Polatoğlu, Kaan; Servi, Hüseyin; Özçınar, Özge; Nalbantsoy, Ayşe; Gücel, Salih
2017-01-01
There are very few reports on the phytochemistry of the Arabis L. (Brassicaceae) species in the literature. Here we present essential oil composition of aerial parts of two endemic Arabis species from Cyprus. The essential oils of Arabis purpurea Sm. and Arabis cypria Holmboe afforded very low oil yields (essential oil of A. purpurea that represent 82.75 ± 0.21 % (n = 3) of the oil. The major components of the oil were nonacosane 16.18 ± 0.13 %, heptacosane 14.91 ± 0.17 %, hexahydrofarnesyl acetone 12.44 ± 0.10 % and phytol 7.36 ± 0.10 % (n = 3). Forty three compounds were identified in the essential oil of A. cypria which represent 81.28 ± 1.55 % (n = 3) of the oil. The major components of the oil were nonacosane 20.25 ± 0.47 %, heptacosane 9.13 ± 1.88 %, hexahydrofarnesyl acetone 9.03 ± 0.44 % and 1-tetradecanol 4.38 ± 2.60 % (n = 3). To the best of our knowledge this is the first report on the essential oil compositions of these species.
L'héritage spirituel d'Ibn Arabi
Directory of Open Access Journals (Sweden)
Abd as Sabour Turrini
2005-12-01
Full Text Available Shaykh Muhieddin Ibn Arabi reçut une éducation religieuse tant par ses oncles, qui embrassèrent la voie initiatique que par les maîtres spirituels qui lui autorisèrent et le dirigèrent ainsi dans cette retraite spirituelle, "khalwa", qui lui permit le dévoilement de la connaissance divine. Le comportement spirituel acquis par Ibn Arabi, à travers les enseignements des maîtres, peut être synthétisé dans la présence spirituelle scrupuleuse, dans la sollicitude, dans l’abandon confiant en Dieu et dans la pleine conscience que Dieu se révèle à tout instant.
Directory of Open Access Journals (Sweden)
José Vicente FERRÁNDEZ PALACIO
2012-12-01
Full Text Available RESUMEN: En esta nota confirmamos la presencia de Arabis soyeri subsp. soyeri en el Pirineo aragonés (provincia de Huesca. Esta cita oscense se sitúa en el límite SW de su área de distribución endémica. Además, comentamos algunos aspectos sobre su autoecología y conservación.SUMMARY: Arabis soyeri Reuter & Huet subsp. soyeri is confirmed for the flora of the Aragonese Pyrenees (Huesca province, Spain. Moreower, this new station is located on the south-western border of its endemic range. Some aspects on its autecology and conservation are discussed as well.
HALOPHYTIC VEGETATION OF IRAN: TOWARDS A SYNTAXONOMICAL CLASSIFICATION
Directory of Open Access Journals (Sweden)
H. AKHANI
2004-05-01
Full Text Available Iran with its diverse c1irnatic conditions and geologic and land use history support large areas of saline habitats and diverse halophytic flora. The halophytic diversity in not only enriched by the evolving of a large number of autochthonous Irano-Turanian elements, but also many of the halophytes of other phytochoria like Saharo-Arabian, Mediterranean and even Euro-Siberian elements are represented in Iran. Therefore most of the higher syntaxa of Euro-Mediterranean and Afro-Asian-al last partly-occur in Iran. Prior to a consolidated syntaxonomical system for the halophytic vegetation of Iran, major halophytic vegetation units of Iran are summarized and shown along salinity and moisture gradients. These include: (I: Mangrove communities (Avicennio-Sonneratietea. (2: Submerged aquatic plant communities (Ruppietea maritimae. (3: Annual obligatory hygro-halophytic communities on sea, lake and river marshes dominated by stem or leaf succulent C3 chenopods (Thero-Salicornietea. (4 Semi-woody or perennial halophytic communities on muddy or coastal salt flats dominated by stem succulent C3 chenopods (Salicornietea fruticosae. (5: Hydrophi!ous euryhalophytic rush communities: Phragmitetea australis. (6: Halophytic grassland and herbaceous perennial sedge communities belonging to genera Puccinellia and Juncus (Juncetea maritimi. (7: Salt marsh and riverine bruchwood communities dominated by salt-excreting halophytes (Tamaricetea ramosissimae, prov.. (8: Annua1 halophytic communities dominated by C4 chenopods in temporary moist and inundated, or disturbed salty soils (Climacopteretea crassae, prov.. (9: Halophytic shrubby. semi-woody or hemicrytophytic communities on salty and dry soils dominated by lcaf or stem succulent C4 chenopods (Haloxylo-Salsoletea tomentosae, prov.. (1O: Halophytic shrub communities, on salty and sandy coastal or margin of sabkhas with high water table dominated by Nitraria schoberi and Reaumuria fruticosa. (11. Psarno-halophytic
HALOPHYTIC VEGETATION OF IRAN: TOWARDS A SYNTAXONOMICAL CLASSIFICATION
Directory of Open Access Journals (Sweden)
H. AKHANI
2004-01-01
Full Text Available Iran with its diverse c1irnatic conditions and geologic and land use history support large areas of saline habitats and diverse halophytic flora. The halophytic diversity in not only enriched by the evolving of a large number of autochthonous Irano-Turanian elements, but also many of the halophytes of other phytochoria like Saharo-Arabian, Mediterranean and even Euro-Siberian elements are represented in Iran. Therefore most of the higher syntaxa of Euro-Mediterranean and Afro-Asian-al last partly-occur in Iran. Prior to a consolidated syntaxonomical system for the halophytic vegetation of Iran, major halophytic vegetation units of Iran are summarized and shown along salinity and moisture gradients. These include: (I: Mangrove communities (Avicennio-Sonneratietea. (2: Submerged aquatic plant communities (Ruppietea maritimae. (3: Annual obligatory hygro-halophytic communities on sea, lake and river marshes dominated by stem or leaf succulent C3 chenopods (Thero-Salicornietea. (4 Semi-woody or perennial halophytic communities on muddy or coastal salt flats dominated by stem succulent C3 chenopods (Salicornietea fruticosae. (5: Hydrophi!ous euryhalophytic rush communities: Phragmitetea australis. (6: Halophytic grassland and herbaceous perennial sedge communities belonging to genera Puccinellia and Juncus (Juncetea maritimi. (7: Salt marsh and riverine bruchwood communities dominated by salt-excreting halophytes (Tamaricetea ramosissimae, prov.. (8: Annua1 halophytic communities dominated by C4 chenopods in temporary moist and inundated, or disturbed salty soils (Climacopteretea crassae, prov.. (9: Halophytic shrubby. semi-woody or hemicrytophytic communities on salty and dry soils dominated by lcaf or stem succulent C4 chenopods (Haloxylo-Salsoletea tomentosae, prov.. (1O: Halophytic shrub communities, on salty and sandy coastal or margin of sabkhas with high water table dominated by Nitraria schoberi and Reaumuria fruticosa. (11. Psarno-halophytic
Initial response of Arabis johnstonii Munz to fire
Marcia G. Narog; Christie J. Sclafani; Christina Escobar; Kate A. Kramer; Jan L. Beyers
2007-01-01
Arabis johnstonii Munz (Johnstonâs rock cress) is a small herbaceous perennial plant endemic to the San Jacinto Mountains of southern California. It is considered rare by the California Native Plant Society and is a Forest Service Sensitive species. Three A. johnstonii occurrences grow within an area that the San Bernardino...
Directory of Open Access Journals (Sweden)
Hassan Etesami
2018-02-01
Full Text Available Salinity stress is one of the major abiotic stresses limiting crop production in arid and semi-arid regions. Interest is increasing in the application of PGPRs (plant growth promoting rhizobacteria to ameliorate stresses such as salinity stress in crop production. The identification of salt-tolerant, or halophilic, PGPRs has the potential to promote saline soil-based agriculture. Halophytes are a useful reservoir of halotolerant bacteria with plant growth-promoting capabilities. Here, we review recent studies on the use of halophilic PGPRs to stimulate plant growth and increase the tolerance of non-halophytic crops to salinity. These studies illustrate that halophilic PGPRs from the rhizosphere of halophytic species can be effective bio-inoculants for promoting the production of non-halophytic species in saline soils. These studies support the viability of bioinoculation with halophilic PGPRs as a strategy for the sustainable enhancement of non-halophytic crop growth. The potential of this strategy is discussed within the context of ensuring sustainable food production for a world with an increasing population and continuing climate change. We also explore future research needs for using halotolerant PGPRs under salinity stress.
Coping With Metal Toxicity – Cues From Halophytes
Directory of Open Access Journals (Sweden)
Ganesh C. Nikalje
2018-06-01
Full Text Available Being the native flora of saline soil, halophytes are well studied for their salt tolerance and adaptation mechanism at the physiological, biochemical, molecular and metabolomic levels. However, these saline habitats are getting contaminated due to various anthropogenic activities like urban waste, agricultural runoff, mining, industrial waste that are rich in toxic metals and metalloids. These toxic metals impose detrimental effects on growth and development of most plant species. Halophytes by virtue of their tolerance to salinity also show high tolerance to heavy metals which is attributed to the enhanced root to shoot metal translocation and bioavailability. Halophytes rapidly uptake toxic ions from the root and transport them toward aerial parts by using different transporters which are involved in metal tolerance and homeostasis. A number of defense related physiological and biochemical strategies are known to be crucial for metal detoxification in halophytes however; there is paucity of information on the molecular regulators. Understanding of the phenomenon of cross-tolerance of salinity with other abiotic stresses in halophytes could very well boost their potential use in phytoremediation. In this article, we present an overview of heavy metal tolerance in case of halophytes, associated mechanisms and cross-tolerance of salinity with other abiotic stresses.
Potential Use of Halophytes to Remediate Saline Soils
Directory of Open Access Journals (Sweden)
Mirza Hasanuzzaman
2014-01-01
Full Text Available Salinity is one of the rising problems causing tremendous yield losses in many regions of the world especially in arid and semiarid regions. To maximize crop productivity, these areas should be brought under utilization where there are options for removing salinity or using the salt-tolerant crops. Use of salt-tolerant crops does not remove the salt and hence halophytes that have capacity to accumulate and exclude the salt can be an effective way. Methods for salt removal include agronomic practices or phytoremediation. The first is cost- and labor-intensive and needs some developmental strategies for implication; on the contrary, the phytoremediation by halophyte is more suitable as it can be executed very easily without those problems. Several halophyte species including grasses, shrubs, and trees can remove the salt from different kinds of salt-affected problematic soils through salt excluding, excreting, or accumulating by their morphological, anatomical, physiological adaptation in their organelle level and cellular level. Exploiting halophytes for reducing salinity can be good sources for meeting the basic needs of people in salt-affected areas as well. This review focuses on the special adaptive features of halophytic plants under saline condition and the possible ways to utilize these plants to remediate salinity.
Chronologie de l'Arabie Saoudite 2003
Directory of Open Access Journals (Sweden)
Pascal Ménoret
2003-12-01
Full Text Available CEFAS, Pascal Ménoret prépare un doctorat de sociologie politique à l'INALCO sous la direction de Nadine Picaudou. Politique intérieure et sociétéJanvier - février2 janvier : Pour la première fois, sept femmes journalistes participent à une conférence de presse à Djedda. 4 janvier : Après les émeutes du Nouvel An à Manama (Bahreïn, trois ressortissants saoudiens sont extradés vers l'Arabie. 12 janvier : Le prince héritier `Abd Allâh b. `Abd al-`Azîz dévoile à des intellectuels le projet...
Monothéisme en Arabie du Sud préislamique
Directory of Open Access Journals (Sweden)
Iwona Gajda
2002-04-01
Full Text Available A la fin du IVe siècle de l'ère chrétienne, l'Arabie du Sud abandonne les cultes polythéistes et adopte le monothéisme. Dès lors, les inscriptions monothéistes se multiplient. Un certain nombre d'entre elles sont juives ou judaïsantes alors qu'aucune inscription royale n'est explicitement juive. Cet article présente une courte synthèse de nos connaissances sur le monothéisme en Arabie du Sud avant l'islam. L'accent est mis sur la dimension politique et non uniquement religieuse des conflits du VIe siècle qui opposèrent le roi juif Yûsuf aux Ethiopiens chrétiens essayant de conquérir l'Arabie du Sud et leurs alliées, les chrétiens /himyarites. Le caractère de la religion officielle avant les conflits du VIe siècle est discuté en fin de l'article. L'auteur suggère d'y voir un monothéisme judaïsant plutôt que le judaïsme.Monotheism in pre-Islamic South Arabia. South Arabia abandoned polytheistic cults and adopted monotheism at the end of the 4th century AD, after which time monotheistic inscriptions become more common. Some of these inscriptions are Jewish or `judaizing', although no royal inscription is explicitly Jewish. This article brief summarizes our knowledge of monotheism in pre-Islamic South Arabia, with emphasis on the political, not merely doctrinal, dimensions of the conflicts in the 6th century AD between the Jewish king Yûsuf and the Ethiopian Christians, who were trying to conquer South Arabia, and their Christian allies the Himyarites. The author proposes to interpret as `judaizing' monotheism, rather than Judaism as such, the official religion prior to these 6th century conflicts.
Influences of Different Halophyte Vegetation on Soil Microbial Community at Temperate Salt Marsh.
Chaudhary, Doongar R; Kim, Jinhyun; Kang, Hojeong
2018-04-01
Salt marshes are transitional zone between terrestrial and aquatic ecosystems, occupied mainly by halophytic vegetation which provides numerous ecological services to coastal ecosystem. Halophyte-associated microbial community plays an important role in the adaptation of plants to adverse condition and also affected habitat characteristics. To explore the relationship between halophytes and soil microbial community, we studied the soil enzyme activities, soil microbial community structure, and functional gene abundance in halophytes- (Carex scabrifolia, Phragmites australis, and Suaeda japonica) covered and un-vegetated (mud flat) soils at Suncheon Bay, South Korea. Higher concentrations of total, Gram-positive, Gram-negative, total bacterial, and actinomycetes PLFAs (phospholipid fatty acids) were observed in the soil underneath the halophytes compared with mud flat soil and were highest in Carex soil. Halophyte-covered soils had different microbial community composition due to higher abundance of Gram-negative bacteria than mud flat soil. Similar to PLFA concentrations, the increased activities of β-glucosidase, cellulase, phosphatase, and sulfatase enzymes were observed under halophyte soil compared to mud flat soil and Carex exhibited highest activities. The abundance of archaeal 16S rRNA, fungal ITS, and denitrifying genes (nirK, nirS, and nosZ) were not influenced by the halophytes. Abundance bacterial 16S rRNA and dissimilatory (bi)sulfite (dsrA) genes were highest in Carex-covered soil. The abundance of functional genes involved in methane cycle (mcrA and pmoA) was not affected by the halophytes. However, the ratios of mcrA/pmoA and mcrA/dsrA increased in halophyte-covered soils which indicate higher methanogenesis activities. The finding of the study also suggests that halophytes had increased the microbial and enzyme activities, and played a pivotal role in shaping microbial community structure.
Willing, Eva Maria; Rawat, Vimal; Mandáková, Terezie; Maumus, Florian; James, Geo Velikkakam; Nordström, Karl J.V.; Becker, Claude; Warthmann, Norman; Chica, Claudia; Szarzynska, Bogna; Zytnicki, Matthias; Albani, Maria C.; Kiefer, Christiane; Bergonzi, Sara; Castaings, Loren; Mateos, Julieta L.; Berns, Markus C.; Bujdoso, Nora; Piofczyk, Thomas; Lorenzo, De Laura; Barrero-Sicilia, Cristina; Mateos, Isabel; Piednoël, Mathieu; Hagmann, Jörg; Chen-Min-Tao, Romy; Iglesias-Fernández, Raquel; Schuster, Stephan C.; Alonso-Blanco, Carlos; Roudier, François; Carbonero, Pilar; Paz-Ares, Javier; Davis, Seth J.; Pecinka, Ales; Quesneville, Hadi; Colot, Vincent; Lysak, Martin A.; Weigel, Detlef; Coupland, George; Schneeberger, Korbinian
2015-01-01
Despite evolutionary conserved mechanisms to silence transposable element activity, there are drastic differences in the abundance of transposable elements even among closely related plant species. We conducted a de novo assembly for the 375 .Mb genome of the perennial model plant, Arabis alpina.
IBN ‘ARABI AND THE TRANSCENDENTAL UNITY OF RELIGIONS
Directory of Open Access Journals (Sweden)
Media Zainul Bahri
2012-07-01
Full Text Available This essay describes Ibn ‘Arabi’s comprehensive views, captured in his important Futuhat and Fusus, on the concept of wahdat al-adyan, the discrepancy of beliefs, and the Shari’ah as well as its juncture and its unity. Elaborated explanation in this paper is expected to result in a true understanding of this crucial issue, particularly the concept of religious pluralism in the discourse of Islamic studies. Ibn Arabi’ extensively discusses religion in the sense of the “ideal” versus “historical” or “esoteric” versus “the exoteric”. Ibn ‘Arabi concludes that the absolute unity of religions may only occur within spiritual, ideal, or transcendental realm (or “esoteric”, which is beyond the formal form of religions. Hence, the transcendental unity of religions cannot be found in the formal form of religions nor in the shari’ah.[Artikel ini mengulas pandangan Ibn ‘Arabi’ mengenai wahdat al-adyan seperti dijelaskan dalam dua bukunya; Futuhat dan Fusus, dan perbedaan dan kesamaan antara iman dan shariah. Diharapkan diskusi artikel ini berkontribusi dalam kajian pluralisme, utamanya dalam disiplin studi Islam. Dalam diskusinya, Ibn Arabi’ menjelaskan perbedaan ‘ideal’ dan ‘historikal’ atau antara ‘esoterik’ dan ‘eksoterik’. Ibn ‘Arabi berpendapat bahwa kemanunggalan agama-agama dapat dicapai melalui spiritualitas, ideal, atau dimensi transcendental (esoterik yang ada di luar tampilan formal agama-agama. Dengan kata lain, kemanunggalan tersebut tidak akan ditemukan pada shari’ah.
Towards saving freshwater: halophytes as unconventional feedstuffs in livestock feed: a review.
Abd El-Hack, Mohamed E; Samak, Dalia H; Noreldin, Ahmed E; Arif, Muhammad; Yaqoob, Hilal S; Swelum, Ayman A
2018-04-26
Water represents 71% of all earth area and about 97% of this water is salty water. So, only 3% of the overall world water quantity is freshwater. Human can benefit only from 1% of this water and the remaining 2% freeze at both poles of earth. Therefore, it is important to preserve the freshwater through increasing the plants consuming salty water. The future prosperity of feed resources in arid and semi-arid countries depends on economic use of alternative resources that have been marginalized for long periods of time, such as halophytic plants, which are one such potential future resource. Halophyte plants can grow in high salinity water and soil and to some extent during drought. The growth of these plants depends on the contact of the salted water with plant roots as in semi-desert saline water, mangrove swamps, marshes, and seashores. Halophyte plants need high levels of sodium chloride in the soil water for growth, and the soil water must also contain high levels of salts, as sodium hydroxide or magnesium sulfate. There are many uses for halophyte plants, including feed for animals, vegetables, drugs, sand dune stabilizers, wind shelter, soil cover, wetland cultivation, laundry detergents, and paper production. This paper will focus on the use of halophytes as a feed additive for animals. In spite of the good nutritional value of halophytes, some anti-nutritional factors as nitrates, nitrite complexes, tannins, glycosides, phenolic compounds, saponins, oxalates, and alkaloids may be present in some of them. The presence of such anti-nutritional agents makes halophytes unpalatable to animals, which tends to reduce feed intake and nutrient use. Therefore, the negative effects of these plants on animal performance are the only objection against using halophytes in animal feed diets. This review article highlights the beneficial impact of considering halophytes in animal feeding on saving freshwater and illustrates its nutritive value for livestock from different
Accumulation of cadmium by halophytic and non-halophytic Juncus species
Czech Academy of Sciences Publication Activity Database
Vaněk, Tomáš; Moťková, Kateřina; Podlipná, Radka
2016-01-01
Roč. 28, č. 4 (2016), s. 415-423 ISSN 2197-0025 R&D Projects: GA MŠk(CZ) OC10028; GA MPO FR-TI3/778 Institutional support: RVO:61389030 Keywords : plant-responses * salt-tolerance * heavy-metals * salinity tolerance * abiotic stress * rice seedlings * amino-acids * proline * phytoremediation * detoxification * Halophyte * Cadmium accumulation * Proline * Juncus gerardii * Juncus inflexus Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.045, year: 2016
Hermeneutik Sufi : Sebuah Kajian atas Pandangan Ibn Arabi tentang Takwil al-Qur’an
Directory of Open Access Journals (Sweden)
Kautsar Azhari Nur
2012-12-01
Full Text Available Abstract : This article is an attempt to analyze Ibn ‘Arabi’s view of ta’wīl (esoteric commentary of the Qur’an. This Sufi Master of Andalusia refuses the ta’wīl controlled by reasoning, reflection, thinking, and desire because such ta’wīl deviates from what God meant by His words contained by His Book. But he accepts the ta’wīl guided by God through intuitive unveiling (kashf, that is, the ta’wīl bestowed by God to those whom He gave success in understanding what God meant by His words contained by His Book. This ta’wīl, which is advocated by Ibn ’Arabi, maintains the coformity between the outward meaning and inward meaning.Keywords : Teosophical tasawwuf, ta’wil, categorical signs (āyāt muhkamāt, analogical signs (āyāt mutashābihāt, correspondence, similarity, bestowal Abstrak : Artikel ini adalah sebuah usaha untuk menganalisis pandangan Ibn ‘Arabi tentang takwil al-Qur’an. Syekh Sufi dari Andalusia ini menolak takwil yang dikendalikan oleh penalaran, pemikiran, refleksi dan hawa nafsu karena takwil jenis ini melenceng dari apa yang dimaksud oleh Allah dengan kata-kata-Nya yang dikandung oleh Kitab-Nya. Tetapi ia menerima takwil yang dibimbing oleh Allah melalui penyingkapan intuitif (kasyf, yaitu takwil yang dianugerahkan oleh Allah kepada orang-orang yang diberi-Nya keberhasilan dalam memahami apa yang Dia maksud dengan kata-kata yang dikandung oleh Kitab-Nya. Takwil yang didukung oleh Ibn ‘Arabi ini tetap mempertahankan kesesuaian antara arti lahiriah dan arti batiniah.Kata kunci : Tasawuf teosofi, ta’wīl, ayat-ayat muhkamāt, ayat-ayat mutasyābihāt, persesuaian, keserupaan, pemberian (wahb
The Epistemology Of Heart-Mind In The Spiritual Teachings Of Muhyiddin Ibn ‘Arabi
Directory of Open Access Journals (Sweden)
Nikos Yiangou
2012-06-01
Full Text Available Abstrak : Ibn ‘Arabi menawarkan kerangka pikir yang unik dalam menjelaskan struktur ilmu. Epistemologinya bersandar pada prinsip kesatuan wujud, dan bahwa semua pengetahuan adalah berasal dari Wujud yang dimiliki oleh Wujud melalui penampakan Dirinya. Manusia merupakan cermin dari penampakan Diri tersebut, yang di dalamnya terdapat satu fakultas sebagai pusat pengalaman manusia, yaitu hati (qalb. Melalui interaksi dengan pikiran, refleksi dan imajinasi, Ibn ‘Arabi menawarkan model epistemologi yang kokoh yang menjelaskan kerja pikiran dalam menciptakan keyakinan terhadap Tuhan. Ia (The Real hadir dalam tataran potensi tertinggi manusia, sebagaimana Ia hadir setiap saat dalam hati, pada kondisi yang disebut sebagai maqam yang tak bermaqam. Jika pendekatan post-modern sangat menekankan epistemologi yang memperkuat status multiplisitas ontologis mereka, ada paradigma yang berkembang yang mengusung visi kemanusiaan yang utuh melibatkan kesatuan tubuh, pikiran dan ruh. Epistemolgi Ibn ‘Arabi lah yang sanggup mewakili perkembangan ini dan merumuskan struktur yang abadi dan proses yang mencakup kecakapan manusia untuk sadar dan merasakan.Kata kunci : Kehadiran, Hati, Kesatuan wujud Abstract : Ibn ‘Arabi offers a unique framework for explaining the structures of knowledge. His epistemology is referenced within the Oneness of Being (wahdāt al-wujūd, and all knowledge is ultimately the knowledge that the Being has of Itself through Its own self-disclosure. The human form mirrors this self-disclosure, and within this form he situates the center of the human experience in the faculty of the heart (qalb. Through interactions with the faculties of mind, reflection and imagination, he provides a robust model for an epistemology that explains the workings of mind and the creation of the many beliefs about God. He intimates at the highest human potential which is the immediate perception of the Real as It appears to the heart in every moment, a
Biophysical analysis of water filtration phenomenon in the roots of halophytes
Kim, Kiwoong; Lee, Sang Joon
2015-11-01
The water management systems of plants, such as water collection and water filtration have been optimized through a long history. In this point of view, new bio-inspired technologies can be developed by mimicking the nature's strategies for the survival of the fittest. In this study, the biophysical characteristics of water filtration process in the roots of halophytes are experimentally investigated in the plant hydrodynamic point of view. To understand the functional features of the halophytes 3D morphological structure of their roots are analyzed using advanced bioimaging techniques. The surface properties of the roots of halophytes are also examined Based on the quantitatively analyzed information, water filtration phenomenon in the roots is examined. Sodium treated mangroves are soaked in sodium acting fluorescent dye solution to trace sodium ions in the roots. In addition, in vitroexperiment is carried out by using the roots. As a result, the outermost layer of the roots filters out continuously most of sodium ions. This study on developing halophytes would be helpful for understanding the water filtration mechanism of the roots of halophytes and developing a new bio inspired desalination system. This research was financially supported by the National Research Foundation (NRF) of Korea (Contract grant number: 2008-0061991).
Halophytes: Potential Resources for Salt Stress Tolerance Genes and Promoters.
Mishra, Avinash; Tanna, Bhakti
2017-01-01
Halophytes have demonstrated their capability to thrive under extremely saline conditions and thus considered as one of the best germplasm for saline agriculture. Salinity is a worldwide problem, and the salt-affected areas are increasing day-by-day because of scanty rainfall, poor irrigation system, salt ingression, water contamination, and other environmental factors. The salinity stress tolerance mechanism is a very complex phenomenon, and some pathways are coordinately linked for imparting salinity tolerance. Though a number of salt responsive genes have been reported from the halophytes, there is always a quest for promising stress-responsive genes that can modulate plant physiology according to the salt stress. Halophytes such as Aeluropus, Mesembryanthemum, Suaeda, Atriplex, Thellungiella, Cakile , and Salicornia serve as a potential candidate for the salt-responsive genes and promoters. Several known genes like antiporters ( NHX, SOS, HKT, VTPase ), ion channels (Cl - , Ca 2+ , aquaporins), antioxidant encoding genes ( APX, CAT, GST, BADH, SOD ) and some novel genes such as USP, SDR1, SRP etc. were isolated from halophytes and explored for developing stress tolerance in the crop plants (glycophytes). It is evidenced that stress triggers salt sensors that lead to the activation of stress tolerance mechanisms which involve multiple signaling proteins, up- or down-regulation of several genes, and finally the distinctive or collective effects of stress-responsive genes. In this review, halophytes are discussed as an excellent platform for salt responsive genes which can be utilized for developing salinity tolerance in crop plants through genetic engineering.
Halophytes: Potential Resources for Salt Stress Tolerance Genes and Promoters
Directory of Open Access Journals (Sweden)
Avinash Mishra
2017-05-01
Full Text Available Halophytes have demonstrated their capability to thrive under extremely saline conditions and thus considered as one of the best germplasm for saline agriculture. Salinity is a worldwide problem, and the salt-affected areas are increasing day-by-day because of scanty rainfall, poor irrigation system, salt ingression, water contamination, and other environmental factors. The salinity stress tolerance mechanism is a very complex phenomenon, and some pathways are coordinately linked for imparting salinity tolerance. Though a number of salt responsive genes have been reported from the halophytes, there is always a quest for promising stress-responsive genes that can modulate plant physiology according to the salt stress. Halophytes such as Aeluropus, Mesembryanthemum, Suaeda, Atriplex, Thellungiella, Cakile, and Salicornia serve as a potential candidate for the salt-responsive genes and promoters. Several known genes like antiporters (NHX, SOS, HKT, VTPase, ion channels (Cl−, Ca2+, aquaporins, antioxidant encoding genes (APX, CAT, GST, BADH, SOD and some novel genes such as USP, SDR1, SRP etc. were isolated from halophytes and explored for developing stress tolerance in the crop plants (glycophytes. It is evidenced that stress triggers salt sensors that lead to the activation of stress tolerance mechanisms which involve multiple signaling proteins, up- or down-regulation of several genes, and finally the distinctive or collective effects of stress-responsive genes. In this review, halophytes are discussed as an excellent platform for salt responsive genes which can be utilized for developing salinity tolerance in crop plants through genetic engineering.
