.

  18. A novel web-based TinT application and the chronology of the Primate Alu retroposon activity

    Directory of Open Access Journals (Sweden)

    Makałowski Wojciech

    2010-12-01

    Full Text Available Abstract Background DNA sequences afford access to the evolutionary pathways of life. Particularly mobile elements that constantly co-evolve in genomes encrypt recent and ancient information of their host's history. In mammals there is an extraordinarily abundant activity of mobile elements that occurs in a dynamic succession of active families, subfamilies, types, and subtypes of retroposed elements. The high frequency of retroposons in mammals implies that, by chance, such elements also insert into each other. While inactive elements are no longer able to retropose, active elements retropose by chance into other active and inactive elements. Thousands of such directional, element-in-element insertions are found in present-day genomes. To help analyze these events, we developed a computational algorithm (Transpositions in Transpositions, or TinT that examines the different frequencies of nested transpositions and reconstructs the chronological order of retroposon activities. Results By examining the different frequencies of such nested transpositions, the TinT application reconstructs the chronological order of retroposon activities. We use such activity patterns as a comparative tool to (1 delineate the historical rise and fall of retroposons and their relations to each other, (2 understand the retroposon-induced complexity of recent genomes, and (3 find selective informative homoplasy-free markers of phylogeny. The efficiency of the new application is demonstrated by applying it to dimeric Alu Short INterspersed Elements (SINE to derive a complete chronology of such elements in primates. Conclusion The user-friendly, web-based TinT interface presented here affords an easy, automated screening for nested transpositions from genome assemblies or trace data, assembles them in a frequency-matrix, and schematically displays their chronological activity history.

  19. Condiciones laborales de la profesión: ¿Precariedad laboral o conditio sine qua non? (Working conditions: precariousness or a sine qua non situation?

    Directory of Open Access Journals (Sweden)

    Paula Francisca Vidal Molina

    2009-01-01

    Full Text Available Resumo: Las condiciones laborales en que se desempeñan las profesiones em general han sufrido mutaciones. Ello ha afectado también a la profesión del Trabajo Social Chileno. Este estudio, cuya metodología priorizó una mirada cuantitativa, devela algunos de los cambios sufridos a nivel de las formas de contrato, el espacio profesional, La pluriempleabilidad y los salarios, visibilizando así una situación de creciente precarización laboral. El refl exionar acerca de esos cambios ayudará a identificar tensiones de la práctica y los desafíos para la profesión en relación AL momento actual en que Estado y modelo económico se entrelazan.Abstract: Professionals´ working conditions have changed in general. These changes have also affected social work in Chile. This study was carried out according to a quantitative methodology and it reveals some of the changes the professions went through, for example, forms of contract, professional space and wages. All these factors contribute to an increasing precarious situation. Reflection about the changes will help identify the tensions in practice and the challenges to the profession in a stage in which the State and the economic model are interwoven.

  20. Behavioral and cognitive effects produced by electrical stimulation in the medial prefrontal cortex: an experimental model for high cortical activation.

    Science.gov (United States)

    Penna, A M; Lee, S Y; Scheidegger da Silva, L; Oliveira, R W; de Freitas Gomes, C; Nakamura-PalaciosEM

    1998-11-01

    An electrical stimulation (ES) session with ten 30-second trains of sine-wave stimuli (30-100 microA, 60 Hz) separated by 30-second intervals was conducted daily in rats with electrodes implanted in the left or right or in both sides of the medial prefrontal cortex (PFC; B = + 2 mmA, + or -0.6 unilateral or 1 mmL bilateral, + 2.7 mmV). The unilateral and bilateral ES in the medial PFC produced abnormal behaviors such as circling spying, body stretching and immobility, and did not affect either the acquisition or the performance of delayed tasks in the 8-arm radial maze conducted 8-10 h after the ES session. However, animals that showed convulsions when the bilateral ES was applied in the medial PFC showed significant deficits in spatial learning and in the performance of short-term (5-second delay) and long-term (1-hour delay) working memory. The behavioral and cognitive effects induced by repeated episodic ES in the medial PFC provide an experimental model to study the effects of increased cortical activation on cognitive processes.

  1. Energy extraction from a semi-passive flapping-foil turbine with active heave and passive pitch

    Science.gov (United States)

    Boudreau, Matthieu; Dumas, Guy; Gunther, Kevin; CFD Laboratory LMFN Team

    2017-11-01

    Due to the inherent complexity of the mechanisms needed to prescribe the heaving and the pitching motions of optimal flapping-foil turbines, several research groups are now investigating the potential of using unconstrained passive motions. The amplitude, the phase and the frequency of such free motions are thus the result of the interaction of the blade with the flow and its elastic supports, namely springs and dampers. In parallel with our current study on fully-passive flapping-foil turbines, we investigate in this work the possibility of using a semi-passive turbine. Unlike previous semi-passive turbines studied in the literature, we propose a turbine with a passive pitching motion and an active heaving motion constrained to be a sine wave with desired amplitude and frequency. As most of the energy extracted by flapping-foil turbines comes from the heaving motion, it is natural to connect an electric generator to this degree of freedom, thereby allowing one to constrain this motion. It is found that large-amplitude pitching motions leading to a considerable energy extraction can arise under different circumstances and mechanisms, either forced by the heaving motion or driven by an instability of the pitching motion itself. The authors gratefully acknowledge the support from the Natural Sciences and Engineering Research Council of Canada (NSERC), the Tyler Lewis Clean Energy Research Foundation, Calcul Québec and Compute Canada.

  2. Activated Charcoal

    Science.gov (United States)

    Activated Carbon, Animal Charcoal, Carbo Vegetabilis, Carbon, Carbón Activado, Charbon Actif, Charbon Activé, Charbon Animal, Charbon Médicinal, Charbon Végétal, Charbon Végétal Activé, Charcoal, Gas Black, Lamp Black, Medicinal Charcoal, Noir de Gaz, ...

  3. A novel autonomic activation measurement method for stress monitoring: non-contact measurement of heart rate variability using a compact microwave radar.

    Science.gov (United States)

    Suzuki, Satoshi; Matsui, Takemi; Imuta, Hayato; Uenoyama, Maki; Yura, Hirofumi; Ishihara, Masayuki; Kawakami, Mitsuyuki

    2008-07-01

    We developed a novel method for non-contact monitoring of stress-induced autonomic activation through the back of a chair, using a compact 24 GHz microwave radar (8 x 5 x 3 cm), without large-scale equipment and placing a heavy burden on the monitored individual. Following a silent period of 120 s, audio stimuli using a composite tone of 2,120 and 2,130 Hz sine-waves at 95 dB were conducted for 120 s. From dorsal, LF/HF of HRV reflecting sympatho-vagal balance was determined by microwave radar with the maximum entropy method using eight volunteers (mean age 23 +/- 1 years). Mean LF/HF measured by non-contact and contact (using electrocardiography for reference) methods during audio stimuli increased 34 and 37%, respectively, as compared with those of the silent period. Maximum cross-correlations between contact and non-contact measurements averaged 0.73 +/- 0.10. Our method appears to be promising for future monitoring of stress-induced autonomic activation of operators and may reduce stress-induced accidents.

  4. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  5. Activation of the Torpedo nicotinic acetylcholine receptor. The contribution of residues alphaArg55 and gammaGlu93.

    Science.gov (United States)

    Kapur, Ankur; Davies, Martin; Dryden, William F; Dunn, Susan M J

    2006-03-01

    The Torpedo nicotinic acetylcholine receptor is a heteropentamer (alpha2betagammadelta) in which structurally homologous subunits assemble to form a central ion pore. Viewed from the synaptic cleft, the likely arrangement of these subunits is alpha-gamma-alpha-delta-beta lying in an anticlockwise orientation. High affinity binding sites for agonists and competitive antagonists have been localized to the alpha-gamma and alpha-delta subunit interfaces. We investigated the involvement of amino acids lying at an adjacent interface (gamma-alpha) in receptor properties. Recombinant Torpedo receptors, expressed in Xenopus oocytes, were used to investigate the consequences of mutating alphaArg55 and gammaGlu93, residues that are conserved in most species of the peripheral nicotinic receptors. Based on homology modeling, these residues are predicted to lie in close proximity to one another and it has been suggested that they may form a salt bridge in the receptor's three-dimensional structure (Sine et al. 2002 J Biol Chem277, 29 210-29 223). Although substitution of alphaR55 by phenylalanine or tryptophan resulted in approximately a six-fold increase in the EC50 value for acetylcholine activation, the charge reversal mutation (alphaR55E) had no significant effect. In contrast, the replacement of gammaE93 by an arginine conferred an eight-fold increase in the potency for acetylcholine-induced receptor activation. In the receptor carrying the double mutations, alphaR55E-gammaE93R or alphaR55F-gammaE93R, the potency for acetylcholine activation was partially restored to that of the wild-type. The results suggest that, although individually these residues influence receptor activation, direct interactions between them are unlikely to play a major role in the stabilization of different conformational states of the receptor.

  6. Characterization of the past and current duplication activities in the human 22q11.2 region

    Directory of Open Access Journals (Sweden)

    Morrow Bernice

    2011-01-01

    Full Text Available Abstract Background Segmental duplications (SDs on 22q11.2 (LCR22, serve as substrates for meiotic non-allelic homologous recombination (NAHR events resulting in several clinically significant genomic disorders. Results To understand the duplication activity leading to the complicated SD structure of this region, we have applied the A-Bruijn graph algorithm to decompose the 22q11.2 SDs to 523 fundamental duplication sequences, termed subunits. Cross-species syntenic analysis of primate genomes demonstrates that many of these LCR22 subunits emerged very recently, especially those implicated in human genomic disorders. Some subunits have expanded more actively than others, and young Alu SINEs, are associated much more frequently with duplicated sequences that have undergone active expansion, confirming their role in mediating recombination events. Many copy number variations (CNVs exist on 22q11.2, some flanked by SDs. Interestingly, two chromosome breakpoints for 13 CNVs (mean length 65 kb are located in paralogous subunits, providing direct evidence that SD subunits could contribute to CNV formation. Sequence analysis of PACs or BACs identified extra CNVs, specifically, 10 insertions and 18 deletions within 22q11.2; four were more than 10 kb in size and most contained young AluYs at their breakpoints. Conclusions Our study indicates that AluYs are implicated in the past and current duplication events, and moreover suggests that DNA rearrangements in 22q11.2 genomic disorders perhaps do not occur randomly but involve both actively expanded duplication subunits and Alu elements.

  7. Astronomy Activities.

    Science.gov (United States)

    Greenstone, Sid

    This document consists of activities and references for teaching astronomy. The activities (which include objectives, list of materials needed, and procedures) focus on: observing the Big Dipper and locating the North Star; examining the Big Dipper's stars; making and using an astrolabe; examining retograde motion of Mars; measuring the Sun's…

  8. Active matter

    Science.gov (United States)

    Ramaswamy, Sriram

    2017-05-01

    The study of systems with sustained energy uptake and dissipation at the scale of the constituent particles is an area of central interest in nonequilibrium statistical physics. Identifying such systems as a distinct category—Active matter—unifies our understanding of autonomous collective movement in the living world and in some surprising inanimate imitations. In this article I present the active matter framework, briefly recall some early work, review our recent results on single-particle and collective behaviour, including experiments on active granular monolayers, and discuss new directions for the future.

  9. ACTIVITY STUDIES

    African Journals Online (AJOL)

    2-HYDROXY-4-METHOXYBENZALDEHYDE: LARVICIDAL STRUCTURE-. ACTIVITY STUDIES. Geoffrey M. Mahangal, Teresa O. Akengal, Wilber Lwandez, Isaiah 0. ... 2Behavioural and Chemical Ecology Department, International Centre for Insect Physiology and .... Y = mean death count, X = initial larvae population'.

  10. Active Galaxies

    DEFF Research Database (Denmark)

    Kilerci Eser, Ece

    one is related to the mass estimates of supermassive black holes (SMBHs). Mass estimates of SMBHs are important to understand the formation and evolution of SMBHs and their host galaxies. Black hole masses in Type 1 AGN are measured with the reverberation mapping (RM) technique. Reverberation mapping......Galaxy formation and evolution is one of the main research themes of modern astronomy. Active galaxies such as Active Galactic Nuclei (AGN) and Ultraluminous Infrared Galaxies (ULIRGs) are important evolutionary stages of galaxies. The ULIRG stage is mostly associated with galaxy mergers...... and interactions. During the interactions of gas-rich galaxies, the gas inflows towards the centers of the galaxies and can trigger both star formation and AGN activity. The ULIRG stage includes rapid star formation activity and fast black hole growth that is enshrouded by dust. Once the AGN emission...

  11. Infection-Induced Retrotransposon-Derived Noncoding RNAs Enhance Herpesviral Gene Expression via the NF-κB Pathway.

    Directory of Open Access Journals (Sweden)

    John Karijolich

    Full Text Available Short interspersed nuclear elements (SINEs are highly abundant, RNA polymerase III-transcribed noncoding retrotransposons that are silenced in somatic cells but activated during certain stresses including viral infection. How these induced SINE RNAs impact the host-pathogen interaction is unknown. Here we reveal that during murine gammaherpesvirus 68 (MHV68 infection, rapidly induced SINE RNAs activate the antiviral NF-κB signaling pathway through both mitochondrial antiviral-signaling protein (MAVS-dependent and independent mechanisms. However, SINE RNA-based signaling is hijacked by the virus to enhance viral gene expression and replication. B2 RNA expression stimulates IKKβ-dependent phosphorylation of the major viral lytic cycle transactivator protein RTA, thereby enhancing its activity and increasing progeny virion production. Collectively, these findings suggest that SINE RNAs participate in the innate pathogen response mechanism, but that herpesviruses have evolved to co-opt retrotransposon activation for viral benefit.

  12. Disease activity in and quality of life of patients with psoriatic arthritis mutilans: the Nordic PAM Study.

    Science.gov (United States)

    Lindqvist, U; Gudbjornsson, B; Iversen, L; Laasonen, L; Ejstrup, L; Ternowitz, T; Ståhle, M

    2017-11-01

    To describe the social status and health-related quality of life of patients with psoriatic arthritis mutilans (PAM) in the Nordic countries. Patients with at least one mutilated joint confirmed by radiology were studied. Disease activity involving joints and skin, physician-assessed disease activity, and patient's education and work status were recorded. Data from the 36-item Short Form Health Survey, Health Assessment Questionnaire and Dermatology Life Quality Index questionnaire were gathered and correlated with disease duration, pain, and general well-being (visual analogue scale). The controls were 58 Swedish patients with long-standing psoriatic arthritis sine PAM. Sixty-seven patients were included. Patients with PAM had a protracted disease history (33 ± 14 years) and disease onset at a relatively early age (30 ± 12 years). Overall inflammatory activity at inclusion was mild to moderate. The mean number of mutilated joints was 8.2 and gross deformity was found in 16% of patients. Forty per cent were treated with biological and 32% with conventional synthetic disease-modifying anti-rheumatic drugs. Forty-two per cent had retired early or were on sick leave. Impaired functional capacity with little or no ability to perform self-care or everyday tasks was reported by 21% of the patients. Patients between 45 and 60 years of age reported the most impaired quality of life in comparison to the control group. PAM seriously affects social functioning. Whether early recognition of PAM and new forms of therapy can improve disease outcome and quality of life remains to be studied.

  13. AcEST: BP920276 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.34 sp|A7XYH5|SOBP_CHICK Sine oculis-binding protein homolog OS=Gall... 34 0.34 sp|P59729|RIN3_MOUSE Ra...ization-activate... 34 0.45 sp|A7XYQ1|SOBP_HUMAN Sine oculis-binding protein homo

  14. Hvordan håndterer Danmark risikoen for civile tab i sine bombeangreb med F16?

    DEFF Research Database (Denmark)

    Kjærgaard, Steen; Marrup, Karsten

    fjenden under så vanskelige forhold som i Libyen eller Irak/Syrien. Forsvarsakademiet peger på, at 1) et robust magtanvendelsesmandat, primært begrænset af den internationale humanitære folkerets regler, krigens love, samt 2) en høj grad af delegering af beslutningsansvar til en 3) erfaren F-16 pilot på...

  15. The light in the architecture of minimalism: Architectura sine luce nulla architectura est: Alberto Campo Baeza

    OpenAIRE

    Vasilski Dragana

    2010-01-01

    Field of interest of man is directly linked to the vision and illusion, and they again with the light. We live in an era when the light as a concept of changes is very emphasized, so it is understandable that as 'all roads lead to Rome', in architecture all roads lead to the light. We can look at an architectural history as a display of objects that are creatively adapted to the light. One focus of observation may be the connection between what people see and the construction of building. Des...

  16. “Neurologist's contribution to the diagnosis of sine materia respiratory insufficiency: case report”

    Directory of Open Access Journals (Sweden)

    Carbonelli Cristiano

    2012-08-01

    Full Text Available Abstract Background Right-to-left shunt (RLS may be the cause of marked hypoxemia, a respiratory insufficiency which is usually difficult to diagnose by respiratory physicians as it develops in the absence of an intrinsic lung disease. Case presentation We report a case of RLS in a patient with a hepatopulmonary syndrome caused by chronic autoimmune cholangitis. RLS was suspected clinically by physical examination and by standard CT imaging and MIP reconstruction of the pulmonary vascular bed. Repeated previous transthoracic echocardiography (TTE studies did not reveal shunts or any cardiac defect. The final diagnosis was made by means of a minimally invasive transcranial Doppler examination with the use of saline agitated with 0.5 ml of patient’s blood as contrast solution. Conclusions Transcranial Colour-Coded Duplex Sonography (TCCS with saline contrast medium injection is described to have a higher sensitivity than TTE and comparable to transesophageal echocardiography (TEE in RLS diagnosis. The collaboration of neurologists in diagnosing respiratory insufficiency is very important as the examination is simple, well tolerated in comparison with the discomfort associated with transesophageal echocardiography, and minimally invasive in comparison with angiography, which is the last diagnostic procedure in this clinical scenario. In order to confirm RLS, TCCS with blood-saline contrast medium injection should be performed for the diagnosis of chronic hypoxemia for which causes are not detected with routine clinical examinations.

  17. A generalized exp-function method for multiwave solutions of sine ...

    Indian Academy of Sciences (India)

    ) equation and single-, double- and three-wave solutions are obtained. It is shown that the generalized exp-function method combined with appropriate anstaz may provide a straightforward, effective and alternative method for constructing ...