Rigoulet-Roze David, Géopolitique de l’Arabie Saoudite
Directory of Open Access Journals (Sweden)
Laurent Bonnefoy
2007-12-01
Full Text Available Depuis quelques années, l’Arabie Saoudite suscite un intérêt grandissant de la part des chercheurs et des experts occidentaux. Rares sont néanmoins les écrits qui à l’information collectée sur le terrain allient une démarche rigoureusement construite. C’est à juste titre que David Rigoulet-Roze rappelle dans son introduction la nécessité de dépasser les « lieux communs » et d’adopter « une perspective véritablement géopolitique, avec les outils et la méthode » (p. 8 que cela implique. Il est...
Threat of heavy metal pollution in halophytic and mangrove plants of Tamil Nadu, India
Energy Technology Data Exchange (ETDEWEB)
Agoramoorthy, Govindasamy; Chen, F.-A. [Department of Pharmacy, Tajen University, Yanpu, Pingtung 907, Taiwan (China); Hsu, Minna J. [Department of Biological Sciences, National Sun Yat-sen University, Kaohsiung 80424, Taiwan (China)], E-mail: hsumin@mail.nsysu.edu.tw
2008-09-15
Mangrove and halophytic plants occur along the coastal areas of Tamil Nadu, south India and these plants have been used in traditional medicine for centuries. Heavy metals are known to pose a potential threat to terrestrial and aquatic biota. However, little is known on the toxic levels of heavy metals found in mangrove and halophytic plants that are used in traditional medicine in India. To understand heavy metal toxicity, we investigated the bioconcentration factors (BCF) of heavy metals in leaves collected from eight mangroves and five halophytes in the protected Pichavaram mangrove forest reserve in Tamil Nadu State, south India. Data presented in this paper describe the impact of essential (Cu, Fe, Mg, Mn and Zn) and non-essential/environmentally toxic trace metals (Hg, Pb and Sn) in mangrove and halophytic medicinal plants. The concentrations of Pb among 13 plant species were higher than the normal range of contamination reported for plants. The average concentration of Hg in the halophytic plants (0.43 {+-} 0.37 {mu}g/g) was seven times higher than mangrove plants (0.06 {+-} 0.03 {mu}g/g) and it indicated pollutants from industrial sources affecting halophytes more than mangroves. - Metal effects occur in India's mangrove ecosystem.
Threat of heavy metal pollution in halophytic and mangrove plants of Tamil Nadu, India
International Nuclear Information System (INIS)
Agoramoorthy, Govindasamy; Chen, F.-A.; Hsu, Minna J.
2008-01-01
Mangrove and halophytic plants occur along the coastal areas of Tamil Nadu, south India and these plants have been used in traditional medicine for centuries. Heavy metals are known to pose a potential threat to terrestrial and aquatic biota. However, little is known on the toxic levels of heavy metals found in mangrove and halophytic plants that are used in traditional medicine in India. To understand heavy metal toxicity, we investigated the bioconcentration factors (BCF) of heavy metals in leaves collected from eight mangroves and five halophytes in the protected Pichavaram mangrove forest reserve in Tamil Nadu State, south India. Data presented in this paper describe the impact of essential (Cu, Fe, Mg, Mn and Zn) and non-essential/environmentally toxic trace metals (Hg, Pb and Sn) in mangrove and halophytic medicinal plants. The concentrations of Pb among 13 plant species were higher than the normal range of contamination reported for plants. The average concentration of Hg in the halophytic plants (0.43 ± 0.37 μg/g) was seven times higher than mangrove plants (0.06 ± 0.03 μg/g) and it indicated pollutants from industrial sources affecting halophytes more than mangroves. - Metal effects occur in India's mangrove ecosystem
Modeling Halophytic Plants in APEX for Sustainable Water and Agriculture
DeRuyter, T.; Saito, L.; Nowak, B.; Rossi, C.; Toderich, K.
2013-12-01
A major problem for irrigated agricultural production is soil salinization, which can occur naturally or can be human-induced. Human-induced, or secondary salinization, is particularly a problem in arid and semi-arid regions, especially in irrigated areas. Irrigated land has more than twice the production of rainfed land, and accounts for about one third of the world's food, but nearly 20% of irrigated lands are salt-affected. Many farmers worldwide currently seasonally leach their land to reduce the soil salt content. These practices, however, create further problems such as a raised groundwater table, and salt, fertilizer, and pesticide pollution of nearby lakes and groundwater. In Uzbekistan, a combination of these management practices and a propensity to cultivate 'thirsty' crops such as cotton has also contributed to the Aral Sea shrinking nearly 90% by volume since the 1950s. Most common agricultural crops are glycophytes that have reduced yields when subjected to salt-stress. Some plants, however, are known as halophytic or 'salt-loving' plants and are capable of completing their life-cycle in higher saline soil or water environments. Halophytes may be useful for human consumption, livestock fodder, or biofuel, and may also be able to reduce or maintain salt levels in soil and water. To assess the potential for these halophytes to assist with salinity management, we are developing a model that is capable of tracking salinity under different management practices in agricultural environments. This model is interdisciplinary as it combines fields such as plant ecology, hydrology, and soil science. The US Department of Agriculture (USDA) model, Agricultural Policy/Environmental Extender (APEX), is being augmented with a salinity module that tracks salinity as separate ions across the soil-plant-water interface. The halophytes Atriplex nitens, Climacoptera lanata, and Salicornia europaea are being parameterized and added into the APEX model database. Field sites
Salt tolerance of halophytes, research questions reviewed in the perspective of saline agriculture
Rozema, J.; Schat, H.
2013-01-01
Halophytes of the lower coastal salt marsh show increased salt tolerance, and under high salinity they grow faster than upper marsh species. We could not show reduced growth rate of halophytes compared with glycophytes when grown under non-saline conditions. This indicates limited energy costs
Do Halophytes Really Require Salts for Their Growth and Development? An Experimental Approach
Directory of Open Access Journals (Sweden)
Marius Nicusor GRIGORE
2012-05-01
Full Text Available Halophytes are salt-tolerant plants found exclusively in habitats with high levels of soil salinity. It is generally assumed that salt stress is the most important limiting factor for plant growth in natural saline environments, and that halophytes have developed specific adaptations to elevated salinity which make them unfitted to grow in the absence of salt, thus explaining their distribution in nature. To address experimentally this question, two halophytic species (Inula crithmoides L. and Plantago crassifolia Forssk. and a maritime dune species (Medicago marina L. were grown in the greenhouse for several weeks in different substrates: peat, vegetable garden soil, saline soil and sand from maritime dunes. Measurements of growth parameters number of leaves, plant length, fresh and dry weights showed that all three species grew much better on the salt-free and nutrient-rich substrates, peat and garden soil, than on saline soil and dune sand. These results indicate that salts are not compulsorily required for development of halophytic species, and suggest that limitation of water and nutrients, rather than soil salinity per se, are the most important restrictive factors for plant growth in saline habitats. The distribution of halophytes in nature is probably dependent on their limited ability to compete with glycophytes in non-saline areas, while remaining highly competitive under environmental conditions stressful for non-tolerant species.
Do Halophytes Really Require Salts for Their Growth and Development? An Experimental Approach
Directory of Open Access Journals (Sweden)
Marius Nicusor GRIGORE
2012-05-01
Full Text Available Halophytes are salt-tolerant plants found exclusively in habitats with high levels of soil salinity. It is generally assumed that salt stress is the most important limiting factor for plant growth in natural saline environments, and that halophytes have developed specific adaptations to elevated salinity which make them unfitted to grow in the absence of salt, thus explaining their distribution in nature. To address experimentally this question, two halophytic species (Inula crithmoides L. and Plantago crassifolia Forssk. and a maritime dune species (Medicago marina L. were grown in the greenhouse for several weeks in different substrates: peat, vegetable garden soil, saline soil and sand from maritime dunes. Measurements of growth parameters � number of leaves, plant length, fresh and dry weights � showed that all three species grew much better on the salt-free and nutrient-rich substrates, peat and garden soil, than on saline soil and dune sand. These results indicate that salts are not compulsorily required for development of halophytic species, and suggest that limitation of water and nutrients, rather than soil salinity per se, are the most important restrictive factors for plant growth in saline habitats. The distribution of halophytes in nature is probably dependent on their limited ability to compete with glycophytes in non-saline areas, while remaining highly competitive under environmental conditions stressful for non-tolerant species.
Comparison of Views of Allame Tabatabai and M.Arabi on Vision and Seeing
Directory of Open Access Journals (Sweden)
Forugh Rahimpur
2010-01-01
Full Text Available This paper compares vision, in general, and seeing God, in particular from two view points: Allame M.H.Tabatabai’s and M.Arabi’s, who are representatives of two school of Hikmat Mutaalie and Gnosticism. Subjects such as: heart as the place of receiving vision, the factors for incerasing heart’s receiving capability of the inspirations, error in visionary knowledge, criteria for finding these errors and seeing God are investigated in this paper. A quick look at these two scholars’ definition of “vision” makes one think that these two views are complementary and point to the same direction.Also there are similarities in their approach to the subject of vision. For example, both agreed that the heart is the place to receive the vision and Aref can increase his heart’s receiving ability by some self-watching exercises. They both believe that it is possible for visionary knowledge to be erroneous for the probability of non-divine sources of revelations or inspirations and wrong interpretations of observations. However, there are important differences between the thinking methods of Allameh and Ibn Arabi, the most crucial of which is the different position of rational mind in their views.As for Allameh, unlike Ibn Arabi, it has a special importance as a cognitive tool and he refers to it as a criterion for the validity of visionary knowledge.
The development of halophyte-based agriculture: past and present.
Ventura, Yvonne; Eshel, Amram; Pasternak, Dov; Sagi, Moshe
2015-02-01
Freshwater comprises about a mere 2·5% of total global water, of which approximately two-thirds is locked into glaciers at the polar ice caps and on mountains. In conjunction with this, in many instances irrigation with freshwater causes an increase in soil salinity due to overirrigation of agricultural land, inefficient water use and poor drainage of unsuitable soils. The problem of salinity was recognized a long time ago and, due to the importance of irrigated agriculture, numerous efforts have been devoted towards improving crop species for better utilization of saline soils and water. Irrigating plants with saline water is a challenge for practitioners and researchers throughout the world. Recruiting wild halophytes with economic potential was suggested several decades ago as a way to reduce the damage caused by salinization of soil and water. A range of cultivation systems for the utilization of halophytes have been developed, for the production of biofuel, purification of saline effluent in constructed wetlands, landscaping, cultivation of gourmet vegetables, and more. This review critically analyses past and present halophyte-based production systems in the context of genetics, physiology, agrotechnical issues and product value. There are still difficulties that need to be overcome, such as direct germination in saline conditions or genotype selection. However, more and more research is being directed not only towards determining salt tolerance of halophytes, but also to the improvement of agricultural traits for long-term progress. © The Author 2014. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Jeong, Chan; Escobar, Enrique; Zavattieri, Pablo, Dr.
2013-01-01
The Cryptochiton Stelleri is known to have ultra-hard radular teeth that have one of the largest hardness (9-12GPa) and stiffness (90-125GPa) among other biological materials such as Enamel and Abalone shell. The ultrastructure of the teeth is formed by a bundle of highly mineralized rods composed of iron oxides and organic material. The main method to measure the material properties has been through nanoindentation. However there are limitations to nanoindentation of the Chiton’s teeth such ...
Halophytes, Algae, and Bacteria Food and Fuel Feedstocks
Hendricks, R. C.; Bushnell, D. M.
2009-01-01
The constant, increasing demand for energy, freshwater, and food stresses our ability to meet these demands within reasonable cost and impact on climate while sustaining quality of life. This environmental Triangle of Conflicts between energy, food, and water--while provoked by anthropogenic monetary and power struggles--can be resolved through an anthropogenic paradigm shift in how we produce and use energy, water, and food. With world population (6.6 billion) projected to increase 40 percent in 40 to 60 yr, proper development of saline agriculture and aquaculture is required, as 43 percent of the Earth's landmass is arid or semi-arid and 97 percent of the Earth's water is seawater. In light of this, we seek fuel alternatives in plants that thrive in brackish and saltwater with the ability to survive in arid lands. The development and application of these plants (halophytes) become the primary focus. Herein we introduce some not-so-familiar halophytes and present a few of their benefits, cite a few research projects (including some on the alternatives algae and bacteria), and then set theoretical limits on biomass production followed by projections in terms of world energy demands. Based on diverse arid lands with a total size equivalent to the Sahara Desert (8.6(exp 8) ha, or 2.1(exp 9) acres), these projections show that halophyte agriculture and algae systems can provide for the projected world energy demand.
Biophysical and biochemical constraints imposed by salt stress:Learning from halophyte
Directory of Open Access Journals (Sweden)
Bernardo eDuarte
2014-12-01
Full Text Available Soil salinization is one of the most important factors impacting plant productivity. About 3.6 billion of the world’s 5.2 billion ha of agricultural dryland have already suffered erosion, degradation and salinization. Halophytes typically are considered as plants able to complete their life cycle in environments where the salt concentration is 200 mM NaCl or higher. Different strategies are known to overcome salt stress, as adaptation mechanisms from this type of plants. Salinity adjustment is a complex phenomenon characterized by both biochemical and biophysical adaptations. As photosynthesis is a prerequisite for biomass production, halophytes adapted their electronic transduction pathways and the entire energetic metabolism to overcome the salt excess. The maintenance of ionic homeostasis is in the basis of all cellular stress in particular in terms of redox potential and energy transduction. In the present work the biophysical mechanisms underlying energy capture and transduction in halophytes are discussed alongside with their relation to biochemical mechanisms, integrating data from photosystem light harvesting complexes, electronic transport chains to the quinone pools, carbon harvesting and energy dissipation metabolism.
KEMAJEMUKAN AGAMA MENURUT IBN AL-‘ARABI
Directory of Open Access Journals (Sweden)
Syahrul Adam
2017-08-01
Full Text Available Ibn al-'Arabi> considers that religious pluralism is inevitable necessities. His opinion is actually rooted in his main Sufi he achieved wah}dat al-wuju>d. With such diversity, it is not necessary to the claims of truth (truth claim on a particular religion. All religions should live together in harmony for the worship of the same God, who is called by different names attributed to differences in the perception of God as well as differences in appearance (tajalli of God. The understanding of causality religious diversity will make believers can appreciate the existence differences. Ibn al-‘Arabī menganggap bahwa keberagaman agama merupakan suatu keniscayaan yang tak terelakkan. Pendapatnya tersebut sebenarnya berakar dari konsep utama pemikiran sufistik yang dicapainya yakni wah}dat al-wuju>d. Dengan keragaman tersebut, maka tidak diperlukan adanya klaim-klaim kebenaran (truth claim pada agama tertentu. Semua agama yang ada harus hidup harmonis sebab sama-sama melakukan penyembahan kepada Tuhan yang sama, yang disebut dengan nama-nama berbeda disebabkan adanya perbedaan persepsi terhadap Tuhan dan juga perbedaan penampakan (tajalli> Tuhan. Pemahaman terhadap kausalitas keberagaman agama akan membuat penganut agama dapat menghargai perbedaan yang ada.
Directory of Open Access Journals (Sweden)
Dihyatun Masqon
2017-12-01
Full Text Available Insha 'Arabi At-tahriri is one of the important subject in the Kulliyatul Mu'allimin Al-Islamiyah (KMI curriculum. However, in the implementation, it was found that most of them (60% still scored below 6. This study aims to find the problems that exist in the learning of Insya 'Arabi At-tahriri amongs student or santri of KMI, especially fifth grade student. This research is a field research using descriptive qualitative analysis. This research takes place in Modern Islamic Boarding School of Darussalam Gontor Campus 2. The sample of this research includes the Vice-director of KMI, teacher of KMI, staff of KMI, and all the fifth-grade students of KMI. The results of this study indicate the problem of learning Insya caused by several source. From the internal students, such as the lack of ability to express the language in writing competence, the weak mastery of Arabic Material and psychological aspect like willingness and motivation. And the external aspect of student including their activities outside class such as joining organization. While the factor of teachers, the problematic learning occurs due to teacher teaching method, some of them do not use student learning center method. It cause the teaching process becomes monotonous and bit boring.
A bio-thermic seawater desalination system using halophytes
Finck, C.
2014-01-01
A bio-thermic seawater desalination system using halophytes was developed and successfully tested. A greenhouse as part of a test rig, with different sorts of mangroves, was installed. Measurements showed promising results concerning fresh water relative yielding rates up to 1.4 kg/h/m2 (leaf
Facing the challenge of sustainable bioenergy production: Could halophytes be part of the solution?
Debez, Ahmed; Belghith, Ikram; Friesen, Jan; Montzka, Carsten; Elleuche, Skander
2017-01-01
Due to steadily growing population and economic transitions in the more populous countries, renewable sources of energy are needed more than ever. Plant biomass as a raw source of bioenergy and biofuel products may meet the demand for sustainable energy; however, such plants typically compete with food crops, which should not be wasted for producing energy and chemicals. Second-generation or advanced biofuels that are based on renewable and non-edible biomass resources are processed to produce cellulosic ethanol, which could be further used for producing energy, but also bio-based chemicals including higher alcohols, organic acids, and bulk chemicals. Halophytes do not compete with conventional crops for arable areas and freshwater resources, since they grow naturally in saline ecosystems, mostly in semi-arid and arid areas. Using halophytes for biofuel production may provide a mid-term economically feasible and environmentally sustainable solution to producing bioenergy, contributing, at the same time, to making saline areas - which have been considered unproductive for a long time - more valuable. This review emphasises on halophyte definition, global distribution, and environmental requirements. It also examines their enzymatic valorization, focusing on salt-tolerant enzymes from halophilic microbial species that may be deployed with greater advantage compared to their conventional mesophilic counterparts for faster degradation of halophyte biomass.
ADAPTIVE STRATEGIES OF THE HALOPHYTE POPULATIONS
Directory of Open Access Journals (Sweden)
O. Z. Glukhov
2013-11-01
Full Text Available Studies of the adaptive strategies of halophytes at different levels of their organization are important not only for assessment of their health condition and prognosticating their future behaviors, but also for testing potential suitability of technogenic edaphotopes for plant growth without making additional analyses. We investigated the population structure and morphological variation of three halophilic Gypsophyla L. species which actively spread in different technogenic ecotopes of Ukraine by methods generally accepted in ecology and phytocenology. By the type of strategy populations of species of the genus Gypsophila in technogenic edaphotopes can change the primary type of strategy for the secondary, or gain the stress-tolerant type, mainly due to the changes of parameters of seed productivity. The studied populations are stable with predominance of individuals which reached the prereproductive and reproductive stages of their development. At the organism level the species differ by phenotypic plasticity revealing in compensatory development of vegetative and generative organs. This reflects not only in absolute values of parameters of features, but also when calculating the coefficients of divergence, variation, as well as the vitality classes in populations.By the adaptive strategy halophytes are candidates for use in local phytoremediation of disturbed lands.
Alternate-Fueled Flight: Halophytes, Algae, Bio-, and Synthetic Fuels
Hendricks, R. C.
2012-01-01
Synthetic and biomass fueling are now considered to be near-term aviation alternate fueling. The major impediment is a secure sustainable supply of these fuels at reasonable cost. However, biomass fueling raises major concerns related to uses of common food crops and grasses (some also called "weeds") for processing into aviation fuels. These issues are addressed, and then halophytes and algae are shown to be better suited as sources of aerospace fuels and transportation fueling in general. Some of the history related to alternate fuels use is provided as a guideline for current and planned alternate fuels testing (ground and flight) with emphasis on biofuel blends. It is also noted that lessons learned from terrestrial fueling are applicable to space missions. These materials represent an update (to 2009) and additions to the Workshop on Alternate Fueling Sustainable Supply and Halophyte Summit at Twinsburg, Ohio, October 17 to 18, 2007.
Balnokin, Yurii; Balnokin, Yurii; Myasoedov, Nikolay; Popova, Larissa; Tikhomirov, Alexander A.; Ushakova, Sofya; Tikhomirova, Natalia; Lasseur, Christophe; Gros, Jean-Bernard
Currently, the closure of matter turnover is one of the urgent problems of bioregenerative life support system (BLSS) designing. The important aspect of the problem is involving of substances contained in liquid and solid exometabolites of humans inhabiting BLSS into intrasystem matter turnover. Recycling of Na+ and Cl- contained in human liquid exometabolites, i.e. urine is acknowledged to be among the main tasks of the matter turnover in BLSS. The ions excreted with urine may be returned to human organism with food. A way to allow this is including edible halophytic plants into the phototrophic compartment of BLSS. Halophytes are defined as plants which can grow on saline soils and produce high biomass under these conditions. Some halophytes can take up high quantities of Na+ and Cl- and accumulate the ions in the shoots or extrude them to leaf surface by means of salt glands. To allow Na+ and Cl- recycling through halophyte utilization, the following principal steps should be accomplished: (i) mineralization of the exometabolites by physicochemical methods; (ii) oxidation of ammonia formed during the exometabolite mineralization to nitrate by nitrifying bacteria, (iii) growing the halophyte on the nutrient solution prepared on the basis of the mineralized exometabolites, (iv) introducing the halophyte green biomass into human food. The present work is devoted to the following problems: (i) selection of a salt-accumulating/extruding halophytic plant suitable for Na+ and Cl- recycling in BLSS and (ii) parameter evaluation of a plant conveyor containing the halophytic plants at various ages. Halophytic plants selected for BLSS should meet the following criteria: (i) ability to grow under 24-hour-illumination, (ii) high productivity, (iii) ability to accumulate Na+ and Cl- in high quantities in shoots or to excrete salts to leaf surface, (iv) edibility, and (v) high nutritive value of the biomass. Relying on these criteria, salt-accumulating halophyte Salicornia
International Nuclear Information System (INIS)
Altay, V.
2012-01-01
Investigations were undertaken during 2010-2011 to study effect of human induced land degradation on structure of some halophytic plant communities. Over all 183 taxa of vascular plant were recorded. Out of these 76 were of typical halophytes. The dominant plant taxa were; Phragmites australis, Halimione portulacoides and Bolboschoenus maritimus. The threatened categories of these taxa were identified from the Red Data Book of Turkey together with their distribution. The impact of degradation on the habitats due to land use for agriculture, organic and inorganic waste disposal and housing for tourisitc purposes were identified and conservation measures were outlined in this study. (author)
Directory of Open Access Journals (Sweden)
Patricia María Rodríguez-González
2014-04-01
Full Text Available Coastal wetlands are among most threatened ecosystems, owing to the intense human activity concentrated in shoreline areas together with the expected sea level rise resultant from climate change. Salt marshes are wetlands which are inundated twice daily by the sea, thus tightly dependent on frequency and duration of submergence. Identifying the factors that determine the diversity, distribution and abundance of halophyte species in salt marshes will help retaining their conservation status and adopt anticipate management measures, and this will ultimately contribute to preserve marshland biodiversity and ecological services. Reserva Natural de Castro Marim e Vila Real de Santo António (RNSCMVRSA is a natural reserve located in South Eastern Portugal, comprising the tidal area of Guadiana River mouth. In spite of their great ecological value, salt marsh ecosystems in this region have suffered intense anthropic disturbance, namely hydrologic alterations and vegetation removal to gain soils for agriculture and salt intensive production. The present study aimed at characterizing the halophyte diversity in the RNSCMVRSA salt marshes and determining their major ecological correlates. The end-point is to implement, afterward, a sustainable cultivation of autochthonous halophyte plants, with economic value, in the abandoned saltpans and degraded rangelands. This project will contribute to the conservation of halophyte diversity, promote environmental requalification, and provide an economic alternative for local populations, enabling the reduction of unregulated harvest of halophyte plant populations. Field sampling strategy included a preliminary survey of local vegetation diversity and floristic inventories of halophyte communities in plots established across the existing environmental heterogeneity in order to span the whole variation gradients of the species presence and abundance. The abiotic characterization of halophyte communities included a
Modeling salt movement and halophytic crop growth on marginal lands with the APEX model
Goehring, N.; Saito, L.; Verburg, P.; Jeong, J.; Garrett, A.
2016-12-01
Saline soils negatively impact crop productivity in nearly 20% of irrigated agricultural lands worldwide. At these saline sites, cultivation of highly salt-tolerant plants, known as halophytes, may increase productivity compared to conventional salt-sensitive crops (i.e., glycophytes), thereby increasing the economic potential of marginal lands. Through a variety of mechanisms, halophytes are more effective than glycophytes at excluding, accumulating, and secreting salts from their tissues. Each mechanism can have a different impact on the salt balance in the plant-soil-water system. To date, little information is available to understand the long-term impacts of halophyte cultivation on environmental quality. This project utilizes the Agricultural Policy/Environmental Extender (APEX) model, developed by the US Department of Agriculture, to model the growth and production of two halophytic crops. The crops being modeled include quinoa (Chenopodium quinoa), which has utilities for human consumption and forage, and AC Saltlander green wheatgrass (Elymus hoffmannii), which has forage utility. APEX simulates salt movement between soil layers and accounts for the salt balance in the plant-soil-water system, including salinity in irrigation water and crop-specific salt uptake. Key crop growth parameters in APEX are derived from experimental growth data obtained under non-stressed conditions. Data from greenhouse and field experiments in which quinoa and AC Saltlander were grown under various soil salinity and irrigation salinity treatments are being used to parameterize, calibrate, and test the model. This presentation will discuss progress on crop parameterization and completed model runs under different salt-affected soil and irrigation conditions.
Directory of Open Access Journals (Sweden)
Monika Strzałkowska-Abramek
2016-04-01
Full Text Available Ecological environment in urban areas is specific in many aspects. There are evidences that ornamental plants cultivated in local urban gardens may help in conservation of pollinators. In this study, the flowering pattern, the abundance of flowering, nectar and pollen production as well as insect visitation in Arabis procurrens Waldst. & Kit. and Iberis sempervirens L. were investigated. The species were grown in the UMCS Botanical Garden in Lublin, southeastern Poland. Arabis procurrens bloomed from the middle of April until middle of May and I. sempervirens from the end of April until middle of June. In both species, most flowers opened in the morning hours (40–45% of total were opened by 8:00 h GMT + 2 h. The average sugar yield of A. procurrens was ca. 53% lower compared to I. sempervirens (mean = 1.08 g/m2 and 2.32 g/m2, respectively. In both species, considerable differences in the amount of produced sugars were noted between years. The mass of pollen produced in the flowers of A. procurrens was approx. 35% lower compared to that of I. sempervirens (mean = 0.06 mg and 0.09 mg per flower, respectively. Pollen produced per unit area was correlated with the number of flowers. On average, the species produced 1.46 g (A. procurrens and 2.54 g (I. sempervirens of pollen per 1 m2. The flowers of A. procurrens attracted mainly dipterans (56.3% of total visitors, while I. sempervirens lured chiefly solitary bees (47.4% of total visitors, however in both cases, honeybees, bumblebees and lepidopterans were also recorded. The A. procurrens and I. sempervirens due to flowering in early spring period may be promoted for use in small gardens (rock or pot gardens for both aesthetic value and as plants that support insect visitors in nectar and pollen rewards.
Cross-reacting and heterospecific monoclonal antibodies produced against arabis mosaic nepovirus.
Frison, E A; Stace-Smith, R
1992-10-01
Monoclonal antibodies (MAbs) were produced against arabis mosaic nepovirus (AMV). A hybridoma screening procedure was applied which involved the testing of culture supernatants, before the hybridomas were cloned to single cell lines, for their reaction with eight nepoviruses [AMV, cherry leafroll virus (CLRV), grapevine fanleaf virus (GFLV), peach rosette mosaic virus, raspberry ringspot virus (RRSV), tobacco ringspot virus, tomato black ring virus (TBRV) and tomato ringspot virus]. In addition to AMV-specific MAbs, this screening technique has allowed the selection of two cross-reacting MAbs: one reacting with AMV and GFLV, and one reacting with AMV and RRSV. This is the first report of MAbs cross-reacting with these nepoviruses. In addition, five heterospecific MAbs (HS-MAbs) could be selected: two reacting with RRSV, two with CLRV and one with TBRV. The usefulness of the screening technique that was applied for the selection of cross-reacting MAbs and HS-MAbs, and the potential use of such antibodies are discussed.
Teng, Songshan; Liu, Yanping; Zhao, Lei
2010-11-01
We Isolated and characterized 1-aminocyclopropane-1-carboxylate (ACC) deaminase-containing endophytic bacteria from halophyte Suaeda salsa to understand the interactions between endophytes and halophyte. ACC deaminase-containing endophytic bacteria were isolated from root, stalk and leaf of Suaeda salsa and were identified based on morphological, physiological-biochemical properties, API and 16S rRNA sequence analysis. Isolates were evaluated for their ACC deaminase, antifungal, protease activity, siderophores and phytohormones, such as indole-3-acetic acid, gibberellic acid and abscisic acid production, as well as atmospheric nitrogen fixation and phosphate solubilization. Four ACC deaminase-containing endophytic bacteria strains named as LP11, SS12, TW1 and TW2 were isolated and identified as Pseudomonas oryzihabitans, Pseudomonas sp., Pantoea agglomerans and Pseudomonas putida respectively. All the strains possessed the phosphate-solubilizing ability and could produce siderophores and phytohormones more or less. None of them could fix atmospheric nitrogen or produce protease. Only strain SS12 showed antagonism against two phytopathogenic fungi viz Fusarium oxysporum f. sp. conglutinans and F. oxysporum f. sp. cucumerinum. ACC deaminase-containing endophytic bacteria of Pseudomonas sp. and Pantoea sp. isolated from halophyte Suaeda salsa have abundant biological characteristics related to plant growth promotion, stress homeostasis regulation and biocontrol activity.