  18. Dendritic cell neurofibroma sine pseudorosettes: report of a case with a granulomatous appearance.

    Science.gov (United States)

    Petersson, Fredrik

    2011-10-01

    An unusual variant of dendritic cell neurofibroma is reported. In contrast to previous cases, the formation of pseudorosettes was lacking. The tumor was located on the anterior aspect of the thigh in a previously healthy 71-year-old woman with no evidence of neurofibromatosis. The tumor was composed of type-1 and type-2 cells, which were immunoreactive for S-100 protein and CD57. The granulomatous appearance was due to the zonal accumulation of CD34-positive dendritic cells and type-1 cells in a serpiginous fashion surrounding large areas with lesser cellularity featuring type-2 cells with scattered type-1 cells arranged in a haphazard fashion. Intralesional small neurites positive for neurofilament and perilesional perineural cells positive for epithelial membrane antigen were documented immunohistochemically.

  19. A Two-Dimensional Transverse Magnetic Propagation Model of a Sine Wave Using Mur Boundary Conditions

    National Research Council Canada - National Science Library

    Korjack, T

    1997-01-01

    .... The nonreflecting boundary conditions due to Mur were used at the boundary surfaces. Electric field intensity distributions resulted over a progressive time expansion to illustrate the propagation effect over the entire 2-D mesh...

  20. CRM1 Blockade by Selective Inhibitors of Nuclear Export (SINE) attenuates Kidney Cancer Growth

    Science.gov (United States)

    Inoue, Hiromi; Kauffman, Michael; Shacham, Sharon; Landesman, Yosef; Yang, Joy; Evans, Christopher P.; Weiss, Robert H.

    2015-01-01

    Since renal cell carcinoma (RCC) often presents asymptomatically, patients are commonly diagnosed at the metastatic stage when treatment options are limited and survival is poor. Given that progression-free survival with current therapies for metastatic RCC is only one to two years and existing drugs are associated with a high rate of resistance, new pharmacological targets are desperately needed. We identified and evaluated the nuclear exporter protein, chromosome region maintenance protein 1 (CRM1), as a novel potential therapeutic for RCC. Purpose To evaluate novel, selective inhibitors of nuclear export as potential RCC therapeutics. Materials and Methods Efficacy of the CRM1 inhibitors, KPT-185 and -251, was tested in several RCC cell lines and in a RCC xenograft model. Apoptosis and cell cycle arrest were quantified, and localization of p53 family proteins was assessed using standard techniques. Results KPT-185 attenuated CRM1 and showed increased cytotoxicity in RCC cells in vitro, with evidence of increased apoptosis as well as cell cycle arrest. KPT-185 caused both p53 and p21 to remain primarily in the nucleus in all RCC cell lines, suggesting a mechanism of action of these compounds dependent upon tumor-suppressor protein localization. Furthermore, when administered orally in a high-grade RCC xenograft model, the bioavailable CRM1 inhibitor KPT-251 significantly inhibited tumor growth in vivo with the expected on-target effects and with no obvious toxicity. Conclusions The CRM1 inhibitor family of proteins are novel therapeutic targets RCC and deserve further intensive investigation in this and other urologic malignancies. PMID:23079374

  1. SINE1'3Ethi0p'. I. Sci., 30(1)

    African Journals Online (AJOL)

    6). Furthermore, Bawa and Beach (1981) proposed that evolution of monoecism represents the continuation of the trend seen in andromoecious~ species towards the specialization of flowers into . pollen donors and pollen recipients which is partly due to sexual selection and partly due to the mechanics of pollination and it ...

  2. Diagonal tarsal suture technique sine marginal sutures for closure of full-thickness eyelid defects.

    Science.gov (United States)

    Willey, Andrea; Caesar, Richard H

    2013-01-01

    Precise apposition of the tarsal plates and meticulous alignment of the eyelid margins are essential to ensure a seamless repair and avoid notching of the eyelid margin. The authors present a simple and reliable technique that firmly apposes and precisely aligns the eyelid margin in the x, y, and z axes, obviating the need for marginal sutures. A retrospective audit of electronic medical records was performed for all patients who underwent reconstructive procedures that included the repair of a full-thickness defect in the eyelid margin using the diagonal suture technique from 2003 to 2012. Of the 652 surgeries performed in the past 9 years, 9 incidences of notching occurred, all of which were associated with infections. The diagonal tarsal suture technique is a simple and effective method for the repair of full-thickness defects with a high degree of patient satisfaction.

  3. Analysing Diagnostic Assessment on the Ratio of Sine in a Right Triangle

    Science.gov (United States)

    Andika, R.; Juandi, D.; Rosjanuardi, R.

    2017-09-01

    This study aims to develop diagnostic assessment with the special topic of the ratio of sinus in a right triangle and analyze the result whether the students are ready to continue to the next lesson of trigonometry specially the sinus rule. The methodology that use in this study is a design research of Plomp model which is it comprises of 3 phases: (a) preliminary research; (b) prototyping phase; and (c) assessment phase. The findings show that almost half of students made a mistake in determining the ratio of sin in a right triangle, consequently the procedure for solving the problem went wrong. In strategic competency and adaptive communication most of students did not solve the problem that was given. According to the result, the students have to get remedial program before to the next lesson, the rule of sin.

  4. Phonetic matching of auditory and visual speech develops during childhood : Evidence from sine-wave speech

    NARCIS (Netherlands)

    Baart, M.; Bortfeld, H.; Vroomen, J.

    2015-01-01

    The correspondence between auditory speech and lip-read information can be detected based on a combination of temporal and phonetic cross-modal cues. Here, we determined the point in developmental time at which children start to effectively use phonetic information to match a speech sound with one

  5. Limitations caused by distortion in room impulse response measurements by swept sine technique

    DEFF Research Database (Denmark)

    Stojic, Branko; Ciric, Dejan; Markovic, Milos

    2011-01-01

    The significance of a room impulse response implies the requirement that its measurement should have a high level of accuracy in certain applications. One of the common problems in a measurement process is nonlinearity leading to the distortion of a room impulse response. Limitations caused by th...

  6. Photon trajectory in strongly scattering media transilluminated by the sine-modulated laser radiation

    Science.gov (United States)

    Lyubimov, Vladimir V.; Kravtsenyuk, Olga V.; Skotnikov, V. A.; Volkonski, Vladimir B.

    1998-12-01

    Results of experimental study of the scattering object shape influence on the photon average trajectories (AT) are presented. The systematic experimental study of the AT inside the scattering bodies of different forms (semi- infinite medium, flat layer, rectangular sector, and cylinder) was carried out. The staking of the AT from a source to detect was carried out with the use of the standard inhomogeneity (SI): a point absolute absorber was embedded inside the object, and the point was searched where the maximal decrease of the detector signal was observed. Also this decreasing was explored as a function of the SI displacement from the AT. As it was predicted in our previous theoretical study, the simple approximation for the AT shape could be done as a three-segment polygonal line that is normal to the body surface at the initial and thermal trajectory points. The approximation error is much less then the width of the area where the presence of the SI is detectable. The obtained results comprise the base for further development of the fast computer algorithms for the real-time multi-aspect 3D optical imaging of strongly scattering objects.

  7. bases structurales de la motilité des kinésines

    OpenAIRE

    Cao, Luyan

    2016-01-01

    Kinesins are a family of microtubule-interacting motor proteins that convert the chemical energy from ATP hydrolysis into mechanical work. Many kinesins are motile, walking along microtubules to fulfill different functions. Most kinesins are dimers, the monomer comprising a motor domain, a dimerizing stalk domain, and a tail domain. The motor domain contains both the nucleotide-binding site and the microtubule-binding site. I am interested in the molecular mechanism of kinesin's motility. In ...

  8. Riemann-Hilbert approach to the time-dependent generalized sine kernel

    Energy Technology Data Exchange (ETDEWEB)

    Kozlowski, K.K.

    2010-12-15

    We derive the leading asymptotic behavior and build a new series representation for the Fredholm determinant of integrable integral operators appearing in the representation of the time and distance dependent correlation functions of integrable models described by a six-vertex R-matrix. This series representation opens a systematic way for the computation of the long-time, long-distance asymptotic expansion for the correlation functions of the aforementioned integrable models away from their free fermion point. Our method builds on a Riemann-Hilbert based analysis. (orig.)

  9. Bilingualism in the English of tertiary students: A sine-qua-non for ...

    African Journals Online (AJOL)

    Based on these findings, recommendations such as encouraging parents to maintain bilingualism at home and schools, language teachers to emphasis areas of difficulty and interference, more emphasis to be made by textbook writers, syllabus designers, curriculum planners, provision of instructional materials and ...

  10. Environmental education: A sine-qua-non for building a sustainable ...

    African Journals Online (AJOL)

    Several related literature showed limited quantitative works that highlighted strategies and necessary Environmental Education (EE) components to meet sustainable development goals. Study fills the gap. Inferential and descriptive statistics incorporated after reviews and other print media assessments. Results indicate a ...

  11. Synergism Analysis of Bedding Slope with Piles and Anchor Cable Support under Sine Wave Vehicle Load

    Directory of Open Access Journals (Sweden)

    Li Dan-Feng

    2016-01-01

    Full Text Available Slope instability under dynamic load is the technical difficulty in the engineering; the evaluation of slope stability under dynamic load and the control of dynamic load is particularly important. In this paper, taking the right side slope of K27+140 m~380 m typical section (K27 slope for short in Chongqing Fuling-Fengdu-Shizhu expresses highway as an example to calculate and analyze. The K27 slope is under sinusoidal vehicle load and supported by anchor cable and antislide pile to resist downslide strength; at the same time, the combined effect of them is studied. Three-dimensional finite element methodology (FEM is used to simulate the bedding slope with piles and anchor cable support; furthermore, the eigenvalue can be obtained. In order to reduce error of the elastic boundary conditions caused by the reflection effect of wavelengths, the combination of Lysmer surface viscous boundary and traditional ground support boundaries is utilized to analyze and calculate the time-histories during bedding slope under dynamic load. The dynamic response of pile anchor support to resist sliding force is obtained. The concept of the pile anchor supporting coordinate interval is put forward. Furthermore, it is verified that the pile anchor supporting coordinate interval can be used to evaluate the stability of the slope under dynamic load and provide a new method for the control of the dynamic load.

  12. Impact of an oceanic port (Sines, Portugal on the fish community

    Directory of Open Access Journals (Sweden)

    Nuno Mamede

    2015-10-01

    These results suggest that this port may provide favorable conditions for the occurrence of a greater fish diversity and abundance than outside areas, particularly for some species that live in subtidal rocky substrates. Recreational and commercial fishing interdiction, in place in most areas of this port for several years, may be responsible for these patterns.

  13. Self-Repairing Energy Materials: Sine Qua Non for a Sustainable Future.

    Science.gov (United States)

    Cahen, David; Lubomirsky, Igor

    2017-03-21

    Materials are central to our way of life and future. Energy and materials as resources are connected, and the obvious connections between them are the energy cost of materials and the materials cost of energy. For both of these, resilience of the materials is critical; thus, a major goal of future chemistry should be to find materials for energy that can last longer, that is, design principles for self-repair in these.

  14. Self-Repairing Energy Materials: Sine Qua Non for a Sustainable Future

    OpenAIRE

    Cahen, David; Lubomirky, Igor

    2017-01-01

    Materials are central to our way of life and future. Energy and materials as resources are connected and the obvious connections between them are the energy cost of materials and the materials cost of energy. For both of these resilience of the materials is critical; thus a major goal of future chemistry should be to find materials for energy that can last longer, i.e., design principles for self-repair in these.

  15. Intangible activities

    DEFF Research Database (Denmark)

    Hermansen, Jonathan

    2016-01-01

    ‘Informal helping’ is often associated with other types of prosocial behaviour such as formal voluntary work. Therefore, one could jump to the conclusion that it would be the same factors driving both types of activities. This article demonstrates that this is not the case. The study relies...

  16. Physical activity

    Science.gov (United States)

    ... not exercised or been active in a long time, start slowly to prevent injuries. Taking a brisk 10-minute walk twice a week is a good start. Try joining a dance, yoga, or karate class if it appeals to you. You could also ...

  17. Importance of the N-terminal proline for the promiscuous activity of 4-oxalocrotonate tautomerase (4-OT

    Directory of Open Access Journals (Sweden)

    Lazić Jelena

    2016-01-01

    Full Text Available Michael addition of aldehydes to nitroolefins is an effective method to obtain useful chiral γ-nitroaldehydes. γ-Nitroaldehydes are precursors for chiral γ-aminobytiric acid analogues which have numerous pharmacological activities and are used for treatment of neurological disorders. A whole-cell system based on recombinantly expressed 4-oxalocrotonate tautomerase (4-OT has been developed and shown to be an effective biocatalyst for Michael addition of branched aldehydes to β-nitrostyrenes. The aim of this study was to investigate the influence of the substitution of the N-terminal proline with lysine and arginine both containing the reactive ε-amino group, on the Michael addition catalyzed by 4-OT. Firstly, the effect of these mutations was examined by in silico analysis, followed by generation of three terminal ly-sine mutants. The generated mutants, 4-OT_K, 4-OT_PK and 4-OT_KK were tested for the ability to utilise β-nitrostyrene (1, (E-2-(thiophene-2-ylnitroethen (2 and p-chloro-trans-β-nitrostyrene (3 as Michael acceptors with isobutanal as the donor. For comparison, the lithium salt of lysine was used in the same organocatalytic reactions. In general, the introduction of lysine had a negative effect on Michael additions based on overall product yields. However, additional lysine residues at the N-terminus of the protein resulted in structural changes that enhanced the activity towards 2 and 3. Therefore, the N-terminal proline is important for the 4-OT catalysed Michael-additons, but it is not essential. [Projekat Ministarstva nauke Republike Srbije, br. 173048 i br. 172002

  18. Active particles

    CERN Document Server

    Degond, Pierre; Tadmor, Eitan

    2017-01-01

    This volume collects ten surveys on the modeling, simulation, and applications of active particles using methods ranging from mathematical kinetic theory to nonequilibrium statistical mechanics. The contributing authors are leading experts working in this challenging field, and each of their chapters provides a review of the most recent results in their areas and looks ahead to future research directions. The approaches to studying active matter are presented here from many different perspectives, such as individual-based models, evolutionary games, Brownian motion, and continuum theories, as well as various combinations of these. Applications covered include biological network formation and network theory; opinion formation and social systems; control theory of sparse systems; theory and applications of mean field games; population learning; dynamics of flocking systems; vehicular traffic flow; and stochastic particles and mean field approximation. Mathematicians and other members of the scientific commu...

  19. Analgesic Activity.

    Science.gov (United States)

    2016-01-01

    Analgesics are agents which selectively relieve pain by acting in the CNS and peripheral pain mediators without changing consciousness. Analgesics may be narcotic or non-narcotic. The study of pain in animals raises ethical, philosophical, and technical problems. Both peripheral and central pain models are included to make the test more evident for the analgesic property of the plant. This chapter highlights methods such as hot plate and formalin and acetic acid-induced pain models to check the analgesic activity of medicinal plants.

  20. Active house

    DEFF Research Database (Denmark)

    Eriksen, Kurt Emil; Olesen, Gitte Gylling Hammershøj

    2010-01-01

    Formålet med dette abstrakt er at illustrere, at huse kan være konstrueret til at basere sig udelukkende på vedvarende energikilder og samtidig være CO2-neutrale og producere mere energi end de forbruger. Active House Visionen undersøger disse muligheder i otte demonstration huse i fem forskellige...... europæiske lande, hvor husene konstrueres, fremstilles og testes. Kvalitative og kvantitative målinger vil blive designet til at vurdere husene i forhold til energi, indeklima og miljø....

  1. Active packaging with antifungal activities.

    Science.gov (United States)

    Nguyen Van Long, N; Joly, Catherine; Dantigny, Philippe

    2016-03-02

    There have been many reviews concerned with antimicrobial food packaging, and with the use of antifungal compounds, but none provided an exhaustive picture of the applications of active packaging to control fungal spoilage. Very recently, many studies have been done in these fields, therefore it is timely to review this topic. This article examines the effects of essential oils, preservatives, natural products, chemical fungicides, nanoparticles coated to different films, and chitosan in vitro on the growth of moulds, but also in vivo on the mould free shelf-life of bread, cheese, and fresh fruits and vegetables. A short section is also dedicated to yeasts. All the applications are described from a microbiological point of view, and these were sorted depending on the name of the species. Methods and results obtained are discussed. Essential oils and preservatives were ranked by increased efficacy on mould growth. For all the tested molecules, Penicillium species were shown more sensitive than Aspergillus species. However, comparison between the results was difficult because it appeared that the efficiency of active packaging depended greatly on the environmental factors of food such as water activity, pH, temperature, NaCl concentration, the nature, the size, and the mode of application of the films, in addition to the fact that the amount of released antifungal compounds was not constant with time. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Staying Active: Physical Activity and Exercise

    Science.gov (United States)

    ... Events Advocacy For Patients About ACOG Staying Active: Physical Activity and Exercise Home For Patients Search FAQs Staying ... Exercise FAQ045, November 2016 PDF Format Staying Active: Physical Activity and Exercise Women's Health What are the benefits ...

  3. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Needs for Pregnant or Postpartum Women Physical Activity & Health Adding Physical Activity to Your Life Activities for Children Activities ... Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social ... Physical Activity Steps to Wellness Walkability Audit Tool Sample ...

  4. Activating schoolyards

    DEFF Research Database (Denmark)

    Andersen, Henriette Bondo; Pawlowski, Charlotte Skau; Scheller, Hanne Bebendorf

    2015-01-01

    and structural changes in the physical environment. METHOD: The study builds on a quasi-experimental study design using a mixed method approach including: 1) an exploratory study aimed at providing input for the developing process; 2) an evaluation of the effect of the interventions using a combination...... as well as quantitative methods can be seen as a strength, as the different types of data complement each other and results of one part of the study informed the following parts. A unique aspect of our study is the use of accelerometers in combination with GPS and GIS in the effect evaluation...... to objectively determine where and how active the students are in the schoolyard, before and after the intervention. This provides a type of data that, to our knowledge, has not been used before in schoolyard interventions. Exploring the change in behavior in relation to specific intervention elements...

  5. Halal Activism

    DEFF Research Database (Denmark)

    Fischer, Johan

    2016-01-01

    The purpose of this article is to further our understanding of contemporary Muslim consumer activism in Malaysia with a particular focus on halal (in Arabic, literally “permissible” or “lawful”) products and services. Muslim activists and organisations promote halal on a big scale in the interface...... zones between new forms of Islamic revivalism, the ethnicised state and Muslim consumer culture. Organisations such as the Muslim Consumers Association of Malaysia play an important role in pushing and protecting halal in Malaysia, that is, halal activists constantly call on the state to tighten halal...... in particular historical/national settings and that these issues should be explored in the interfaces between Islam, the state and market. More specifically, this article examines the above issues building on ethnography from fieldwork with three Muslim organisations in Malaysia....

  6. Active shear flow control for improved combustion

    Science.gov (United States)

    Gutmark, E.; Parr, T. P.; Hanson-Parr, D. M.; Schadow, K. C.

    1990-01-01

    The acoustical and fluid dynamic facets of an excited premixed flame were studied experimentally to evaluate possibilities for development of a stabilizing closed-loop control system. The flame was analyzed as a nonlinear system which includes different subcomponents: acoustics, fluid dynamics, and chemical reaction. Identification of the acoustical and fluid dynamics subsystems is done by analyzing the transfer function, which was obtained by driving the system with both white-noise and a frequency-sweeping sine-wave. The features obtained by this analysis are compared to results of flow visualization and hot-wire flow-field and spectral measurements. The acoustical subsystem is determined by the resonant acoustic modes of the settling chamber. These modes are subsequently filtered and amplified by the flow shear layer, whose instability characteristics are dominated by the preferred mode frequency.

  7. Active sharing

    CERN Multimedia

    2012-01-01

    The big news this week is, of course, the conclusions from the LHC performance workshop held in Chamonix from 6 to 10 February . The main recommendation, endorsed by CERN’s Machine Advisory Committee and adopted by the Management, is that the LHC will run at 4 TeV per beam this year. You can find all the details from Chamonix in the slides presented on Wednesday at the summary session, which leaves me free to talk about another important development coming up soon.   In ten days time, a new kind of gathering will be taking place in Geneva, bringing together two previously separate conferences, one driven by physics, the other by the medical community, but both looking to apply physics to the advancement of health. The merger of the International Conference for Translational Research in Radio-Oncology and CERN’s workshop on Physics for Health in Europe (ICTR-PHE) makes for a very eclectic mix. Presentations range from active shielding for interplanetary flight to the rather...

  8. DAVIC activities

    Science.gov (United States)

    Fujiwara, Hiroshi

    1995-12-01

    DAVIC (Digital Audio Visual Council) is the defacto standardization organization established in Mar. 1994, based on international consensus for digital audio visual services. After completion of MPEG2 standardization, the broadcasting industry, the communication industry, the computer industry, and consumer electronics industry have started development of concrete services and products. Especially the interactive digital audio visual services, such as Video On Demand (VOD) or Near Video On Demand (NVOD), have become hot topics all over the world. Such interactive digital audio visual services are combined technologies of multi-media coding, digital transmission and computer networking. Therefore more than 150 organizations from all industry sectors have participated in DAVIC and are contributing from their own industrial contexts. DAVIC's basic policy is to use the available technologies specified by the other standards bodies as much as possible. So DAVIC's standardization activities have close relationship with ISO IEC/JTC1/SC29, ITU-T SG 9, ATM-Forum, IETF, IMA, DVB, etc. DAVIC is trying to specify Applications, Reference Models, Security, Usage Information Control, and the interfaces and protocols among the Content Provider, the Server, the core network, the access network, and the Set Top Unit. DAVIC's first goal is to specify DAVIC1.0 based on CFP1 (Call for Proposal) and CFP2 by Dec. 1995, and the next direction is under preparation for further progress based on CFP3 and CFP4.

  9. Activation Energy

    Science.gov (United States)

    Gadeken, Owen

    2002-01-01

    Teaming is so common in today's project management environment that most of us assume it comes naturally. We further assume that when presented with meaningful and challenging work, project teams will naturally engage in productive activity to complete their tasks. This assumption is expressed in the simple (but false) equation: Team + Work = Teamwork. Although this equation appears simple and straightforward, it is far from true for most project organizations whose reality is a complex web of institutional norms based on individual achievement and rewards. This is illustrated by the very first successful team experience from my early Air Force career. As a young lieutenant, I was sent to Squadron Officer School, which was the first in the series of Air Force professional military education courses I was required to complete during my career. We were immediately formed into teams of twelve officers. Much of the course featured competition between these teams. As the most junior member of my team, I quickly observed the tremendous pressure to show individual leadership capability. At one point early in the course, almost everyone in our group was vying to become the team leader. This conflict was so intense that it caused us to fail miserably in our first outdoor team building exercise. We spent so much time fighting over leadership that we were unable to complete any of the events on the outdoor obstacle course. This complete lack of success was so disheartening to me that I gave our team little hope for future success. What followed was a very intense period of bickering, conflict, and even shouting matches as our dysfunctional team tried to cope with our early failures and find some way to succeed. British physician and researcher Wilfred Bion (Experiences in Groups, 1961) discovered that there are powerful psychological forces inherent in all groups that divert from accomplishing their primary tasks. To overcome these restraining forces and use the potential

  10. Evolution of Two Short Interspersed Elements in Callorhinchus milii (Chondrichthyes, Holocephali) and Related Elements in Sharks and the Coelacanth.

    Science.gov (United States)

    Luchetti, Andrea; Plazzi, Federico; Mantovani, Barbara

    2017-06-01

    Short interspersed elements (SINEs) are non-autonomous retrotransposons. Although they usually show fast evolutionary rates, in some instances highly conserved domains (HCDs) have been observed in elements with otherwise divergent sequences and from distantly related species. Here, we document the life history of two HCD-SINE families in the elephant shark Callorhinchus milii, one specific to the holocephalan lineage (CmiSINEs) and another one (SacSINE1-CM) with homologous elements in sharks and the coelacanth (SacSINE1s, LmeSINE1s). The analyses of their relationships indicated that these elements share the same 3'-tail, which would have allowed both elements to rise to high copy number by exploiting the C. milii L2-2_CM long interspersed element (LINE) enzymes. Molecular clock analysis on SINE activity in C. milii genome evidenced two replication bursts occurring right after two major events in the holocephalan evolution: the end-Permian mass extinction and the radiation of modern Holocephali. Accordingly, the same analysis on the coelacanth homologous elements, LmeSINE1, identified a replication wave close to the split age of the two extant Latimeria species. The genomic distribution of the studied SINEs pointed out contrasting results: some elements were preferentially sorted out from gene regions, but accumulated in flanking regions, while others appear more conserved within genes. Moreover, data from the C. milii transcriptome suggest that these SINEs could be involved in miRNA biogenesis and may be targets for miRNA-based regulation. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  11. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Physical Activity Basics Needs for Adults Needs for Children What Counts Needs for Older Adults Needs for ... Adding Physical Activity to Your Life Activities for Children Activities for Older Adults Overcoming Barriers Measuring Physical ...

  12. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Adults Needs for Children What Counts Needs for Older Adults Needs for Pregnant or Postpartum Women Physical Activity & ... to Your Life Activities for Children Activities for Older Adults Overcoming Barriers Measuring Physical Activity Intensity Target Heart ...

  13. Types of Physical Activity

    Science.gov (United States)

    ... basics Types of physical activity Types of physical activity Not sure what kinds of physical activity you should do? Well, you need three main types of activity . They are aerobic (sometimes called "cardio"), muscle-strengthening , ...

  14. Facts about Physical Activity

    Science.gov (United States)

    ... Micronutrient Malnutrition State and Local Programs Facts about Physical Activity Recommend on Facebook Tweet Share Compartir Some Americans ... Activity Guideline for aerobic activity than older adults. Physical activity and socioeconomic status Adults with more education are ...

  15. Physical Activity Guidelines

    Science.gov (United States)

    ... use this site. health.gov Physical Activity Guidelines Physical Activity Physical activity is key to improving the health of the Nation. Based on the latest science, the Physical Activity Guidelines for Americans is an essential resource for ...

  16. Active knee joint flexibility and sports activity

    DEFF Research Database (Denmark)

    Hahn, Thomas; Foldspang, Anders; Vestergaard, E

    1999-01-01

    The aim of the study was to estimate active knee flexion and active knee extension in athletes and to investigate the potential association of each to different types of sports activity. Active knee extension and active knee flexion was measured in 339 athletes. Active knee extension...... was significantly higher in women than in men and significantly positively associated with weekly hours of swimming and weekly hours of competitive gymnastics. Active knee flexion was significantly positively associated with participation in basketball, and significantly negatively associated with age and weekly...... hours of soccer, European team handball and swimming. The results point to sport-specific adaptation of active knee flexion and active knee extension. Udgivelsesdato: 1999-Apr...

  17. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Needs for Pregnant or Postpartum Women Physical Activity & Health Adding Physical Activity to Your Life Activities for Children Activities for ... June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National Center for Chronic Disease Prevention and Health Promotion ... Listen Watch ...

  18. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... gov . Physical Activity Physical Activity Basics Needs for Adults Needs for Children What Counts Needs for Older Adults Needs for Pregnant or Postpartum Women Physical Activity & ...

  19. Physical Activity Assessment

    Science.gov (United States)

    Current evidence convincingly indicates that physical activity reduces the risk of colon and breast cancer. Physical activity may also reduce risk of prostate cancer. Scientists are also evaluating potential relationships between physical activity and other cancers.

  20. Activities of Daily Living

    Science.gov (United States)

    ... With Parkinson's › Managing Parkinson's › Activities of Daily Living Activities of Daily Living Sometimes Parkinson’s disease (PD) can complicate the basic daily activities a person with living with Parkinson’s once did ...

  1. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... About Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More Physical Activity MMWR Data Highlights State Indicator Report on Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community ...

  2. Guide to Physical Activity

    Science.gov (United States)

    ... Families ( We Can! ) Health Professional Resources Guide to Physical Activity Physical activity is an important part of your ... to injury. Examples of moderate-intensity amounts of physical activity Common Chores Washing and waxing a car for ...

  3. Physical Activity Basics

    Science.gov (United States)

    ... Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Physical Activity Basics Recommend on Facebook Tweet Share Compartir How much physical activity do you need? Regular physical activity helps improve ...

  4. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Needs for Pregnant or Postpartum Women Physical Activity & Health Adding Physical Activity to Your Life Activities for ... Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram Listen Watch ...

  5. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Adults Needs for Children What Counts Needs for Older Adults Needs for Pregnant or Postpartum Women Physical ... to Your Life Activities for Children Activities for Older Adults Overcoming Barriers Measuring Physical Activity Intensity Target ...

  6. Measuring Physical Activity Intensity

    Science.gov (United States)

    ... 67 Data & Statistics Facts About Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More Physical Activity MMWR Data Highlights State Indicator Report on Physical Activity, 2014 Recommendations & Guidelines Fact ...

  7. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... 67 Data & Statistics Facts About Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More Physical Activity MMWR Data Highlights State Indicator Report on Physical Activity, 2014 Recommendations & Guidelines Fact ...

  8. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community Strategies Worksite Physical Activity Steps to ... counts as aerobic activity, watch this video: Windows Media Player, 4:48 More videos Here are some ...

  9. Physical activity and obesity

    National Research Council Canada - National Science Library

    Bouchard, Claude; Katzmarzyk, Peter T

    2010-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 2 The Physical Activity and Exercise Continuum 7 Darren Warburton Definition of Health, Physical Activity, and Exercise . . . . . . . 7 The Continuum...

  10. Physical Activity During School

    DEFF Research Database (Denmark)

    Østergaard, Lars Domino

    to be even more active during school hours further enhancing their academic behaviour, it is important to know when, why and how they are active, and their attitude towards different types of physical activities. Therefore, the aim of this study was to categorize the physical activities attended by students...... during school hours and to elucidate their attitude towards the different types of activities. The data consisted of observations of lessons followed by group interviews. Analyses of the observations revealed six categories of physical activities, varying from mandatory physical activities, activities...

  11. Physical Activity and Cancer

    Science.gov (United States)

    ... Cancer Genetics Services Directory Cancer Prevention Overview Research Physical Activity and Cancer On This Page What is physical activity? What is known about the relationship between physical ...

  12. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community Strategies Worksite Physical Activity Steps to Wellness Walkability Audit Tool Sample ...

  13. Criminalisation of Activism

    DEFF Research Database (Denmark)

    Uldam, Julie

    Different forms of political participation involve different challenges. This paper focuses on challenges to radical activism and particularly the criminalisation of activism.......Different forms of political participation involve different challenges. This paper focuses on challenges to radical activism and particularly the criminalisation of activism....

  14. Diabetes - keeping active

    Science.gov (United States)

    ... ways to add more activity to your day. Introduction There are many benefits to being active. Staying ... of activities and locations. When the weather is cold or wet, stay active by ... and equipment. Start slowly. A common mistake is to try and do too much ...

  15. Increasing Youth Physical Activity with Activity Calendars

    Science.gov (United States)

    Eckler, Seth

    2016-01-01

    Physical educators often struggle with ways to get their students to be active beyond the school day. One strategy to accomplish this is the use of physical activity calendars (PACs). The purpose of this article is to support the use of PACs and give practical advice for creating effective PACs.

  16. Active nematic gels as active relaxing solids

    Science.gov (United States)

    Turzi, Stefano S.

    2017-11-01

    I propose a continuum theory for active nematic gels, defined as fluids or suspensions of orientable rodlike objects endowed with active dynamics, that is based on symmetry arguments and compatibility with thermodynamics. The starting point is our recent theory that models (passive) nematic liquid crystals as relaxing nematic elastomers. The interplay between viscoelastic response and active dynamics of the microscopic constituents is naturally taken into account. By contrast with standard theories, activity is not introduced as an additional term of the stress tensor, but it is added as an external remodeling force that competes with the passive relaxation dynamics and drags the system out of equilibrium. In a simple one-dimensional channel geometry, we show that the interaction between nonuniform nematic order and activity results in either a spontaneous flow of particles or a self-organization into subchannels flowing in opposite directions.

  17. Neutron Activation Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Corliss, William R.

    1968-01-01

    In activation analysis, a sample of an unknown material is first irradiated (activated) with nuclear particles. In practice these nuclear particles are almost always neutrons. The success of activation analysis depends upon nuclear reactions which are completely independent of an atom's chemical associations. The value of activation analysis as a research tool was recognized almost immediately upon the discovery of artificial radioactivity. This book discusses activation analysis experiments, applications and technical considerations.

  18. Lectures Abandoned: Active Learning by Active Seminars

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Corry, Aino Vonge

    2012-01-01

    Traditional lecture-based courses are widely criticised for be- ing less eective in teaching. The question is of course what should replace the lectures and various active learning tech- niques have been suggested and studied. In this paper, we report on our experiences of redesigning a software ......- tive seminars as a replacement of traditional lectures, an activity template for the contents of active seminars, an ac- count on how storytelling supported the seminars, as well as reports on our and the students' experiences....

  19. The number of full-sine cycles per pulse influences the efficacy of multicycle transcranial magnetic stimulation

    DEFF Research Database (Denmark)

    Pechmann, Astrid; Delvendahl, Igor; Bergmann, Til O

    2012-01-01

    Previous studies have shown that the efficacy of transcranial magnetic stimulation (TMS) to excite corticospinal neurons depends on pulse waveform. OBJECTIVE/HYPOTHESES: In this study, we examined whether the effectiveness of polyphasic TMS can be increased by using a pulse profile that consists...

  20. "Eg vil ha graut og sjokomelk" : foreldre sine erfaringar med opplæring og bruk av PECS heime

    OpenAIRE

    Sande, Anita

    2006-01-01

    SAMANDRAG Menneske som av ulike årsaker ikkje kan formidle seg via talespråk kan ha nytte av alternativ eller supplerande kommunikasjon (ASK). The Picture Exchange Communication System (PECS) er eit kommunikasjonssystem basert på grafiske symbol, som ei aukande gruppe barn og unge utan talespråk tek i bruk. Det spesialpedagogiske hjelpeapparatet i Norge er i stor grad retta inn mot å rettleie det pedagogiske personalet, i barnehage og skule, som arbeider med barn med særskilde vanska...

  1. Ribosomal Biogenesis and Translational Flux Inhibition by the Selective Inhibitor of Nuclear Export (SINE XPO1 Antagonist KPT-185.

    Directory of Open Access Journals (Sweden)

    Yoko Tabe

    Full Text Available Mantle cell lymphoma (MCL is an aggressive B-cell lymphoma characterized by the aberrant expression of several growth-regulating, oncogenic effectors. Exportin 1 (XPO1 mediates the nucleocytoplasmic transport of numerous molecules including oncogenic growth-regulating factors, RNAs, and ribosomal subunits. In MCL cells, the small molecule KPT-185 blocks XPO1 function and exerts anti-proliferative effects. In this study, we investigated the molecular mechanisms of this putative anti-tumor effect on MCL cells using cell growth/viability assays, immunoblotting, gene expression analysis, and absolute quantification proteomics. KPT-185 exhibited a p53-independent anti-lymphoma effect on MCL cells, by suppression of oncogenic mediators (e.g., XPO1, cyclin D1, c-Myc, PIM1, and Bcl-2 family members, repression of ribosomal biogenesis, and downregulation of translation/chaperone proteins (e.g., PIM2, EEF1A1, EEF2, and HSP70 that are part of the translational/transcriptional network regulated by heat shock factor 1. These results elucidate a novel mechanism in which ribosomal biogenesis appears to be a key component through which XPO1 contributes to tumor cell survival. Thus, we propose that the blockade of XPO1 could be a promising, novel strategy for the treatment of MCL and other malignancies overexpressing XPO1.

  2. Ribosomal Biogenesis and Translational Flux Inhibition by the Selective Inhibitor of Nuclear Export (SINE) XPO1 Antagonist KPT-185.