On the distribution and evaluation of Na, Mg and Cl in leaves of selected halophytes
Energy Technology Data Exchange (ETDEWEB)
Pongrac, Paula; Vogel-Mikuš, Katarina; Regvar, Marjana [Department of Biology, Biotechnical Faculty, University of Ljubljana, Večna pot 111, SI-1000 Ljubljana (Slovenia); Kaligarič, Mitja [Department of Biology, Faculty of Natural Sciences and Mathematics, Koroška c. 160, SI-2000 Maribor (Slovenia); Vavpetič, Primož; Kelemen, Mitja; Grlj, Nataša [Jožef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Shelef, Oren; Golan-Goldhirsh, Avi; Rachmilevitch, Shimon [French Associates Institute for Agriculture and Biotechnology of Drylands, The Jacob Blaustein Institutes for Desert Research (BIDR), Ben-Gurion University of the Negev, 84990 Midreshet Ben-Gurion (Israel); Pelicon, Primož, E-mail: primoz.pelicon@ijs.si [Jožef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia)
2013-07-01
Diverse physiological, biochemical and morphological adaptations enable plants to survive in extreme saline environments where osmotic and ionic stresses limit growth and development. Halophytes are salt-tolerant plants that can withstand extraordinarily high levels of Na and Cl in their leaves. The tissue and cellular distribution patterns of salt ions can be linked to the underlying mechanisms of salt tolerance. Application of fast, reliable, multi-elemental and quantitative techniques such as micro-proton-induced X-ray emission (micro-PIXE) will significantly contribute to and accelerate studies of plant salt tolerance, especially as micro-PIXE also provides spatially resolved quantitative data for light elements, such as Na and Mg. The spatial concentration distributions of Na, Mg, Cl, K, P and S in leaves of four halophytes (Bassia indica, Atriplex prostrata, Spartina maritima and Limonium angustifolium) were determined using micro-PIXE, to study the salt-tolerance strategies of the selected halophytes. Different distribution patterns of the studied elements were seen in the leaves; however, in all four of these plant species, Na was excluded from photosynthetically active chlorophyl tissues. With the exception of L. angustifolium, Cl, P and S contents (representing chloride, phosphate and sulphate ionic forms, respectively) did not ensure charge balance in the leaves, which suggests other anionic compounds, such as nitrate and organic anions, have crucial roles in maintaining electroneutrality in these halophytes. By increasing soil salinisation worldwide, the possibility to reliably complement spatial distributions of Na, Mg, Cl, K, P and S with plant structural morphology will contribute significantly to our understanding of plant tolerance mechanisms at the tissue and cell levels. In addition, these kinds of studies are of particular value for designing crop plants with high salt tolerance and for the development of phytoremediation technologies.
Boestfleisch, Christian; Wagenseil, Niko B; Buhmann, Anne K; Seal, Charlotte E; Wade, Ellie Merrett; Muscolo, Adele; Papenbrock, Jutta
2014-08-13
Halophytes, salt-tolerant plants, are a source of valuable secondary metabolites with potential economic value. The steady-state pools of many stress-related metabolites are already enhanced in halophytes when compared with glycophytes, but growth under conditions away from the optimum can induce stress and consequently result in changes to secondary metabolites such as antioxidants. However, direct evidence for increasing the concentration of valuable secondary metabolites as a consequence of altering the salinity of the growing environment still remains equivocal. To address this, we analysed a range of metabolites with antioxidant capacity (including total phenols, flavonoids, ascorbate, reduced/oxidized glutathione and reactive oxygen species scavenging enzymes) in seedlings and plants from different families (Amaranthaceae, Brassicaceae, Plantaginaceae and Rhizophoraceae) and habitats grown under different salt concentrations. We show that it is possible to manipulate the antioxidant capacity of plants and seedlings by altering the saline growing environment, the length of time under saline cultivation and the developmental stage. Among the species studied, the halophytes Tripolium pannonicum, Plantago coronopus, Lepidium latifolium and Salicornia europaea demonstrated the most potential as functional foods or nutraceuticals. Published by Oxford University Press on behalf of the Annals of Botany Company.
Comparative transcriptome analysis of the Asteraceae halophyte Karelinia caspica under salt stress.
Zhang, Xia; Liao, Maoseng; Chang, Dan; Zhang, Fuchun
2014-12-17
Much attention has been given to the potential of halophytes as sources of tolerance traits for introduction into cereals. However, a great deal remains unknown about the diverse mechanisms employed by halophytes to cope with salinity. To characterize salt tolerance mechanisms underlying Karelinia caspica, an Asteraceae halophyte, we performed Large-scale transcriptomic analysis using a high-throughput Illumina sequencing platform. Comparative gene expression analysis was performed to correlate the effects of salt stress and ABA regulation at the molecular level. Total sequence reads generated by pyrosequencing were assembled into 287,185 non-redundant transcripts with an average length of 652 bp. Using the BLAST function in the Swiss-Prot, NCBI nr, GO, KEGG, and KOG databases, a total of 216,416 coding sequences associated with known proteins were annotated. Among these, 35,533 unigenes were classified into 69 gene ontology categories, and 18,378 unigenes were classified into 202 known pathways. Based on the fold changes observed when comparing the salt stress and control samples, 60,127 unigenes were differentially expressed, with 38,122 and 22,005 up- and down-regulated, respectively. Several of the differentially expressed genes are known to be involved in the signaling pathway of the plant hormone ABA, including ABA metabolism, transport, and sensing as well as the ABA signaling cascade. Transcriptome profiling of K. caspica contribute to a comprehensive understanding of K. caspica at the molecular level. Moreover, the global survey of differentially expressed genes in this species under salt stress and analyses of the effects of salt stress and ABA regulation will contribute to the identification and characterization of genes and molecular mechanisms underlying salt stress responses in Asteraceae plants.
Directory of Open Access Journals (Sweden)
Waseem M. ABBASI
2011-01-01
Full Text Available Root-knot nematode, Meloidogyne javanica (Treub Chitwood is a soil-borne plant pathogen of roots. Nematode infection results in altered plant growth and physicochemical processes due to gall formation. Many plants contain unique biochemicals that have biocidal properties and offer a potential novel approach to suppress the nematode populations in soil and improve growth of crop plants. In the present study effect of some indigenous halophytic plant species (Tamarix indica Willd, Suaeda fruticosa Forssk and Salsola imbricata (Schultz Dandy were tested against M. javanica. Tested halophytes significantly (P<0.001 reduced egg hatching and caused mortality of second stage juveniles (J2 in vitro. These halophytes when incorporated in soil (0.3, 0.5 and 1% w/w markedly increased growth of eggplant (Solanum melongena L. cv. Black beauty and okra (Abelmoschus esculentus [L.] Moench. cv. Arka anamika and provided control of root-knot infection at higher doses (0.5 and 1%. Amended eggplants and okra showed significant (P<0.001 increase in chlorophylls and decrease in chlorophyll a/b ratio. Protein concentration in leaves of both the plants were increased with 1% amendment of S. fruticosa and S. imbricata. While nucleic acid concentrations were varied with different treatments.
The role of succulent halophytes in the water balance of salt marsh rodents.
Coulombe, Harry N
1970-09-01
The role of succulent halophytes in the water balance and ecology of salt marsh rodents is dependent upon an evaluation of the composition of the available sources and the physiological properties of their potential consumers. Studies of the osmotic properties of succulent halophytes from southern California coastal salt marshes are presented, together with experiments regarding the utilization of Common Pickleweed (Salicornia virginica L.) by indigenous populations of cricetid rodents (harvest mouse Reithrodontomys megalotis limicola Von Bloecker, and meadow-mouse Microtus californicus stephensi Von Bloecker). These data are discussed in relation to other available information concerning the ecology of coastal salt marshes, particularly in western North America.Extruded sap of Common Pickleweed was found to have a mean total osmotic pressure (TOP) of 1,450 mOsm/liter, with an average chloride ion content of 876 mEq/liter (about 70% of the TOP). A related species, Salicornia subterminale, had a slightly lower TOP (1,300 mOsm/liter), of which about 29% was accounted for by chloride ion concentration. Sea Blight (Suaeda fruticosa) was the only species in which the TOP correlated with the distance from the tide level; sap TOP increased away from the lagoon's edge. In both Sea Blight and Common Pickle weed, TOP was not directly related to chloride content, indicating the importance of other osmotically active solutes.Harvest mice were placed on three experimental regimes: 1) millet seeds only, 2) pickleweed only, and 3) pickleweed and millet seed. Meadow mice were tested on the last regime only. Harvest mice survived best on a strict millet seed diet; when Salicornia was consumed to a detectable extent, the mice did not survive. Meadow mice, however, could survive using Salicornia as a dietary source in conjunction with seeds. Kidney electrolyte concentrating abilities indicated that harvest mice should be able to utilize pickleweed; this was not confirmed in my
Responses of five Mediterranean halophytes to seasonal changes in environmental conditions.
Gil, Ricardo; Bautista, Inmaculada; Boscaiu, Monica; Lidón, Antonio; Wankhade, Shantanu; Sánchez, Héctor; Llinares, Josep; Vicente, Oscar
2014-08-19
In their natural habitats, different mechanisms may contribute to the tolerance of halophytes to high soil salinity and other abiotic stresses, but their relative contribution and ecological relevance, for a given species, remain largely unknown. We studied the responses to changing environmental conditions of five halophytes (Sarcocornia fruticosa, Inula crithmoides, Plantago crassifolia, Juncus maritimus and J. acutus) in a Mediterranean salt marsh, from summer 2009 to autumn 2010. A principal component analysis was used to correlate soil and climatic data with changes in the plants' contents of chemical markers associated with stress responses: ions, osmolytes, malondialdehyde (MDA, a marker of oxidative stress) and antioxidant systems. Stress tolerance in S. fruticosa, I. crithmoides and P. crassifolia (all succulent dicots) seemed to depend mostly on the transport of ions to aerial parts and the biosynthesis of specific osmolytes, whereas both Juncus species (monocots) were able to avoid accumulation of toxic ions, maintaining relatively high K(+)/Na(+) ratios. For the most salt-tolerant taxa (S. fruticosa and I. crithmoides), seasonal variations of Na(+), Cl(-), K(+) and glycine betaine, their major osmolyte, did not correlate with environmental parameters associated with salt or water stress, suggesting that their tolerance mechanisms are constitutive and relatively independent of external conditions, although they could be mediated by changes in the subcellular compartmentalization of ions and compatible osmolytes. Proline levels were too low in all the species to possibly have any effect on osmotic adjustment. However-except for P. crassifolia-proline may play a role in stress tolerance based on its 'osmoprotectant' functions. No correlation was observed between the degree of environmental stress and the levels of MDA or enzymatic and non-enzymatic antioxidants, indicating that the investigated halophytes are not subjected to oxidative stress under natural
Silicon alleviates deleterious effects of high salinity on the halophytic grass Spartina densiflora.
Mateos-Naranjo, Enrique; Andrades-Moreno, Luis; Davy, Anthony J
2013-02-01
The non-essential element silicon is known to improve plant fitness by alleviating the effects of biotic and abiotic stresses, particularly in crops. However, its possible role in the exceptional tolerance of halophytes to salinity has not been investigated. This study reports the effect of Si supply on the salinity tolerance of the halophytic grass Spartina densiflora; plants were treated with NaCl (0-680 mM), with or without silicon addition of 500 μM, in a glasshouse experiment. Plant responses were examined using growth analysis, combined with measurements of gas exchange, chlorophyll fluorescence and photosynthetic pigment concentrations. In addition, tissue concentrations of aluminium, calcium, copper, iron, potassium, magnesium, sodium, phosphorus and silicon were determined. Although high salinity decreased growth, this effect was alleviated by treatment with Si. Improved growth was associated with higher net photosynthetic rate (A), and greater water-use efficiency (WUE). Enhanced A at high salinity could be explained by beneficial effects of Si on the photochemical apparatus, and on chlorophyll concentrations. Ameliorative effects of Si were correlated with reduced sodium uptake, which was unrelated to a reduction in the transpiration rate, since Si-supplemented plants had higher stomatal conductances (G(s)). These plants also had higher tissue concentrations of essential nutrients, suggesting that Si had a positive effect on the mineral nutrient balance in salt-stressed plants. Si appears to play a significant role in salinity tolerance even in a halophyte, which has other, specific salt-tolerance mechanisms, through diverse protective effects on the photosynthetic apparatus, water-use efficiency and mineral nutrient balance. Copyright © 2012 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
Berne M.
2006-11-01
Full Text Available En Arabie Saoudite, la contribution du secteur pétrolier au Produit Intérieur Brut est encore aujourd'hui de la moitié environ. Mais l'importance du pétrole ne se limite pas à ce chiffre. Au-delà de la comptabilité nationale, les mécanismes budgétaires et financiers, les grands équilibres économiques reposent dans une très large mesure sur l'existence d'importants revenus pétroliers perçus par l'état. Dans son effort de développement économique, l'Arabie a choisi de créer une puissante industrie pétrochimique pour valoriser sa production d'hydrocarbures et pour amorcer le décollage d'un secteur industriel diversifié. Cette stratégie a aussi des implications sur le bilan énergétique et le développement régional du pays. Ayant mis à profit les revenus pétroliers exceptionnels de la décennie passée pour construire une infrastructure remarquable, l'Arabie peut, malgré les problèmes économiques posés par son choix de développement, envisager raisonnablement une croissance équilibrée qui réduira sa dépendance sur le pétrole. In Saudi Arabia, the oil sector still accounts for half of the gross domestic product (GDP. But the importance of oil is not limited to this figure. Over and beyond national accounting and budgetary and financial mechanisms, the major economic balances to a very large extent are based on the existence of large oil revenues received by the state. In its economic development effort, Saudi Arabia has chosen to create a powerful petrochemical industry to upgrade its hydrocarbon production and to prime the take-off of a diversified industrial sector. This strategy also has implications on the energy balance and regional development of the country. Having taken advantage of the exceptional oil revenues of the past decade to build a remarkable infrastructure, Saudi Arabian can, despite the economic problems raised by its development choice, reasonably plan on balanced growth that will reduce its
Soil Microbial Community Structure Evolution along Halophyte Succession in Bohai Bay Wetland
Directory of Open Access Journals (Sweden)
Mingyang Cong
2014-01-01
Full Text Available It is urgent to recover Bohai Bay costal wetland ecosystem because of covering a large area of severe saline-alkali soil. To explore the relationship between halophyte herbaceous succession and microbial community structure, we chose four local communities which played an important role in improving soil microenvironment. We performed phospholipid fatty acid analysis, measured soil parameters, and evaluated shifts of microbial community structure. Results showed that microbial community structure changed significantly along succession and bacteria community was dominant. Total phospholipid fatty acid content increased in different successional stages but decreased with depth, with similar variations in bacterial and fungal biomass. Soil organic carbon and especially total nitrogen were positively correlated with microbial biomass. Colonization of pioneering salt-tolerant plants Suaeda glauca in saline-alkali bare land changed total soil microorganism content and composition. These results showed that belowground processes were strongly related with aboveground halophyte succession. Fungal/bacterial ratio, Gram-negative/Gram-positive bacteria ratio, total microbial biomass, and fungi and bacteria content could indicate the degree of succession stages in Bohai Bay wetland ecosystem. And also these findings demonstrated that microbial community biomass and composition evolved along with vegetation succession environmental variables.
International Nuclear Information System (INIS)
Karakas, S.; Cullu, M. A.; Kaya, C.; Dikilitas, M.
2016-01-01
Salinity becomes a major concern when soil salt concentration becomes excessive in growth medium. Halophytes are capable of accumulating high concentrations of NaCl in their tissues, thus using halophytic plants in crop rotations or even in mixed cropping systems may be a promising management practices to mitigate salt stress related yield loses. Salinity induced yield losses and related physiological parameters on tomato plants (Lycopersicon esculentum Mill. cv. SC2121) grown with or without halophytic companion plants (SalsolasodaL. and Portulacaoleracea L.) were investigated in pot experiment. Treatments consist of four soil type (collected from Harran plain-Turkey) with similar physical properties but varying in salinity level: electrical conductivity (EC): 0.9, 4.2, 7.2, and 14.1 dS m/sup -1/. The reduction in plant total dry weight was 24, 19, and 48 percent in soils with slight (4.2dS m/sup -1/), moderate (7.2 dS m/sup -1/) and high (14.1 dS m/sup -1/) salinity as compared to non-saline soil (0.9 dS m/sup -1/), respectively. Leaf content of proline, malondialdehyde (MDA), catalase (CAT) and peroxidase (POX) enzyme activity increased with increasing level of salinity. In tomato plants grown in consociation with Salsolasoda, salinity induced DM decrease was only 6, 12 and 28% in soils with slight, moderate and high salinity as compared to non-saline soil, respectively. However, when Portulaca oleracea used as companion plant, no significant change in biomass or fruit yield was observed. This study showed that mixed planting with Salsolasodain high saline soils may be an effective phyto-remediation technique that may secure yield formation and quality of tomato. (author)
Lutts, Stanley; Lefèvre, Isabelle
2015-01-01
Background Many areas throughout the world are simultaneously contaminated by high concentrations of soluble salts and by high concentrations of heavy metals that constitute a serious threat to human health. The use of plants to extract or stabilize pollutants is an interesting alternative to classical expensive decontamination procedures. However, suitable plant species still need to be identified for reclamation of substrates presenting a high electrical conductivity. Scope Halophytic plant species are able to cope with several abiotic constraints occurring simultaneously in their natural environment. This review considers their putative interest for remediation of polluted soil in relation to their ability to sequester absorbed toxic ions in trichomes or vacuoles, to perform efficient osmotic adjustment and to limit the deleterious impact of oxidative stress. These physiological adaptations are considered in relation to the impact of salt on heavy metal bioavailabilty in two types of ecosystem: (1) salt marshes and mangroves, and (2) mine tailings in semi-arid areas. Conclusions Numerous halophytes exhibit a high level of heavy metal accumulation and external NaCl may directly influence heavy metal speciation and absorption rate. Maintenance of biomass production and plant water status makes some halophytes promising candidates for further management of heavy-metal-polluted areas in both saline and non-saline environments. PMID:25672360
Glyceride structure and sterol composition of SOS-7 halophyte oil
Directory of Open Access Journals (Sweden)
El-Shami, S. M.
1991-06-01
Full Text Available Glyceride structure of SOS-7 halophyte oil was studied using the lipase hydrolysis technique. This halophyte sample was obtained from 1988 harvest planted in Ghardaka, on the border of the Red Sea, Egypt. The oilseed was ground and extracted for its oil using commercial hexane in Soxhlet extractor. The unsaturated fatty acids were found centralized in the 2-position of triglycerides, whereas oleic and linolenic acids showed more preference for this position. It was found that P3 was the major component of GS3, whereas P2L and PStL; PL2, POL and StL2 are predominating among GS2U and GSU3 respectively. L3 manifested itself as the principal constituent of GU3 type.
Sterol composition of the halophyte oil was determined by GLC as TMS derivative. It was found that the oil contains campsterol, β-sitosterol, stigmasterol and 7-stigmasterol of which 7-stigmasterol is the major sterol and constitute 52.4%.
Se ha estudiado usando la técnica de hidrólisis mediante lipasa la estructura glicerídica de aceite de halofito SOS-7. Esta muestra de halofito fue obtenida a partir de una cosecha de 1988 plantada en Ghardaka, en la orilla del Mar Rojo, Egipto.
Para la extracción del aceite de la semilla molida se utilizó hexano comercial en extractor Soxhlet.
Los ácidos grasos insaturados se encontraron centralizados en la posición 2 de los triglicéridos, siendo los ácidos oleico y linolénico los que mostraron mayor preferencia por esta posición. Se encontró que P3 fue el componente mayoritario de GS3, mientras que P2L y PStL; PL2 POL y StL2 son los predominantes para GS2U y GSU3 respectivamente. L3 se manifestó como el principal constituyente de los GU3.
La composición esterólica del aceite de halofito se determinó por GLC como derivados del
DEFF Research Database (Denmark)
Panuccio, M.R.; Jacobsen, Sven-Erik; Saleem Akhtar, Saqib
2014-01-01
with their high protein content and unique amino acid composition. Although the species has been described as a facultative halophyte, and its tolerance to salt stress has been investigated, its physiological and molecular responses to seawater (SW) and other salts have not been studied. We evaluated the effects...... been carried out to investigate the mechanisms used by quinoa, a facultative halophytic species, in order to cope with high salt levels at various stages of its develop- ment. Quinoa is regarded as one of the crops that might sustain food security in this century, grown primarily for its edible seeds...... of SW and different salts on seed germination, seedling emergence and the antioxidative pathway of quinoa. Seeds were germi- nated in Petri dishes and seedlings grown in pots with SW solutions (25, 50, 75 and 100 %) and NaCl, CaCl2, KCl and MgCl2 individually, at the concentrations in which...
Stoichiometric variation of halophytes in response to changes in soil salinity.
Sun, X; Gao, Y; Wang, D; Chen, J; Zhang, F; Zhou, J; Yan, X; Li, Y
2017-05-01
Variation in soil salt may change the stoichiometry of a halophyte by altering plant ecophysiology, and exert different influences on various plant organs, which has potentially important consequences for the nutrition of consumers as well as nutrient cycling in a saline ecosystem. Using a greenhouse pot experiment, we investigated the effect of salinity variability on the growth and stoichiometry of different organs of Suaeda glauca and Salicornia europaea - two dominant species of important ecological and economic value in the saline ecosystem. Our results showed that appropriate salt stimulated the growth of both species during the vigorous growth period, while high salt suppressed growth. Na significantly increased with increased salt in the culture, whereas concentrations of other measured elements and K:Na ratio for both species significantly decreased at low salt treatments, and became more gradual under higher salt conditions. Furthermore, with the change of salt in culture, variations in leaf (degenerated leaf for S. europaea, considered as young stem) stoichiometry, except N:P ratio, were large and less in stems (old stems for S. europaea) than in roots, reflecting physiological and biochemical reactions in the leaf in response to salt stress, supported by sharp changes in trends. These results suggest that appropriate saline conditions can enhance biological C fixation of halophytes; however, increasing salt could affect consumer health and decrease cycling of other nutrients in saline ecosystems. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.
Effect of extraction solvents on polyphenols and antioxidant activity of medicinal halophytes
International Nuclear Information System (INIS)
Qasim, M.; Aziz, I.; Gul, B.
2016-01-01
This study was conducted to determine the most effective solvent for extraction of polyphenols and antioxidant activity of medicinally important coastal halophytes (Thespesia populneoides, Salvadora persica, Ipomoea pes-caprae, Suaeda fruticosa and Pluchea lanceolata) known for high antioxidant potential. Five different solvents (water, 80% methanol, 80% ethanol, acetone and chloroform) were used to quantify polyphenols including total phenolic (TPC), total flavonoid (TFC) and proanthocyanidin contents (PC) and antioxidant capacity using DPPH radical scavenging and Ferric reducing antioxidant power (FRAP) activities. Among solvents of different polarities 80% methanol appeared most effective for polyphenol extraction. Thespesia populneoides had the highest polyphenols (TPC, TFC and PC) followed by Salvadora persica. Highest antioxidant activity was also found in T. populneoides and S. persica using the same solvent (80% methanol) which appeared better than synthetic antioxidants (BHA and BHT). The correlation analyses of each solvent showed strong to weak relationships among all studied parameters with maximum values (r and R2) in methanol followed by ethanol and water. Weaker correlation of acetone and chloroform indicates low capacity of these solvents both for polyphenol extraction and antioxidant activity. Our results reveal that aqueous methanol extracts of coastal halophytes had comparatively higher antioxidant activity than commercial antioxidants which indicate both their prospective efficacy and potential to replace synthetic derivatives from edible and medicinal products. (abstract)
Directory of Open Access Journals (Sweden)
Yana Kazachkova
2016-08-01
Full Text Available The salinization of land is a major factor limiting crop production worldwide. Halophytes adapted to high levels of salinity are likely to possess useful genes for improving crop tolerance to salt stress, as well as providing a food source on marginal lands. However, despite being salt-tolerant plants, the seeds of many halophytes will not germinate on saline soils, yet little is understood regarding biochemical and gene expression changes underlying salt-mediated inhibition of halophyte seed germination. We have used the halophytic Arabidopsis relative model system, Eutrema (Thellungiella salsugineum to explore salt-mediated inhibition of germination. We show that E. salsugineum seed germination is inhibited by salt to a far greater extent than in Arabidopsis, and that this inhibition is in response to the osmotic component of salt exposure. E. salsugineum seeds remain viable even when germination is completely inhibited, and germination resumes once seeds are transferred to non-saline conditions. Moreover, removal of the seed coat from salt-treated seeds allows embryos to germinate on salt-containing medium. Mobilization of seed storage reserves is restricted in salt-treated seeds, while many germination-associated metabolic changes are arrested or progress to a lower extent. Salt-exposed seeds are further characterized by a reduced GA/ABA ratio and increased expression of the germination repressor genes, RGL2, ABI5 and DOG1. Furthermore, a salt-mediated increase in expression of a LATE EMBRYOGENESIS ABUNDANT gene and accretion of metabolites involved in osmoprotection indicates induction of processes associated with stress tolerance, and accumulation of easily mobilized carbon reserves. Overall, our results suggest that salt inhibits E. salsugineum seed germination by inducing a seed state with molecular features of dormancy while a physical constraint to radicle emergence is provided by the seed coat layers. This seed state could facilitate
De Bakker, N.; Hemminga, M.A.; Van Soelen, J.
1999-01-01
Analysis of silicon concentrations of various halophytes from salt marshes in the S.W. Netherlands shows that the silicon concentration of Spartina anglica (Gramineae) is relatively high. To study the influence of dissolved Si concentrations on growth and plant tissue concentrations of S. anglica,
Seasonal variations in plant water status of four desert halophytes from semi-arid region of Karachi
International Nuclear Information System (INIS)
Aziz, I.; Gul, B.; Gulzar, S.; Khan, A
2011-01-01
Halophytes in arid and semi arid zones of the world are often subjected to extremely variable drought, salinity and temperature. These fluctuations may bring about changes in their osmoregulation and gas exchange responses besides other physiological and biochemical processes. The purpose of this study was to detect temporal changes in plant water status and osmotic adjustment in four desert halophytes viz., Suaeda fruticosa, Heliotropium curassavicum, Haloxylon stocksii and Atriplex stocksii from an inland community at Karachi University Campus. During the dry period (November to January) water and osmotic potentials of all test species increased with higher values in A. stocksii (salt secretor) than those of S. fruticosa and H. stocksii (salt includer) and H. curassavicum (salt excluder). Proline increased substantially and was highest in H. curassavicum followed by A. stocksii in comparison to the two salt includers. The lowering of osmotic potential corresponded to an increase in Na and Cl, lower stomatal conductance and chlorophyll content indicating reduced gas exchange during the dry period. The increase in proline may have little role in osmoreglation but could contribute in scavenging reactive oxygen species. (author)
Jha, Bhavanath; Lal, Sanjay; Tiwari, Vivekanand; Yadav, Sweta Kumari; Agarwal, Pradeep K
2012-12-01
Salinity severely affects plant growth and development. Plants evolved various mechanisms to cope up stress both at molecular and cellular levels. Halophytes have developed better mechanism to alleviate the salt stress than glycophytes, and therefore, it is advantageous to study the role of different genes from halophytes. Salicornia brachiata is an extreme halophyte, which grows luxuriantly in the salty marshes in the coastal areas. Earlier, we have isolated SbASR-1 (abscisic acid stress ripening-1) gene from S. brachiata using cDNA subtractive hybridisation library. ASR-1 genes are abscisic acid (ABA) responsive, whose expression level increases under abiotic stresses, injury, during fruit ripening and in pollen grains. The SbASR-1 transcript showed up-regulation under salt stress conditions. The SbASR-1 protein contains 202 amino acids of 21.01-kDa molecular mass and has 79 amino acid long signatures of ABA/WDS gene family. It has a maximum identity (73 %) with Solanum chilense ASR-1 protein. The SbASR-1 has a large number of disorder-promoting amino acids, which make it an intrinsically disordered protein. The SbASR-1 gene was over-expressed under CaMV 35S promoter in tobacco plant to study its physiological functions under salt stress. T(0) transgenic tobacco seeds showed better germination and seedling growth as compared to wild type (Wt) in a salt stress condition. In the leaf tissues of transgenic lines, Na(+) and proline contents were significantly lower, as compared to Wt plant, under salt treatment, suggesting that transgenic plants are better adapted to salt stress.
International Nuclear Information System (INIS)
Rasool, S. G.; Hameed, A.; Ahmed, M. Z.; Khan, M. A.