    Science.gov (United States)

    Tabe, Yoko; Kojima, Kensuke; Yamamoto, Shinichi; Sekihara, Kazumasa; Matsushita, Hiromichi; Davis, Richard Eric; Wang, Zhiqiang; Ma, Wencai; Ishizawa, Jo; Kazuno, Saiko; Kauffman, Michael; Shacham, Sharon; Fujimura, Tsutomu; Ueno, Takashi; Miida, Takashi; Andreeff, Michael

    2015-01-01

    Mantle cell lymphoma (MCL) is an aggressive B-cell lymphoma characterized by the aberrant expression of several growth-regulating, oncogenic effectors. Exportin 1 (XPO1) mediates the nucleocytoplasmic transport of numerous molecules including oncogenic growth-regulating factors, RNAs, and ribosomal subunits. In MCL cells, the small molecule KPT-185 blocks XPO1 function and exerts anti-proliferative effects. In this study, we investigated the molecular mechanisms of this putative anti-tumor effect on MCL cells using cell growth/viability assays, immunoblotting, gene expression analysis, and absolute quantification proteomics. KPT-185 exhibited a p53-independent anti-lymphoma effect on MCL cells, by suppression of oncogenic mediators (e.g., XPO1, cyclin D1, c-Myc, PIM1, and Bcl-2 family members), repression of ribosomal biogenesis, and downregulation of translation/chaperone proteins (e.g., PIM2, EEF1A1, EEF2, and HSP70) that are part of the translational/transcriptional network regulated by heat shock factor 1. These results elucidate a novel mechanism in which ribosomal biogenesis appears to be a key component through which XPO1 contributes to tumor cell survival. Thus, we propose that the blockade of XPO1 could be a promising, novel strategy for the treatment of MCL and other malignancies overexpressing XPO1.

  3. Comparing the effect of pause duration on threshold interaural time differences between exponential and squared-sine envelopes (L).

    Science.gov (United States)

    Dietz, Mathias; Wendt, Torben; Ewert, Stephan D; Laback, Bernhard; Hohmann, Volker

    2013-01-01

    Recently two studies [Klein-Hennig et al., J. Acoust. Soc. Am. 129, 3856-3872 (2011); Laback et al., J. Acoust. Soc. Am. 130, 1515-1529 (2011)] independently investigated the isolated effect of pause duration on sensitivity to interaural time differences (ITD) in the ongoing stimulus envelope. The steepness of the threshold ITD as a function of pause duration functions differed considerably across studies. The present study, using matched carrier and modulation frequencies, directly compared threshold ITDs for the two envelope flank shapes from those studies. The results agree well when defining the metric of pause duration based on modulation depth sensitivity.

  4. A Measurement of the CP Parameter sine two beta Using Fully Reconstructed B to ccbar Decays at the BABAR Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Charles, Eric A

    2003-04-22

    This dissertation presents a measurement of the time-dependent CP-violating asymmetries in the neutral B-meson system performed with data collected with the BABAR detector at the PEP-II asymmetric-energy B Factory at the Stanford Linear Accelerator Center. The data sample used consists of 29.7 fb{sup -1} collected at the {Upsilon}(4S) resonance and 3.9 fb{sup -1} collected off-resonance. We analyze three samples of fully-reconstructed B-meson decays: a sample of decays to CP eigenstates in the modes J/{psi} K{sub s}{sup 0}, {psi}(2S) K{sub s}{sup 0}, {chi}{sub cl} K{sub s}{sup 0}, and J/{psi} K*{sup 0} (822 events); as well as both charged (14304 events) and neutral (10457 events) B decays to flavor-eigenstates including D{sup (*)} and {pi}/{rho}/{alpha}{sub 1}. In all cases, the proper decay time difference between the reconstructed B-meson and the recoiling B-meson is determined by measuring the separation of the two decay vertices. Furthermore, the flavor of the recoiling B-meson is tagged using a neural network algorithm. We use the flavor-eigenstate samples to calibrate both the vertexing and tagging performance. We measure the amplitude of the CP asymmetry, sin2{beta} = 0.61 {+-} 0.14(stat) {+-} 0.06(syst). These results indicate the existence of indirect CP violation in the B-meson system.

  5. Proles sine matre creata: The Promethean Urge in the History of the Human Body in the West

    Directory of Open Access Journals (Sweden)

    Montiel, Luis

    2013-06-01

    Full Text Available Since the beginning of modernity there has been an observable tendency in Western thought to consider the human body as susceptible of technical manipulation, to the extreme of conceiving the possibility of manufacturing it. The figures of the homunculus and the automaton, the heirs of the Golem, represent the clearest embodiment of this aspiration. This paper explores the psychology underlying this plan, based on the psychological theory of C.G. Jung, and developed more recently by J. Hillman, on the hypothesis that the plan involves the denial of the feminine and, therefore, of the more truly psychological aspects of humanity, in the name of a unilaterally rationalistic and materialistic worldview. From the viewpoint of the authors mentioned, the mythicalpsychological reference capable of providing the fundamental key to this project would be Prometheus.Desde los inicios de la modernidad puede detectarse en el pensamiento occidental una tendencia a pensar el cuerpo humano como susceptible de manipulación técnica, hasta el extremo de concebir la posibilidad de fabricarlo. Las figuras del homúnculo y el autómata, herederas de la del gólem, representan las cristalizaciones más evidentes de esta pretensión. El presente trabajo pretende explorar la psicología que está en la base de este designio a partir de la teoría psicológica de C.G. Jung desarrollada más recientemente por J. Hillman, sobre la hipótesis de que dicho proyecto implica la negación de lo femenino y, con ello, de los aspectos más propiamente psíquicos de lo humano, al servicio de una cosmovisión unilateralmente racionalista y materialista. El referente mítico –psicológico, en la perspectiva de los autores mencionados- capaz de suministrar las claves profundas de ese proyecto sería Prometeo.

  6. Reliability and Validity: A Sine Qua Non for Fair Assessment of Undergraduate Technical and Vocational Education Projects in Nigerian Universities

    Science.gov (United States)

    John, A. C.

    2015-01-01

    The aim of the study was to examine the importance of reliability and validity as necessary foundation for fair assessment. The concepts of reliability, validity, fair assessment and their relationships were analysed. Qualities of fair assessment were discussed. A number of recommendations were made to make assessors be more cautious in award of…

  7. Transcranial magnetic stimulation with a half-sine wave pulse elicits direction-specific effects in human motor cortex

    DEFF Research Database (Denmark)

    Jung, Nikolai H; Delvendahl, Igor; Pechmann, Astrid

    2012-01-01

    Transcranial magnetic stimulation (TMS) commonly uses so-called monophasic pulses where the initial rapidly changing current flow is followed by a critically dampened return current. It has been shown that a monophasic TMS pulse preferentially excites different cortical circuits in the human motor...

  8. Sapientiam sine eloquentia prodesse non est dubium: the rapport of wisdom and eloquence in the work of Isidore of Seville

    Directory of Open Access Journals (Sweden)

    Elena Marey

    2013-02-01

    Full Text Available The works of Isidore of Seville reveal several levels of knowledge. The fi rst and the highest is wisdom (sapientia, which according to Isidore, is knowledge of divine things. This wisdom will most definitely lead the initiate to salvation and the Kingdom of Heaven. But the specific quality of wisdom is interpreted by Isidore in diff erent ways according to his various works. In those works which possess an encyclopedic character («Etymologies» and the first book of «Differences», wisdom involves an understanding of how the world and the whole of the cosmos are organised. A wise man is able to comprehend the causes of both the visible and the heavenly world. On the contrary, a person’s rationality (prudentia is oriented towards worldly and secular things. It aims at distinguishing between good and evil and how best to arrange one’s own life and final destiny. Rationality is connected with knowledge (scientia, which is bookish learning, and which Isidore treats as a part of philosophy. At the same time, rationality and knowledge act as instruments for the gaining of wisdom (sapientia. Thus wisdom is linked also with the art of speaking well (eloquentia. In his works meant for a clerical readership, particularly the second book of the «Differences» and the «Sentences», wisdom is opposed to vain mundane knowledge. In these works Isidore affirms that mere eloquence is alien to wisdom and that true wisdom is to be cherished precisely because of its lack of pretention. In the context of these works, wisdom is geared only to the living of a devout life and towards the final aim of the salvation of one’s soul. The differences in the interpretation of the word sapientia can be easily explained by the differences in literary genre among the various works as well as by the readers for whom the various works were intended by the author.

  9. Sine Labe. Immaculatism in 15th to 17th-Century Spain: The Social Projection of a Religious Imaginary

    Directory of Open Access Journals (Sweden)

    Ruiz-Gálvez Priego, Estrella

    2008-12-01

    Full Text Available Immaculatism, the devotion to the Virgin Mary, is an area of research of especial relevance for the history of social and religious mentalities. In Spain, it became a Matter of State from the 15th to the 17th centuries. The author aims to unravel how it was that such an abstruse and seemingly foreign-to-everyday-concerns theological subject turned into a social issue. Rooted in the theological discourse concerning human nature as “stained”, the concept of “original sin” began in the 13th century to be understood in terms of “infidelity”. In 1215, the 4th Lateran Council established a system of signs as markers for “infidels”, the first step toward an assimilation of the notions of fidelity/infidelity into those of trustworthiness/unloyalty which would later mean the association of the concept of original sin with that of the sin of the converts. In addition, the jural notions of Pactum and Fides, basis of the Feudal Contract, would inform the relationships between Man and God. Worshiping the Precious Blood of Jesus would impinge upon the so-called statutes for “Cleanliness” and “Nobility” of blood. This statutory definition of one’s blood would pass to one’s descendants, its formulation in terms of purity/impurity determining one’s social integration or exclusion.El inmaculismo, devoción a la Virgen, constituye un campo de investigación particularmente interesante para la historia de las mentalidades sociales y religiosas, llegando a ser asunto de Estado en la España de los siglos XV al XVIII. Nuestro propósito es elucidar cómo pudo llegar a convertirse en cuestión social un asunto de teología tan árduo y aparentemente tan alejado de lo cotidiano. Partiendo del discurso sobre la naturaleza humana “manchada” de los teólogos, llegamos al momento (siglo XIII en que la “mácula original” empieza a traducirse en términos de “infidelidad”. Las marcas decretadas por el IV Concilio de Letrán (1215 para señalar a los “infieles” son el primer paso para una asimilación entre las nociones de fidelidad/infidelidad y de fiabilidad/felonía; un paso que llevará a asimilar la mácula original a la mácula de los orígenes conversos. Las nociones jurídicas de Pacto y Fides, base del contrato feudal, servirán también para traducir las relaciones entre el hombre y Dios. El culto a la Preciosa Sangre de Cristo repercutirá en los estatutos llamados de “Limpieza” y “Nobleza” de sangre. El estatuto de la sangre será vehículo de transmisión; su formulación en términos de pureza/impureza condicionará la inserción o la exclusión social.

  10. Effects of using coding potential, sequence conservation and mRNA structure conservation for predicting pyrroly-sine containing genes

    DEFF Research Database (Denmark)

    Have, Christian Theil; Zambach, Sine; Christiansen, Henning

    2013-01-01

    Background Pyrrolysine (the 22nd amino acid) is in certain organisms and under certain circumstances encoded by the amber stop codon, UAG. The circumstances driving pyrrolysine translation are not well understood. The involvement of a predicted mRNA structure in the region downstream UAG has been...... these clusters according to several features that may influence pyrrolysine translation. The ranking effects of different features are assessed and we propose a weighted combination of these features which best explains the currently known pyrrolysine incorporating genes. We devote special attention...... for prediction of pyrrolysine incorporating genes in genomes of bacteria and archaea leading to insights about the factors driving pyrrolysine translation and identification of new gene candidates. The method predicts known conserved genes with high recall and predicts several other promising candidates...

  11. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Measuring ... About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs File ...

  12. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Address What's this? Submit What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & Obesity ... Address What's this? Submit What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & Obesity ...

  13. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Intensity The amount of energy used by the body per minute of activity. The table below lists ... upon the amount of energy used by the body while doing the activity. Top of Page Moderate ...

  14. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... for a breath. Absolute Intensity The amount of energy used by the body per minute of activity. ... or vigorous-intensity based upon the amount of energy used by the body while doing the activity. ...

  15. Active Marine Station Metadata

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Active Marine Station Metadata is a daily metadata report for active marine bouy and C-MAN (Coastal Marine Automated Network) platforms from the National Data...

  16. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... relative intensity and absolute intensity. Relative Intensity The level of effort required by a person to do an activity. When using relative intensity, people pay attention to how physical activity affects their heart rate ...

  17. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community Strategies Worksite Physical Activity Steps ... Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram Listen Watch ...

  18. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More Physical Activity MMWR Data Highlights State Indicator Report on Physical Activity, 2014 Recommendations & Guidelines Fact Sheets & ...

  19. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... intensity, people pay attention to how physical activity affects their heart rate and breathing. The talk test ... Physical Activity, and Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube ...

  20. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... and absolute intensity. Relative Intensity The level of effort required by a person to do an activity. When using relative intensity, people pay attention to how physical activity affects their heart rate ...

  1. Active ageing technologies

    DEFF Research Database (Denmark)

    Lassen, Aske Juul

    In the recent decade the concept of active aging has become important in the Western hemisphere. The World Health Organization and The European Union have staged active aging as a core policy area and initiated programs of physical activity, independence and prolonged working lives among...... the elderly. As part of this rearticulation of old age, many new technologies take form. This paper uses a wide concept of technologies (devices, regimes, strategies and ways of doing) and argues that technologies form active aging subjectivities, and on the other hand, that these subjectivities...... of physical and productive activity; e.g. that a game of billiards is a technology of active aging. Thus, active aging is enacted in the socio-material practices of the technologies in this paper. The paper contributes with a strengthening of the concept of active aging, by focusing on entangled practices...

  2. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... activity. When using relative intensity, people pay attention to how physical activity affects their heart rate and breathing. The talk test is a simple way to measure relative intensity. In general, if you're ...

  3. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient ... What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient ...

  4. Preschoolers’ Physical Activity Behaviours

    Science.gov (United States)

    Irwin, Jennifer D.; He, Meizi; Bouck, L. Michelle Sangster; Tucker, Patricia; Pollett, Graham L.

    2016-01-01

    Objectives To understand parents’ perspectives of their preschoolers’ physical activity behaviours. Methods A maximum variation sample of 71 parents explored their preschoolers’ physical activity behaviours through 10 semi-structured focus group discussions. Results Parents perceived Canada’s Physical Activity Guidelines for Children as inadequate; that their preschoolers get and need more than 30–90 minutes of activity daily; and that physical activity habits must be established during the preschool years. Nine barriers against and facilitators toward adequate physical activity were proposed: child’s age, weather, daycare, siblings, finances, time, society and safety, parents’ impact, and child’s activity preferences. Discussion The need for education and interventions that address current barriers are essential for establishing physical activity as a lifestyle behaviour during early childhood and, consequently, helping to prevent both childhood and adulthood obesity. PMID:16625802

  5. USAID Activity Locations

    Data.gov (United States)

    US Agency for International Development — The USAID Activities dataset is a snapshot of activities supported by USAID including their geographical locations within countries at the time of the snapshot. The...

  6. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local ... Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local ...

  7. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... or vigorous-intensity based upon the amount of energy used by the body while doing the activity. Top of ... 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National ...

  8. Major operations and activities

    Energy Technology Data Exchange (ETDEWEB)

    Black, D.G.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the major operations and activities on the site. These operations and activities include site management, waste management, environmental restoration and corrective actions, and research and technology development.

  9. Family Activities for Fitness

    Science.gov (United States)

    Grosse, Susan J.

    2009-01-01

    This article discusses how families can increase family togetherness and improve physical fitness. The author provides easy ways to implement family friendly activities for improving and maintaining physical health. These activities include: walking, backyard games, and fitness challenges.

  10. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs ... Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs ...

  11. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... About Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More Physical Activity ... Windows Media Player, 4:48 More videos Here are some ways to understand and measure the intensity ...

  12. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... activity. If you're doing vigorous-intensity activity, you will not be able to say more than a few words without pausing for a breath. Absolute ... ABOUT About CDC Jobs Funding LEGAL ...

  13. Activity-based design

    DEFF Research Database (Denmark)

    Andersen, Peter Bøgh

    2006-01-01

      In many types of activities communicative and material activities are so intertwined that the one cannot be understood without taking the other into account. This is true of maritime and hospital work that are used as examples in the paper. The spatial context of the activity is also important:...... and automatic machinery can replace one another in an activity. It also gives an example of how to use the framework for design....

  14. Comparing Active Vision Models

    NARCIS (Netherlands)

    Croon, G.C.H.E. de; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2009-01-01

    Active vision models can simplify visual tasks, provided that they can select sensible actions given incoming sensory inputs. Many active vision models have been proposed, but a comparative evaluation of these models is lacking. We present a comparison of active vision models from two different

  15. Computers + Student Activities Handbook.

    Science.gov (United States)

    Masie, Elliott; Stein, Michele

    Designed to provide schools with the tools to start utilizing computers for student activity programs without additional expenditures, this handbook provides beginning computer users with suggestions and ideas for using computers in such activities as drama clubs, yearbooks, newspapers, activity calendars, accounting programs, room utilization,…

  16. Comparing active vision models

    NARCIS (Netherlands)

    Croon, G.C.H.E. de; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2009-01-01

    Active vision models can simplify visual tasks, provided that they can select sensible actions given incoming sensory inputs. Many active vision models have been proposed, but a comparative evaluation of these models is lacking. We present a comparison of active vision models from two different

  17. Recurrent radio activity in active galactic nuclei

    Directory of Open Access Journals (Sweden)

    Jamrozy M.

    2012-12-01

    Full Text Available There has been a growing body of persuasive evidence to indicate that AGN activity, powered by mass accretion onto a supermassive black hole, can involve multiple episodes. Thus thinking of jet activity as occurring within a unique brief period in the life of a galaxy is no longer valid. The most striking examples of AGNs with recurrent jet activity are the double-double radio sources, which contain two or more pairs of distinct lobes on the opposite sides of a parent optical object. On the other hand, we have now conclusive arguments that galaxy mergers and interactions are principal triggers for AGNs. Quite a number of examples of powerful radio sources hosted by galaxies with peculiar optical morphologies (tails, shells, dust-lanes, etc. can be cited to support such a scenario. The structure and spectra of extended radio emission from radio galaxies, with sizes ranging up to a few Mpc, can provide a lot of information on the history of the central AGN activity, while the spectral and dynamical ages of these extended radio lobes could be used to constrain the time scales of recurrent AGN activity.