2016-01-01
Salinity affects seed germination of halophytes by inducing ionic toxicity, osmotic constraint or both. Information about the effects of salinity on seed germination of a large number of halophytes exists, but generally little is known about the basis of salinity-induced germination inhibition. In order to partition salinity effects, we studied seed germination and recovery responses of a coastal salt marsh halophyte halopeplis perfoliata to different isotonic treatments (Psi/sub S/: -0.5, -1.0, -1.5, -2.0 and -2.5, MPa) of various salts and polythylene glycol (PEG) under two light regimes (12-h light photo period and 24-h complete darkness). Highest seed germination was observed in distilled water under 12-h light photo period and reduction in osmotic potential of the solution decreased seed germination. However, some seeds of H. perfoliata could germinate in as low as -2.5 MPa (600 mM NaCl), which is equivalent to seawater salinity. Sea-salt treatment was more inhibitory than isotonic NaCl at the lowest osmotic potential (Psi/sub S/ -2.5 MPa). Generally, chloride salts with lowest Psi/sub S/ inhibited germination more than the isotonic sulfate salts. Comparable germination responses of the seeds in NaCl and isotonic PEG treatments as well as high recovery of germination in un-germinated seeds after alleviation of NaCl salinity indicated prevalence of osmotic constraint. These results thus indicate that the seeds of H. perfoliata could tolerate high levels of a wide variety of salts found in soil. (author)
Directory of Open Access Journals (Sweden)
Gang Yu
2017-11-01
Full Text Available Plant productivity is limited by salinity stress, both in natural and agricultural systems. Identification of salt stress-related genes from halophyte can provide insights into mechanisms of salt stress tolerance in plants. Atriplex canescens is a xero-halophyte that exhibits optimum growth in the presence of 400 mM NaCl. A cDNA library derived from highly salt-treated A. canescens plants was constructed based on a yeast expression system. A total of 53 transgenic yeast clones expressing enhanced salt tolerance were selected from 105 transformants. Their plasmids were sequenced and the gene characteristics were annotated using a BLASTX search. Retransformation of yeast cells with the selected plasmids conferred salt tolerance to the resulting transformants. The expression patterns of 28 of these stress-related genes were further investigated in A. canescens leaves by quantitative reverse transcription-PCR. In this study, we provided a rapid and robust assay system for large-scale screening of genes for varied abiotic stress tolerance with high efficiency in A. canescens.
Barkla, Bronwyn J.; Vera-Estrella, Rosario
2015-01-01
One of the remarkable adaptive features of the halophyte and facultative CAM plant Mesembryathemum crystallinum are the specialized modified trichomes called epidermal bladder cells (EBC) which cover the leaves, stems, and peduncle of the plant. They are present from an early developmental stage but upon salt stress rapidly expand due to the accumulation of water and sodium. This particular plant feature makes it an attractive system for single cell type studies, with recent proteomics and tr...
DEFF Research Database (Denmark)
Bonales-Alatorre, Edgar; Pottosin, Igor; Shabala, Lana
2013-01-01
quinoa genotypes contrasting in their salinity tolerance. The work is complemented by studies of the kinetics of net ion fluxes across the plasma membrane of quinoa leaf mesophyll tissue. Our results suggest that multiple mechanisms contribute towards genotypic differences in salinity tolerance in quinoa....... These include: (i) a higher rate of Na+ exclusion from leaf mesophyll; (ii) maintenance of low cytosolic Na+ levels; (iii) better K+ retention in the leaf mesophyll; (iv) a high rate of H+ pumping, which increases the ability of mesophyll cells to restore their membrane potential; and (v) the ability to reduce......Halophytes species can be used as a highly convenient model system to reveal key ionic and molecular mechanisms that confer salinity tolerance in plants. Earlier, we reported that quinoa (Chenopodium quinoa Willd.), a facultative C3 halophyte species, can efficiently control the activity of slow...
Zhang, Fang; Xiong, Hei-gang; Nurbay, Abdusalih; Luan, Fu-ming
2011-12-01
Based on the field-measured Vis-NIR reflectance of four common types of halophyte (Achnatherum splendens(Trin.) Nevski, Sophora alopecuroides L., Camphorosma monspeliaca L. subsp. lessingii(L.)Aellen, Alhagi sparsifolia shap) within given spots in the Northern Slope Area of Tianshan Mountain in Xinjiang, the spectral response characteristics and species recognition of these types of halophyte were analyzed. The results showed that (Alhagi sparsifolia shap) had higher chlorophyll and carotenoid by CARI and SIPI index. (Sophora alopecuroides L. was at a vigorously growing state and had a higher NDVI compared with the other three types of halophyte because of its greater canopy density. But its CARI and SIPI values were lower due to the influence of its flowers. (Sophora alopecuroides L.) and (Camphorosma monspeliaca L. subsp. lessingii(L.)) had stable REPs and BEPs, but REPs and BEPs of (Achnatherum splendens(Trin.)Nevski, Aellen, Alhagi sparsifolia shap) whose spectra red shift and spectra blue shift occurred concurrently obviously changed. There was little difference in spectral curves among the four types of halophyte, so the spectrum mixing phenomenon was severe. (Camphorosma monspeliaca L. subsp. lessingii (L.)Aellen) and (Alhagi sparsifolia shap) could not be separated exactly in a usual R/NIR feature space in remote sensing. Using the stepwise discriminant analysis, five indices were selected to establish the discriminant model, and the model accuracy was discussed using the validated sample group. The total accuracy of the discriminant model was above 92% and (Achnatherum splendens(Trin.)Nevski) and (Camphorosma monspeliaca L. subsp. lessingii(L.)Aellen) could be respectively recognized 100% correctly.
Zhao, Shuai; Zhou, Na; Zhao, Zheng-Yong; Zhang, Ke; Wu, Guo-Hua; Tian, Chang-Yan
2016-10-01
Several reports have highlighted that many plant growth-promoting endophytic bacteria (PGPE) can assist their host plants in coping with various biotic and abiotic stresses. However, information about the PGPE colonizing in the halophytes is still scarce. This study was designed to isolate and characterize PGPE from salt-accumulating halophyte Salicornia europaea grown under extreme salinity and to evaluate in vitro the bacterial mechanisms related to plant growth promotion. A total of 105 isolates were obtained from the surface-sterilized roots, stems, and assimilation twigs of S. europaea. Thirty-two isolates were initially selected for their ability to produce 1-aminocyclopropane-1-carboxylate deaminase as well as other properties such as production of indole-3-acetic acid and phosphate-solubilizing activities. The 16S rRNA gene-sequencing analysis revealed that these isolates belong to 13 different genera and 19 bacterial species. For these 32 strains, seed germination and seedling growth in axenically grown S. europaea seedlings at different NaCl concentrations (50-500 mM) were quantified. Five isolates possessing significant stimulation of the host plant growth were obtained. The five isolates were identified as Bacillus endophyticus, Bacillus tequilensis, Planococcus rifietoensis, Variovorax paradoxus, and Arthrobacter agilis. All the five strains could colonize and can be reisolated from the host plant interior tissues. These results demonstrate that habitat-adapted PGPE isolated from halophyte could enhance plant growth under saline stress conditions.
Ebadi, Ali; Khoshkholgh Sima, Nayer Azam; Olamaee, Mohsen; Hashemi, Maryam; Ghorbani Nasrabadi, Reza
2018-05-08
The negative impact of salinity on plant growth and the survival of rhizosphere biota complicates the application of bioremediation to crude oil-contaminated saline soils. Here, a comparison was made between the remedial effect of treating the soil with Pseudomonas aeruginosa, a salinity tolerant hydrocarbon-degrading consortium in conjunction with either the halophyte Salicornia persica or the non-halophyte Festuca arundinacea. The effect of the various treatments on salinized soils was measured by assessing the extent of total petroleum hydrocarbon (TPH) degradation, the soil's dehydrogenase activity, the abundance of the bacteria and the level of phytotoxicity as measured by a bioassay. When a non-salinized soil was assessed after a treatment period of 120 days, the ranking for effectiveness with respect to TPH removal was F. arundinacea > P. aeruginosa > S. persica > no treatment control, while in the presence of salinity, the ranking changed to S. persica > P. aeruginosa > F. arundinacea > no treatment control. Combining the planting of S. persica or F. arundinacea with P. aeruginosa inoculation ("bioaugmentation") boosted the degradation of TPH up to 5-17%. Analyses of the residual oil contamination revealed that long chain alkanes (above C20) were particularly strongly degraded following the bioaugmentation treatments. The induced increase in dehydrogenase activity and the abundance of the bacteria (3.5 and 10 fold respectively) achieved in the bioaugmentation/S. persica treatment resulted in 46-76% reduction in soil phytotoxicity in a saline soil. The indication was that bioaugmentation of halophyte can help to mitigate the adverse effects on the effectiveness of bioremediation in a crude oil-contaminated saline soil. Copyright © 2018 Elsevier Ltd. All rights reserved.
Bouma, T.J.; Koutstaal, B.P.; Van Dongen, M.; Nielsen, K.F.
2001-01-01
We describe the responses of three halophytic grass species that dominate the low (Spartina anglica), middle (Puccinellia maritima) and high (Elymus pycnanthus) parts of a salt marsh, to soil conditions that are believed to favour contrasting root-growth strategies. Our hypotheses were: (1)
Directory of Open Access Journals (Sweden)
Jorge Luis Becerra-López
2017-08-01
Full Text Available The decrease of the habitat is one of the main factors that affect the survival of G. flavomarginatus. This study assesses the halophytic grasslands loss over a period of 30 years in the distribution area of the Bolson tortoise and the effects of climate change on the habitat suitability of these grasslands and its possible impact on this tortoise. Grassland loss was assessed by an analysis of symmetric differences and the habitat suitability model was carried out by the method of overlapping layers raster. Our results showed a grassland loss of 63.7%; however, our current habitat suitability model points out that much of the grassland loss has occurred where the environmental conditions are suitable. These results suggest that anthropic activity is a main factor in the habitat disturbance in the study area. Likewise, the models for years 2050 and 2070 under the criteria RCP 2.6, RCP 4.5, RCP 6.0, suggest that anthropic activity will continue be the main cause of the grassland loss. Therefore, considering the association between the Bolson tortoise and grassland halophyte Hilaria mutica, which comprises around 60% of its diet, the viability of the Bolson tortoise depends largely on strategies aimed at protecting the soil that allow the presence of this grassland.
The use of halophytic plants for salt phytoremediation in constructed wetlands.
Farzi, Abolfazl; Borghei, Seyed Mehdi; Vossoughi, Manouchehr
2017-07-03
This research studied the use of constructed wetlands (CWs) to reduce water salinity. For this purpose, three halophytic species of the Chenopodiaceae family (Salicornia europaea, Salsola crassa, and Bienertia cycloptera) that are resistant to saline conditions were planted in the CWs, and experiments were conducted at three different salinity levels [electrical conductivity (EC)∼2, 6, 10 dS/m]. EC and concentrations of calcium (Ca), magnesium (Mg), sodium (Na), and chlorine (Cl) were measured before and after phytoremediation with a retention time of 1 week. The results suggested that these plants were able to grow well and complete their life cycles at all the salinity levels within this study. Moreover, these plants reduced the measured parameters to acceptable levels. Therefore, these plants can be considered good options for salt phytoremediation.
Growing halophytes floating at sea
Directory of Open Access Journals (Sweden)
Ricardo Radulovich
2017-11-01
Full Text Available Freshwater shortages are increasingly limiting both irrigated and rainfed agriculture. To expand possibilities for controlled plant production without using land nor freshwater, we cultivated potted halophytes floating at sea that were provided with rain- and seawater. Plantlets of two mangroves (Avicennia germinans and Rhizophora mangle and plants of two herbaceous species, sea purslane (Sesuvium portulacastrum and salt couch grass (Sporobolus virginicus were grown in near-coastal tropical Pacific waters of Costa Rica for 733 days. There were a total of 504 rainless days, including two dry periods of ca. 150 d long each, evidencing prolonged and exclusive reliance on seawater. Pots with a sandy soil mixture and the transplanted plants were placed on low-cost wooden floating rafts with their lower end perforated and immersed for capillary rise of water. Free seawater entry and exit through the bottom from bobbing with waves, which also occasionally added water from the top, effectively controlled soil salinity build-up even during the rainless seasons. Continuous leaching made necessary frequent fertilizer addition. No water deficit symptoms were observed and midday canopy temperature during rainless periods was not significantly different between species or from air temperature. With all-year-round growth, height increase of mangrove plantlets ranged from 208.1 to 401.5 mm yr−1. Fresh biomass production of sea purslane and the grass was 10.9 and 3.0 kg m−2 yr−1 respectively. High yield, edibility and protein content of 10.2% dry weight established sea purslane as a potential crop. While further research is needed, the method evidenced to be a viable plant production option of potentially far-reaching applications.
Deficit irrigation of a landscape halophyte for reuse of saline waste water in a desert city
Glenn, E.P.; Mckeon, C.; Gerhart, V.; Nagler, P.L.; Jordan, F.; Artiola, J.
2009-01-01
Saline waste waters from industrial and water treatment processes are an under-utilized resource in desert urban environments. Management practices to safely use these water sources are still in development. We used a deeprooted native halophyte, Atriplex lentiformis (quailbush), to absorb mildly saline effluent (1800 mg l-1 total dissolved solids, mainly sodium sulfate) from a water treatment plant in the desert community of Twentynine Palms, California. We developed a deficit irrigation strategy to avoid discharging water past the root zone to the aquifer. The plants were irrigated at about one-third the rate of reference evapotranspiration (ETo) calculated from meteorological data over five years and soil moisture levels were monitored to a soil depth of 4.7 m at monthly intervals with a neutron hydroprobe. The deficit irrigation schedule maintained the soil below field capacity throughout the study. Water was presented on a more or less constant schedule, so that the application rates were less than ETo in summer and equal to or slightly greater than ETo in winter, but the plants were able to consume water stored in the profile in winter to support summer ET. Sodium salts gradually increased in the soil profile over the study but sulfate levels remained low, due to formation of gypsum in the calcic soil. The high salt tolerance, deep roots, and drought tolerance of desert halophytes such as A. lentiformis lend these plants to use as deficit-irrigated landscape plants for disposal of effluents in urban setting when protection of the aquifer is important. ?? 2008 Elsevier B.V.
Secondary metabolites as anti-nutritional factors in locally used halophytic forage/fodder
International Nuclear Information System (INIS)
Ehsen, S.; Qasim, M.; Abideen, Z.; Rizve, R. F.; Gul, B.; Ansari, R.
2016-01-01
Rampant salinity coupled with population explosion necessitates search for suitable alternatives to conventional sources of food both for human and animal consumption. While it may be difficult to change our culinary preferences, training animals to adopt a changed diet of nonconventional salt tolerant plants is easier. Using these wild plants however, requires estimation of undesirable secondary metabolites (SMs) produced during stressful conditions, which may be harmful for health of animals. Some of these anti-nutritional components (total phenols, flavonoids, tannins, nitrates, saponins and oxalates) were determined in 22 halophytes locally used as fodder/forage. Most of the species were perennial shrubs and herbs of an area where environmental conditions like high mean annual temperature (∼35 degree C), low rainfall (< 250mm) with soil mostly dry (average 2 percent moisture) and saline (average EC 13 dSm/sup -1/) supported the growth of halophytes and xerophytes. Values of SMs in the studied plants ranged from 0.13-4.05 percent for total phenols, 0.38-6.99 percent for tannins, 0.15-1.50 percent for flavonoids, 0.10-1.15 percent for nitrates, 0.45-8.68 percent for saponins and 0.36-2.34 percent for oxalates. Most of the species (19) contained low to moderate amount of individual as well as total SMs which were within the non-toxic ranges. However, three species distributed in coastal habitats where average soil salinity (27.67 dSm-1) was considerably higher than inland ones (7.09 dSm-1) had SMs contents above the safe limits. It is evident from these Results that most of these plants contained moderate to low levels of anti-nutritional factors, which lies under the safe limits and hence, could be used as a potential feed source to raise animals, particularly in arid/semiarid areas. Additionally, these plants represents a viable choice as they can be grown without encroaching on agricultural lands and fresh water resources and could promote livestock
Mondal, Tapan Kumar; Ganie, Showkat Ahmad; Debnath, Ananda Bhusan
2015-01-01
Oryza coarctata, a halophyte and wild relative of rice, is grown normally in saline water. MicroRNAs (miRNAs) are non-coding RNAs that play pivotal roles in every domain of life including stress response. There are very few reports on the discovery of salt-responsive miRNAs from halophytes. In this study, two small RNA libraries, one each from the control and salt-treated (450 mM NaCl for 24 h) leaves of O. coarctata were sequenced, which yielded 338 known and 95 novel miRNAs. Additionally, we used publicly available transcriptomics data of O. coarctata which led to the discovery of additional 48 conserved miRNAs along with their pre-miRNA sequences through in silico analysis. In total, 36 known and 7 novel miRNAs were up-regulated whereas, 12 known and 7 novel miRNAs were down-regulated under salinity stress. Further, 233 and 154 target genes were predicted for 48 known and 14 novel differentially regulated miRNAs respectively. These targets with the help of gene ontology analysis were found to be involved in several important biological processes that could be involved in salinity tolerance. Relative expression trends of majority of the miRNAs as detected by real time-PCR as well as predicted by Illumina sequencing were found to be coherent. Additionally, expression of most of the target genes was negatively correlated with their corresponding miRNAs. Thus, the present study provides an account of miRNA-target networking that is involved in salinity adaption of O. coarctata.
International Nuclear Information System (INIS)
Ali, A.; Gairola, S.
2015-01-01
Seeds are either stored in a soil seed bank or retained on maternal plants until they are released (aerial seed bank). Though there are extensive studies on the germination requirements of seeds in soil banks of saline habitats, studies conducted for halophytes with aerial seed banks are rare. We assessed the impact of aerial and room-temperature storages on the light and temperature requirements during germination in two small-seeded halophytes: Halocnmum strobilaceum having a short-term aerial seed bank (less than one year) and Halopeplis perfoliata having a longer term aerial seed bank (up to two years). Seed storage in the aerial bank reduced the germination in H. strobilaceum, but either increased it (5-months storage) or had no effect (17-months storage) in H. perfoliata. Seeds of both species that were stored in aerial bank germinated to higher percentages in light than in darkness, indicating that considerable portions of the seed populations are light sensitive. Seeds of H. perfoliata attained less than 5.0 percentage germination in darkness at higher temperatures, compared to more than 90.0 percentage in light. The results support the hypothesis that the aerial seed bank is an adaptive strategy for survival in the saline habitats of the two species. (author)
Directory of Open Access Journals (Sweden)
Mohamed Y. Saleh
2017-11-01
Full Text Available The plant-based-sea water culture medium is introduced to in vitro cultivation and in situ recovery of the microbiome of halophytes. The ice plant (Mesembryanthemum crystallinum was used, in the form of juice and/or dehydrated plant powder packed in teabags, to supplement the natural sea water. The resulting culture medium enjoys the combinations of plant materials as rich source of nutrients and sea water exercising the required salt stress. As such without any supplements, the culture medium was sufficient and efficient to support very good in vitro growth of halotolerant bacteria. It was also capable to recover their in situ culturable populations in the phyllosphere, ecto-rhizosphere and endo-rhizosphere of halophytes prevailing in Lake Mariout, Egypt. When related to the total bacterial numbers measured for Suaeda pruinosa roots by quantitative-PCR, the proposed culture medium increased culturability (15.3–19.5% compared to the conventional chemically-synthetic culture medium supplemented with (11.2% or without (3.8% NaCl. Based on 16S rRNA gene sequencing, representative isolates of halotolerant bacteria prevailed on such culture medium were closely related to Bacillus spp., Halomonas spp., and Kocuria spp. Seed germination tests on 25–50% sea water agar indicated positive interaction of such bacterial isolates with the germination and seedlings’ growth of barley seeds.
Oxygen dynamics during submergence in the halophytic stem succulent Halosarcia pergranulata
DEFF Research Database (Denmark)
Pedersen, Ole; Vos, Harrie; Colmer, Timothy David
2006-01-01
This study elucidated O2 dynamics in shoots and roots of submerged Halosarcia pergranulata (Salicornioideae), a perennial halophytic stem succulent that grows on flood-prone mudflats of salt lakes. Oxygen within shoots and roots was measured using microelectrodes, for plants when waterlogged...... the roots, at least during the first several hours (the time period measured) after submergence or when light periods followed darkness. The influence of light on tissue O2 dynamics was confirmed in an experiment on a submerged plant in a salt lake in south-western Australia. In the late afternoon, partial...... pressure of O2 (pO2) in the succulent stem was 23.2 kPa (i.e. ~10% above that in the air), while in the roots, it was 6.2-9.8 kPa. Upon sunset, the pO2 in the succulent stems declined within 1 h to below detection, but then showed some fluctuations with the pO2 increasing to at most 2.5 kPa during...
Halophyte vegetation influences in salt marsh retention capacity for heavy metals
International Nuclear Information System (INIS)
Reboreda, Rosa; Cacador, Isabel
2007-01-01
We analysed concentrations of Cu, Cd and Pb in above and belowground tissues of the halophyte species Halimione portulacoides and Spartina maritima, as well as in sediments and pore water between the roots in a Tagus estuary salt marsh (Portugal). From these results we calculated the pools of metals in the compartments mentioned above. Relative percentages of accumulation in each pool were also determined. Our aim was to determine how the type of vegetation in the salt marsh affects overall metal retention capacity of the system. It was concluded that areas colonised by H. portulacoides are potential sources of Cu, Cd and Pb to the marsh ecosystem, whereas areas colonised by S. maritima are more effective sinks at least for Cu and Cd. Consequently, S. maritima seems to contribute more effectively to the stabilisation of metals in salt marsh sediments, reducing their availability to the estuarine system. - The type of vegetal cover can affect the overall retention capacity of a salt marsh as well as the functioning of the salt marsh as a sink or source of metals to the estuarine system
Protein profiling of epidermal bladder cells from the halophyte Mesembryanthemum crystallinum.
Barkla, Bronwyn J; Vera-Estrella, Rosario; Pantoja, Omar
2012-09-01
Plant epidermal trichomes are as varied in morphology as they are in function. In the halophyte Mesembryanthemum crystallinum, specialized trichomes called epidermal bladder cells (EBC) line the surface of leaves and stems, and increase dramatically in size and volume upon plant salt-treatment. These cells have been proposed to have roles in plant defense and UV protection, but primarily in sodium sequestration and as water reservoirs. To gain further understanding into the roles of EBC, a cell-type-specific proteomics approach was taken in which precision single-cell sampling of cell sap from individual EBC was combined with shotgun peptide sequencing (LC-MS/MS). Identified proteins showed diverse biological functions and cellular locations, with a high representation of proteins involved in H(+)-transport, carbohydrate metabolism, and photosynthesis. The proteome of EBC provides insight into the roles of these cells in ion and water homeostasis and raises the possibility that they are photosynthetically active and functioning in Crassulacean acid metabolism. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Pardo, T; Bernal, M P; Clemente, R
2017-07-01
Phytostabilisation strategies have proven to be an efficient remediation option for mine tailings, but the adequate plant species and amendments have to be carefully selected. A remediation experiment was carried out at the semi-field level in tailings (pH 3.2, ≈1100, 4700 and 5000 mg kg -1 of As, Pb and Zn, respectively) from the mining district of La Unión-Cartagena (SE Spain). A red mud derivative (Fe/Al oxides), its combination with compost, and hydrated lime (Ca hydroxide) were applied in field plots of 0.25 m 2 . After four months of field stabilisation, tailings were transferred unaltered to a plant growth facility, and Atriplex halimus and Zygophyllum fabago (halophytes) were sown. Three months later, trace element (TE) solubility, plant accumulation and chemical speciation in the tailings pore water were studied. In unamended tailings, soluble TEs concentrations were very high (e.g., 40 mg Zn l -1 ), the dominant species being free ions and SO 4 2- - complexes (>70%). The addition of amendments increased tailings pH (6.7-7), reduced TEs solubility and extractability (>80-99%) and changed the dominant species of soluble Al, Cu, Pb and Zn to hydroxides and/or organo-metallic complexes, but increased slightly the extractable As and soluble Tl concentrations. Plants were able to grow only in amended tailings, and both species presented low levels of Al, As, Cd and Zn. Therefore, the use of combined red mud derivative and compost and halophytes was shown to be a good phytostabilisation strategy, although the dose applied must be carefully chosen in order to avoid possible solubilisation of As and Tl. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Edgar Bonales-Alatorre
2013-04-01
Full Text Available Halophytes species can be used as a highly convenient model system to reveal key ionic and molecular mechanisms that confer salinity tolerance in plants. Earlier, we reported that quinoa (Chenopodium quinoa Willd., a facultative C3 halophyte species, can efficiently control the activity of slow (SV and fast (FV tonoplast channels to match specific growth conditions by ensuring that most of accumulated Na+ is safely locked in the vacuole (Bonales-Alatorre et al. (2013 Plant Physiology. This work extends these finding by comparing the properties of tonoplast FV and SV channels in two quinoa genotypes contrasting in their salinity tolerance. The work is complemented by studies of the kinetics of net ion fluxes across the plasma membrane of quinoa leaf mesophyll tissue. Our results suggest that multiple mechanisms contribute towards genotypic differences in salinity tolerance in quinoa. These include: (i a higher rate of Na+ exclusion from leaf mesophyll; (ii maintenance of low cytosolic Na+ levels; (iii better K+ retention in the leaf mesophyll; (iv a high rate of H+ pumping, which increases the ability of mesophyll cells to restore their membrane potential; and (v the ability to reduce the activity of SV and FV channels under saline conditions. These mechanisms appear to be highly orchestrated, thus enabling the remarkable overall salinity tolerance of quinoa species.
Bonales-Alatorre, Edgar; Pottosin, Igor; Shabala, Lana; Chen, Zhong-Hua; Zeng, Fanrong; Jacobsen, Sven-Erik; Shabala, Sergey
2013-04-29
Halophytes species can be used as a highly convenient model system to reveal key ionic and molecular mechanisms that confer salinity tolerance in plants. Earlier, we reported that quinoa (Chenopodium quinoa Willd.), a facultative C3 halophyte species, can efficiently control the activity of slow (SV) and fast (FV) tonoplast channels to match specific growth conditions by ensuring that most of accumulated Na+ is safely locked in the vacuole (Bonales-Alatorre et al. (2013) Plant Physiology). This work extends these finding by comparing the properties of tonoplast FV and SV channels in two quinoa genotypes contrasting in their salinity tolerance. The work is complemented by studies of the kinetics of net ion fluxes across the plasma membrane of quinoa leaf mesophyll tissue. Our results suggest that multiple mechanisms contribute towards genotypic differences in salinity tolerance in quinoa. These include: (i) a higher rate of Na+ exclusion from leaf mesophyll; (ii) maintenance of low cytosolic Na+ levels; (iii) better K+ retention in the leaf mesophyll; (iv) a high rate of H+ pumping, which increases the ability of mesophyll cells to restore their membrane potential; and (v) the ability to reduce the activity of SV and FV channels under saline conditions. These mechanisms appear to be highly orchestrated, thus enabling the remarkable overall salinity tolerance of quinoa species.
The physiological role of a vacuolar ATPase subunit c1 (SaVHAc1) from a halophyte grass Spartina alterniflora was studied through its expression in rice. The SaVHAc1– expressing plants showed enhanced tolerance to salt stress than the wild-type plants, mainly through adjustments in early stage and p...
Wang, Lei; Huang, Zhenying; Baskin, Carol C; Baskin, Jerry M; Dong, Ming
2008-11-01
Suaeda aralocaspica is a C4 summer annual halophyte without Kranz anatomy that is restricted to the deserts of central Asia. It produces two distinct types of seeds that differ in colour, shape and size. The primary aims of the present study were to compare the dormancy and germination characteristics of dimorphic seeds of S. aralocaspica and to develop a conceptual model of their dynamics. Temperatures simulating those in the natural habitat of S. aralocaspica were used to test for primary dormancy and germination behaviour of fresh brown and black seeds. The effects of cold stratification, gibberellic acid, seed coat scarification, seed coat removal and dry storage on dormancy breaking were tested in black seeds. Germination percentage and recovery responses of brown seeds, non-treated black seeds and 8-week cold-stratified black seeds to salt stress were tested. Brown seeds were non-dormant, whereas black seeds had non-deep Type 2 physiological dormancy (PD). Germination percentage and rate of germination of brown seeds and of variously pretreated black seeds were significantly higher than those of non-pretreated black seeds. Exposure of seeds to various salinities had significant effects on germination, germination recovery and induction into secondary dormancy. A conceptual model is presented that ties these results together and puts them into an ecological context. The two seed morphs of S. aralocaspica exhibit distinct differences in dormancy and germination characteristics. Suaeda aralocaspica is the first cold desert halophyte for which non-deep Type 2 PD has been documented.
Bose, Jayakumar; Rodrigo-Moreno, Ana; Lai, Diwen; Xie, Yanjie; Shen, Wenbiao; Shabala, Sergey
2015-01-01
Background and Aims The activity of H+-ATPase is essential for energizing the plasma membrane. It provides the driving force for potassium retention and uptake through voltage-gated channels and for Na+ exclusion via Na+/H+ exchangers. Both of these traits are central to plant salinity tolerance; however, whether the increased activity of H+-ATPase is a constitutive trait in halophyte species and whether this activity is upregulated at either the transcriptional or post-translation level remain disputed. Methods The kinetics of salt-induced net H+, Na+ and K+ fluxes, membrane potential and AHA1/2/3 expression changes in the roots of two halophyte species, Atriplex lentiformis (saltbush) and Chenopodium quinoa (quinoa), were compared with data obtained from Arabidopsis thaliana roots. Key Results Intrinsic (steady-state) membrane potential values were more negative in A. lentiformis and C. quinoa compared with arabidopsis (−144 ± 3·3, −138 ± 5·4 and −128 ± 3·3 mV, respectively). Treatment with 100 mm NaCl depolarized the root plasma membrane, an effect that was much stronger in arabidopsis. The extent of plasma membrane depolarization positively correlated with NaCl-induced stimulation of vanadate-sensitive H+ efflux, Na+ efflux and K+ retention in roots (quinoa > saltbush > arabidopsis). NaCl-induced stimulation of H+ efflux was most pronounced in the root elongation zone. In contrast, H+-ATPase AHA transcript levels were much higher in arabidopsis compared with quinoa plants, and 100 mm NaCl treatment led to a further 3-fold increase in AHA1 and AHA2 transcripts in arabidopsis but not in quinoa. Conclusions Enhanced salinity tolerance in the halophyte species studied here is not related to the constitutively higher AHA transcript levels in the root epidermis, but to the plant’s ability to rapidly upregulate plasma membrane H+-ATPase upon salinity treatment. This is necessary for assisting plants to maintain highly negative
Barkla, Bronwyn J.; Vera-Estrella, Rosario; Raymond, Carolyn
2016-01-01
Background Epidermal bladder cells (EBC) are large single-celled, specialized, and modified trichomes found on the aerial parts of the halophyte Mesembryanthemum crystallinum. Recent development of a simple but high throughput technique to extract the contents from these cells has provided an opportunity to conduct detailed single-cell-type analyses of their molecular characteristics at high resolution to gain insight into the role of these cells in the salt tolerance of the plant. Results In...
Phytoremediation potential of some halophytic species for soil salinity.
Devi, S; Nandwal, A S; Angrish, R; Arya, S S; Kumar, N; Sharma, S K
2016-01-01
Phytoremediation potential of six halophytic species i.e. Suaeda nudiflora, Suaeda fruticosa, Portulaca oleracea, Atriplex lentiformis, Parkinsonia aculeata and Xanthium strumarium was assessed under screen house conditions. Plants were raised at 8.0, 12.0, 16.0, and 20.0 dSm(-1) of chloride-dominated salinity. The control plants were irrigated with canal water. Sampling was done at vegetative stage (60-75 DAS). About 95 percent seed germination occurred up to 12 dSm(-1) and thereafter declined slightly. Mean plant height and dry weight plant(-1) were significantly decreased from 48.71 to 32.44 cm and from 1.73 to 0.61g plant(-1) respectively upon salinization. Na(+)/K(+) ratio (0.87 to 2.72), Na(+)/ Ca(2+) + Mg(2+) (0.48 to 1.54) and Cl(-)/SO4(2-) (0.94 to 5.04) ratio showed increasing trend. Salinity susceptibility index was found minimum in Suaeda fruticosa (0.72) and maximum in Parkinsonia aculeata (1.17). Total ionic content also declined and magnitude of decline varied from 8.51 to 18.91% at 8 dSm(-1) and 1.85 to 7.12% at 20 dSm(-1) of salinity. On the basis of phytoremediation potential Suaeda fruticosa (1170.02 mg plant(-1)), Atriplex lentiformis (777.87 mg plant(-1)) were the best salt hyperaccumulator plants whereas Xanthium strumarium (349.61 mg plant(-1)) and Parkinsonia aculeata (310.59 mg plant(-1)) were the least hyperaccumulator plants.
Bose, Jayakumar; Rodrigo-Moreno, Ana; Lai, Diwen; Xie, Yanjie; Shen, Wenbiao; Shabala, Sergey
2015-02-01
The activity of H(+)-ATPase is essential for energizing the plasma membrane. It provides the driving force for potassium retention and uptake through voltage-gated channels and for Na(+) exclusion via Na(+)/H(+) exchangers. Both of these traits are central to plant salinity tolerance; however, whether the increased activity of H(+)-ATPase is a constitutive trait in halophyte species and whether this activity is upregulated at either the transcriptional or post-translation level remain disputed. The kinetics of salt-induced net H(+), Na(+) and K(+) fluxes, membrane potential and AHA1/2/3 expression changes in the roots of two halophyte species, Atriplex lentiformis (saltbush) and Chenopodium quinoa (quinoa), were compared with data obtained from Arabidopsis thaliana roots. Intrinsic (steady-state) membrane potential values were more negative in A. lentiformis and C. quinoa compared with arabidopsis (-144 ± 3·3, -138 ± 5·4 and -128 ± 3·3 mV, respectively). Treatment with 100 mm NaCl depolarized the root plasma membrane, an effect that was much stronger in arabidopsis. The extent of plasma membrane depolarization positively correlated with NaCl-induced stimulation of vanadate-sensitive H(+) efflux, Na(+) efflux and K(+) retention in roots (quinoa > saltbush > arabidopsis). NaCl-induced stimulation of H(+) efflux was most pronounced in the root elongation zone. In contrast, H(+)-ATPase AHA transcript levels were much higher in arabidopsis compared with quinoa plants, and 100 mm NaCl treatment led to a further 3-fold increase in AHA1 and AHA2 transcripts in arabidopsis but not in quinoa. Enhanced salinity tolerance in the halophyte species studied here is not related to the constitutively higher AHA transcript levels in the root epidermis, but to the plant's ability to rapidly upregulate plasma membrane H(+)-ATPase upon salinity treatment. This is necessary for assisting plants to maintain highly negative membrane potential values and to
Oh, Dongha
2010-09-10
The genome of Thellungiella parvula, a halophytic relative of Arabidopsis (Arabidopsis thaliana), is being assembled using Roche-454 sequencing. Analyses of a 10-Mb scaffold revealed synteny with Arabidopsis, with recombination and inversion and an uneven distribution of repeat sequences. T. parvula genome structure and DNA sequences were compared with orthologous regions from Arabidopsis and publicly available bacterial artificial chromosome sequences from Thellungiella salsuginea (previously Thellungiella halophila). The three-way comparison of sequences, from one abiotic stress-sensitive species and two tolerant species, revealed extensive sequence conservation and microcolinearity, but grouping Thellungiella species separately from Arabidopsis. However, the T. parvula segments are distinguished from their T. salsuginea counterparts by a pronounced paucity of repeat sequences, resulting in a 30% shorter DNA segment with essentially the same gene content in T. parvula. Among the genes is SALT OVERLY SENSITIVE1 (SOS1), a sodium/proton antiporter, which represents an essential component of plant salinity stress tolerance. Although the SOS1 coding region is highly conserved among all three species, the promoter regions show conservation only between the two Thellungiella species. Comparative transcript analyses revealed higher levels of basal as well as salt-induced SOS1 expression in both Thellungiella species as compared with Arabidopsis. The Thellungiella species and other halophytes share conserved pyrimidine-rich 5\\' untranslated region proximal regions of SOS1 that are missing in Arabidopsis. Completion of the genome structure of T. parvula is expected to highlight distinctive genetic elements underlying the extremophile lifestyle of this species. © American Society of Plant Biologists.
Directory of Open Access Journals (Sweden)
Julien Charbonnier
2008-04-01
Full Text Available Le présent article vise à reconstituer les différents systèmes de culture d’Arabie du sud antique. Pour ce faire, les études archéobotaniques sont mises en perspective avec les recherches sur les paysages et les techniques de culture anciennes. Il apparaît ainsi, qu’entre l’âge du Bronze et la période sudarabique, le Yémen n’a cessé de s’enrichir de l’arrivée de nouvelles plantes, en provenance de Proche-Orient, de l’Afrique et du Monde indien. Leurs capacités propres et les nouvelles combinaisons dont elles offraient l’opportunité ont permis à l’homme de diversifier les systèmes de culture afin de tirer au maximum parti des terres et d’être plus flexible face aux altérations du climat et de l’environnement.This paper aims at recognizing and understanding the various agro-systems of the ancient South Arabia. Archaeobotanical data are confronted with studies concerning pre-Islamic landscapes and agricultural techniques. It appears that, during the Bronze Age and the South Arabian period, new cultivars, coming from the Near-East, Africa and India, have regularly reached the region. Because of their own specificities and of the new associations they permitted, these plants have allowed Man to enrich agro-systems and to be more flexible in order to cope with climatic and environmental changes.
Ayyappan, Durai; Sathiyaraj, Ganesan; Ravindran, Konganapuram Chellappan
2016-01-01
The present study investigated the sources for remediation of heavy metals and salts from tannery effluent using salt marsh halophyte Sesuvium portulacastrum. From the results observed, in tannery effluent treated soil from 1 kg dry weight of plant sample, Sesuvium portulacastrum accumulated 49.82 mg Cr, 22.10 mg Cd, 35.10 mg Cu and 70.10 mg Zn and from 1 g dry weight of the plant sample, 246.21 mg Na Cl. Cultivation of Sesuvium portulacastrum significantly reduced the EC, pH and SAR levels in tannery effluent and salt treated soil and correspondingly increased in plant sample after 125 days of cultivation. In conclusion, Sesuvium portulacastrum was an efficient in accumulating heavy metals such as Chromium, Cadmium, Copper and Zinc, sodium and chloride maximum through its leaves when compared to stem and root. The finding of these bioacccumulation studies indicates that Sesuvium portulacastrum could be used for phytoremediation of tannery effluent contaminated field.
Al Hassan, Mohamad; Chaura, Juliana; López-Gresa, María P; Borsai, Orsolya; Daniso, Enrico; Donat-Torres, María P; Mayoral, Olga; Vicente, Oscar; Boscaiu, Monica
2016-01-01
Dittrichia viscosa is a Mediterranean ruderal species that over the last decades has expanded into new habitats, including coastal salt marshes, ecosystems that are per se fragile and threatened by human activities. To assess the potential risk that this native-invasive species represents for the genuine salt marsh vegetation, we compared its distribution with that of Inula crithmoides, a taxonomically related halophyte, in three salt marshes located in "La Albufera" Natural Park, near the city of Valencia (East Spain). The presence of D. viscosa was restricted to areas of low and moderate salinity, while I. crithmoides was also present in the most saline zones of the salt marshes. Analyses of the responses of the two species to salt and water stress treatments in controlled experiments revealed that both activate the same physiological stress tolerance mechanisms, based essentially on the transport of toxic ions to the leaves-where they are presumably compartmentalized in vacuoles-and the accumulation of specific osmolytes for osmotic adjustment. The two species differ in the efficiency of those mechanisms: salt-induced increases in Na(+) and Cl(-) contents were higher in I. crithmoides than in D. viscosa, and the osmolytes (especially glycine betaine, but also arabinose, fructose and glucose) accumulated at higher levels in the former species. This explains the (slightly) higher stress tolerance of I. crithmoides, as compared to D. viscosa, established from growth inhibition measurements and their distribution in nature. The possible activation of K(+) transport to the leaves under high salinity conditions may also contribute to salt tolerance in I. crithmoides. Oxidative stress level-estimated from malondialdehyde accumulation-was higher in the less tolerant D. viscosa, which consequently activated antioxidant responses as a defense mechanism against stress; these responses were weaker or absent in the more tolerant I. crithmoides. Based on these results, we
Directory of Open Access Journals (Sweden)
Mohamad eAl Hassan
2016-04-01
Full Text Available Dittrichia viscosa is a Mediterranean ruderal species that over the last decades has expanded into new habitats, including coastal salt marshes, ecosystems that are per se fragile and threatened by human activities. To assess the potential risk that this native-invasive species represents for the genuine salt marsh vegetation, we compared its distribution with that of Inula crithmoides, a taxonomically related halophyte, in three salt marshes located in ‘La Albufera’ Natural Park, near the city of Valencia (East Spain. The presence of D. viscosa was restricted to areas of low and moderate salinity, while I. crithmoides was also present in the most saline zones of the salt marshes. Analyses of the responses of the two species to salt and water stress treatments in controlled experiments revealed that both activate the same physiological stress tolerance mechanisms, based essentially on the transport of toxic ions to the leaves – where they are presumably compartmentalized in vacuoles – and the accumulation of specific osmolytes for osmotic adjustment. The two species differ in the efficiency of those mechanisms: salt-induced increases in Na+ and Cl- contents were higher in I. crithmoides than in D. viscosa, and the osmolytes (especially glycine betaine, but also arabinose, fructose and glucose accumulated at higher levels in the former species. This explains the (slightly higher stress tolerance of I. crithmoides, as compared to D. viscosa, established from growth inhibition measurements and their distribution in nature. The possible activation of K+ transport to the leaves under high salinity conditions may also contribute to salt tolerance in I. crithmoides. Oxidative stress level – estimated from malondialdehyde accumulation – was higher in the less tolerant D. viscosa, which consequently activated antioxidant responses as a defense mechanism against stress; these responses were weaker or absent in the more tolerant I. crithmoides
Mafalda R. Almeida; Joana Pacheco
2014-01-01
Reserva Natural do Sapal de Castro Marim e Vila Real de Santo António (RNSCMVRSA) is a natural reserve (SE of Portugal, Algarve region) that has habitats with different saline conditions and great ecological importance. Halophytes are plants that grow in a wide variety of saline habitats, namely in RNSCMVRSA, and can accumulated in their biomass high contents of salt. This plant behavior can increase production of reactive oxygen species (ROS) and consequently, the oxidative stress, cellular ...
Czech Academy of Sciences Publication Activity Database
Gharbi, E.; Martínez, J. L.; Benahmed, H.; Hichri, I.; Dobrev, Petre; Motyka, Václav; Quineta, M.; Lutts, S.
2017-01-01
Roč. 258, MAY (2017), s. 77-89 ISSN 0168-9452 R&D Projects: GA ČR(CZ) GA16-14649S Institutional support: RVO:61389030 Keywords : antioxidant enzyme-activities * improves salinity tolerance * enhances salt tolerance * abscisic-acid * water-stress * na+-exclusion * accumulation * ethylene * growth * arabidopsis * Osmotic adjustment * Halophyte * Salinity * Solanum chilense * Hormone * Tomato Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 3.437, year: 2016
Pottosin, Igor; Bonales-Alatorre, Edgar; Shabala, Sergey
2014-11-03
Activity of tonoplast slow vacuolar (SV, or TPC1) channels has to be under a tight control, to avoid undesirable leak of cations stored in the vacuole. This is particularly important for salt-grown plants, to ensure efficient vacuolar Na(+) sequestration. In this study we show that choline, a cationic precursor of glycine betaine, efficiently blocks SV channels in leaf and root vacuoles of the two chenopods, Chenopodium quinoa (halophyte) and Beta vulgaris (glycophyte). At the same time, betaine and proline, two major cytosolic organic osmolytes, have no significant effect on SV channel activity. Physiological implications of these findings are discussed. Copyright © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Mafalda R. Almeida
2014-06-01
Full Text Available Reserva Natural do Sapal de Castro Marim e Vila Real de Santo António (RNSCMVRSA is a natural reserve (SE of Portugal, Algarve region that has habitats with different saline conditions and great ecological importance. Halophytes are plants that grow in a wide variety of saline habitats, namely in RNSCMVRSA, and can accumulated in their biomass high contents of salt. This plant behavior can increase production of reactive oxygen species (ROS and consequently, the oxidative stress, cellular damage and metabolic disorders. In order to protect the cells from ROS, these plants developed an efficient antioxidant system. This system can be constituted by phenolics compounds that have an important effect on oxidative, anti-inflammatory and microbial stability important properties for food, dietary and pharmaceutical industries. Therefore, this work aims to identify the phenolic compounds in biomass of different autochthones halophytes species growing on natural conditions in RNSCMVSRA. Composite samples of Salicornia patula, Salicornia ramosissima, Sarcoccornia fruticosa and Sarcocornia perennis were collected in 2013. Sequential extraction was realized: firstly the plant samples were subjected to soxhlet extraction using dichloromethane and then by a solid-liquid extraction with ethanol. Finally, the main compounds present in each extract were identified by GC-MS (Gas chromatography–mass spectrometry. The total of phenolic compounds and polyphenolic antioxidants in the extracts was also determined by Folin-Ciocalteu method.
Energy Technology Data Exchange (ETDEWEB)
Fuzy, A.; Biro, B.; Toth, T.
2010-07-01
Soil and root samples were collected from the rhizosphere of dominant halophytes (Artemisia santonicum, Aster tripolium, Festuca pseudovina, Lepidium crassifolium, Plantago maritima and Puccinellia limosa) at four locations with saline soils in Hungary. The correlations- between arbuscular mycorrhiza (AM) fungal colonisation parameters (% colonisation, % arbuscules) and soil physical, chemical and biological parameters were determined Endomycorrhiza colonisation was found to be negatively correlated with the electric conductivity of the soil paste, the salt-specific ion concentrations and the cation exchange capacity, showing the sensitivity of AM fungi at increasing salt concentrations, independently of the types of salt-specific anions. A positive correlation was detected between the mycorrhiza colonisation and the abundance of oligotroph bacteria known to be the less variable and more stable (k-strategist) group. This fact and the negative correlation found with the humus content underlines the importance of nutrient availability and the limitations of the symbiotic interactions in stressed saline or sodic soils. (Author) 29 refs.
THE GENESIS OF PHOTOSYNTHESIS TYPES AS THE BASIS OF ECOLOGICAL EXPANSION OF HALOPHYTIC PLANTS
Directory of Open Access Journals (Sweden)
Pyurko O.Ye.
2011-12-01
Full Text Available The C3, C4, and CAM photosynthesis types are considerably differed by CO2 absorption intensity, its biochemistry, saturation level, water productivity, biological productivity, and other different features, which secure the plants survival at stress and extreme conditions. The aim of current research was to discover the photosynthesis peculiarities at halophytic plants species (Salicornia europaea L., Halimione pedunculata, Artemisia santonica L., Plantago lanceolata L. by salinity at model and natural conditions, and to generalize data in historical aspect. It was constituted that S. europaea L. was characterized by C3 photosynthesis passage which was switched on CAM CO2 fixation under soil salinity conditions till 4-4,5 %, but glycophyte A.santonica was immanent C4assimilation way of aspartate type.Analysis of literature data and own research allows to find out that in majority the C3photosynthesis dependence from environmental factors described by determinate curve with matched mathematical expression. It was suggested to generalize the data by Lagrange polynomial. The obtained results proved that the pattern of photosynthesis evolution is: C3 → C4 → CAM with commute possibilities: C3 → CAM; C4 → CAM.
International Nuclear Information System (INIS)
Redondo-Gomez, Susana; Mateos-Naranjo, Enrique; Andrades-Moreno, Luis
2010-01-01
The potential of the extreme halophyte Arthrocnemum macrostachyum was examined to determine its tolerance and ability to accumulate cadmium for phytoremediation purposes. A glasshouse experiment was designed to investigate the effect of cadmium from 0 to 1.35 mmol l -1 on the growth and the photosynthetic apparatus of A. macrostachyum by measuring chlorophyll fluorescence parameters, gas exchange and photosynthetic pigment concentrations. We also determined ash, cadmium, calcium, copper, iron, manganese, magnesium, phosphorous, sodium, and zinc concentrations, and C/N ratio. A. macrostachyum demonstrated hypertolerance to cadmium stress; it did not show phytotoxicity at shoot concentration as high as 70 mg kg -1 . The bioaccumulator factors exceeded the critical value (1.0) for all Cd treatments, and the transport factors indicated that this species has higher ability to transfer Cd from roots to shoots at lower Cd concentrations. At 1.35 mmol l -1 Cd A. macrostachyum showed 25% biomass reduction after a month of treatment. Long-term effects of cadmium on the growth were mainly determined by variations in net photosynthetic rate (P N ). Reductions in P N could be accounted by higher dark respiration and lower pigment concentrations. Finally, A. macrostachyum has the basic characteristics of a Cd-hyperaccumulator and may be useful for restoring Cd-contaminated sites.
Energy Technology Data Exchange (ETDEWEB)
Redondo-Gomez, Susana, E-mail: susana@us.es [Departamento de Biologia Vegetal y Ecologia, Facultad de Biologia, Universidad de Sevilla, Apartado 1095, 41080 Sevilla (Spain); Mateos-Naranjo, Enrique; Andrades-Moreno, Luis [Departamento de Biologia Vegetal y Ecologia, Facultad de Biologia, Universidad de Sevilla, Apartado 1095, 41080 Sevilla (Spain)
2010-12-15
The potential of the extreme halophyte Arthrocnemum macrostachyum was examined to determine its tolerance and ability to accumulate cadmium for phytoremediation purposes. A glasshouse experiment was designed to investigate the effect of cadmium from 0 to 1.35 mmol l{sup -1} on the growth and the photosynthetic apparatus of A. macrostachyum by measuring chlorophyll fluorescence parameters, gas exchange and photosynthetic pigment concentrations. We also determined ash, cadmium, calcium, copper, iron, manganese, magnesium, phosphorous, sodium, and zinc concentrations, and C/N ratio. A. macrostachyum demonstrated hypertolerance to cadmium stress; it did not show phytotoxicity at shoot concentration as high as 70 mg kg{sup -1}. The bioaccumulator factors exceeded the critical value (1.0) for all Cd treatments, and the transport factors indicated that this species has higher ability to transfer Cd from roots to shoots at lower Cd concentrations. At 1.35 mmol l{sup -1} Cd A. macrostachyum showed 25% biomass reduction after a month of treatment. Long-term effects of cadmium on the growth were mainly determined by variations in net photosynthetic rate (P{sub N}). Reductions in P{sub N} could be accounted by higher dark respiration and lower pigment concentrations. Finally, A. macrostachyum has the basic characteristics of a Cd-hyperaccumulator and may be useful for restoring Cd-contaminated sites.
Bonales-Alatorre, Edgar; Shabala, Sergey; Chen, Zhong-Hua; Pottosin, Igor
2013-01-01
Halophyte species implement a “salt-including” strategy, sequestering significant amounts of Na+ to cell vacuoles. This requires a reduction of passive Na+ leak from the vacuole. In this work, we used quinoa (Chenopodium quinoa) to investigate the ability of halophytes to regulate Na+-permeable slow-activating (SV) and fast-activating (FV) tonoplast channels, linking it with Na+ accumulation in mesophyll cells and salt bladders as well as leaf photosynthetic efficiency under salt stress. Our data indicate that young leaves rely on Na+ exclusion to salt bladders, whereas old ones, possessing far fewer salt bladders, depend almost exclusively on Na+ sequestration to mesophyll vacuoles. Moreover, although old leaves accumulate more Na+, this does not compromise their leaf photochemistry. FV and SV channels are slightly more permeable for K+ than for Na+, and vacuoles in young leaves express less FV current and with a density unchanged in plants subjected to high (400 mm NaCl) salinity. In old leaves, with an intrinsically lower density of the FV current, FV channel density decreases about 2-fold in plants grown under high salinity. In contrast, intrinsic activity of SV channels in vacuoles from young leaves is unchanged under salt stress. In vacuoles of old leaves, however, it is 2- and 7-fold lower in older compared with young leaves in control- and salt-grown plants, respectively. We conclude that the negative control of SV and FV tonoplast channel activity in old leaves reduces Na+ leak, thus enabling efficient sequestration of Na+ to their vacuoles. This enables optimal photosynthetic performance, conferring salinity tolerance in quinoa species. PMID:23624857
1985-04-24
LEBANON Beirut Citizens Offer Gloomy Response in Economic Poll ( Ilham Nasr Tablt, Hayyam Kayruz; AL-NAHAR AL-’ARABI WAL-DUWALI, 18-23 Feb 85) 115...concern ?obo?h sides. ^ develoPme^s and common iShSS-rSi B^^tj^^ yesterday, Mr Habib areas of cooperation between ?he So Countries ^ ^f^f?’ disc...8217ARABI WAL-DUWALI in Arabic 18-23 Feb 85 pp 36-41 [Article by Ilham Nasr Tabit and Hayyam Kayruzs "AL-NAHAR AL-’ARABI WAL- DUWALI’ s Poll of the
de Melo, Hidelblandi Farias; de Souza, Edivan Rodrigues; de Almeida, Brivaldo Gomes; Mulas, Maurizio
2018-02-23
Atriplex nummularia is a halophyte widely employed to recover saline soils and was used as a model to evaluate the water potentials in the soil-plant system under drought and salt stresses. Potted plants grown under 70 and 37% of field capacity irrigated with solutions of NaCl and of a mixture of NaCl, KCl, MgCl 2 and CaCl 2 reproducing six electrical conductivity (EC): 0, 5, 10, 20, 30, and 40 dS m -1 . After 100 days, total water (Ψ w, plant ) and osmotic (Ψ o, plant ) potentials at predawn and midday and Ψ o, soil , matric potential (Ψ m, soil ) and Ψ w, soil were determined. The type of ion in the irrigation water did not influence the soil potential, but was altered by EC. The soil Ψ o component was the largest contributor to Ψ w, soil . Atriplex is surviving ECs close to 40 dS m -1 due to the decrease in the Ψ w . The plants reached a Ψ w of approximately -8 MPa. The water potentials determined for different moisture levels, EC levels and salt types showed huge importance for the management of this species in semiarid regions and can be used to recover salt affected soils.
NaCl protects against Cd and Cu-induced toxicity in the halophyte Atriplex halimus
Energy Technology Data Exchange (ETDEWEB)
Bankaji, I.; Sleimi, N.; Gómez-Cadenas, A.; Pérez-Clemente, R.M.
2016-07-01
The objective of the present work was to evaluate the extent of Cd- and Cu-induced oxidative stress and the antioxidant response triggered in the halophyte species Atriplex halimus after metallic trace elements exposure. Plants were treated for one month with Cd2+ or Cu2+ (400 µM) in the absence or presence of 200 mM NaCl in the irrigation solution. The interaction between salinity and heavy metal stress was analyzed in relation to plant growth, tissue ion contents (Na+, K+ and Mg2+), oxidative damage and antioxidative metabolism. Data indicate that shoot and root weight significantly decreased as a consequence of Cd2+- or Cu2+-induced stress. Metallic stress leads to unbalanced nutrient uptake by reducing the translocation of K+ and Mg2+ from the root to the shoot. The levels of malondialdehyde increased in root tissue when Cd, and especially Cu, were added to the irrigation solution, indicating that oxidative damage occurred. Results showed that NaCl gave a partial protection against Cd and Cu induced toxicity, although these contaminants had distinct influence on plant physiology. It can be concluded that salinity drastically modified heavy metal absorption and improved plant growth. Salinity also decreased oxidative damage, but differently in plants exposed to Cd or Cu stress.
NATURAL DEVELOPMENT OF THE HALOPHYTE Salicornia bigelovii (TOR. IN COASTAL AREA OF SONORA STATE
Directory of Open Access Journals (Sweden)
Edgar Omar Rueda Puente
2017-05-01
Full Text Available In order to increase knowledge about the vegetative structure and environmental conditions, two coastal areas (north and south in Sonora, Mexico, where Salicornia bigelovii develops in natural form were investigated. Based on the abundance of Salicornia, three locations were selected in the two areas. Transects in each of the three sites were developed. The sediments in the northern areas showed higher values compared with the south areas of Sonora in organic matter. Plant biomass, density, height and frequency of occurrence were higher in frequently flooded areas compared to sparsely or less often by the tides. The average total biomass ranged from 2.23 to 6.33 kg (dry weight m-2 and is composed primarily of surface components. The maximum values of biomass of Salicornia were observed in February to May in both areas. The growth of Salicornia bigelovii is influenced mainly by the frequency of flooding, duration of exposure to air during low tide, rainfall, salinity and salt content of the ambient water and sediment, respectively. The carbon content increased with plant age, while protein content decreased by 233.6%. The steady increase in human pressure on coastal areas where Salicornia and other halophytes growth, require immediate protection order to prevent vulnerabilities in their populations.
La belleza del mundo es la Belleza de Dios (El núcleo estético del lrtán de Ibn'Arabi IIª parte.
Directory of Open Access Journals (Sweden)
José Miguel Puerta Vílchez
2001-01-01
Full Text Available We will intend to evaluate, throughout the two consecutive parts of this study, which is to be considered the status at the veiy same time hierophan¡cal and cosmological, ontological and anthropological, that the notion of Beauty invests in te speculative misticism of te andalusian Mubyi al-Din Este artículo es la ponencia presentada en ci Seminario Mu¿iyi al-Din ¡bn `Arabi -Mawldnd falal al-Din al Ram!. Dos frentes clásicaspara el estudio de la mística especulativa en el Islam, que se celebró en la Facultad de Filosofia de la Universidad Complutense, en colaboración que la Consejería Cultural de la República islámica de Irán en Madrid, durante los días ¡9,20 y 21 de enero de 1999. ¡ La primera parte de este artículo se publicó en el número anterior de esta misma Revista. 31 José Miguel Puerta Vílchez La belleza del mundo es la belleza de Dios lbn `Arabí (1165-1240, known as well as "te greatest master" in the realm of islamie spirituality. And this by conftonting the theories of islaxnic aesthetics and philosophy, and both flarthermore by clari~'ing a vocabula¡y plenty of poliedric significances and by presenting the doctrine of a creative imagination of which its noetical and sacred value will be thus explored.
Pereira, Catarina Guerreiro; Barreira, Luísa; da Rosa Neng, Nuno; Nogueira, José Manuel Florêncio; Marques, Cátia; Santos, Tamára F; Varela, João; Custódio, Luísa
2017-09-01
Aromatic halophyte plants are an outstanding source of bioactive compounds and natural products with potential use in the food industry. This work reports the in vitro antioxidant activity, toxicity, polyphenolic profile and mineral contents of infusions and decoctions from stems, leaves and flowers of Crithmum maritimum L., an aromatic and edible maritime halophyte (sea fennel). Aspalathus linearis (Burm.f.) Dahlg. (rooibos) herbal tea was used as a reference. Sea fennel's tisanes, particularly from leaves, were rich in phenolic compounds and five of them (p-hydroxybenzoic and ferulic acids, epicatechin, pyrocatechol and 4-hydroxybenzaldehyde) were here described in C. maritimum for the first time. Chlorogenic acid was the dominant phenolic determined. Na was the most abundant mineral in all tisanes followed by Ca and Mg in leaves' tisanes and K in flowers. Sea fennel's samples had a similar antioxidant activity than those from A. linearis, and had no significant toxicity towards four different mammalian cell lines. Altogether, our results suggest that sea fennel can be a source of products and/or molecules for the food industry with antioxidant properties and minerals in the form, for example, of innovative health-promoting herbal beverages. Copyright © 2017 Elsevier Ltd. All rights reserved.