  18. Proteolytic activities in yeast.

    Science.gov (United States)

    Saheki, T; Holzer, H

    1975-03-28

    Studies on the mechanism and time course of the activation of proteinases A (EC 3.4.23.8), B (EC 3.4.22.9) and C (EC 3.4.12.--) in crude yeast extracts at pH 5.1 and 25 degrees C showed that the increase in proteinase B activity is paralleled with the disappearance of proteinase B inhibitor. Addition of purified proteinase A to fresh crude extracts accelerates the inactivation of the proteinase B inhibitor and the appearance of maximal activities of proteinases B and C. The decrease of proteinase B inhibitor activity and the increase of proteinase B activity are markedly retarded by the addition of pepstatin. Because 10-minus 7 M pepstatin completely inhibits proteinase A without affecting proteinase B activity, this is another indication for the role of proteinase A during the activation of proteinase B. Whereas extracts of yeast grown on minimal medium reached maximal activation of proteinases B and C after 20 h of incubation at pH 5.1 and 25 degrees C, extracts of yeast grown on complete medium had to be incubated for about 100 h. In the latter case, the addition of proteinas A results in maximal activation of proteinases B and C and disappearance of proteinase B inhibitor activity only after 10--20 h of incubation. With the optimal conditions, the maximal activities of proteinases A, B and C, as well as of the proteinase B inhibitor, were determined in crude extracts of yeast that had been grown batchwise for different lengths of time either on minimal or on complete medium. Upon incubation, all three proteinases were activated by several times their initial activity. This reflects the existence of proteolytically degradable inhibitors of the three proteinases and together with the above mentioned observations it demonstrates that the "activation" of yeast proteinases A, B and C upon incubation results from the proteolytic digestion of inhibitors rather than from activation of inactive zymogens by limited proteolysis.

  19. Accessibility, activity participation and location of activities

    DEFF Research Database (Denmark)

    Næss, Petter

    2006-01-01

    By investigating relationships between residential location and the availability of facilities, location of activities, trip distances, activity participation and trip frequencies, this paper seeks to contribute to a more detailed and nuanced understanding of the relationships between residential...... outweigh each other. However, differences in trip distances due to the location of the dwelling relative to concentrations of facilities translate into substantially longer total travelling distances among suburbanites than among inner-city residents....... location and the amount of daily-life travel in an urban region. The empirical data are from a comprehensive study of residential location and travel in Copenhagen Metropolitan Area. Differences between inner- and outer-area residents in activity frequencies and trip frequencies are modest and partly...

  20. Factor XII Contact Activation.

    Science.gov (United States)

    Naudin, Clément; Burillo, Elena; Blankenberg, Stefan; Butler, Lynn; Renné, Thomas

    2017-11-01

    Contact activation is the surface-induced conversion of factor XII (FXII) zymogen to the serine protease FXIIa. Blood-circulating FXII binds to negatively charged surfaces and this contact to surfaces triggers a conformational change in the zymogen inducing autoactivation. Several surfaces that have the capacity for initiating FXII contact activation have been identified, including misfolded protein aggregates, collagen, nucleic acids, and platelet and microbial polyphosphate. Activated FXII initiates the proinflammatory kallikrein-kinin system and the intrinsic coagulation pathway, leading to formation of bradykinin and thrombin, respectively. FXII contact activation is well characterized in vitro and provides the mechanistic basis for the diagnostic clotting assay, activated partial thromboplastin time. However, only in the past decade has the critical role of FXII contact activation in pathological thrombosis been appreciated. While defective FXII contact activation provides thromboprotection, excess activation underlies the swelling disorder hereditary angioedema type III. This review provides an overview of the molecular basis of FXII contact activation and FXII contact activation-associated disease states. Thieme Medical Publishers 333 Seventh Avenue, New York, NY 10001, USA.

  1. Marine Biology Activities. Ocean Related Curriculum Activities.

    Science.gov (United States)

    Pauls, John

    The ocean affects all of our lives. Therefore, awareness of and information about the interconnections between humans and oceans are prerequisites to making sound decisions for the future. Project ORCA (Ocean Related Curriculum Activities) has developed interdisciplinary curriculum materials designed to meet the needs of students and teachers…

  2. Participatory Activities in Practice

    DEFF Research Database (Denmark)

    Gottlieb, Frederik; Sørensen, Vicki

    Through a series of participatory activities within a product development project, we analyse how these activities influence the design process and how new meaning is created through the interaction of crossing intentions (Larsen, 2010). By focusing on a specific theme in the project we reflect...... on how participatory activities are a key part in establishing important interactions between participants resulting in new design approaches. At other times participatory activities become a part of blurring these new approaches when performing new participatory activities towards developing new...... iterations of the concept in focus. We conclude that participatory activities can play a key part in the uptake of user knowledge but that a participatory innovation approach of establishing collaboration between crossing intentions can as well be considered provocative and as such, result in resistance...

  3. Mechanics of active surfaces

    Science.gov (United States)

    Salbreux, Guillaume; Jülicher, Frank

    2017-09-01

    We derive a fully covariant theory of the mechanics of active surfaces. This theory provides a framework for the study of active biological or chemical processes at surfaces, such as the cell cortex, the mechanics of epithelial tissues, or reconstituted active systems on surfaces. We introduce forces and torques acting on a surface, and derive the associated force balance conditions. We show that surfaces with in-plane rotational symmetry can have broken up-down, chiral, or planar-chiral symmetry. We discuss the rate of entropy production in the surface and write linear constitutive relations that satisfy the Onsager relations. We show that the bending modulus, the spontaneous curvature, and the surface tension of a passive surface are renormalized by active terms. Finally, we identify active terms which are not found in a passive theory and discuss examples of shape instabilities that are related to active processes in the surface.

  4. Solar Activity and TECHNOSPHERE

    Science.gov (United States)

    Kuznetsov, V. D.

    2017-05-01

    A review of solar activity factors impacting on the near-Earth space and technosphere are given. Solar activity in the form of enhanced fluxes of hard electromagnetic and corpuscular radiation, solar wind streams and mass ejections is considered as a principal source of space weather creating the dangerous for the astronauts, satellites, International Space Station and for the ground technical systems. The examples of effects of solar activity on the space and ground technosphere are given.

  5. Confinement for Active Objects

    OpenAIRE

    Florian Kammuller

    2014-01-01

    In this paper, we provide a formal framework for the security of distributed active objects. Active objects com-municate asynchronously implementing method calls via futures. We base the formal framework on a security model that uses a semi-lattice to enable multi-lateral security crucial for distributed architectures. We further provide a security type system for the programming model ASPfun of functional active objects. Type safety and a confinement property are presented. ASPfun thus reali...

  6. CDBG Public Services Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to public services, including senior services, legal services, youth services, employment training, health services, homebuyer counseling, food...

  7. CDBG Housing Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to housing, including multifamily rehab, housing services, code enforcement, operation and repair of foreclosed property and public housing...

  8. Physical activity and sarcopenia.

    Science.gov (United States)

    Pillard, Fabien; Laoudj-Chenivesse, Dalila; Carnac, Gilles; Mercier, Jacques; Rami, Jacques; Rivière, Daniel; Rolland, Yves

    2011-08-01

    Physical activity can be a valuable countermeasure to sarcopenia in its treatment and prevention. In considering physical training strategies for sarcopenic subjects, it is critical to consider personal and environmental obstacles to access opportunities for physical activity for any patient with chronic disease. This article presents an overview of current knowledge of the effects of physical training on muscle function and the physical activity recommended for sarcopenic patients. So that this countermeasure strategy can be applied in practice, the authors propose a standardized protocol for prescribing physical activity in chronic diseases such as sarcopenia. Copyright © 2011 Elsevier Inc. All rights reserved.

  9. CDBG Economic Development Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to economic development, including commercial or industrial rehab, commercial or industrial land acquisition, commercial or industrial...

  10. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... What's this? Submit Button Our Division About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs ...

  11. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Adults Overcoming Barriers Measuring Physical Activity Intensity Target Heart Rate & Estimated Maximum Heart Rate Perceived Exertion (Borg Rating of Perceived Exertion Scale) ...

  12. Active Flow Control Activities at NASA Langley

    Science.gov (United States)

    Anders, Scott G.; Sellers, William L., III; Washburn, Anthony E.

    2004-01-01

    NASA Langley continues to aggressively investigate the potential advantages of active flow control over more traditional aerodynamic techniques. This paper provides an update to a previous paper and describes both the progress in the various research areas and the significant changes in the NASA research programs. The goals of the topics presented are focused on advancing the state of knowledge and understanding of controllable fundamental mechanisms in fluids as well as to address engineering challenges. An organizational view of current research activities at NASA Langley in active flow control as supported by several projects is presented. On-center research as well as NASA Langley funded contracts and grants are discussed at a relatively high level. The products of this research are to be demonstrated either in bench-top experiments, wind-tunnel investigations, or in flight as part of the fundamental NASA R&D program and then transferred to more applied research programs within NASA, DOD, and U.S. industry.

  13. Habitats, activities, and signs

    DEFF Research Database (Denmark)

    Andersen, Peter Bøgh; Brynskov, Martin

    2004-01-01

    Digital habitats is a framework for designing and modeling environments for activities that involve mobile and embedded computing systems. This paper 1) introduces the basic concepts of the framework, i.e. activity, thematic role, and the three ‘dimensions’ of a habitat: physical, informational, ...

  14. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More Physical Activity MMWR ... Tracking Stair Usage Project Checklist CDC’s Example Related Resources Walking Step It Up! Surgeon General’s Call to ...

  15. Emotionally Intense Science Activities

    Science.gov (United States)

    King, Donna; Ritchie, Stephen; Sandhu, Maryam; Henderson, Senka

    2015-01-01

    Science activities that evoke positive emotional responses make a difference to students' emotional experience of science. In this study, we explored 8th Grade students' discrete emotions expressed during science activities in a unit on Energy. Multiple data sources including classroom videos, interviews and emotion diaries completed at the end of…

  16. Active Students in Webinars

    Science.gov (United States)

    Kolås, Line; Nordseth, Hugo; Yri, Jørgen Sørlie

    2015-01-01

    To ensure student activity in webinars we have defined 10 learning tasks focusing on production and communication e.g. collaborative writing, discussion and polling, and investigated how the technology supports the learning activities. The three project partners in the VisPed-project use different video-conferencing systems, and we analyzed how it…

  17. Coordinating Shared Activities

    Science.gov (United States)

    Clement, Bradley

    2004-01-01

    Shared Activity Coordination (ShAC) is a computer program for planning and scheduling the activities of an autonomous team of interacting spacecraft and exploratory robots. ShAC could also be adapted to such terrestrial uses as helping multiple factory managers work toward competing goals while sharing such common resources as floor space, raw materials, and transports. ShAC iteratively invokes the Continuous Activity Scheduling Planning Execution and Replanning (CASPER) program to replan and propagate changes to other planning programs in an effort to resolve conflicts. A domain-expert specifies which activities and parameters thereof are shared and reports the expected conditions and effects of these activities on the environment. By specifying these conditions and effects differently for each planning program, the domain-expert subprogram defines roles that each spacecraft plays in a coordinated activity. The domain-expert subprogram also specifies which planning program has scheduling control over each shared activity. ShAC enables sharing of information, consensus over the scheduling of collaborative activities, and distributed conflict resolution. As the other planning programs incorporate new goals and alter their schedules in the changing environment, ShAC continually coordinates to respond to unexpected events.

  18. Global physical activity levels

    DEFF Research Database (Denmark)

    Hallal, Pedro C; Andersen, Lars Bo; Bull, Fiona C

    2012-01-01

    To implement effective non-communicable disease prevention programmes, policy makers need data for physical activity levels and trends. In this report, we describe physical activity levels worldwide with data for adults (15 years or older) from 122 countries and for adolescents (13-15-years...

  19. Activation force splines

    DEFF Research Database (Denmark)

    Engell-Nørregård, Morten Pol; Erleben, Kenny

    We present a method for simulating the active contraction of deformable models, usable for interactive animation of soft deformable objects. We present a novel physical principle as the governing equation for the coupling between the low dimensional 1D activation force model and the higher...

  20. Tendinopathy and Doppler activity

    DEFF Research Database (Denmark)

    Boesen, M I; Koenig, M J; Torp-Pedersen, S

    2006-01-01

    Intratendinous Doppler activity has been interpreted as an equivalent of neovessels in the Achilles tendon and as a sign of tendinosis (AT).......Intratendinous Doppler activity has been interpreted as an equivalent of neovessels in the Achilles tendon and as a sign of tendinosis (AT)....

  1. The Activity of Play

    DEFF Research Database (Denmark)

    Pichlmair, Martin

    This paper presents Activity Theory as a framework for understanding the action of playing games with the intention of building a foundation for the creation of new game design tools and methods. Activity Theory, an epistemological framework rooted in Soviet psychology of the first half of the 20...

  2. Respirometry in activated sludge

    NARCIS (Netherlands)

    Spanjers, H.

    1993-01-01

    The purpose of the study was (1) to develop a respiration meter capable of continuously measuring, using different procedures, the oxygen uptake rate of activated sludge and (2) to expand knowledge about respiration related characteristics of wastewater and activated sludge.

    A

  3. [Field Learning Activities].

    Science.gov (United States)

    Nolde Forest Environmental Education Center, Reading, PA.

    Seventy field activities, pertinent to outdoor, environmental studies, are described in this compilation. Designed for elementary and junior high school students, the activities cover many discipline areas--science, social studies, language arts, health, history, mathematics, and art--and many are multidisciplinary in use. Topics range from soil…

  4. Mental activity and culture

    NARCIS (Netherlands)

    Hofstede, Gert Jan

    2018-01-01

    How does culture affect mental activity? That question, applied to the design of social agents, is tackled in this chapter. Mental activity acts on the perceived outside world. It does so in three steps: perceive, interpret, select action. We see that when culture is taken into account, objective

  5. Obesity and physical activity.

    NARCIS (Netherlands)

    Westerterp, K.R.

    1999-01-01

    Department of Human Biology, Maastricht University, The Netherlands. k.westerterp@hb.unimaas.nl OBJECTIVES: Three aspects of obesity and physical activity are reviewed: whether the obese are inactive; how the activity level can be increased; and which are the effects of an increase in physical

  6. ANTHROPOGENIC ACTIVITIES THREATENING THE ...

    African Journals Online (AJOL)

    Osondu

    2012-02-17

    Feb 17, 2012 ... Abstract. Abundant fauna and flora resources in Nigeria are being threatened due to the increasing rate of anthropogenic activities across the protected areas in the country. This study examined anthropogenic activities threatening the natural resources considered to be of ecotourism value in Old Oyo ...

  7. Peak Longevity Physical Activity

    Science.gov (United States)

    People who engage in three to five times the recommended minimum level of leisure-time physical activity derive the greatest benefit in terms of mortality reduction when compared with people who do not engage in leisure-time physical activity.

  8. Measuring children's physical activity

    DEFF Research Database (Denmark)

    Schneller, Mikkel Bo; Bentsen, Peter; Nielsen, Glen

    2017-01-01

    INTRODUCTION: Accelerometer-based physical activity monitoring has become the method of choice in many large-scale physical activity (PA) studies. However, there is an ongoing debate regarding the placement of the device, the determination of device wear time, and how to solve a lack of participant...

  9. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Measuring Physical Activity Intensity Recommend on Facebook Tweet Share Compartir For more help with what counts as aerobic activity, watch this video: Windows Media Player, 4:48 More videos Here are some ...

  10. Activity Book: Ocean Ecology.

    Science.gov (United States)

    Learning, 1992

    1992-01-01

    Presents a collection of activities to help elementary students study ocean ecology. The activities have students investigate ocean inhabitants, analyze animal adaptations, examine how temperature and saltiness affect ocean creatures, and learn about safeguarding the sea. Student pages offer reproducible learning sheets. (SM)

  11. Plasminogen activation in cancer

    NARCIS (Netherlands)

    Reijerkerk, Arie

    2004-01-01

    The subject of this thesis focusses on the role of the plasminogen activation system in angiogenesis and cancer. The plasminogen activation system regulates fibrinolysis and controls cell migration and invasion by plasmin-mediated matrix proteolysis. Plasmin is formed upon cleavage of the zymogen

  12. ANTHROPOGENIC ACTIVITIES THREATENING THE ...

    African Journals Online (AJOL)

    Osondu

    2012-02-17

    Feb 17, 2012 ... anthropogenic activities threatening the natural resources considered to be of ecotourism value in Old Oyo National Park. ... Result of the analysis showed that human activities had negative impacts on the Park resources. Recommendations .... Patrol Team (PPT) or the assigned rangers and other diurnal ...

  13. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... CDC’s Example StairWELL Stairwell Appearance Motivational Signs Installing Music Other Ideas to Consider Tracking Stair Usage Project ... an activity. When using relative intensity, people pay attention to how physical activity affects their heart rate ...

  14. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... relative intensity and absolute intensity. Relative Intensity The level of effort required by a person to do an activity. When using relative intensity, people pay attention to how physical activity affects their heart rate and breathing. The talk test is a simple ...

  15. Nutrition Activities Resource Guide.

    Science.gov (United States)

    New York City Board of Education, Brooklyn, NY. Div. of Special Education.

    The resource guide suggests activities to help special education students make appropriate choices about their nutritional habits. It is explained that the activities can be infused into other curriculum areas. The guide consists of five themes and includes performance objectives for each: foods eaten at school (planning a school lunch, keeping a…

  16. Associated Nitrogenase Activity.

    African Journals Online (AJOL)

    The feedback control mechanism in which the demand for fixed N by the plant regulates nitrogenase activity (NA) in legumes as ..... phoenolpyruvate carboxylase in vitro decreases sensitivity to inhibition by L-malate. Plant. Physiology 67:37-42. Silsbury, J.H. (1987). Nitrogenase activity in Trifo- lium subterraneum L. in ...

  17. Analog active filters

    Science.gov (United States)

    Ghausi, M. S.

    1984-01-01

    The evolution of active filters during the time from 1920 to 1980 is considered, taking into account the hardware used to implement a filtering network for voice frequency over 60 years. From 1920 to 1960 the majority of voice-frequency filters was realized as discrete RLC networks. After the development of transistors, it was realized that size and cost reductions could be achieved by replacing the inductors with active networks. In the early 1970's, batch-processed thin-film hybrid integrated circuits began to be employed. The synthesis of transfer functions which are predominantly input/output types is considered. Attention is given to direct realizations, synthesis using component simulation, cascade synthesis, multiple-loop feedback design, active-R and active-C filters, aspects of sensitivity, and switched-capacitor filters.