Liu, Xiaoli; Lai, Yongkai; Sun, Hushan; Wang, Yiyan; Zou, Ning
2016-04-01
Suaeda salsa is the pioneer halophyte in the Yellow River Delta and was consumed as a popular vegetable. Mercury has become a highly risky contaminant in the sediment of intertidal zones of the Yellow River Delta. In this work, we investigated the interactive effects of mercury and selenium in S. salsa on the basis of metabolic profiling, antioxidant enzyme activities and gene expression quantification. Our results showed that mercury exposure (20 μg L(-1)) inhibited plant growth of S. salsa and induced significant metabolic responses and altered expression levels of INPS, CMO, and MDH in S. salsa samples, together with the increased activities of antioxidant enzymes including SOD and POD. Overall, these results indicated osmotic and oxidative stresses, disturbed protein degradation and energy metabolism change in S. salsa after mercury exposures. Additionally, the addition of selenium could induce both antagonistic and synergistic effects including alleviating protein degradation and aggravating osmotic stress caused by mercury. © 2014 Wiley Periodicals, Inc.
Physiological and proteomic analyses of salt stress response in the halophyte Halogeton glomeratus.
Wang, Juncheng; Meng, Yaxiong; Li, Baochun; Ma, Xiaole; Lai, Yong; Si, Erjing; Yang, Ke; Xu, Xianliang; Shang, Xunwu; Wang, Huajun; Wang, Di
2015-04-01
Very little is known about the adaptation mechanism of Chenopodiaceae Halogeton glomeratus, a succulent annual halophyte, under saline conditions. In this study, we investigated the morphological and physiological adaptation mechanisms of seedlings exposed to different concentrations of NaCl treatment for 21 d. Our results revealed that H. glomeratus has a robust ability to tolerate salt; its optimal growth occurs under approximately 100 mm NaCl conditions. Salt crystals were deposited in water-storage tissue under saline conditions. We speculate that osmotic adjustment may be the primary mechanism of salt tolerance in H. glomeratus, which transports toxic ions such as sodium into specific salt-storage cells and compartmentalizes them in large vacuoles to maintain the water content of tissues and the succulence of the leaves. To investigate the molecular response mechanisms to salt stress in H. glomeratus, we conducted a comparative proteomic analysis of seedling leaves that had been exposed to 200 mm NaCl for 24 h, 72 h and 7 d. Forty-nine protein spots, exhibiting significant changes in abundance after stress, were identified using matrix-assisted laser desorption ionization tandem time-of-flight mass spectrometry (MALDI-TOF/TOF MS/MS) and similarity searches across EST database of H. glomeratus. These stress-responsive proteins were categorized into nine functional groups, such as photosynthesis, carbohydrate and energy metabolism, and stress and defence response. © 2014 The Authors. Plant, Cell & Environment published by John Wiley & Sons Ltd.
Department of the Interior — Declines of Steller’s eiders (Polysticta stelleri) (STEIs) have resulted in listing the North American breeding population as Threatened under the Endangered Species...
Increased resistance to a generalist herbivore in a salinity-stressed non-halophytic plant.
Renault, Sylvie; Wolfe, Scott; Markham, John; Avila-Sakar, Germán
2016-01-01
Plants often grow under the combined stress of several factors. Salinity and herbivory, separately, can severely hinder plant growth and reproduction, but the combined effects of both factors are still not clearly understood. Salinity is known to reduce plant tissue nitrogen content and growth rates. Since herbivores prefer tissues with high N content, and biochemical pathways leading to resistance are commonly elicited by salt-stress, we hypothesized that plants growing in saline conditions would have enhanced resistance against herbivores. The non-halophyte, Brassica juncea, and the generalist herbivore Trichoplusia ni were used to test the prediction that plants subjected to salinity stress would be both more resistant and more tolerant to herbivory than those growing without salt stress. Plants were grown under different NaCl levels, and either exposed to herbivores and followed by removal of half of their leaves, or left intact. Plants were left to grow and reproduce until senescence. Tissue quality was assessed, seeds were counted and biomass of different organs measured. Plants exposed to salinity grew less, had reduced tissue nitrogen, protein and chlorophyll content, although proline levels increased. Specific leaf area, leaf water content, transpiration and root:shoot ratio remained unaffected. Plants growing under saline condition had greater constitutive resistance than unstressed plants. However, induced resistance and tolerance were not affected by salinity. These results support the hypothesis that plants growing under salt-stress are better defended against herbivores, although in B. juncea this may be mostly through resistance, and less through tolerance. Published by Oxford University Press on behalf of the Annals of Botany Company.
Ksouri, Riadh; Falleh, Hanen; Megdiche, Wided; Trabelsi, Najla; Mhamdi, Baya; Chaieb, Kamel; Bakrouf, Amina; Magné, Christian; Abdelly, Chedly
2009-08-01
Tamarix gallica is a halophytic species having hepatotonic and stimulant properties, as it was traditionally used in the treatment of various liver disorders. Leaf and flower infusion have anti-inflammatory and anti-diarrheic properties. In this work, we have investigated antioxidant and antimicrobial activities of leaf and flower extracts and their phenolic composition. Results showed that flowers exhibit a higher antioxidant activity as compared to the leaves, IC(50) values of the flower extracts are being 1.3 (beta-carotene bleaching) to 19 times (lipid peroxidation inhibition) lower than those for leaves. Accordingly, flower extracts exhibited the highest total phenolic content (135.35 mgGAE/gDW) and RP-HPLC analysis showed that syringic acid, isoquercitin as well as catechin were the major phenolics. Furthermore, Tamarix extracts showed appreciable antibacterial properties against human pathogen strains. The mean inhibition zone was from 0 to 6.5mm when the concentration increased from 2 to 100mg/l. The strongest activity was recorded against Micrococcus luteus and the lowest activity was observed against Escherichia coli. Moreover, organ extracts show a weakly to moderate activity against the tested Candida. These findings suggest that Tamarix may be considered as an interesting source of antioxidants for therapeutic or nutraceutical industries and for food manufactures.
A spatial pattern analysis of the halophytic species distribution in an arid coastal environment.
Badreldin, Nasem; Uria-Diez, J; Mateu, J; Youssef, Ali; Stal, Cornelis; El-Bana, Magdy; Magdy, Ahmed; Goossens, Rudi
2015-05-01
Obtaining information about the spatial distribution of desert plants is considered as a serious challenge for ecologists and environmental modeling due to the required intensive field work and infrastructures in harsh and remote arid environments. A new method was applied for assessing the spatial distribution of the halophytic species (HS) in an arid coastal environment. This method was based on the object-based image analysis for a high-resolution Google Earth satellite image. The integration of the image processing techniques and field work provided accurate information about the spatial distribution of HS. The extracted objects were based on assumptions that explained the plant-pixel relationship. Three different types of digital image processing techniques were implemented and validated to obtain an accurate HS spatial distribution. A total of 2703 individuals of the HS community were found in the case study, and approximately 82% were located above an elevation of 2 m. The micro-topography exhibited a significant negative relationship with pH and EC (r = -0.79 and -0.81, respectively, p < 0.001). The spatial structure was modeled using stochastic point processes, in particular a hybrid family of Gibbs processes. A new model is proposed that uses a hard-core structure at very short distances, together with a cluster structure in short-to-medium distances and a Poisson structure for larger distances. This model was found to fit the data perfectly well.
Wei, Huaibin; Yu, Huibin; Pan, Hongwei; Gao, Hongjie
2018-05-01
UV-visible absorption spectroscopy combined with principal component analysis (PCA) and two-dimensional correlation (2D correlation) is used to trace components of dissolved organic matter (DOM) extracted from soils in a larger estuarine delta and to investigate spatial variations of DOM fractions. Soil samples of different depths were collected from native halophyte soils along a saline gradient, i.e., Suaeda salsa Comm. (SSC), Chenopodium album Comm. (CAC), Phragmites australis Comm. (PAC), and Artemisia selengensis Comm. (ASC). Molecular weights of DOM within the SSC soil profile were the lowest, followed by the CAC, PAC, and ASC soil profiles. Humification degree of DOM within the ASC soil profile was the highest, followed by the PAC, SSC, and CAC soil profiles. DOM within the soil profiles mainly contained phenolic, carboxylic, microbial products, and aromatic and alkyl groups through the PCA, which presented the significant differentiation among the four native halophyte soil profiles. The 2D UV correlation spectra of DOM within the SSC soil profile indicated that the variations of the phenolic groups were the largest, followed by the carboxylic groups, microbial products, and humified organic materials according to the band changing order of 285 → 365 → 425 → 520 nm. The 2D UV correlation spectra of DOM within the CAC soil profiles determined that the decreasing order of the variations was phenolic groups > carboxylic groups > microbial products according the band changing order of 285 → 365 → 425 nm. The 2D UV correlation spectra of DOM within the PAC soil profile proved that the variations of the phenolic groups were larger than those of the carboxylic groups according to the band changing order of 285 → 365 nm. The 2D UV correlation spectra of DOM within the ASC soil profile demonstrated that the variations of the phenolic groups were larger than those of the other DOM fractions according to the broad cross-peak at
Barkla, Bronwyn J; Vera-Estrella, Rosario
2015-01-01
One of the remarkable adaptive features of the halophyte Mesembryanthemum crystallinum are the specialized modified trichomes called epidermal bladder cells (EBC) which cover the leaves, stems, and peduncle of the plant. They are present from an early developmental stage but upon salt stress rapidly expand due to the accumulation of water and sodium. This particular plant feature makes it an attractive system for single cell type studies, with recent proteomics and transcriptomics studies of the EBC establishing that these cells are metabolically active and have roles other than sodium sequestration. To continue our investigation into the function of these unusual cells we carried out a comprehensive global analysis of the metabolites present in the EBC extract by gas chromatography Time-of-Flight mass spectrometry (GC-TOF) and identified 194 known and 722 total molecular features. Statistical analysis of the metabolic changes between control and salt-treated samples identified 352 significantly differing metabolites (268 after correction for FDR). Principal components analysis provided an unbiased evaluation of the data variance structure. Biochemical pathway enrichment analysis suggested significant perturbations in 13 biochemical pathways as defined in KEGG. More than 50% of the metabolites that show significant changes in the EBC, can be classified as compatible solutes and include sugars, sugar alcohols, protein and non-protein amino acids, and organic acids, highlighting the need to maintain osmotic homeostasis to balance the accumulation of Na(+) and Cl(-) ions. Overall, the comparison of metabolic changes in salt treated relative to control samples suggests large alterations in M. crystallinum epidermal bladder cells.
Barkla, Bronwyn J; Rhodes, Timothy; Tran, Kieu-Nga T; Wijesinghege, Chathura; Larkin, John C; Dassanayake, Maheshi
2018-06-01
Endopolyploidy occurs when DNA replication takes place without subsequent mitotic nuclear division, resulting in cell-specific ploidy levels within tissues. In plants, endopolyploidy plays an important role in sustaining growth and development, but only a few studies have demonstrated a role in abiotic stress response. In this study, we investigated the function of ploidy level and nuclear and cell size in leaf expansion throughout development and tracked cell type-specific ploidy in the halophyte Mesembryanthemum crystallinum In addition to developmental endopolyploidy, we examined the effects of salinity stress on ploidy level. We focused specifically on epidermal bladder cells (EBC), which are modified balloon-like trichomes, due to their large size and role in salt accumulation. Our results demonstrate that ploidy increases as the leaves expand in a similar manner for each leaf type, and ploidy levels up to 512C were recorded for nuclei in EBC of leaves of adult plants. Salt treatment led to a significant increase in ploidy levels in the EBC, and these cells showed spatially related differences in their ploidy and nuclear and cell size depending on the positions on the leaf and stem surface. Transcriptome analysis highlighted salinity-induced changes in genes involved in DNA replication, cell cycle, endoreduplication, and trichome development in EBC. The increase in cell size and ploidy observed in M. crystallinum under salinity stress may contribute to salt tolerance by increasing the storage capacity for sodium sequestration brought about by higher metabolic activity driving rapid cell enlargement in the leaf tissue and EBC. © 2018 American Society of Plant Biologists. All rights reserved.
Barkla, Bronwyn J.; Vera-Estrella, Rosario
2015-01-01
One of the remarkable adaptive features of the halophyte Mesembryanthemum crystallinum are the specialized modified trichomes called epidermal bladder cells (EBC) which cover the leaves, stems, and peduncle of the plant. They are present from an early developmental stage but upon salt stress rapidly expand due to the accumulation of water and sodium. This particular plant feature makes it an attractive system for single cell type studies, with recent proteomics and transcriptomics studies of the EBC establishing that these cells are metabolically active and have roles other than sodium sequestration. To continue our investigation into the function of these unusual cells we carried out a comprehensive global analysis of the metabolites present in the EBC extract by gas chromatography Time-of-Flight mass spectrometry (GC-TOF) and identified 194 known and 722 total molecular features. Statistical analysis of the metabolic changes between control and salt-treated samples identified 352 significantly differing metabolites (268 after correction for FDR). Principal components analysis provided an unbiased evaluation of the data variance structure. Biochemical pathway enrichment analysis suggested significant perturbations in 13 biochemical pathways as defined in KEGG. More than 50% of the metabolites that show significant changes in the EBC, can be classified as compatible solutes and include sugars, sugar alcohols, protein and non-protein amino acids, and organic acids, highlighting the need to maintain osmotic homeostasis to balance the accumulation of Na+ and Cl− ions. Overall, the comparison of metabolic changes in salt treated relative to control samples suggests large alterations in M. crystallinum epidermal bladder cells. PMID:26113856
Detection and isolation of nepoviruses on strawberry in the Czech Republic.
Honetslegrová, J; Spak, J
1995-06-01
Arabis mosaic, strawberry latent ringspot, tomato black ring and raspberry ringspot nepoviruses were monitored using double sandwich enzyme-linked immunosorbent assay (DAS-ELISA) in 18 cultivars of strawberry Fragaria x ananassa Duch. in the Czech Republic. Arabis mosaic and strawberry latent ringspot viruses were detected, isolated and characterized on differential host plants and by electron microscopy. Both viruses were purified and antisera to them were prepared.
Balnokin, Yurii; Myasoedov, Nikolay; Popova, Larissa; Tikhomirov, Alexander A.; Ushakova, Sofya; Tikhomirova, Natalia; Lasseur, Christophe; Gros, Jean-Bernard
One problem in designing bioregenerative life support systems (BLSS) is developing technolo-gies to include human liquid and solid waste in intrasystem recycling. A specific task is recycling of NaCl excreted in urine by humans. We showed recently that this could be achieved through inclusion of the salt accumulating halophyte Salicornia europaea in the autotrophic compart-ment of the BLSS (Balnokin et al., ASR, 2010, in press). A model of NaCl circulation in BLSS with inclusion of S. europaea was based on the NaCl turnover in the human -urine -nutrient solution -S. europaea -human cycle. Mineralized urine was used as a basis for preparation of a nutrient solution for the halophyte cultivation. The shoots of the halophyte cultivated in the mineralized urine and containing NaCl could to be used by the BLSS inhabitants in their diets. In this report we describe cultivation of S. europaea which allows turnover of NaCl and produces daily shoot biomass containing Na+ and Cl- in quantities approximately equal to those excreted in daily human urine. The plants were grown in water culture in a climatic chamber under controlled conditions. A solution simulating mineralized urine (SSMU) was used as a basis for preparation of a nutri-ent solution for S. europaea cultivation. For continuous biomass production, seedlings of S. europaea, germinated preliminary in moist sand, were being transferred to the nutrient solu-tion at regular intervals (every two days). Duration of the conveyor operation was 112 days. During the first 56 days, the seedlings were being planted in SSMU diluted by a factor of 1.5 (2/3 SSMU). The same solution was introduced into the growth vessels as volumes of growth medium decreased due to plant transpiration. Starting from the 56th day as conveyor operation was initiated, the plants were being harvested every two days; the solutions from the discharged vessels were mixed with the fresh SSMU and the mixture was introduced into all other growth vessels of
Directory of Open Access Journals (Sweden)
Jingtao Li
2014-06-01
Full Text Available Little information is available on gene expression profiling of halophyte A. canescens. To elucidate the molecular mechanism for stress tolerance in A. canescens, a full-length complementary DNA library was generated from A. canescens exposed to 400 mM NaCl, and provided 343 high-quality ESTs. In an evaluation of 343 valid EST sequences in the cDNA library, 197 unigenes were assembled, among which 190 unigenes (83.1% ESTs were identified according to their significant similarities with proteins of known functions. All the 343 EST sequences have been deposited in the dbEST GenBank under accession numbers JZ535802 to JZ536144. According to Arabidopsis MIPS functional category and GO classifications, we identified 193 unigenes of the 311 annotations EST, representing 72 non-redundant unigenes sharing similarities with genes related to the defense response. The sets of ESTs obtained provide a rich genetic resource and 17 up-regulated genes related to salt stress resistance were identified by qRT-PCR. Six of these genes may contribute crucially to earlier and later stage salt stress resistance. Additionally, among the 343 unigenes sequences, 22 simple sequence repeats (SSRs were also identified contributing to the study of A. canescens resources.
Directory of Open Access Journals (Sweden)
Bronwyn Jane Barkla
2015-06-01
Full Text Available One of the remarkable adaptive features of the halophyte and facultative CAM plant Mesembryathemum crystallinum are the specialized modified trichomes called epidermal bladder cells (EBC which cover the leaves, stems, and peduncle of the plant. They are present from an early developmental stage but upon salt stress rapidly expand due to the accumulation of water and sodium. This particular plant feature makes it an attractive system for single cell type studies, with recent proteomics and transcriptomics studies of the EBC establishing that these cells are metabolically active and have roles other than sodium sequestration. To continue our investigation into the function of these unusual cells we carried out a comprehensive global analysis of the metabolites present in the EBC extract by gas chromatography Time-of-Flight mass spectrometry (GC-TOF and identified 194 known and 722 total molecular features. Statistical analysis of the metabolic changes between control and salt-treated samples was used to identify 352 significantly differing metabolites (268 after correction for FDR. Principal components analysis provided an unbiased evaluation of the data variance structure. Biochemical pathway enrichment analysis suggested significant perturbations in 13 biochemical pathways as defined in KEGG. More than 50% of the metabolites that show significant changes in the EBC, can be classified as compatible solutes and include sugars, sugar alcohols, protein and non-protein amino acids, and organic acids, highlighting the need to maintain osmotic homeostasis to balance the accumulation of Na and Cl ions. Overall, the comparison of metabolic changes in salt treated relative to control samples suggest large alterations in Mesembryanthemum crystallinum epidermal bladder cells.
Directory of Open Access Journals (Sweden)
Tahereh Assadi
2013-04-01
Full Text Available Background: Suaeda aegyptica (S. aegyptica species belong to the Chenepodiaceae family, the second largest family in the world of plants kingdom. It is indigenous to arid and semi-arid regions of the world and salty coastal zones Persian Gulf of Iran. It is an annual succulent halophyte plant which is characterized by producing oily seeds, high growth rate and large number of biomass. The aim of this study was analysis and determination of oil and fatty acids concentration in the S. aegyptica seed. Material and Methods: The seeds of S. aegyptica were collected form coastal zones of Persian Gulf in Bushehr province, washed and dried. The fatty acids content of the dried seeds were extracted in n-hexane solvent by soxhellet apparatus. The residue of n-hexane in oily phase was evaporated by rotary evaporator and remaining oil was collected for fatty acids analysis. In the presence of potassium hydroxide and BF3 by refluxing for 30 minutes, the methyl ester derivative of fatty acids were produced. Then the resulted derivatives were analyzed by gas chromatography (GC-FID. Results: The seeds of S. aegyptica contains eight fatty acids as: Pelargonic (C9, Capric (C10, Undecylic (C11, Tridecylic (C13, Myristic (C14, Palmitic (C16, Stearic (C18, Linoleic (18:2 and Linolenic (18:3. Average oil content in seeds 014/0 ± 87 / percent. Conclusion: The ratio of unsaturated fatty acids was higher than the saturated ones. Linoleic and Palmitic acids are major unsaturated and saturated fatty acids of S. aegyptica seed respectively.
Alharby, Hesham F; Colmer, Timothy D; Barrett-Lennard, Edward G
2018-01-01
Water use by plants in landscapes with shallow saline groundwater may lead to the accumulation of salt in the root zone. We examined the accumulation of Na + and Cl - around the roots of the halophyte Atriplex nummularia Lindl. and the impacts of this increasing salinity for stomatal conductance, water use and growth. Plants were grown in columns filled with a sand-clay mixture and connected at the bottom to reservoirs containing 20, 200 or 400 mM NaCl. At 21 d, Na + and Cl - concentrations in the soil solution were affected by the salinity of the groundwater, height above the water table and the root fresh mass density at various soil depths (P soil solution therefore had a feedback effect on further salinization within the root zone. © 2017 John Wiley & Sons Ltd.
Qin, Sheng; Bian, Guang-Kai; Tamura, Tomohiko; Zhang, Yue-Ji; Zhang, Wen-Di; Cao, Cheng-Liang; Jiang, Ji-Hong
2013-08-01
A novel actinomycete, designated KLBMP 1284(T), was isolated from the surface-sterilized stems of a coastal halophyte Tamarix chinensis Lour. collected from the city of Nantong, Jiangsu Province, east China. The strain was found to have morphological and chemotaxonomic characteristics typical of members of the genus Streptomyces. Analysis of the 16S rRNA gene sequence of strain KLBMP 1284(T) revealed that the strain formed a distinct clade within the phylogenetic tree based on 16S rRNA gene sequences and the highest sequence similarity (99.43 %) was to Streptomyces sulphureus NRRL B-1627(T). 16S rRNA gene sequence similarity to other species of the genus Streptomyces was lower than 97 %. Based on DNA-DNA hybridization values and comparison of morphological and phenotypic data, KLBMP 1284(T) could be distinguished from the closest phylogenetically related species, Streptomyces sulphureus NRRL B-1627(T). Thus, based on these data, it is evident that strain KLBMP 1284(T) represents a novel species of the genus Streptomyces, for which the name Streptomyces halophytocola sp. nov. is proposed. The type strain is KLBMP 1284(T) (= KCTC 19890(T) = NBRC 108770(T)).
Directory of Open Access Journals (Sweden)
I.V. Kosakivska
2017-05-01
Full Text Available The aim of this research was to investigate the leaf surface microstructure, pigments spectrum, hormones status and lipids composition of halophytes Polygonum maritimum L. and Euphorbia paralias L. that grow under natural conditions on the dunes of Pomorie Lake, (Bulgaria. It was shown that the existence in saline and dry soils provided among others adaptive mechanisms by specific microstructure of leaf. The adaxial and abaxial surfaces of P. maritimum leaves are covered with a dense layer of cuticle wax, stomata are located on the leaf both sides below the cuticle level. In E. paralias the cuticle is also well developed on the adaxial surface of leaf laminas. The epidermis of the leaf lower side is covered with a less dense cuticle layer formed by large wax crystals. This plant has stoma pores only on the abaxial side of small leaves below the cuticle level and they are surrounded with hump-shaped cuticle constructions. A high amount of carotenoids (as compared with that of chlorophylls in P. maritimum leaves indicates that these pigments have a light-collecting function and could transfer an additional energy to chlorophylls. The high performance liquid chromatography method has been used to provide a qualitative and quantitative analysis of hormones. It was shown that in leaves of E. paralias and P. maritimum free abscisic (ABA and conjugated indole-3-acetic (IAA acids prevailed. A high level of active ABA is correlated with the salt tolerance and ability to survive and grow in stress conditions. A high level of conjugated form of IAA demonstrated that activity of this hormone is limited. The cytokinins qualitative and quantitative analyses demonstrated that in E. paralias leaves zeatin forms dominated, and the level of inactive cytokinins (cis-zeatin and zeatin-O-glucoside was much higher than that of active ones (trans-zeatin and zeatin riboside. P. maritinum leaves contained a significant quantity of isopentenyl forms
Turcios, Ariel E; Weichgrebe, Dirk; Papenbrock, Jutta
2016-03-01
This project analyses the biogas potential of the halophyte Chenopodium quinoa Willd. In a first approach C. quinoa was grown with different concentrations of NaCl (0, 10 and 20 ppt NaCl) and the crop residues were used as substrate for biogas production. In a second approach, C. quinoa was grown with 0, 10, 20 and 30 ppt NaCl under hydroponic conditions and the fresh biomass was used as substrate. The more NaCl is in the culture medium, the higher the sodium, potassium, crude ash and hemicellulose content in the plant tissue whereas the calcium, sulfur, nitrogen and carbon content in the biomass decrease. According to this study, it is possible to produce high yields of methane using biomass of C. quinoa. The highest specific methane yields were obtained using the substrate from the plants cultivated at 10 and 20 ppt NaCl in both experiments. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Vinayak H. Lokhande
2015-12-01
Full Text Available In this study, we report phytoremediation of textile dyes using hairy roots derived through Agrobacterium rhizogenes (NCIM 5140 infection of in vitro leaf and stem explants of a halophyte Sesuvium portulacastrum (L. L. Leaf explants showed higher frequency of hairy root induction (70% than stem explants (30%, and maximum number of roots (leaf 42.3 ± 2.4 and stem 50.3 ± 1.7. Transformed nature of hairy roots was ascertained by amplifying 970 bp region of T-DNA of Ri plasmid. Hairy roots were screened for phytoremediation of various textile dyes and results showed that HRs were able to degrade Reactive green 19A HE4BD upto 98% within 5 days of incubation. Spectrophotometric analysis showed decrease in dye concentration while HPLC and FTIR analysis confirmed its degradation. Seed germination assay demonstrated non-toxic nature of the extracted metabolites. This is the first report on induction of hairy root culture in Sesuvium portulacastrum and phytoremediation of textile dyes.
Directory of Open Access Journals (Sweden)
Tahar eGhnaya
2015-03-01
Full Text Available The implication of organic acids in Cd and Ni translocation was studied in the halophyte species Sesuvium portulacastrum. Citric, fumaric, malic and ascorbic acids were separated and quantified by HPLC technique in shoots, roots and xylem saps of plants grown on nutrient solutions added with 50 µM Cd, 100 µM Ni and the combination of 50 µM Cd + 100 µM Ni. Results showed that Cd had no significant impact on biomass production while Ni and the combination of both metals drastically affected plant development. Cadmium and Ni concentrations in tissues and xylem sap were higher in plants individually exposed to heavy metal application than in those subjected to the combined treatment Cd + Ni, suggesting a possible competition between these metals for absorption. Both metals applied separately or in combination induced an increase in citrate concentration in shoots and xylem sap but a decrease of this concentration in the roots. However a minor relationship was observed between metal application and fumaric, malic and ascorbic acids. Both observations suggest the implication of citric acid in Cd, Ni translocation and shoot accumulation in S. portulacastrum. The relatively high accumulation of citric acid in xylem sap and shoot of S. portulacastrum could be involved in metal chelation and thus contributes to heavy metal tolerance in this species.
EFFECT OF EXOGENOUS ABSCISIC ACID ON GROWTH AND BIOCHEMICAL CHANGES IN THE HALOPHYTE SUAEDA MARITIMA
Directory of Open Access Journals (Sweden)
Anbarasi G.
2015-04-01
Full Text Available Different types of phytohormones are being extensively used to alleviate the adverse effect of salinity stress on plant growth. Among those, Abscisic acid (ABA is a plant stress hormone and one of the most important signaling molecules in plants. Drought and salinity activate De-novo abscisic acid synthesis prevent further water loss by evaporation through stomata, mediated by changes in the guard cell turgor pressure. Under osmotic stress abscisic acid induce the accumulation of protein involved in the biosynthesis of osmolites which increasing the stress tolerance of plant. In addition, exogenous application of ABA enhances the tolerance of plants or plant cells to cold, heat, drought, anoxia and heavy metal stresses. This study was carried out to study the exogenous abscisic (ABA acid induced regulatory role on the growth, water content, protein content, chlorophyll content, osmolyte accumulation and protein profiling through SDS PAGE in a halophyte, Suaeda maritima. The osmolyte accumulation of proline and glycine betaine was found to be more in 50 µM ABA concentrations. The protein profiling through SDS PAGE revealed that ̴ 66KDa proteins was not expressed in the control plant and in 10μM ABA treated plants. Interestingly, the ABA treatment induced a new protein of 14.2KDa in 10μM concentration. The ABA treated plants with concentrations 50μM, 100μM and 150μM showed changes in the expression of protein in abundance than the control and 10μM ABA treated plants. The findings in this study indicate that among all the concentrations, 50μM ABA concentration treated plants exhibited higher growth rate.