  18. Ras activation by SOS

    DEFF Research Database (Denmark)

    Iversen, Lars; Tu, Hsiung-Lin; Lin, Wan-Chen

    2014-01-01

    SOS molecules catalyzing nucleotide exchange in H-Ras. Single-molecule kinetic traces revealed that SOS samples a broad distribution of turnover rates through stochastic fluctuations between distinct, long-lived (more than 100 seconds), functional states. The expected allosteric activation of SOS...... by Ras-guanosine triphosphate (GTP) was conspicuously absent in the mean rate. However, fluctuations into highly active states were modulated by Ras-GTP. This reveals a mechanism in which functional output may be determined by the dynamical spectrum of rates sampled by a small number of enzymes, rather......Activation of the small guanosine triphosphatase H-Ras by the exchange factor Son of Sevenless (SOS) is an important hub for signal transduction. Multiple layers of regulation, through protein and membrane interactions, govern activity of SOS. We characterized the specific activity of individual...

  19. Targeting the Nuclear Export Protein XPO1/CRM1 Reverses Epithelial to Mesenchymal Transition.

    Science.gov (United States)

    Azmi, Asfar S; Muqbil, Irfana; Wu, Jack; Aboukameel, Amro; Senapedis, William; Baloglu, Erkan; Bollig-Fischer, Aliccia; Dyson, Gregory; Kauffman, Michael; Landesman, Yosef; Shacham, Sharon; Philip, Philip A; Mohammad, Ramzi M

    2015-11-05

    Here we demonstrate for the first time that targeted inhibition of nuclear exporter protein exportin 1 (XPO1) also known as chromosome maintenance region 1 (CRM1) by Selective Inhibitor of Nuclear Export (SINE) compounds results in reversal of EMT in snail-transduced primary human mammary epithelial cells (HMECs). SINE compounds selinexor (KPT-330) and KPT-185, leptomycin B (LMB as +ve control) but not KPT-301 (-ve control) reverse EMT, suppress mesenchymal markers and consequently induce growth inhibition, apoptosis and prevent spheroid formation. SINE treatment resulted in nuclear retention of snail regulator FBXL5 that was concurrent with suppression of snail and down-regulation of mesenchymal markers. FBXL5 siRNA or transfection with cys528 mut-Xpo1 (lacking SINE binding site) markedly abrogated SINE activity highlighting an XPO1 and FBXL5 mediated mechanism of action. Silencing XPO1 or snail caused re-expression of FBXL5 as well as EMT reversal. Pathway analysis on SINE treated HMECs further verified the involvement of additional F-Box family proteins and confirmed the suppression of snail network. Oral administration of selinexor (15 mg/kg p.o. QoDx3/week for 3weeks) resulted in complete cures (no tumor rebound at 120 days) of HMLER-Snail xenografts. These findings raise the unique possibility of blocking EMT at the nuclear pore.

  20. Who is actively denitrifying in activated sludge?

    DEFF Research Database (Denmark)

    Hansen, Aviaja Anna; Nielsen, Jeppe Lund

    -scale wastewater treatment plant the transcripts (mRNA) of the nirS, nirK and nosZ denitrification genes expressed under acetate or amino acid consumption were amplified, sequenced and identified. This revealed that the majority of the denitrifiers belonged to Alpha- and Betaproteobacteria, while only few...... with Bacteroidetes. Furthermore, potential denitrifying genera of Alpha- and Betaproteobacteria were quantified in the activated sludge with 16S rRNA gene probes for fluorescence in situ hybridization (FISH). This revealed that Aquaspirillum-related bacteria were dominant followed by bacteria related to Azoarcus...... by microautoradiography combined with FISH....

  1. Active Photonic Devices

    Science.gov (United States)

    Della Valle, Giuseppe; Osellame, Roberto

    The chapter is devoted to active photonic devices fabricated by fs-laser writing. After a brief introduction focused on the role played by fs-laser written active devices, Sect. 10.2 briefly reviews the spectroscopical properties of the most interesting active ions so far exploited, namely erbium, ytterbium, neodimium, and bismuth. In Sect. 10.3 the main figures of merit for an active waveguide, namely the internal gain, the insertion loss, the net gain, and the noise figure are introduced and the experimental procedure for accurate gain measurement is also detailed. A thorough review of the active photonic devices demonstrated with the femtosecond laser microfabrication technique is presented in Sects. 10.4, 10.5, and 10.6, where several active waveguides and amplifiers, prototypal lasers, as well as more functionalized laser devices (operating under single longitudinal mode or stable mode-locking regime) are illustrated, respectively. Finally, conclusions and future perspectives of femtosecond-laser micromachining of active photonic devices are provided.

  2. A universe of activities

    Science.gov (United States)

    Armentia, J.; Jáuregui, F.; Gordón, N.; Manzanal, R.

    Since its opening back in november 1993 the Planetarium of Pamplona has gone a long way creating activities related to teaching and communicating Astronomy, Science and other areas of what we call Culture. In this poster we present a summary of some of the most relevant activities that have had an special relevance throughout these years. We will refer to our “School of Stars” in which more than 400 000 students have already been involved and other activities that have been very appreciated by our visitors.

  3. Active Directory cookbook

    CERN Document Server

    Hunter, Laura

    2008-01-01

    When you need practical hands-on support for Active Directory, the updated edition of this extremely popular Cookbook provides quick solutions to more than 300 common (and uncommon) problems you might encounter when deploying, administering, and automating Microsoft's network directory service. For the third edition, Active Directory expert Laura E. Hunter offers troubleshooting recipes based on valuable input from Windows administrators, in addition to her own experience. You'll find solutions for the Lightweight Directory Access Protocol (LDAP), ADAM (Active Directory Application Mode), m

  4. Evoked cavernous activity.

    Science.gov (United States)

    Yilmaz, Uğur; Soylu, Ahmet; Ozcan, Cemal; Kutlu, Ramazan; Güneş, Ali

    2002-01-01

    Corpus cavernosum electromyography has been widely done to evaluate autonomic dysfunction in patients with erectile dysfunction. We assessed the value of corpus cavernosum electromyography, evoked cavernous activity and penile sympathetic skin responses for their accuracy in determining autonomic involvement in cases of erectile dysfunction. We evaluated 75 men with erectile dysfunction by corpus cavernosum electromyography, evoked cavernous activity and penile sympathetic skin response tests at our neurourology laboratory. The etiology of dysfunction was vascular, neurogenic, psychogenic or mixed based on a detailed medical and sexual history, physical examination, electrophysiological and laboratory studies, penile color Doppler ultrasonography, and cavernosography and/or cavernosometry. Autonomic involvement was clinically assessed by systemic findings, such as orthostatic hypotension, impaired gastrointestinal motility, sinus dysrhythmia and secretomotor changes. A concentric electromyography needle placed in the right cavernous body was used to record corpus cavernosum electromyography and evoked cavernous activity. The right median nerve was stimulated electrically with 13 to 16 mA. to determine evoked cavernous activity and the penile sympathetic skin response. The latter response was recorded with silver disc electrodes placed on the left cavernous body. All tests were performed using an electromyography/evoked potential machine. We determined the relationships among corpus cavernosum electromyography, evoked cavernous activity and penile sympathetic skin response tests in respect to etiological factors. The 56 patients with normal corpus cavernosum electromyography activity had also evoked cavernous activity and a penile sympathetic skin response except for 1 with no penile sympathetic skin response but evoked cavernous activity. None of these patients had autonomic neuropathy. Of the 19 patients without corpus cavernosum electromyography activity 11 had

  5. Creative activity and inclusion

    Directory of Open Access Journals (Sweden)

    Shemanov A.Yu.

    2013-09-01

    Full Text Available The aim of the article was to analyze the inclusion potential of art creative activity, namely of theatre performance, in people with disabilities. The article provides examples of disagreements in understanding the significance of these art activities for exercising the rights of people with disabilities to contribute to culture and art and some problems arising here. The conclusion is made that theatre art performed by people with disabilities is gradually changing its function: from being a means of self-affirmation to the determination of its specific place in overall theatre process. These changes confirm the inclusion potential of theatre art activity.

  6. PRCR Classes and Activities

    Data.gov (United States)

    Town of Cary, North Carolina — This data is specific to Parks and Recreation classes, workshops, and activities within the course catalog. It contains an entry for upcoming classes.*This data set...

  7. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Recommendations & Guidelines Fact Sheets & Infographics Social Media Tools Community Strategies Worksite Physical Activity Steps to Wellness Walkability ... Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram Listen Watch ...

  8. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... For this reason, some items on this page will be unavailable. For more information about this message, ... If you're doing vigorous-intensity activity, you will not be able to say more than a ...

  9. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... is not supported by your browser. For this reason, some items on this page will be unavailable. ... Intensity The level of effort required by a person to do an activity. When using relative intensity, ...

  10. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Measuring Physical Activity Intensity Recommend on Facebook Tweet ... Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs File Formats Help: How do I view different ...

  11. Active Materials Characterization Laboratory

    National Research Council Canada - National Science Library

    Lagoudas, Dimitris

    2001-01-01

    The Active Materials Laboratory has recently acquired upgraded and new equipment made possible by the AFOSR in the form of a research grant as a part of the Defense University Research Instrumentation Program...

  12. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... to A to Z list Skip directly to navigation Skip directly to page options Skip directly to ... Statistics Facts About Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults Need More ...

  13. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Motivational Signs Installing Music Other Ideas to Consider Tracking Stair Usage Project Checklist CDC’s Example Related Resources ... Intensity The level of effort required by a person to do an activity. When using relative intensity, ...

  14. OTI Activity Database

    Data.gov (United States)

    US Agency for International Development — OTI's worldwide activity database is a simple and effective information system that serves as a program management, tracking, and reporting tool. In each country,...

  15. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... When using relative intensity, people pay attention to how physical activity affects their heart rate and breathing. ... Malnutrition State and Local Programs File Formats Help: How do I view different file formats (PDF, DOC, ...

  16. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... or vigorous-intensity based upon the amount of energy used by the body while doing the activity. Top of Page Moderate Intensity Walking briskly (3 miles per hour or faster, but ...

  17. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... updated: June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram Listen Watch ...

  18. Bax activation by Bim?

    National Research Council Canada - National Science Library

    Czabotar, P E; Colman, P M; Huang, D C S

    2009-01-01

    .... Although some data support a role for certain BH3-only proteins, such as Bim or tBid, to directly activate Bax, others have led to the conclusion that BH3-only proteins act indirectly by antagonizing...

  19. Balance Food and Activity

    Science.gov (United States)

    ... News Features Spokespeople News Archive eNewsletters Calendar Balance Food and Activity What is Energy Balance? Energy is ... of calories just by breathing air and digesting food. You also burn a certain number of calories ( ...

  20. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Videos Glossary of Terms Personal Stories Harold, Age 7 Maria, Age 16 Alex, Age 32 Demetrise, Age ... aerobic activity, watch this video: Windows Media Player, 4:48 More videos Here are some ways to ...

  1. Physical activity: genes & health

    CERN Multimedia

    2002-01-01

    Carl Johan SUNDBERG is an Associate Professor in Physiology and Licenced Physician. His research focus is Molecular mechanisms involved in the adaptation of human skeletal muscle to physical activity.

  2. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Sample Audit Glossary Selected References Discount Fitness Club Network Assessing Need and Interest Selecting a DFCN Promotion ... Physical Activity, and Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube ...

  3. Active at Any Size

    Science.gov (United States)

    ... outdoor biking, you may want to try a mountain bike. Mountain bikes have wider tires and are sturdier than ... or clipped to your clothing. Keeping an activity journal is another good way to help you stay ...

  4. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... 2015 Page last updated: June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National ... INFO U.S. Department of Health & Human Services HHS/Open USA.gov Top

  5. CDBG Public Improvements Activity

    Data.gov (United States)

    Department of Housing and Urban Development — CDBG activity related to public improvements, including senior centers, youth centers, parks, street improvements, water/sewer improvements, child care centers, fire...

  6. Lesion activity assessment

    DEFF Research Database (Denmark)

    Ekstrand, K R; Zero, D T; Martignon, S

    2009-01-01

    of predictors increases the accuracy of lesion activity prediction for both primary coronal and root lesions. Three surrogate methods have been used for evaluating lesion activity (construct validity); all have disadvantages. If construct validity is accepted as a 'gold standard', it is possible to assess......This chapter focusses on the probability of a caries lesion detected during a clinical examination being active (progressing) or arrested. Visual and tactile methods to assess primary coronal lesions and primary root lesions are considered. The evidence level is rated as low (R...... in response to cariogenic plaque as well as lesion arrest. Based on this understanding, different clinical scoring systems have been developed to assess the severity/depth and activity of lesions. A recent system has been devised by the International Caries Detection and Assessment System Committee...

  7. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... on this page will be unavailable. For more information about this message, please visit this page: About CDC.gov . ... Resources & Publications Reports Adults Need More Physical Activity ...

  8. Distributed Active Learning

    National Research Council Canada - National Science Library

    Shen, Pengcheng; Li, Chunguang; Zhang, Zhaoyang

    2016-01-01

    Active learning aims at obtaining high-accuracy models with as a few labeled data as possible, by iteratively and elaborately selecting most valuable data to query labels during the learning process...

  9. Benefits of Physical Activity

    Science.gov (United States)

    ... a bone-strengthening activity. Stretching helps improve your flexibility and your ability to fully move your joints. ... own, consider joining a support group. Many hospitals, workplaces, and community groups offer classes to help people ...

  10. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... per hour or faster, but not race-walking) Water aerobics Bicycling slower than 10 miles per hour ... 2015 Page last updated: June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National ...

  11. Local Worlds of Activation

    DEFF Research Database (Denmark)

    Jacobsson, Kerstin; Hollertz, Katarina; Garsten, Christina

    2017-01-01

    . This article studies local activation policy and practice in three Swedish municipalities, representing three distinct ‘local worlds of activation’. The analysis shows that policy orientations in the municipalities studied ranged from ‘work-first’ to ‘life-first’ approaches to activation. Governance...... of Coordination Unions, as multi-party collaborate organisational structures established for activation policy implementation for certain target groups. Thus, activation must be approached not as a fixed and universal policy for social inclusion, but as susceptible to local practice and hence open to influence...... from local politics, established local traditions, patterns of networking and modes of collaborating, as the notion of ‘local words of activation’ intends to capture....

  12. Tanzania - Kigoma Solar Activity

    Data.gov (United States)

    Millennium Challenge Corporation — The performance evaluation of the Kigoma solar activity was designed to answer questions about the implementation of the program and about outcomes that may have...

  13. Interactive Design Activism

    Science.gov (United States)

    Goulev, Petar; Farrer, Joan

    The following sections are included: * Introduction * Computers and Human Well-being * To Fuzzy or Yes (No)! * Interactive Design Activism * Sensing the Sun * Personalised Public Health Advice * Modifying Human Behaviour * Transdisciplinarity, Knowledge Transfer and Multi-domain

  14. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... CDC’s Example StairWELL Stairwell Appearance Motivational ... relative intensity, people pay attention to how physical activity affects their heart rate and breathing. The talk test ...

  15. Homebuyer Activities Report

    Data.gov (United States)

    Department of Housing and Urban Development — This monthly report is an Excel spreadsheet. PJs can use this report to view homebuyer activities with the 2012 or 2013 program year in IDIS that are in final draw,...

  16. Active Photonic Crystal Waveguides

    DEFF Research Database (Denmark)

    Ek, Sara

    due to photonic crystal dispersion. The observations are explained by the enhancement of net gain by light slow down. Another application based on active photonic crystal waveguides is micro lasers. Measurements on quantum dot micro laser cavities with different mirror configurations and photonic......This thesis deals with the fabrication and characterization of active photonic crystal waveguides, realized in III-V semiconductor material with embedded active layers. The platform offering active photonic crystal waveguides has many potential applications. One of these is a compact photonic...... crystal semiconductor optical amplier. As a step towards such a component, photonic crystal waveguides with a single quantum well, 10 quantum wells and three layers of quantum dots are fabricated and characterized. An experimental study of the amplied spontaneous emission and a implied transmission...

  17. Home Activities Reports

    Data.gov (United States)

    Department of Housing and Urban Development — This monthly report is an Excel spreadsheet, broken up by state. PJs can use this report to view activities with the 2012 or 2013 program year in IDIS, including;...

  18. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... 2015 Page last updated: June 4, 2015 Content source: Division of Nutrition, Physical Activity, and Obesity , National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram ...

  19. Active Fire Mapping Program

    Science.gov (United States)

    Active Fire Mapping Program Current Large Incidents (Home) New Large Incidents Fire Detection Maps MODIS Satellite Imagery VIIRS Satellite Imagery Fire Detection GIS Data Fire Data in Google Earth ...

  20. Sedimentation of active particles

    OpenAIRE

    Vachier, Jérémy; Marco G. Mazza

    2017-01-01

    Active particles convert energy from chemical, biochemical, or other processes into motion. Their collective motion has attracted enormous interest on account of the technological applications of artificial and biological particles. By combining theoretical arguments, and molecular dynamics simulations we explore the collective behavior of active particles under a gravity field in three dimensions. Dilute systems exhibit sedimentation, which we study with two approaches. Firstly, we solve ana...

  1. Low activation ferritic alloys

    Science.gov (United States)

    Gelles, D.S.; Ghoniem, N.M.; Powell, R.W.

    1985-02-07

    Low activation ferritic alloys, specifically bainitic and martensitic stainless steels, are described for use in the production of structural components for nuclear fusion reactors. They are designed specifically to achieve low activation characteristics suitable for efficient waste disposal. The alloys essentially exclude molybdenum, nickel, nitrogen and niobium. Strength is achieved by substituting vanadium, tungsten, and/or tantalum in place of the usual molybdenum content in such alloys.

  2. RAVEN Quality Assurance Activities

    Energy Technology Data Exchange (ETDEWEB)

    Cogliati, Joshua Joseph [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-01

    This report discusses the quality assurance activities needed to raise the Quality Level of Risk Analysis in a Virtual Environment (RAVEN) from Quality Level 3 to Quality Level 2. This report also describes the general RAVEN quality assurance activities. For improving the quality, reviews of code changes have been instituted, more parts of testing have been automated, and improved packaging has been created. For upgrading the quality level, requirements have been created and the workflow has been improved.

  3. Activation Energy for Fission

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.

    1952-08-29

    The experimentally determined exponential dependence of spontaneous fission rate on Z{sup 2}/A has been used to derive an expression for the dependence of the fission activation energy on Z{sup 2}/A. This expression has been used to calculate the activation energy for slow neutron induced fission and photofission. The correlation with the experimental data on these types of fission seems to be quite good.