Xing, Ke; Qin, Sheng; Bian, Guang-Kai; Zhang, Yue-Ji; Zhang, Wen-Di; Dai, Chuan-Chao; Liu, Chang-Hong; Li, Wen-Jun; Jiang, Ji-Hong
2012-11-01
A novel isolate, designated strain KLBMP 1282(T) was isolated from the surface-sterilized leaves of a coastal halophyte Tamarix chinensis Lour., collected from Nantong, Jiangsu Province, east of China. Phylogenetic analysis based on 16S rRNA gene sequences revealed that this strain belongs to the genus Pseudonocardia, being most closely related to Pseudonocardia kongjuensis LM 157(T) (98.33 %), Pseudonocardia autotrophica IMSNU 20050(T) (97.77 %), Pseudonocardia endophytica YIM 56035(T) (97.63 %), Pseudonocardia ammonioxydans H9 (T) (97.62 %) and Pseudonocardia compacta IMSNU 20111(T) (97.56 %); similarity to other type strains of the genus Pseudonocardia was <97.5 %. Chemotaxonomic data confirmed the affiliation of strain KLBMP 1282(T) to the genus Pseudonocardia. Strain KLBMP 1282(T) contained MK-8(H(4)) as the predominant ubiquinone and iso-C(16:0) as the major fatty acid. The polar lipids detected in strain KLBMP 1282(T) were diphosphatidylglycerol, phosphatidylglycerol, phosphatidylcholine, phosphatidylmethylethanolamine, phosphatidylethanolamine, phosphatidylinositol, phosphatidylinositol mannosides, one unknown phospholipid and four unknown glycolipids. The DNA G + C content of strain KLBMP 1282(T) was 73.1 mol %. The results of DNA-DNA hybridizations and the phylogenetic analysis, together with the phenotypic and biochemical tests, allowed the differentiation of strain KLBMP 1282(T) from strains of other recognized Pseudonocardia species. Therefore, strain KLBMP 1282(T) represents a novel species of the genus Pseudonocardia, for which the name Pseudonocardia nantongensis sp. nov. is proposed. The type strain is KLBMP 1282(T) (=KCTC 29053(T) = NBRC 108677(T)).
2010-10-01
..., without a permit, take scrub jays (Aphelocoma coerulescens) and Steller's jays (Cyanocitta stelleri) when... transported or sold or offered for sale except that, such transportation within the area, as may be necessary... the State agricultural department, college, or other public institution may requisition such scrub...
Sghaier, Dhouha Belhaj; Duarte, Bernardo; Bankaji, Insaf; Caçador, Isabel; Sleimi, Noomene
2015-08-01
Trace metal elements can cause various environmental and health issues due to their accumulation and integration in the food chain. In the present study, we determined the major toxic effects of arsenic on physiological behaviour of plants. For this propose, several combinations of high salinity and arsenic (As) concentrations were applied to the halophytic shrub, Tamarix gallica, by growing for three months with an irrigation solution supplemented with different concentrations of As (0, 200, 500 and 800M) with and without 200mM NaCl. The effect of the combined stress conditions on growth, physiological patterns and biochemical parameters were also assessed. The results demonstrated that T. gallica is a tolerant plant regarding arsenic. The photosynthesis apparatus Fo, Fm and Fv fluorescence, as well as Fv/Fm were not affected by As nor by As combined with salt. Likewise, pigment and nutrient (K(+), Ca(2+) and Mg(2+)) contents were not affected either. However, the study results revealed that As adversely and significantly influenced the growth with increasing the concentration of As. Despite shoots growth reduction, the present research demonstrates that T. gallica is able to cope with high external concentrations of As (under 500μM) alone or in combination with NaCl. Copyright © 2015 Elsevier B.V. All rights reserved.
Jha, Bhavanath; Agarwal, Pradeep K; Reddy, Palakolanu Sudhakar; Lal, Sanjay; Sopory, Sudhir K; Reddy, Malireddy K
2009-04-01
Salinity severely affects plant growth and development causing crop loss worldwide. We have isolated a large number of salt-induced genes as well as unknown and hypothetical genes from Salicornia brachiata Roxb. (Amaranthaceae). This is the first description of identification of genes in response to salinity stress in this extreme halophyte plant. Salicornia accumulates salt in its pith and survives even at 2 M NaCl under field conditions. For isolating salt responsive genes, cDNA subtractive hybridization was performed between control and 500 mM NaCl treated plants. Out of the 1200 recombinant clones, 930 sequences were submitted to the NCBI database (GenBank accession: EB484528 to EB485289 and EC906125 to EC906292). 789 ESTs showed matching with different genes in NCBI database. 4.8% ESTs belonged to stress-tolerant gene category and approximately 29% ESTs showed no homology with known functional gene sequences, thus classified as unknown or hypothetical. The detection of a large number of ESTs with unknown putative function in this species makes it an interesting contribution. The 90 unknown and hypothetical genes were selected to study their differential regulation by reverse Northern analysis for identifying their role in salinity tolerance. Interestingly, both up and down regulation at 500 mM NaCl were observed (21 and 10 genes, respectively). Northern analysis of two important salt tolerant genes, ASR1 (Abscisic acid stress ripening gene) and plasma membrane H+ATPase, showed the basal level of transcripts in control condition and an increase with NaCl treatment. ASR1 gene is made full length using 5' RACE and its potential role in imparting salt tolerance is being studied.
Directory of Open Access Journals (Sweden)
Elham Kalantari
2018-01-01
Full Text Available The expansion of arid and semi-arid areas and consequently water scarcity are affected by climate change. This can influence on availability and quality of water while demands on food and water are increasing. As pressure on freshwater is increasing, utilization of saline water in a sustainable approach is inevitable. Therefore, bioremediation using salt tolerant plants that is consistent with sustainable development objectives might be an alternative and effective approach. In this study, saline wastewater from a local desalination treatment plant was utilized to irrigate four halophyte plants, including Aloevera, Tamarix aphylla, Rosmarinus officinalis and Matricaria chamomilla. A field experiment was designed and conducted in Zarrindasht, south of Iran in years 2012-2013 accordingly. Two irrigation treatments consisting of freshwater with salinity of 2.04 dS.m-1 and desalination wastewater with salinity of 5.77dSm-1 were applied. The experiment was designed as a split plot in the form of randomized complete block design (RCB with three replications. The results of variance analysis, ANOVA, on salt concentration in Aloevera showed that there was no significant difference between the effects of two irrigation water qualities except for Na. In Rosmarinus officinalis, only the ratio of K/Na showed a significant difference. None of the examined salt elements showed a significant difference in Tamarix aphylla irrigated with both water qualities. In Matricaria chamomilla, only Mg and K/Na ratio showed a significant difference (Duncan 5%. As a result, no significant difference was observed in salt absorption by the examined plants in treatments which were irrigated by desalination wastewater and freshwater. This could be a good result that encourages the use of similar wastewater to save freshwater in a sustainable system.
Kant, Surya; Bi, Yong-Mei; Weretilnyk, Elizabeth; Barak, Simon; Rothstein, Steven J
2008-07-01
A comprehensive knowledge of mechanisms regulating nitrogen (N) use efficiency is required to reduce excessive input of N fertilizers while maintaining acceptable crop yields under limited N supply. Studying plant species that are naturally adapted to low N conditions could facilitate the identification of novel regulatory genes conferring better N use efficiency. Here, we show that Thellungiella halophila, a halophytic relative of Arabidopsis (Arabidopsis thaliana), grows better than Arabidopsis under moderate (1 mm nitrate) and severe (0.4 mm nitrate) N-limiting conditions. Thellungiella exhibited a lower carbon to N ratio than Arabidopsis under N limitation, which was due to Thellungiella plants possessing higher N content, total amino acids, total soluble protein, and lower starch content compared with Arabidopsis. Furthermore, Thellungiella had higher amounts of several metabolites, such as soluble sugars and organic acids, under N-sufficient conditions (4 mm nitrate). Nitrate reductase activity and NR2 gene expression in Thellungiella displayed less of a reduction in response to N limitation than in Arabidopsis. Thellungiella shoot GS1 expression was more induced by low N than in Arabidopsis, while in roots, Thellungiella GS2 expression was maintained under N limitation but was decreased in Arabidopsis. Up-regulation of NRT2.1 and NRT3.1 expression was higher and repression of NRT1.1 was lower in Thellungiella roots under N-limiting conditions compared with Arabidopsis. Differential transporter gene expression was correlated with higher nitrate influx in Thellungiella at low (15)NO(3)(-) supply. Taken together, our results suggest that Thellungiella is tolerant to N-limited conditions and could act as a model system to unravel the mechanisms for low N tolerance.
Barkla, Bronwyn J; Garibay-Hernández, Adriana; Melzer, Michael; Rupasinghe, Thusitha W T; Roessner, Ute
2018-05-29
Salt stress causes dramatic changes in the organization and dynamic properties of membranes, however, little is known about the underlying mechanisms involved. Modified trichomes, known as epidermal bladder cells (EBC), on the leaves and stems of the halophyte Mesembryanthemum crystallinum can be successfully exploited as a single-cell-type system to investigate salt-induced changes to cellular lipid composition. In this study alterations in key molecular species from different lipid classes highlighted an increase in phospholipid species, particularly those from phosphatidylcholine (PC) and phosphatidic acid (PA), where the latter is central to the synthesis of membrane lipids. Triacylglycerol (TG) species decreased during salinity, while there was little change in plastidic galactolipids. EBC transcriptomic and proteomic data mining revealed changes in genes and proteins involved in lipid metabolism and the upregulation of transcripts for PIPKIB, PI5PII, PIPKIII, and PLDδ, suggested the induction of signalling processes mediated by phosphoinositides and PA. TEM and flow cytometry showed the dynamic nature of lipid droplets in these cells under salt stress. Altogether, this work indicates the metabolism of TG might play an important role in EBC response to salinity as either an energy reserve for sodium accumulation and/or driving membrane biosynthesis for EBC expansion. This article is protected by copyright. All rights reserved.
Radionuclides transfer into halophytes growing in tidal salt marshes from the Southwest of Spain
International Nuclear Information System (INIS)
Luque, Carlos J.; Vaca, Federico; García-Trapote, Ana; Hierro, Almudena; Bolívar, Juan P.; Castellanos, Eloy M.
2015-01-01
Estuaries are sinks of materials and substances which are released directly into them or transported from rivers that drain the basin. It is usual to find high organic matter loads and fine particles in the sediments. We analyzed radionuclide concentrations ("2"1"0Po, "2"3"0Th, "2"3"2Th, "2"3"4U, "2"3"8U, "2"2"6Ra, "2"2"8Th, "2"2"8Ra, "4"0K) in sediments and three different organs (roots, stems and leaves) of three species of halophytes plants (Spartina maritima, Spartina densiflora and Sarcocornia perennis). The study was carried out in two tidal salt marshes, one polluted by U-series radionuclides and another nearby that was unpolluted and was used as a control (or reference) area. The Tinto River salt marsh shows high levels of U-series radionuclides coming from mining and industrial discharges. On the contrary, the unperturbed Piedras River salt marsh is located about 25 km from the Tinto marsh, and shows little presence of contaminants and radionuclides. The results of this work have shown that natural radionuclide concentrations (specially the U-isotopes) in the Tinto salt marsh sediments are one order of magnitude higher than those in the Piedras marsh. These radionuclide enhancements are reflected in the different organs of the plants, which have similar concentration increases as the sediments where they have grown. Finally, the transfer factor (TF) of the most polluted radionuclides (U-isotopes and "2"1"0Po) in the Tinto area are one order of magnitude higher than in the Piedras area, indicating that the fraction of each radionuclide in the sediment originating from the pollution is more available for the plants than the indigenous fraction. This means that the plants of the salt marshes are unhelpful as bioindicators or for the phytoremediation of radionuclides. - Highlights: • Radionuclides were analyzed in sediments and plants in unpolluted salt marshes. • Plants uptake radionuclides in all organs in both salt marshes. • The transfer factors
Lifescience Database Archive (English)
Full Text Available Molecule: Ubiquitin Conjugating Enzyme; Chain: Null; Synonym: Ubc1; Engineered: Yes Ubiquitin Conjugation 6....TPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD arabi_2AAK.jpg ...
Lifescience Database Archive (English)
Full Text Available Synonym: 3-Ketoacyl-Acyl Carrier Protein Synthase, Mitochondrial Beta-Ketoacyl-Acyl Carrier Protein Synthase; Chai...VIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQPPEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAI...KTVFSEHATSGTLAFSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLTTSKKMLVRTAMSNSFGFGGTNASLLFASI arabi_1W0I.jpg ...
NEW ASPECTS OF THE ALPINE VEGETATION OF PARÂNG MOUNTAINS (SOUTH CARPATHIANS
Directory of Open Access Journals (Sweden)
SIMON TIBOR
2012-12-01
Full Text Available 4 plant communities unknown in the the European syntaxonomy are described from the alpine and subalpine belts of Parâng Mountains, based on vegetation studies of the authors during 1955–1960. These are: Arabis alpina-Saxifraga aizoides, Arabis alpina-Delphinium elatum, Dianthus tenuifolius-Festuca dalmatica and the Primula minima-Dryas octopetala communities. These communities could be described later as new associations in the possession of more relevés from different localities. The East and South Carpathian Doronico carpatici-Festucetum pictae association is distinguished under this new name from the Festucetum pictae Krajina described from the Tatra Mountains. 7 further associations are found as new to the Parâng Mountains.
Lifescience Database Archive (English)
Full Text Available Molecule: Sulfolipid Biosynthesis (Sqd1) Protein; Chain: A; Engineered: Yes Isomerase A.M.Mulichak, M.J.Thei...IASIHDRISRWKALTGKSIELYVGDICDFEFLAESFKSFEPDSVVHFGEQRSAPYSMIDRSRAVYTQHNNVIGTLNVLFAIKEFGEECHLVKLGTMGEYGTPNIDIEE...LNRFCVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKAGEFRVFNQFTEQFSVNELASLVTKAGSKLGLDVKKMTVPNPRVEAEEHYYNAKHTKLMELGLEPHYLSDSLLDSLLNFAVQFKDRVDTKQIMPSVSWKKIGVKTKSMTT arabi_1QRR.jpg ...
Directory of Open Access Journals (Sweden)
Jérémie Schiettecatte
2008-04-01
Full Text Available L’Arabie du Sud, au début de l’ère chrétienne, connaît des changements significatifs. Parmi ceux-ci, le développement du commerce maritime au détriment de l’ancienne voie caravanière. Ce changement est souvent décrit comme brusque et débouchant sur une situation pérenne durant les siècles suivants.Nous avons choisi de reprendre ce dossier en réunissant, dans un premier temps, l’ensemble des données épigraphiques et historiques relatives aux ports préislamiques de la mer Rouge et du golfe d’Aden depuis leur fondation jusqu’au viie siècle. Ces synthèses nous permettent de décrire, dans un second temps, l’évolution de l’économie maritime au cours des premiers siècles de l’ère chrétienne, la nature des espaces d’échanges et le rôle du pouvoir politique dans le contrôle de cette nouvelle économie.Ceci nous amène à conclure que le commerce maritime ne se développe pas aussi brusquement qu’il n’y paraît : la mise en place des réseaux et des ports majeurs s’étale sur plusieurs siècles. Ce commerce ne fut le moteur économique des royaumes sudarabiques qu’au cours d’une période limitée, du milieu du ier siècle au début du iiie siècle. Les ports connurent ensuite une activité irrégulière, conditionnée par l’évolution politique et économique des royaumes sudarabiques, des pays voisins et du bassin méditerranéen.By the dawn of the Christian era, Southern Arabia is undergoing major changes; among these, the expansion of maritime trade at the expense of the old caravan route. This change is often described as something sudden, leading to a more perennial situation the ensuing centuries.We have chosen to take a new look at this case by first gathering all the epigraphic and historic data having to do with pre-Islamic ports in the Red Sea and the Aden Gulf, from when they were first founded 'till the 7th century. This global outline then has then allowed us to describe the
Kazachkova, Yana; Batushansky, Albert; Cisneros, Aroldo; Tel-Zur, Noemi; Fait, Aaron; Barak, Simon
2013-07-01
Comparative studies of the stress-tolerant Arabidopsis (Arabidopsis thaliana) halophytic relative, Eutrema salsugineum, have proven a fruitful approach to understanding natural stress tolerance. Here, we performed comparative phenotyping of Arabidopsis and E. salsugineum vegetative development under control and salt-stress conditions, and then compared the metabolic responses of the two species on different growth platforms in a defined leaf developmental stage. Our results reveal both growth platform-dependent and -independent phenotypes and metabolic responses. Leaf emergence was affected in a similar way in both species grown in vitro but the effects observed in Arabidopsis occurred at higher salt concentrations in E. salsugineum. No differences in leaf emergence were observed on soil. A new effect of a salt-mediated reduction in E. salsugineum leaf area was unmasked. On soil, leaf area reduction in E. salsugineum was mainly due to a fall in cell number, whereas both cell number and cell size contributed to the decrease in Arabidopsis leaf area. Common growth platform-independent leaf metabolic signatures such as high raffinose and malate, and low fumarate contents that could reflect core stress tolerance mechanisms, as well as growth platform-dependent metabolic responses were identified. In particular, the in vitro growth platform led to repression of accumulation of many metabolites including sugars, sugar phosphates, and amino acids in E. salsugineum compared with the soil system where these same metabolites accumulated to higher levels in E. salsugineum than in Arabidopsis. The observation that E. salsugineum maintains salt tolerance despite growth platform-specific phenotypes and metabolic responses suggests a considerable degree of phenotypic and metabolic adaptive plasticity in this extremophile.
Kant, Surya; Bi, Yong-Mei; Weretilnyk, Elizabeth; Barak, Simon; Rothstein, Steven J.
2008-01-01
A comprehensive knowledge of mechanisms regulating nitrogen (N) use efficiency is required to reduce excessive input of N fertilizers while maintaining acceptable crop yields under limited N supply. Studying plant species that are naturally adapted to low N conditions could facilitate the identification of novel regulatory genes conferring better N use efficiency. Here, we show that Thellungiella halophila, a halophytic relative of Arabidopsis (Arabidopsis thaliana), grows better than Arabidopsis under moderate (1 mm nitrate) and severe (0.4 mm nitrate) N-limiting conditions. Thellungiella exhibited a lower carbon to N ratio than Arabidopsis under N limitation, which was due to Thellungiella plants possessing higher N content, total amino acids, total soluble protein, and lower starch content compared with Arabidopsis. Furthermore, Thellungiella had higher amounts of several metabolites, such as soluble sugars and organic acids, under N-sufficient conditions (4 mm nitrate). Nitrate reductase activity and NR2 gene expression in Thellungiella displayed less of a reduction in response to N limitation than in Arabidopsis. Thellungiella shoot GS1 expression was more induced by low N than in Arabidopsis, while in roots, Thellungiella GS2 expression was maintained under N limitation but was decreased in Arabidopsis. Up-regulation of NRT2.1 and NRT3.1 expression was higher and repression of NRT1.1 was lower in Thellungiella roots under N-limiting conditions compared with Arabidopsis. Differential transporter gene expression was correlated with higher nitrate influx in Thellungiella at low 15NO3− supply. Taken together, our results suggest that Thellungiella is tolerant to N-limited conditions and could act as a model system to unravel the mechanisms for low N tolerance. PMID:18467466
Directory of Open Access Journals (Sweden)
Amit Kumar Chaturvedi
Full Text Available Heavy metals are common pollutants of the coastal saline area and Salicornia brachiata an extreme halophyte is frequently exposed to various abiotic stresses including heavy metals. The SbMT-2 gene was cloned and transformed to tobacco for the functional validation. Transgenic tobacco lines (L2, L4, L6 and L13 showed significantly enhanced salt (NaCl, osmotic (PEG and metals (Zn++, Cu++ and Cd++ tolerance compared to WT plants. Transgenic lines did not show any morphological variation and had enhanced growth parameters viz. shoot length, root length, fresh weight and dry weight. High seed germination percentage, chlorophyll content, relative water content, electrolytic leakage and membrane stability index confirmed that transgenic lines performed better under salt (NaCl, osmotic (PEG and metals (Zn++, Cu++ and Cd++ stress conditions compared to WT plants. Proline, H2O2 and lipid peroxidation (MDA analyses suggested the role of SbMT-2 in cellular homeostasis and H2O2 detoxification. Furthermore in vivo localization of H2O2 and O2-; and elevated expression of key antioxidant enzyme encoding genes, SOD, POD and APX evident the possible role of SbMT-2 in ROS scavenging/detoxification mechanism. Transgenic lines showed accumulation of Cu++ and Cd++ in root while Zn++ in stem under stress condition. Under control (unstressed condition, Zn++ was accumulated more in root but accumulation of Zn++ in stem under stress condition suggested that SbMT-2 may involve in the selective translocation of Zn++ from root to stem. This observation was further supported by the up-regulation of zinc transporter encoding genes NtZIP1 and NtHMA-A under metal ion stress condition. The study suggested that SbMT-2 modulates ROS scavenging and is a potential candidate to be used for phytoremediation and imparting stress tolerance.
Chaturvedi, Amit Kumar; Patel, Manish Kumar; Mishra, Avinash; Tiwari, Vivekanand; Jha, Bhavanath
2014-01-01
Heavy metals are common pollutants of the coastal saline area and Salicornia brachiata an extreme halophyte is frequently exposed to various abiotic stresses including heavy metals. The SbMT-2 gene was cloned and transformed to tobacco for the functional validation. Transgenic tobacco lines (L2, L4, L6 and L13) showed significantly enhanced salt (NaCl), osmotic (PEG) and metals (Zn++, Cu++ and Cd++) tolerance compared to WT plants. Transgenic lines did not show any morphological variation and had enhanced growth parameters viz. shoot length, root length, fresh weight and dry weight. High seed germination percentage, chlorophyll content, relative water content, electrolytic leakage and membrane stability index confirmed that transgenic lines performed better under salt (NaCl), osmotic (PEG) and metals (Zn++, Cu++ and Cd++) stress conditions compared to WT plants. Proline, H2O2 and lipid peroxidation (MDA) analyses suggested the role of SbMT-2 in cellular homeostasis and H2O2 detoxification. Furthermore in vivo localization of H2O2 and O2-; and elevated expression of key antioxidant enzyme encoding genes, SOD, POD and APX evident the possible role of SbMT-2 in ROS scavenging/detoxification mechanism. Transgenic lines showed accumulation of Cu++ and Cd++ in root while Zn++ in stem under stress condition. Under control (unstressed) condition, Zn++ was accumulated more in root but accumulation of Zn++ in stem under stress condition suggested that SbMT-2 may involve in the selective translocation of Zn++ from root to stem. This observation was further supported by the up-regulation of zinc transporter encoding genes NtZIP1 and NtHMA-A under metal ion stress condition. The study suggested that SbMT-2 modulates ROS scavenging and is a potential candidate to be used for phytoremediation and imparting stress tolerance.
Gerberto, gli Arabi e Gerusalemme
Sigismondi, C.
Gerbert of Aurillac went in Catalonia from 967 to 970, to visit the bishop Atton of Vic, famous for mathematical knowledge, during the apogee of Cordova's reign of the Caliph Al-Hakam II ibn Abd al-Rahman (961-976). He maintained contacts with local personalities like Mirò Bonfill (Bishop of Girona) and Lupitus of Barcelona through letters (both dated 984). When he was pope, Gerbert sent five papal privileges to Catalan dignitaries, showing his attention to this territory. The Caliph's prime minister Al-Mansu'r depredated Barcelona in 985, and conquered Santiago de Compostela in 997, drawing to an end the cultural exchanges between Christian and Arabic world through Mozarabic and Jewish translators. Gerbert learned and after taught and used Indo-Arabic numbers, abaci, astrolabes, monochords and theoretical music. It was possible for pilgrims to reach Jerusalem at Gerbert's times, and a letter written by Gerbert probably for an abbot starting his pilgrimage seems to introduce the first ideas of crusade and indulgences related to offers. The change of attitude of the Al-Andalus' government toward Christianity is probably responsible of these words written in a time very close to the depredations of Barcelona. Jerusalem is also in the index of geographic places in the book of the astrolabe, attributed to Gerbert, as well as Santiago de Compostela. Finally the legend of the Golem and the mass celebrated in the church of Jerusalem in Rome, completes the panorama of Gerbert and the Holy City.
Lifescience Database Archive (English)
Full Text Available tic Subunit Name=Irx3; Synonyms=T10b6_80; Arabidopsis Thaliana Molecule: Cellulose Synthase, Catalytic Subunit (Irx3); Chai...GDKEHLMSEMNFEKTFGQSSIFVTSTLMEEGGVPPSSSPAVLLKEAIHVISCGYEDKTEWGTELGWIYGSITEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSD...RLNQVLRWALGSVEIFFSRHSPLWYGYKGGKLKWLERFAYANTTIYPFTSIPLLAYCILPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWW...RNEQFWVIGGISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVGVVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTSKCGINC arabi_1WEO.jpg ...
Iwaoka, Chikae; Imada, Shogo; Taniguchi, Takeshi; Du, Sheng; Yamanaka, Norikazu; Tateno, Ryunosuke
2018-05-01
Nitrogen (N) is one of the most common limiting nutrients for primary production in terrestrial ecosystems. Soil microbes transform organic N into inorganic N, which is available to plants, but soil microbe activity in drylands is sometimes critically suppressed by environmental factors, such as low soil substrate availability or high salinity. Tamarisk (Tamarix spp.) is a halophytic shrub species that is widely distributed in the drylands of China; it produces litter enriched in nutrients and salts that are thought to increase soil fertility and salinity under its crown. To elucidate the effects of tamarisks on the soil microbial community, and thus N dynamics, by creating "islands of fertility" and "islands of salinity," we collected soil samples from under tamarisk crowns and adjacent barren areas at three habitats in the summer and fall. We analyzed soil physicochemical properties, inorganic N dynamics, and prokaryotic community abundance and composition. In soils sampled beneath tamarisks, the N mineralization rate was significantly higher, and the prokaryotic community structure was significantly different, from soils sampled in barren areas, irrespective of site and season. Tamarisks provided suitable nutrient conditions for one of the important decomposers in the area, Verrucomicrobia, by creating "islands of fertility," but provided unsuitable salinity conditions for other important decomposers, Flavobacteria, Gammaproteobacteria, and Deltaproteobacteria, by mitigating salt accumulation. However, the quantity of these decomposers tended to be higher beneath tamarisks, because they were relatively unaffected by the small salinity gradient created by the tamarisks, which may explain the higher N mineralization rate beneath tamarisks.
Centofanti, Tiziana; Bañuelos, Gary
2015-07-01
Urbanization, industrial development, and intensive agriculture have caused soil contamination and land degradation in many areas of the world. Salinization is one important factor contributing to land degradation and it affects agricultural production and environmental quality. When salinization is combined with soil pollution by trace elements, as it occurs in many arid and semi-arid regions around the world, strategies to phyto-manage pollutants and sustain crop production need to be implemented. In this study, we present the case of saline soils in the West side of Central California which contain naturally-occurring selenium (Se), boron (B), and other salts, such as NaCl, CaCl2, Na2SO4, and Na2SeO4. To sustain crop production on Se- and B-laden arid saline soils, we investigated the potential of the halophyte "agretti" (Salsola soda L.) as an alternative crop. The aim of our greenhouse study was to examine adaptability, B tolerance, and Se accumulation by S. soda grown on soils collected from a typical saline-laden field site located on the West side of the San Joaquin Valley (SJV). Our results showed that S. soda tolerates the saline (EC ∼ 10 dS m(-1)) and B-laden soils (10 mg B L(-1)) of the SJV even with the additional irrigation of saline and B rich water (EC ∼ 3 dS m(-1) and 4 mg B L(-1)). Under these growing conditions, the plant can accumulate high concentrations of Na (80 g Na kg(-1) DW), B (100 mg B kg(-1) DW), and Se (3-4 mg Se kg(-1) DW) without showing toxicity symptoms. Hence, S. soda showed promising potential as a plant species that can be grown in B-laden saline soils and accumulate and potentially manage excessive soluble Se and B in soil. Copyright © 2015 Elsevier Ltd. All rights reserved.
تكوين النادي العربي لتنمية مهارة القراءة بالمدرسة الثانوية الإسلامية الحكومية غنوءواتو بجومبانج
Directory of Open Access Journals (Sweden)
إقناع السلا
2015-11-01
The results of this research can be concluded that: (1 Design of Learning Strategy of An-Nadi Al-Arabi to increase reading skill consists of : understanding of the product, elements of the product, basis of the product, purposes of reading skill, purposes of teaching by using the product, matters of the product, application of the product, making steps of learning strategy, arrangement of places or positions, and assessment, (2 The number of average value of pre-test in the teaching of reading skill is 73,106, and The number of average value of post-test in the teaching of reading skill is 82,273, (3 The application of learning Strategy of An-Nadi Al-Arabi to increase reading skill is effective because the value of t : 14,10446.
Antimicrobial activity of some actinomycetes from Western Ghats of ...
African Journals Online (AJOL)
Pathalam Ganesan
2016-04-04
Apr 4, 2016 ... xylose, inositol, sorbitol, rhamnose, sucrose, lactose, arabi- nose, adonitol and .... surface of the medium and left for 30 min at room temperature for diffusion. The .... histopathological changes in long time treatment. Similarly,.