  4. ACTIVITY - BASED COSTING DESIGNING

    OpenAIRE

    Wioletta Skibiñska; Marta Kad³ubek

    2010-01-01

    The traditional costing system sometimes does not give accurate information about the consumption of different resources and the activities of the organisation. The activity-based costing system is an information-rich costing system which is more and more necessary for the success of many European companies. Base of designing and implementation of an ABC system in the enterprises are presented in the article.

  5. Psychomotor activities with seniors

    Directory of Open Access Journals (Sweden)

    Jitka Kopřivová

    2015-07-01

    Full Text Available BACKGROUND: Given that the population all over the world is aging, it is necessary to fi nd ways to help maintain or improve the quality of life of seniors. The main goal of this paper is to show how appropriate physical activity programs contribute to the improvement of the functionality and psychosocial wellbeing of seniors. We are particularly interested in the possibilities of preserving self-suffi ciency and self-service, independence and the ability to perform everyday activities. One of the most eff ective forms of physical activity is psychomotr activity.OBJECTIVE: The aim of our paper is to present basic information concerning the meaning and the application of the psychomotr activities in intervention movement programmes in order to improve seniors’ life quality.METHODS: We defi ne the term psychomotr activities according to Adamírová (1995 and Novotná (2010. In this paper we present some results of research that stress the positive eff ect of psychomotor exercises and games on the life satisfaction of the elderly (Stará 2011; Stará & Kopřivová, 2011.DESCRIPTION: According to the results of our research and practical experience gained from working with the elderly it is strongly recommended to include suitable psychomotor exercises and games focusing on the development of manual dexterity in training programs in order to improve the balance abilities and the psychosocial area. In terms of prevention, because of the growing number of neurological disorders at an old age it is appropriate to include psychomotor exercises that encourage the development of cognitive functions in the physical interventions.CONCLUSION: We were able to positively infl uence the emotional aspect from performing physical activities, to enhance self-esteem of the exercising subjects and to create new social relationships. Motion programs, which also included psychomotor exercises and games, had a positive eff ect on the physical assessment of the

  6. Youth physical activity resource use and activity measured by accelerometry.

    Science.gov (United States)

    Maslow, Andréa L; Colabianchi, Natalie

    2011-01-01

    To examine whether use of physical activity resources (eg, parks) was associated with daily physical activity measured by accelerometry. One hundred eleven adolescents completed a travel diary with concurrent accelerometry. The main exposure was self-reported use of a physical activity resource (none /1+ resources). The main outcomes were total minutes spent in daily (1) moderate-vigorous physical activity and (2) vigorous physical activity. Using a physical activity resource was significantly associated with total minutes in moderate-vigorous physical activity. African Americans and males had significantly greater moderate-vigorous physical activity. Results from this study support the development and use of physical activity resources.

  7. Youth Physical Activity Resources Use and Activity Measured by Accelerometry

    Science.gov (United States)

    Maslow, Andréa L.; Colabianchi, Natalie

    2014-01-01

    Objectives To examine whether utilization of physical activity resources (eg, parks) was associated with daily physical activity measured by accelerometry. Methods 111 adolescents completed a travel diary with concurrent accelerometry. The main exposure was self-reported utilization of a physical activity resource (none/1+ resources). The main outcomes were total minutes spent in daily 1) moderate-vigorous physical activity and 2) vigorous physical activity. Results Utilizing a physical activity resource was significantly associated with total minutes in moderate-vigorous physical activity. African-Americans and males had significantly greater moderate-vigorous physical activity. Conclusions Results from this study support the development and use of physical activity resources. PMID:21204684

  8. Walkability and Physical Activity

    Science.gov (United States)

    Reis, Rodrigo Siqueira; Hino, Adriano Akira Ferreira; Rech, Cassiano Ricardo; Kerr, Jacqueline; Hallal, Pedro Curi

    2013-01-01

    Background Evidence from developing countries is limited on how income level for a given neighborhood is related to physical activity among its residents. Purpose The goal of the study was to examine the association between walkability and physical activity outcomes, and the effect of income on the relationship between walkability and physical activity in adults. Methods The Spaces for Physical Activity in Adults Study (ESPACOS Project) took place in Curitiba, Brazil. Data were collected in 2010 in 32 census tracts selected to vary in income and walkability, as measured by GIS. Participants were 697 individuals aged 18–65 years (52.0% were women) randomly sampled from the selected neighborhoods. The International Physical Activity Questionnaire was used to measure physical activity. All analyses were conducted in 2012. Results The proportion of those who walked for transportation for ≥150 minutes/week was 21.1% in low-walkability areas, and ranged from 33.5% to 35.0% in high-walkability areas. A total of 12.6% of residents were found to walk for leisure for ≥150 minutes/week; this result did not vary across quadrants of walkability and income level. The prevalence of leisure-time moderate-to-vigorous physical activity (MVPA) was 7.1–10.5 percentage points higher in high-compared to low-walkability areas. After adjusting for all individual confounders, walkability showed an independent association with walking for transport (OR=2.10, 95% CI=1.31, 3.37, p=0.002) and leisure-time MVPA (OR=1.57; 95% CI=1.06, 2.32; p=0.024). Neighborhood income level was independently associated with leisure-time MVPA (OR=1.70; 95% CI=1.06, 2.74, p=0.029). No association was found between walkability and walking for leisure. No interaction was found between walkability and neighborhood income level. Conclusions This study, among adults living in Curitiba, Brazil, confirms findings from studies of high-income countries showing that walkability is positively associated with

  9. [Inflammasome: activation mechanisms].

    Science.gov (United States)

    Suárez, Raibel; Buelvas, Neudo

    2015-03-01

    Inflammation is a rapid biologic response of the immune system in vascular tissues, directed to eliminate stimuli capable of causing damage and begin the process of repair. The macromolecular complexes known as "inflammasomes" are formed by a receptor, either NOD (NLR) or ALR, the receptor absent in melanoma 2 (AIM2). In addition, the inflammasome is formed by the speck-like protein associated to apoptosis (ASC) and procaspase-1, that may be activated by variations in the ionic and intracellular and extracellular ATP concentrations; and the loss of stabilization of the fagolisosomme by internalization of insoluble crystals and redox mechanisms. As a result, there is activation of the molecular platform and the processing of inflammatory prointerleukins to their active forms. There are two modalities of activation of the inflammasome: canonical and non-canonical, both capable of generating effector responses. Recent data associate NLRP 3, IL-1β and IL-18 in the pathogenesis of a variety of diseases, including atherosclerosis, type II diabetes, hyperhomocysteinemia, gout, malaria and hypertension. The inflammasome cascade is emerging as a new chemotherapeutic target in these diseases. In this review we shall discuss the mechanisms of activation and regulation of the inflammasome that stimulate, modulate and resolve inflammation.

  10. Chromatin as active matter

    Science.gov (United States)

    Agrawal, Ankit; Ganai, Nirmalendu; Sengupta, Surajit; Menon, Gautam I.

    2017-01-01

    Active matter models describe a number of biophysical phenomena at the cell and tissue scale. Such models explore the macroscopic consequences of driving specific soft condensed matter systems of biological relevance out of equilibrium through ‘active’ processes. Here, we describe how active matter models can be used to study the large-scale properties of chromosomes contained within the nuclei of human cells in interphase. We show that polymer models for chromosomes that incorporate inhomogeneous activity reproduce many general, yet little understood, features of large-scale nuclear architecture. These include: (i) the spatial separation of gene-rich, low-density euchromatin, predominantly found towards the centre of the nucleus, vis a vis. gene-poor, denser heterochromatin, typically enriched in proximity to the nuclear periphery, (ii) the differential positioning of individual gene-rich and gene-poor chromosomes, (iii) the formation of chromosome territories, as well as (iv), the weak size-dependence of the positions of individual chromosome centres-of-mass relative to the nuclear centre that is seen in some cell types. Such structuring is induced purely by the combination of activity and confinement and is absent in thermal equilibrium. We systematically explore active matter models for chromosomes, discussing how our model can be generalized to study variations in chromosome positioning across different cell types. The approach and model we outline here represent a preliminary attempt towards a quantitative, first-principles description of the large-scale architecture of the cell nucleus.

  11. Shock activation of catalysts

    Science.gov (United States)

    Graham, R. A.; Morosin, B.; Richards, P. M.; Stohl, F. V.; Granoff, B.

    1981-02-01

    Scientists in the Soviet Union have demonstrated that high pressure shock-wave loading can cause significant improvement in the performance of catalysts. This increased catalytic activity is apparently the result of the shock-induced defects, especially vacancies, which act to facilitate atomic migration. We have carried out shock activation experiments on a coal-derived pyrite which has been previously used as a catalyst in coal liquefaction studies. The pyrite powder was packed to a density of about 2.0 Mg/m3 in a copper capsule and explosively loaded to a pressure of about 15 GPa in the copper. The starting and shock-activated samples were analyzed by x-ray diffraction and magnetization measurements. The diffraction patterns of the shock-activated samples were dominated by broadened pyrite lines indicative of a significant increase in crystal defects. The diffraction patterns also showed the presence of pyrrhotite (Fe1-xS) in quantities of a few percent. An iron carbide found in the shocked material was apparently formed from carbon originating from either the calcite or organic impurities in the starting material. Magnetic properties of the sample were found to be substantially changed by the shock loading. The study has demonstrated that shock loading can significantly alter the crystalline order of pyrite and produce measurable quantities of pyrrhotite. The effects of shock-activated pyrite on the liquefaction of coal are being assessed by means by tubing reactor experiments.

  12. Parsing Heterogeneous Striatal Activity

    Directory of Open Access Journals (Sweden)

    Kae Nakamura

    2017-05-01

    Full Text Available The striatum is an input channel of the basal ganglia and is well known to be involved in reward-based decision making and learning. At the macroscopic level, the striatum has been postulated to contain parallel functional modules, each of which includes neurons that perform similar computations to support selection of appropriate actions for different task contexts. At the single-neuron level, however, recent studies in monkeys and rodents have revealed heterogeneity in neuronal activity even within restricted modules of the striatum. Looking for generality in the complex striatal activity patterns, here we briefly survey several types of striatal activity, focusing on their usefulness for mediating behaviors. In particular, we focus on two types of behavioral tasks: reward-based tasks that use salient sensory cues and manipulate outcomes associated with the cues; and perceptual decision tasks that manipulate the quality of noisy sensory cues and associate all correct decisions with the same outcome. Guided by previous insights on the modular organization and general selection-related functions of the basal ganglia, we relate striatal activity patterns on these tasks to two types of computations: implementation of selection and evaluation. We suggest that a parsing with the selection/evaluation categories encourages a focus on the functional commonalities revealed by studies with different animal models and behavioral tasks, instead of a focus on aspects of striatal activity that may be specific to a particular task setting. We then highlight several questions in the selection-evaluation framework for future explorations.

  13. Active Flows on Trees

    Science.gov (United States)

    Forrow, Aden; Woodhouse, Francis; Dunkel, Joern

    Coherent, large scale dynamics in many nonequilibrium physical, biological, or information transport networks are driven by small-scale local energy input. We introduce and explore a generic model for compressible active flows on tree networks. In contrast to thermally-driven systems, active friction selects discrete states with only a small number of oscillation modes activated at distinct fixed amplitudes. This state selection interacts with graph topology to produce different localized dynamical time scales in separate regions of large networks. Using perturbation theory, we systematically predict the stationary states of noisy networks and find good agreement with a Bayesian state estimation based on a hidden Markov model applied to simulated time series data on binary trees. While the number of stable states per tree scales exponentially with the number of edges, the mean number of activated modes in each state averages 1 / 4 the number of edges. More broadly, these results suggest that the macroscopic response of active networks, from actomyosin force networks in cells to cytoplasmic flows, can be dominated by a significantly reduced number of modes, in stark contrast to energy equipartition in thermal equilibrium systems.

  14. Active noise control primer

    CERN Document Server

    Snyder, Scott D

    2000-01-01

    Active noise control - the reduction of noise by generating an acoustic signal that actively interferes with the noise - has become an active area of basic research and engineering applications. The aim of this book is to present all of the basic knowledge one needs for assessing how useful active noise control will be for a given problem and then to provide some guidance for designing, setting up, and tuning an active noise-control system. Written for students who have no prior knowledge of acoustics, signal processing, or noise control but who do have a reasonable grasp of basic physics and mathematics, the book is short and descriptive. It leaves for more advanced texts or research monographs all mathematical details and proofs concerning vibrations, signal processing and the like. The book can thus be used in independent study, in a classroom with laboratories, or in conjunction with a kit for experiment or demonstration. Topics covered include: basic acoustics; human perception and sound; sound intensity...

  15. Factors affecting aspartase activity.

    Science.gov (United States)

    DEPUE, R H; MOAT, A G

    1961-09-01

    Depue, Robert H. (Hahnemann Medical College, Philadelphia), and Albert G. Moat. Factors affecting aspartase activity. J. Bacteriol. 82:383-386. 1961.-Cells of Escherichia coli grown in a glucose-mineral salts medium contain about one-fifth the amount of aspartase activity observed in cells grown in a yeast extract-peptone medium. The aspartase activity of the cells grown in glucose-salts medium would appear to be too low to provide a mechanism for synthesis of amino groups. Aspartase was purified approximately eightfold by ammonium sulfate precipitation and column chromatography of cell-free extracts. The purified preparation was specific for l-aspartic acid and contained no fumarase activity. A divalent metal ion requirement was demonstrated, this requirement being satisfied by cobaltous or manganous ions. The enzyme activity was found to be dependent upon free sulfhydryl groups. Biotin did not appear to be directly involved in the aspartase reaction since high concentrations of avidin did not alter the reaction rate. The Michaelis constant for aspartase with aspartic acid as substrate was determined to be 0.033 m.

  16. Protein (Cyanobacteria): 49900 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available sine phosphatase Crinalium epipsammum PCC 9333 MKRVMFVCKKNSARSQMAEGFAKHLGVGTIDVTSSGLEASVVRPEAIATMKDIGVDISRQTSKALNEFNAKDFDIVISLCGCGVNLPPEWVERAVFEDWQLDDPAEQPEIFPRVRDEIRTRVTQLIESLL ...

  17. Plasminogen activation and cancer

    DEFF Research Database (Denmark)

    Danø, Keld; Behrendt, Niels; Høyer-Hansen, Gunilla

    2005-01-01

    Breakdown of the extracellular matrix is crucial for cancer invasion and metastasis. It is accomplished by the concerted action of several proteases, including the serine protease plasmin and a number of matrix metalloproteases. The activity of each of these proteases is regulated by an array...... of activators, inhibitors and cellular receptors. Thus, the generation of plasmin involves the pro-enzyme plasminogen, the urokinase type plasminogen activator uPA and its pro-enzyme pro-uPA, the uPA inhibitor PAI-1, the cell surface uPA receptor uPAR, and the plasmin inhibitor alpha(2)-antiplasmin. Furthermore......, the regulation of extracellular proteolysis in cancer involves a complex interplay between cancer cells and non-malignant stromal cells in the expression of the molecular components involved. For some types of cancer, this cellular interplay mimics that observed in the tissue of origin during non...

  18. Immunomodulating activity of pidotimod.

    Science.gov (United States)

    Migliorati, G; Nicoletti, I; Riccardi, C

    1994-12-01

    Experiments were performed to analyze the effect of the immunomodulating agent pidotimod ((R)-3-[(S)-(5-oxo-2-pyrrolidinyl) carbonyl]-thiazolidine-4-carboxylic acid, PGT/1A, CAS 121808-62-6) on the mouse splenic proliferative response to Con-A and IL-2, natural killer (NK) cell activity and thymocyte apoptosis. The results indicate that in vivo treatment with pidotimod (200 mg/kg i.p. for 5 days) causes a significant increase in the proliferative response to mitogens (including Con-A and IL-2) and the cytotoxic activity mediated by NK cells. Pidotimod inhibits in vitro thymocyte apoptosis caused by other inducing agents such as protein kinase C activator 12-O-tetradecanoyl-phorbol-13-acetate, Ca(++)-ionophore A23187, genistein and interleukin-2 (IL-2).

  19. Correlates of physical activity

    DEFF Research Database (Denmark)

    Bauman, Adrian E; Reis, Rodrigo S; Sallis, James F

    2012-01-01

    that age, sex, health status, self-efficacy, and motivation are associated with physical activity. Ecological models take a broad view of health behaviour causation, with the social and physical environment included as contributors to physical inactivity, particularly those outside the health sector......Physical inactivity is an important contributor to non-communicable diseases in countries of high income, and increasingly so in those of low and middle income. Understanding why people are physically active or inactive contributes to evidence-based planning of public health interventions, because......, such as urban planning, transportation systems, and parks and trails. New areas of determinants research have identified genetic factors contributing to the propensity to be physically active, and evolutionary factors and obesity that might predispose to inactivity, and have explored the longitudinal tracking...

  20. Postsplenectomy splenic activity.

    Science.gov (United States)

    Orda, R; Barak, J; Baron, J; Spirer, Z; Wiznitzer, T

    1981-01-01

    Evidence of recurring activity of splenic tissue was investigated in patients who had undergone splenectomies. Methods included technetium 99m sulfur colloid scan, serum tuftsin assay, serum immunoglobulin concentration, blood cell counts, and search for Howell-Jolly bodies. Positive scans were observed together with normal levels of tuftsin in 54% of the patients. In 46% of the patients, no splenic activity was detected by scanning and low levels of tuftsin were noticed. The difference in tuftsin levels between the two groups was statistically significant. Howell-Jolly bodies and decreased serum levels of IgM featured all patients. The possible application of combined splenic scan and tuftsin assessment for screening recurring splenic activity in the postsplenectomy population at great risk is suggested. Images Fig. 1. Fig. 2. PMID:7305494

  1. Physical activity and osteoarthritis

    DEFF Research Database (Denmark)

    Gates, L S; Leyland, K M; Sheard, S

    2017-01-01

    Physical activity (PA) is increasingly recognised as an important factor within studies of osteoarthritis (OA). However, subjective methods used to assess PA are highly variable and have not been developed for use within studies of OA, which creates difficulties when comparing and interpreting PA...... established via an international expert consensus meeting and modified Delphi exercise using a geographically diverse committee selected on the basis of individual expertise in physical activity, exercise medicine, and OA. Agreement was met for all aims of study: (1) The use of Metabolic Equivalent of Task...

  2. Effects of Activating Schoolyards

    DEFF Research Database (Denmark)

    Pawlowski, Charlotte Skau; Schipperijn, Jasper; Andersen, Henriette Bondo

    have to support the older children’s recess physical activity on an organisational level by encourage them to use the schoolyard and renewing schoolyard areas close to their classrooms. This follow-up study of children’s perception of the renewed schoolyards can aid development of future schoolyard...... access to the renovated areas for older children and allowed them to leave the school area during recess. Furthermore, most of the children felt that the renewed schoolyard areas were far from their classrooms. CONCLUSIONS: Renewing the schoolyard is not enough to stimulate physical activity. Schools...

  3. Bumblebee vibration activated foraging

    OpenAIRE

    Su, Dan Kuan-Nien

    2009-01-01

    The ability use vibrational signals to activate nestmate foraging is found in the highly social bees, stingless bees and honey bees, and has been hypothesized to exist in the closely related, primitively eusocial bumble bees. We provide the first strong and direct evidence that this is correct. Inside the nest, bumble bee foragers produce brief bursts of vibration (foraging activation pulses) at 594.5 Hz for 63±26 ms (velocityRMS=0.46±0.02mm/s, forceRMS=0.8±0.2 mN. Production of these vibrati...

  4. Active registration models

    Science.gov (United States)

    Marstal, Kasper; Klein, Stefan

    2017-02-01

    We present the Active Registration Model (ARM) that couples medical image registration with regularization using a statistical model of intensity. Inspired by Active Appearance Models (AAMs), the statistical model is embedded in the registration procedure as a regularization term that penalize differences between a target image and a synthesized model reconstruction of that image. We demonstrate that the method generalizes AAMs to 3D images, many different transformation models, and many different gradient descent optimization methods. The method is validated on magnetic resonance images of human brains.

  5. Physical Activity and Health: The Benefits of Physical Activity

    Science.gov (United States)

    ... State and Local Programs Related Topics Diabetes Nutrition Physical Activity and Health Recommend on Facebook Tweet Share Compartir ... Your Chances of Living Longer The Benefits of Physical Activity Regular physical activity is one of the most ...

  6. Dynamic activity-related incentives for physical activity

    OpenAIRE

    Schüler, Julia; Brunner, Sibylle

    2012-01-01

    The present studies adopted the theoretical framework of activity- and purpose-related incentives (Rheinberg, 2008) to explain the maintenance of physical activity. We hypothesized that activity-related incentives (e.g., “fun”) increase more than purpose-related incentives (e.g., “health”) between the initiation and maintenance phase of physical activity. Additionally, change in activity-related incentives was hypothesized to be a better predictor of maintenance of physical activity than chan...

  7. Dimensions of network activity

    NARCIS (Netherlands)

    Torenvlied, R.; Akkerman, A.; Meier, K.; O'Toole, L.

    2013-01-01

    Studies in public management show that agencies draw different types of support from different actors and organizations in their environment. If this is true, we would expect that managers differentiate their networking activity toward different types of external actors and organizations. However,

  8. Institutional investor activism : Introduction

    NARCIS (Netherlands)

    Mc Cahery, Joseph; Bratton, William; Bratton, William; McCahery, Joseph A.

    2015-01-01

    The increase in institutional ownership of recent decades has been accompanied by an enhanced role played by institutions in monitoring companies’ corporate governance behaviour. Activist hedge funds and private equity firms have achieved a degree of success in actively shaping the business plans of

  9. Active Math Learning

    DEFF Research Database (Denmark)

    The presentation is concerned with general course planning philosophy and a specific case study (boomerang flight geometro-dynamics) for active learning of mathematics via computer assisted and hands-on unfolding of first principles - in this case the understanding of rotations and Eulers equatio...

  10. Diagramming Complex Activities

    DEFF Research Database (Denmark)

    Andersen, Peter Bøgh

    2005-01-01

    We increasingly live in heterogeneous ever-changing webs of activities where human actions are intertwined with events created by automatic machines.  In order to make such webs understandable to its human participants, their structure should be represented by displays emphasizing their action...

  11. Mapping Nordic MNE activities

    DEFF Research Database (Denmark)

    Hansen, Annegrethe; Pedersen, Jørgen Lindgaard

    2006-01-01

    This project has investigated outward foreign direct investments from the Nordic economies, and analysed the role domestic multinational companies play in their respective Nordic home economies. The project consisted of a desktop study of existing research, a quantitative study of FDI flows and t...... activities of such companies provide valuable knowledge inputs into the domestic innovation systems of the Nordic...

  12. Access and Fishing Activities

    DEFF Research Database (Denmark)

    Høst, Jeppe Engset

    2015-01-01

    In this chapter, I look at the implications of transferable quotas on the organization of production; that is, how fishing activities are structured around access to the individual and transferable quotas and how, in turn, the quotas structure the production. Therefore, this chapter will give...

  13. Nursing activities score

    NARCIS (Netherlands)

    Miranda, DR; Nap, R; de Rijk, A; Schaufeli, W; Lapichino, G

    Objectives. The instruments used for measuring nursing workload in the intensive care unit (e.g., Therapeutic Intervention Scoring System-28) are based on therapeutic interventions related to severity of illness. Many nursing activities are not necessarily related to severity of illness, and

  14. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... CDC’s Example StairWELL Stairwell Appearance Motivational Signs Installing Music Other Ideas to Consider Tracking Stair Usage Project ... intensity, people pay attention to how physical activity affects their heart rate and breathing. The talk test ...

  15. Active Citizenship? Forget It!

    Directory of Open Access Journals (Sweden)

    Janko Berlogar

    1999-12-01

    Full Text Available There is no doubt about the need for the realisation of active citizenship concept and for practical education for it. Realisation itself might be utopian but the reason for that is less our inability and more wrong understanding of the concept itself. Socio-technical participation and “economic democracy” are self-deception about the active citizenship reality. Active citizenship does not mean to save national identitity and sacred things of that nation. It is neither training for the economic welfare of community and getting rid of problematic individuals. The latter is nothing but serving. The goal must be political participation, even resistence and changes. That is what we should educate for. We are perhaps not allowed to, but it is of crucial importance to ask ourselves (educators if we want and dare to do it. We should do both - ask ourselves and act as proposed. No state itself » produces « active citizens. It creates them according to their interests. Political awakening is not among those interests.

  16. Activities: Preparing for Pythagoras.

    Science.gov (United States)

    Laing, Robert A.

    1989-01-01

    Three worksheets are provided to help secondary students explore relationships among the areas of a variety of similar figures constructed on the sides of right triangles. The activity is extended to include the relationship among the lengths of the sides of the right triangle. Included are several student worksheets. (DC)

  17. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... 67 Data & Statistics Facts About Physical Activity Data, Trends and Maps Surveillance Systems Resources & Publications Reports Adults ... Needs Assessment Evaluating Success CDC’s Example StairWELL Stairwell Appearance Motivational Signs Installing Music Other Ideas to Consider ...

  18. Active Learning Methods

    Science.gov (United States)

    Zayapragassarazan, Z.; Kumar, Santosh

    2012-01-01

    Present generation students are primarily active learners with varied learning experiences and lecture courses may not suit all their learning needs. Effective learning involves providing students with a sense of progress and control over their own learning. This requires creating a situation where learners have a chance to try out or test their…

  19. Seismology of active stars

    NARCIS (Netherlands)

    Hekker, S.; García, R.A.

    2012-01-01

    In this review we will discuss the current standing and open questions of seismology in active stars. With the longer photometric time series data that are, and will become, available from space-missions such as Kepler we foresee significant progress in our understanding of stellar internal

  20. Physical activity and health

    Directory of Open Access Journals (Sweden)

    Aleš Blinc

    2005-12-01

    Full Text Available Background. Due to technological development, the average level of physical activity is decreasing among residents of developed countries, which is an important factor in the epidemic of obesity and metabolic syndrome.Results (findings. Although excessive physical exertion disrupts hormonal balance, harms the immune system and somewhat increases the risk of sudden cardiac death, the overwhelming majority of adaptations to regular exercise comprise health benefits. Sensitivity to insulin is increased, metabolism of triglycerides and cholesterol is improved, and the basal tone of the sympathetic nervous system is decreased, which all reduces coronary atherothrombotic events and cardio-vascular mortality. Physical exercise is linked to reduced risk of colon carcinoma, breast cancer and endometrial carcinoma. Regular physical activity prolongs life on average by about two years in comparison with sedentary population, but even more importantly, it preserves endurance and power necessary for independent living well into in advanced age. Physical exercise reduces symptoms of depression and improves the perceived level of satisfaction.Conclusions. In order to achieve the metabolic and psychological benefits of exercise, it is necessary to engage in at least a half hour of moderately intense activity on most days of the week, but daily physical activity is even better.

  1. Shark Tagging Activities.

    Science.gov (United States)

    Current: The Journal of Marine Education, 1998

    1998-01-01

    In this group activity, children learn about the purpose of tagging and how scientists tag a shark. Using a cut-out of a shark, students identify, measure, record data, read coordinates, and tag a shark. Includes introductory information about the purpose of tagging and the procedure, a data sheet showing original tagging data from Tampa Bay, and…

  2. Creative Activity and Learning.

    Science.gov (United States)

    Cunningham, Flora E.

    1979-01-01

    This article compares three theories of the creative process taken from aesthetic philosophy: aesthetic enjoyment (D. W. Gotshalk), aesthetic experience (John Dewey), and aesthetic knowledge (Susanne Langer). Each shows different versions of the learning that accrues from creative activity. From this, curriculum planning and teaching suggestions…

  3. Simulation Activity Diagrams

    OpenAIRE

    Ryan, John; Heavey, Cathal

    2003-01-01

    This paper presents a technique, Simulation Activity Diagrams (SAD), developed to lessen the modelling burden during the initial requirements gathering phases of a simulation project. The technique also allows the capture and visual communication of detailed information, to manufacturing personnel, which may otherwise be lost in detailed programming code.

  4. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... or vigorous-intensity based upon the amount of energy used by the body while doing the activity. Top of Page Moderate Intensity Walking briskly (3 miles per hour or faster, but not race-walking) Water aerobics Bicycling slower than 10 miles per hour ...

  5. Mechanism of charity activity

    Directory of Open Access Journals (Sweden)

    Roman B. Golovkin

    2015-12-01

    Full Text Available Objective to establish the essential properties of the mechanism of charitable activities and to formulate the concept of quotmechanism of charitable activityquot. Methods the objective of the study is achieved using the complex of methods which are based on the interaction of dialectical and metaphysical analysis the epistemological properties of which allowed to reveal various aspects of the charitable activities mechanism functioning taking into account the principles of comprehensiveness complexity specificity and objectivity of the research. Results the rules are stated of using the term quotmechanismquot to characterize actions of state and law the essence of the charity mechanism is defined the definition of quotthe mechanism of charitable activity quot is formulated. Scientific novelty for the first time at theoretical level in legal science the definition of quotthe mechanism of charitable activityquot is formulated and its essential properties are set. Practical significance the research will contribute to improving the legal regulation in the field of philanthropy as well as to improving the efficiency and quality of charitable activity in the Russian Federation. nbsp

  6. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Stair Usage Project Checklist CDC’s Example Related Resources Walking Step It Up! Surgeon General’s Call to Action ... doing the activity. Top of Page Moderate Intensity Walking briskly (3 miles per hour or faster, but ...

  7. Activating Welfare States

    DEFF Research Database (Denmark)

    Kvist, Jon

    This paper investigates how welfare states may actively contribute to promote employment opportunities, i.e. participation in the labour market through various operations and policies. The principal operations concern in particular the de-familiarisation of caring tasks through social services...

  8. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... CDC A-Z SEARCH A B C D E F G H I J K L M ... Activity Basics Needs for Adults Needs for Children What Counts Needs for Older Adults Needs for Pregnant ... page, enter your email address: Enter Email Address What's this? Submit What's this? Submit Button Our Division ...

  9. Activated Sludge Rheology

    DEFF Research Database (Denmark)

    Ratkovich, Nicolas Rios; Horn, Willi; Helmus, Frank

    2013-01-01

    Rheological behaviour is an important fluid property that severely impacts its flow behaviour and many aspects related to this. In the case of activated sludge, the apparent viscosity has an influence on e.g. pumping, hydrodynamics, mass transfer rates, sludge-water separation (settling and filtr...

  10. ERDA's Fossil Energy Activities

    Science.gov (United States)

    White, Philip C.

    1976-01-01

    The intended coordinative role of the Council on Environmental Quality (CEQ), as defined under the National Environmental Policy Act, is compared and contrasted with its actual activities since its formation in 1969. The Council on Environmental Quality's success has been varied and is subject to dispute. (BT)

  11. Regulating prefrontal cortex activation

    DEFF Research Database (Denmark)

    Aznar, Susana; Klein, Anders Bue

    2013-01-01

    is highly expressed in the prefrontal cortex areas, playing an important role in modulating cortical activity and neural oscillations (brain waves). This makes it an interesting potential pharmacological target for the treatment of neuropsychiatric modes characterized by lack of inhibitory control...

  12. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... of Perceived Exertion Scale) Videos Glossary of Terms Personal Stories Harold, Age 7 Maria, Age 16 Alex, Age 32 Demetrise, Age 42 Susan, Age 45 David, Age 65 Harold, Age 67 Data & Statistics Facts About Physical Activity Data, Trends and ...

  13. Active Optical Lattice Filters

    Directory of Open Access Journals (Sweden)

    Gary Evans

    2005-06-01

    Full Text Available Optical lattice filter structures including gains are introduced and analyzed. The photonic realization of the active, adaptive lattice filter is described. The algorithms which map between gains space and filter coefficients space are presented and studied. The sensitivities of filter parameters with respect to gains are derived and calculated. An example which is relevant to adaptive signal processing is also provided.

  14. Activities of the ILO.

    Science.gov (United States)

    Enevoldsen, Niels; And Others

    1981-01-01

    A series of articles reviews educational activities of the International Labour Organisation (ILO), including international seminars on workers' education, a study of women workers, trade union training courses at the ILO Turin Centre, and the importance of information dissemination to trade unions. (SK)

  15. Measuring Physical Activity Intensity

    Medline Plus

    Full Text Available ... Controls Search Form Controls Cancel Submit Search the CDC CDC A-Z Index MENU CDC A-Z SEARCH A B C D E ... of Search Controls Search Form Controls Search The CDC Cancel Submit Search The CDC Physical Activity Note: ...

  16. Sexual activity and aging.

    Science.gov (United States)

    Ni Lochlainn, Mary; Kenny, Rose Anne

    2013-08-01

    Sexuality is an important component of emotional and physical intimacy that men and women experience throughout their lives. Research suggesting that a high proportion of men and women remain sexually active well into later life refutes the prevailing myth that aging and sexual dysfunction are inexorably linked. Age-related physiological changes do not render a meaningful sexual relationship impossible or even necessarily difficult. Many of these physiological changes are modifiable. There are various therapeutic options available to patients to achieve maximum sexual capacity in old age. This article reviews the prevalence of sexual activity among older adults, the problems these adults encounter with sexual activity, and the role of the health care professional in addressing these problems. The physiological sex-related changes that occur as part of the normal aging process in men and women are reviewed, as well as the effect of age-related physical and psychological illness on sexual function. The attitudes and perceptions of the media and general public toward sexual activity and aging are summarized. An understanding of the sexual changes that accompany the aging process may help general practitioners and other doctors to give practical and useful advice on sexuality as well as refute the misconception that aging equates to celibacy. A thorough awareness of this aspect of older people's quality of life can raise meaningful expectations for aging patients. Copyright © 2013 American Medical Directors Association, Inc. Published by Elsevier Inc. All rights reserved.

  17. Interdisciplinary Astronomy Activities

    Science.gov (United States)

    Nerantzis, Nikolaos; Mitrouda, Aikaterini; Reizopoulou, Ioanna; Sidiropoulou, Eirini; Hatzidimitriou, Antonios

    2016-04-01

    On November 9th, 2015, three didactical hours were dedicated to Interdisciplinary Astronomy Activities (http://wp.me/p6Hte2-1I). Our students and their teachers formed three groups and in rotation, were engaged with the following activities: (a) viewing unique images of the Cosmos in the mobile planetarium STARLAB (http://www.planitario.gr/tholos-starlab-classic-standard.html), (b) watching the following videos: Journey to the end of the universe (https://youtu.be/Ufl_Nwbl8xs), Rosetta update (https://youtu.be/nQ9ivd7wv30), The Solar System (https://youtu.be/d66dsagrTa0), Ambition the film (https://youtu.be/H08tGjXNHO4) in the school's library. Students and teachers were informed about our solar system, the Rosetta mission, the universe, etc. and (c) tactile activities such as Meet our home and Meet our neighbors (http://astroedu.iau.org, http://nuclio.org/astroneighbours/resources) and the creation of planets' 3D models (Geology-Geography A' Class Student's book, pg.15). With the activities above we had the pleasure to join the Cosmic Light Edu Kit / International Year of Light 2015 program. After our Interdisciplinary Astronomy Activities, we did a "small" research: our students had to fill an evaluation about their educational gains and the results can be found here http://wp.me/p6Hte2-2q. Moreover, we discussed about Big Ideas of Science (http://wp.me/p3oRiZ-dm) and through the "big" impact of the Rosetta mission & the infinity of our universe, we print posters with relevant topics and place them to the classrooms. We thank Rosa Doran (Nuclio - President of the Executive Council) for her continuous assistance and support on innovative science teaching proposals. She is an inspiration.

  18. Defining active progressive multiple sclerosis

    DEFF Research Database (Denmark)

    Sellebjerg, Finn; Börnsen, Lars; Ammitzbøll, Cecilie

    2017-01-01

    BACKGROUND: It is unknown whether disease activity according to consensus criteria (magnetic resonance imaging activity or clinical relapses) associate with cerebrospinal fluid (CSF) changes in progressive multiple sclerosis (MS). OBJECTIVE: To compare CSF biomarkers in active and inactive...

  19. Event-Based Activity Modeling

    DEFF Research Database (Denmark)

    Bækgaard, Lars

    2004-01-01

    We present and discuss a modeling approach that supports event-based modeling of information and activity in information systems. Interacting human actors and IT-actors may carry out such activity. We use events to create meaningful relations between information structures and the related...... activities inside and outside an IT-system. We use event-activity diagrams to model activity. Such diagrams support the modeling of activity flow, object flow, shared events, triggering events, and interrupting events....

  20. Leptospirosis Risk in Outdoor Activities

    Science.gov (United States)

    ... Submit Button Past Emails Leptospirosis Risk in Outdoor Activities Recommend on Facebook Tweet Share Compartir People who enjoy outdoor activities where freshwater or wet soil are encountered may ...