Directory of Open Access Journals (Sweden)
Xin-Hua Sun
2014-08-01
Full Text Available Many heavy metals are essential for metabolic processes, but are toxic at elevated levels. Metal tolerance proteins provide resistance to this toxicity. In this study, we identified and characterized a heavy metal-associated protein, AcHMA1, from the halophyte, Atriplex canescens. Sequence analysis has revealed that AcHMA1 contains two heavy metal binding domains. Treatments with metals (Fe, Cu, Ni, Cd or Pb, PEG6000 and NaHCO3 highly induced AcHMA1 expression in A. canescens, whereas NaCl and low temperature decreased its expression. The role of AcHMA1 in metal stress tolerance was examined using a yeast expression system. Expression of the AcHMA1 gene significantly increased the ability of yeast cells to adapt to and recover from exposure to excess iron. AcHMA1 expression also provided salt, alkaline, osmotic and oxidant stress tolerance in yeast cells. Finally, subcellular localization of an AcHMA1/GFP fusion protein expressed in tobacco cells showed that AcHMA1 was localized in the plasma membrane. Thus, our results suggest that AcHMA1 encodes a membrane-localized metal tolerance protein that mediates the detoxification of iron in eukaryotes. Furthermore, AcHMA1 also participates in the response to abiotic stress.
Directory of Open Access Journals (Sweden)
ASISH KUMAR PARIDA
2016-03-01
Full Text Available Salt tolerance mechanism of an extreme halophyte Salvadora persica was assessed by analysing growth, nutrient uptake, anatomical modifications and alterations in levels of some organic metabolites in seedlings imposed to various levels of salinity (0, 250, 500 and 750 mM NaCl under hydroponic culture condition. After 21 days of salt treatment, plant height, leaf area and shoot biomass decreased with increase in salinity whereas the leaf succulence increased significantly with increasing salinity in S. persica. The RWC% of leaf increased progressively in salt-treated seedlings as compared to control. Na+ contents of leaf, stem and root increased in dose-dependent manner whereas there was no significant changes in K+ content. There was significant alterations in leaf, stem and root anatomy by salinity. The thickness of epidermis and spongy parenchyma of leaf increased in salt treated seedlings as compared to control, whereas palisade parenchyma decreased dramatically in extreme salinity (750 mM NaCl. There was a significant reduction in stomatal density and stomatal pore area of leaf with increasing salinity. Anatomical observations of stem showed that the epidermal cells diameter and thickness of cortex decreased by salinity whereas thickness of hypodermal layer, hypodermal cell diameter, pith area and pith cell diameter increased by high salinity. The root anatomy showed an increase in epidermal thickness by salinity whereas diameters of epidermal cells and xylem vessels decreased. Total soluble sugar content remained unchanged at all levels of salinity whereas reducing sugar content increased by 2-fold at high salinity (750 mM NaCl. The starch content of leaf decreased progressively in NaCl treated seedlings as compared to control. Total free amino acid content did not change at low salinity (250 mM, whereas it increased significantly at higher salinity (500 and 750 mM NaCl. The proline content increased in the NaCl treated seedlings as
Cao, Dechang; Baskin, Carol C.; Baskin, Jerry M.; Yang, Fan; Huang, Zhenying
2012-01-01
Background and Aims Differences in dormancy and germination requirements have been documented in heteromorphic seeds of many species, but it is unknown how this difference contributes to maintenance and regeneration of populations. The primary aim of this study was to compare the seed bank dynamics, including dormancy cycling, of the two seed morphs (black and brown) of the cold desert halophyte Suaeda corniculata and, if differences were found, to determine their influence on regeneration of the species. Method Seeds of the two seed morphs were buried, exhumed and tested monthly for 24 months over a range of temperatures and salinities, and germination recovery and viability were determined after exposure to salinity and water stress. Seedling emergence and dynamics of the soil seed bank were also investigated for the two morphs. Key Results Black seeds had an annual dormancy/non-dormancy cycle, while brown seeds, which were non-dormant at maturity, remained non-dormant. Black seeds also exhibited an annual cycle in sensitivity of germination to salinity. Seedlings derived from black seeds emerged in July and August and those from brown seeds in May. Seedlings were recruited from 2·6 % of the black seeds and from 2·8 % of the brown seeds in the soil, and only 0·5 % and 0·4 % of the total number of black and brown seeds in the soil, respectively, gave rise to seedlings that survived to produce seeds. Salinity and water stress induced dormancy in black seeds and decreased viability of brown seeds. Brown seeds formed only a transient soil seed bank and black seeds a persistent seed bank. Conclusions The presence of a dormancy cycle in black but not in brown seeds of S. corniculata and differences in germination requirements of the two morphs cause them to differ in their germination dynamics. The study contributes to our limited knowledge of dormancy cycling and seed bank formation in species producing heteromorphic seeds. PMID:22975287
Effects of Salt Stress on Three Ecologically Distinct Plantago Species.
Al Hassan, Mohamad; Pacurar, Andrea; López-Gresa, María P; Donat-Torres, María P; Llinares, Josep V; Boscaiu, Monica; Vicente, Oscar
2016-01-01
Comparative studies on the responses to salt stress of taxonomically related taxa should help to elucidate relevant mechanisms of stress tolerance in plants. We have applied this strategy to three Plantago species adapted to different natural habitats, P. crassifolia and P. coronopus-both halophytes-and P. major, considered as salt-sensitive since it is never found in natural saline habitats. Growth inhibition measurements in controlled salt treatments indicated, however, that P. major is quite resistant to salt stress, although less than its halophytic congeners. The contents of monovalent ions and specific osmolytes were determined in plant leaves after four-week salt treatments. Salt-treated plants of the three taxa accumulated Na+ and Cl- in response to increasing external NaCl concentrations, to a lesser extent in P. major than in the halophytes; the latter species also showed higher ion contents in the non-stressed plants. In the halophytes, K+ concentration decreased at moderate salinity levels, to increase again under high salt conditions, whereas in P. major K+ contents were reduced only above 400 mM NaCl. Sorbitol contents augmented in all plants, roughly in parallel with increasing salinity, but the relative increments and the absolute values reached did not differ much in the three taxa. On the contrary, a strong (relative) accumulation of proline in response to high salt concentrations (600-800 mM NaCl) was observed in the halophytes, but not in P. major. These results indicate that the responses to salt stress triggered specifically in the halophytes, and therefore the most relevant for tolerance in the genus Plantago are: a higher efficiency in the transport of toxic ions to the leaves, the capacity to use inorganic ions as osmotica, even under low salinity conditions, and the activation, in response to very high salt concentrations, of proline accumulation and K+ transport to the leaves of the plants.
Xie, Tian; Cui, Baoshan; Bai, Junhong; Li, Shanze; Zhang, Shuyan
2018-02-01
Determining how human disturbance affects plant community persistence and species conservation is one of the most pressing ecological challenges. The large-scale disturbance form defense structures usually have a long-term and potential effect on phytocommunity in coastal saltmarshes. Coastal defense structures usually remove the effect of tidal wave on tidal salt marshes. As a consequence, edaphic factors such as the salinity and moisture contents are disturbed by tidal action blocking. However, few previous studies have explicitly addressed the response of halophyte species persistence and dynamics to the changing edaphic conditions. The understanding of the response of species composition in seed banks and aboveground vegetation to the stress is important to identify ecological effect of coastal defense structures and provide usefully insight into restoration. Here, we conducted a field study to distinguish the density, species composition and relationships of seed bank with aboveground vegetation between tidal flat wetlands with and without coastal defense structures. We also addressed the role of edaphic condition in vegetation degradation caused by coastal defense structures in combination with field monitor and greenhouse experiments. Our results showed the density of the seed bank and aboveground vegetation in the tidal flat without coastal defense structures was significantly lower than the surrounded flat with coastal defense structures. A total of 14 species were founded in the surrounded flat seed bank and 11 species in the tidal flat, but three species were only recorded in aboveground vegetation of the tidal flat which was much lower than 24 aboveground species in the surrounded flat. The absent of species in aboveground vegetation contributed to low germination rate which depend on the edaphic condition. The germination of seeds in the seed bank were inhabited by high soil salinity in the tidal flat and low soil moisture in the surrounded flat. Our
Wali, Mariem; Gunsè, Benet; Llugany, Mercè; Corrales, Isabel; Abdelly, Chedly; Poschenrieder, Charlotte; Ghnaya, Tahar
2016-08-01
NaCl alleviates Cd toxicity in Sesvium portulacastrum by maintaining plant water status and redox balance, protecting chloroplasts structure and inducing some potential Cd (2+) chelators as GSH and proline. It has been demonstrated that NaCl alleviates Cd-induced growth inhibition in the halophyte Sesuvium portulacastrum. However, the processes that mediate this effect are still unclear. In this work we combined physiological, biochemical and ultrastructural studies to highlight the effects of salt on the redox balance and photosynthesis in Cd-stressed plants. Seedlings were exposed to different Cd concentrations (0, 25 and 50 µM Cd) combined with low (0.09 mM) (LS), or high (200 mM) NaCl (HS) in hydroponic culture. Plant-water relations, photosynthesis rate, leaf gas exchange, chlorophyll fluorescence, chloroplast ultrastructure, and proline and glutathione concentrations were analyzed after 1 month of treatment. In addition, the endogenous levels of stress-related hormones were determined in plants subjected to 25 µM Cd combined with both NaCl concentrations. In plants with low salt supply (LS), Cd reduced growth, induced plant dehydration, disrupted chloroplast structure and functioning, decreased net CO2 assimilation rate (A) and transpiration rate (E), inhibited the maximum potential quantum efficiency (Fv/Fm) and the quantum yield efficiency (Φ PSII) of PSII, and enhanced the non-photochemical quenching (NPQ). The addition of 200 mM NaCl (HS) to the Cd-containing medium culture significantly mitigated Cd phytotoxicity. Hence, even at similar internal Cd concentrations, HS-Cd plants were less affected by Cd than LS-Cd ones. Hence, 200 mM NaCl significantly alleviates Cd-induced toxicity symptoms, growth inhibition, and photosynthesis disturbances. The cell ultrastructure was better preserved in HS-Cd plants but affected in LS-Cd plants. The HS-Cd plants showed also higher concentrations of reduced glutathione (GSH), proline and jasmonic acid (JA
Derkx, M.P.M.; Brouwer, J.H.D.; Breda, van P.J.M.; Helsen, H.H.M.; Hoffman, M.H.A.; Hop, M.E.C.M.
2014-01-01
The European Commission is currently seeking advice from EFSA (Mandate M-2012-0272) to assess for Arabis mosaic virus, Raspberry ringspot virus, Strawberry latent ringspot virus, Tomato black ring virus, Strawberry mild yellow edge virus, Strawberry crinkle virus, Daktulosphaira vitifoliae,
Rare Plants from the Angmagssalik District, Southeast Greenland
Daniëls, F.J.A.; Molenaar, de J.G.
1970-01-01
Selaginella selaginoides, Arabis arenicola, and Gentiana amarella are recorded as species new to the Angmagssalik district. Other species, formerly only known from single localities, are reported from new localities. Descriptions are given of the habitats in which the species were found.
Jaht Saddamile / Abdel Bari Atwan ; interv. Christopher Dickey, tõlk. Vahur Kuusk, tõlk. Silva Jõulu
Atwan, Abdel Bari
2002-01-01
Väljavõtteid intervjuust Londonis ilmuva ajalehe Al Quds al-Arabi toimetajaga, kes vastab küsimustele Saddam Husseini, tema väljavahetamise, USA võimaliku Iraagi ründamise ja selle tagajärgede ning Osama bin Ladeni kohta
Derkx, M.P.M.; Brouwer, J.H.D.; Breda, van P.J.M.; Heijerman-Peppelman, G.; Heijne, B.; Hop, M.E.C.M.; Wubben, C.F.M.
2014-01-01
The European Commission is currently seeking advice from EFSA (Mandate M-2012-0272) to assess for Arabis mosaic virus, Raspberry ringspot virus, Strawberry latent ringspot virus, Tomato black ring virus, Strawberry mild yellow edge virus, Strawberry crinkle virus, Daktulosphaira vitifoliae,
Plant virus sensitivity to gamma irradiation
International Nuclear Information System (INIS)
Gyoergyne Czeck, B.
1979-01-01
Preliminary experiments for prevention were conducted with weakened plant viruses, namely with Arabis mosaic virus isolated from strawberries and tobacco mosaic virus. Treatment 24 hours prior to the infection with the radiation-weakened virus resulted in a 60-70% infection prevention. (author)
Chronologie de l’Arabie Saoudite 2004
Directory of Open Access Journals (Sweden)
Pascal Ménoret
2004-09-01
Full Text Available Politique et société Janvier-Février 1er janvier : Au lendemain de la clôture de la deuxième session du Centre du dialogue national à La Mecque, consacrée à la réforme des programmes scolaires, les jeunes Saoudiens ironisent sur un « dialogue national » (hiwâr watanî qui n’est pour eux qu’un « meuglement national » (khiwâr watanî. La principale contribution présentée à La Mecque fut celle de l’activiste ‘Abd al-‘Azîz al-Qâsim, « Les programmes scolaires religieux : où est le défaut ? » 3 j...
Chronologie de l’Arabie Saoudite 2004
Ménoret, Pascal
2007-01-01
Politique et société Janvier-Février 1er janvier : Au lendemain de la clôture de la deuxième session du Centre du dialogue national à La Mecque, consacrée à la réforme des programmes scolaires, les jeunes Saoudiens ironisent sur un « dialogue national » (hiwâr watanî) qui n’est pour eux qu’un « meuglement national » (khiwâr watanî). La principale contribution présentée à La Mecque fut celle de l’activiste ‘Abd al-‘Azîz al-Qâsim, « Les programmes scolaires religieux : où est le défaut ? » 3 j...
Barkla, Bronwyn J; Vera-Estrella, Rosario; Raymond, Carolyn
2016-05-10
Epidermal bladder cells (EBC) are large single-celled, specialized, and modified trichomes found on the aerial parts of the halophyte Mesembryanthemum crystallinum. Recent development of a simple but high throughput technique to extract the contents from these cells has provided an opportunity to conduct detailed single-cell-type analyses of their molecular characteristics at high resolution to gain insight into the role of these cells in the salt tolerance of the plant. In this study, we carry out large-scale complementary quantitative proteomic studies using both a label (DIGE) and label-free (GeLC-MS) approach to identify salt-responsive proteins in the EBC extract. Additionally we perform an ionomics analysis (ICP-MS) to follow changes in the amounts of 27 different elements. Using these methods, we were able to identify 54 proteins and nine elements that showed statistically significant changes in the EBC from salt-treated plants. GO enrichment analysis identified a large number of transport proteins but also proteins involved in photosynthesis, primary metabolism and Crassulacean acid metabolism (CAM). Validation of results by western blot, confocal microscopy and enzyme analysis helped to strengthen findings and further our understanding into the role of these specialized cells. As expected EBC accumulated large quantities of sodium, however, the most abundant element was chloride suggesting the sequestration of this ion into the EBC vacuole is just as important for salt tolerance. This single-cell type omics approach shows that epidermal bladder cells of M. crystallinum are metabolically active modified trichomes, with primary metabolism supporting cell growth, ion accumulation, compatible solute synthesis and CAM. Data are available via ProteomeXchange with identifier PXD004045.
De dubbele paradox van de Iraanse energiesector
Schippers, J.L.; Geuns, van L.
2010-01-01
In Iran bestaat wat betreft de energievoorziening een paradoxale situatie. Het land is, na Saoedi-Arabië, de tweede olieproducent van de OPEC-landen en de vierde grootste olie-exporteur ter wereld. Iran heeft verder, na Rusland, de grootse aardgasreserve. Onder meer door te weinig
Some Lexical Aspects of Cape Muslim Afrikaans
African Journals Online (AJOL)
It looks at the role of the literary tradition of Arabic-. Afrikaans and the Islamic .... That these words continued to be used in Cape Muslim Afrikaans, in both sec- ular and religiOUS ...... In tenns of the Arabie dictionary. (Hans Wehr 1980: 68), ...
Photoinduced current and emission induced by current in a ...
Indian Academy of Sciences (India)
... Refresher Courses · Symposia · Live Streaming. Home; Journals; Pramana – Journal of Physics; Volume 86; Issue 3. Photoinduced current and emission induced by current in a nanowire transistor: Temperature dependence. Darehdor Mahvash Arabi Shahtahmassebi Nasser. Regular Volume 86 Issue 3 March 2016 pp ...
Beta-D-xylosidase/alpha-L-arabinofuranosidase from Selenomonas ruminantium (SXA) is the most active enzyme known for catalyzing hydrolysis of 1,4-beta-D-xylooligosaccharides to D-xylose. Temperature dependence for hydrolysis of 4-nitrophenyl-beta-D-xylopyranoside (4NPX), 4-nitrophenyl-alpha-L-arabi...
Directory of Open Access Journals (Sweden)
Mohamad Al Hassan
2017-08-01
Full Text Available We have performed an extensive study on the responses to salt stress in four related Limonium halophytes with different geographic distribution patterns, during seed germination and early vegetative growth. The aims of the work were twofold: to establish the basis for the different chorology of these species, and to identify relevant mechanisms of salt tolerance dependent on the control of ion transport and osmolyte accumulation. Seeds were germinated in vitro, in the presence of increasing NaCl concentrations, and subjected to “recovery of germination” tests; germination percentages and velocity were determined to establish the relative tolerance and competitiveness of the four Limonium taxa. Salt treatments were also applied to young plants, by 1-month irrigation with NaCl up to 800 mM; then, growth parameters, levels of monovalent and divalent ions (in roots and leaves, and leaf contents of photosynthetic pigments and common osmolytes were determined in control and stressed plants of the four species. Seed germination is the most salt-sensitive developmental phase in Limonium. The different germination behavior of the investigated species appears to be responsible for their geographical range size: L. narbonense and L. virgatum, widespread throughout the Mediterranean, are the most tolerant and the most competitive at higher soil salinities; the endemic L. santapolense and L. girardianum are the most sensitive and more competitive only at lower salinities. During early vegetative growth, all taxa showed a strong tolerance to salt stress, although slightly higher in L. virgatum and L. santapolense. Salt tolerance is based on the efficient transport of Na+ and Cl− to the leaves and on the accumulation of fructose and proline for osmotic adjustment. Despite some species-specific quantitative differences, the accumulation patterns of the different ions were similar in all species, not explaining differences in tolerance, except for the
76 FR 33337 - Endangered Species Recovery Permit Applications
2011-06-08
...: Lasthenia conjugens (Contra Costa goldfields), Arabis mcdonaldiana (McDonald's rock-cress), Calystegia... of receipt of permit applications; request for comment. SUMMARY: We, the U.S. Fish and Wildlife... received on or before July 8, 2011. ADDRESSES: Written data or comments should be submitted to the U.S...
76 FR 39888 - Endangered Species Recovery Permit Applications
2011-07-07
... (Sonoma alopecurus); Amsinckia grandiflora (large-flowered fiddleneck); Arabis mcdonaldiana (McDonald's... of receipt of permit applications; request for comment. SUMMARY: We, the U.S. Fish and Wildlife... received on or before August 8, 2011. ADDRESSES: Written data or comments should be submitted to the U.S...
La science de l’amour dans les poèmes et dans les contes soufis
Directory of Open Access Journals (Sweden)
Dr Natália Maria Lopes Nunes
2011-09-01
Full Text Available Cet article est le résultat introductoire du travail de recherche sur l’amour divin à partir de deux grands maîtres soufis, Ibn Arabi et Djalal ad Din Rumi, qui ont développé dans leurs poèmes et contes ce qu’on peut appeler la Science de l’Amour. Rumi, considéré comme l'un des maîtres de la "Science de l'Amour", l’a répandue à travers des poèmes mystiques et de la danse des derviches. Ibn Arabi, connu comme le "maître maximum" du Soufisme a saisi la sagesse sur l'amour dans le Traité d’Amour. Les deux amoureux de Dieu, ont exprimé leur sagesse sur l'Amour et la Beauté du Bien-Aimé, l’extase de l'âme dans l'union entre l'homme et Dieu.
El Arabi, El Hassane; Diez, José Bienvenido; Broutin, Jean; Essamoud, Rachid
2006-07-01
The Middle Anisian has been palynologically characterized for the first time, at the whole Moroccan scale, in the High Atlas of Marrakech. The stratigraphic, tectonic and paleogeographic implications of this discovery are analysed. To cite this article: E.H. El Arabi et al., C. R. Geoscience 338 (2006).
Using microsatellite markers to analyze genetic diversity in 14 sheep types in Iran
Directory of Open Access Journals (Sweden)
M. T. Vajed Ebrahimi
2017-07-01
Full Text Available Investigation of genetic relationship among populations has been traditionally based on the analysis of allele frequencies at different loci. The prime objective of this research was to measure the genetic polymorphism of five microsatellite markers (McMA2, BM6444, McMA26, HSC, and OarHH35 and study genetic diversity of 14 sheep types in Iran. Genomic DNA was extracted from blood samples of 565 individuals using an optimized salting-out DNA extraction procedure. The polymerase chain reaction (PCR was successfully performed with the specific primers. Some locus–population combinations were not at Hardy–Weinberg equilibrium (P < 0. 05. The microsatellite analysis revealed high allelic and gene diversity in all 14 breeds. Pakistani and Arabi breeds showed the highest mean number of alleles (11.8 and 11 respectively, while the highest value for polymorphic information content was observed for the Arabi breed (0.88. A UPGMA (unweighted pair group method with arithmetic mean dendrogram based on the Nei's standard genetic distance among studied breeds showed a separate cluster for Arabi and Pakistani breeds and another cluster for other breeds. The Shannon index (H0 for McMA2, BM6444, McMA26, HSC, and OarHH35 was 2.31, 2.17, 2.27, 2.04 and 2.18, respectively, and polymorphic information content (PIC values were 0.88, 0.92, 0.87, 0.84, and 0.86 for McMA2, BM6444, McMA26, HSC, and OarHH35, respectively. The high degree of variability demonstrated within the studied sheep types implies that these populations are rich reservoirs of genetic diversity that must be preserved.
Naval Blockade and the Humanitarian Crisis in Yemen
Fink, M.D.
A Saudi Arabia-led coalition is supporting the Yemeni Government with military means against the Houthis in Yemen. Part of those military operations are naval operations off the coast of Yemen that aim to stop the influx of weapons meant for the Houthis. It is viewed that these naval enforcement
The pattern of paediatric burn injuries in Southwestern, Saudi Arabia ...
African Journals Online (AJOL)
Objectif: Identifier la tendance et aspects démographiques des blessures à travers ... Central d'Aseer, Abha, royaume d'Arabie saudite et d'analyser la morbidité et ... la flamme, 5% était causé par défaut dans le système électrique tandis que 1 ...
Role of Plants in a Constructed Wetland: Current and New Perspectives
Directory of Open Access Journals (Sweden)
Amit Gross
2013-04-01
Full Text Available The role of plants in the treatment of effluents by constructed wetland (CW systems is under debate. Here, we review ways in which plants can affect CW processes and suggest two novel functions for plants in CWs. The first is salt phytoremediation by halophytes. We have strong evidence that halophytic plants can reduce wastewater salinity by accumulating salts in their tissues. Our studies have shown that Bassia indica, a halophytic annual, is capable of salt phytoremediation, accumulating sodium to up to 10% of its dry weight. The second novel use of plants in CWs is as phytoindicators of water quality. We demonstrate that accumulation of H2O2, a marker for plant stress, is reduced in the in successive treatment stages, where water quality is improved. It is recommended that monitoring and management of CWs consider the potential of plants as phytoremediators and phytoindicators.
ORF Alignment: NC_003071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A
Yadav, Narendra Singh; Shukla, Pushp Sheel; Jha, Anupama; Agarwal, Pradeep K; Jha, Bhavanath
2012-10-11
Soil salinity adversely affects plant growth and development and disturbs intracellular ion homeostasis resulting cellular toxicity. The Salt Overly Sensitive 1 (SOS1) gene encodes a plasma membrane Na(+)/H(+) antiporter that plays an important role in imparting salt stress tolerance to plants. Here, we report the cloning and characterisation of the SbSOS1 gene from Salicornia brachiata, an extreme halophyte. The SbSOS1 gene is 3774 bp long and encodes a protein of 1159 amino acids. SbSOS1 exhibited a greater level of constitutive expression in roots than in shoots and was further increased by salt stress. Overexpressing the S. brachiata SbSOS1 gene in tobacco conferred high salt tolerance, promoted seed germination and increased root length, shoot length, leaf area, fresh weight, dry weight, relative water content (RWC), chlorophyll, K(+)/Na(+) ratio, membrane stability index, soluble sugar, proline and amino acid content relative to wild type (WT) plants. Transgenic plants exhibited reductions in electrolyte leakage, reactive oxygen species (ROS) and MDA content in response to salt stress, which probably occurred because of reduced cytosolic Na(+) content and oxidative damage. At higher salt stress, transgenic tobacco plants exhibited reduced Na(+) content in root and leaf and higher concentrations in stem and xylem sap relative to WT, which suggests a role of SbSOS1 in Na(+) loading to xylem from root and leaf tissues. Transgenic lines also showed increased K(+) and Ca(2+) content in root tissue compared to WT, which reflect that SbSOS1 indirectly affects the other transporters activity. Overexpression of SbSOS1 in tobacco conferred a high degree of salt tolerance, enhanced plant growth and altered physiological and biochemical parameters in response to salt stress. In addition to Na(+) efflux outside the plasma membrane, SbSOS1 also helps to maintain variable Na(+) content in different organs and also affect the other transporters activity indirectly. These
Singh, Dinkar; Yadav, Narendra Singh; Tiwari, Vivekanand; Agarwal, Pradeep K; Jha, Bhavanath
2016-01-01
About 1000 salt-responsive ESTs were identified from an extreme halophyte Salicornia brachiata. Among these, a novel salt-inducible gene SbSLSP (Salicornia brachiata SNARE-like superfamily protein), showed up-regulation upon salinity and dehydration stress. The presence of cis-regulatory motifs related to abiotic stress in the putative promoter region supports our finding that SbSLSP gene is inducible by abiotic stress. The SbSLSP protein showed a high sequence identity to hypothetical/uncharacterized proteins from Beta vulgaris, Spinacia oleracea, Eucalyptus grandis, and Prunus persica and with SNARE-like superfamily proteins from Zostera marina and Arabidopsis thaliana. Bioinformatics analysis predicted a clathrin adaptor complex small-chain domain and N-myristoylation site in the SbSLSP protein. Subcellular localization studies indicated that the SbSLSP protein is mainly localized in the plasma membrane. Using transgenic tobacco lines, we establish that overexpression of SbSLSP resulted in elevated tolerance to salt and drought stress. The improved tolerance was confirmed by alterations in a range of physiological parameters, including high germination and survival rate, higher leaf chlorophyll contents, and reduced accumulation of Na(+) ion and reactive oxygen species (ROS). Furthermore, overexpressing lines also showed lower water loss, higher cell membrane stability, and increased accumulation of proline and ROS-scavenging enzymes. Overexpression of SbSLSP also enhanced the transcript levels of ROS-scavenging and signaling enzyme genes. This study is the first investigation of the function of the SbSLSP gene as a novel determinant of salinity/drought tolerance. The results suggest that SbSLSP could be a potential candidate to increase salinity and drought tolerance in crop plants for sustainable agriculture in semi-arid saline soil.
Directory of Open Access Journals (Sweden)
Dinkar eSingh
2016-06-01
Full Text Available About 1000 salt-responsive ESTs were identified from an extreme halophyte Salicornia brachiata. Among these, a novel salt-inducible gene SbSLSP, (Salicornia brachiata SNARE-like superfamily protein showed up-regulation upon salinity and dehydration stress. The presence of cis-regulatory motifs related to abiotic stress in the putative promoter region supports our finding that SbSLSP gene is inducible by abiotic stress. The SbSLSP protein showed a high sequence identity to hypothetical/uncharacterised proteins from Beta vulgaris, Spinacia oleracea, Eucalyptus grandis and Prunus persica and with SNARE-like superfamily proteins from Zostera marina and Arabidopsis thaliana. Bioinformatics analysis predicted a clathrin adaptor complex small-chain domain and N-myristoylation site in the SbSLSP protein. Subcellular localisation studies indicated that the SbSLSP protein is mainly localised in the plasma membrane. Using transgenic tobacco lines, we establish that overexpression of SbSLSP resulted in elevated tolerance to salt and drought stress. The improved tolerance was confirmed by alterations in a range of physiological parameters, including high germination and survival rate, higher leaf chlorophyll contents, and reduced accumulation of Na+ ion and reactive oxygen species (ROS. Furthermore, overexpressing lines also showed lower water loss, higher cell membrane stability and increased accumulation of proline and ROS-scavenging enzymes. Overexpression of SbSLSP also enhanced the transcript levels of ROS-scavenging and signalling enzyme genes. This study is the first investigation of the function of the SbSLSP gene as a novel determinant of salinity/drought tolerance. The results suggest that SbSLSP could be a potential candidate to increase salinity and drought tolerance in crop plants for sustainable agriculture in semi-arid saline soil.
Coopération avec l'Arabie Saoudite
2008-01-01
A protocole to the cooperation agreement concluded between CERN and Saudi Arabia in 2006, was signed at CERN, in particular with the Minister for Petrol and mineral resources, Finance Minister, and a group of representatives from saoudi universities. (1/4 page)
African Journals Online (AJOL)
Identification of a single nucleotide polymorphism of the pituitary-specific transcriptional factor 1 (Pit 1) gene and its association with body composition trait in Iranian commercial broiler line. Abstract PDF · Vol 10, No 70 (2011) - Articles Polymorphisms of the prion protein gene Arabi sheep breed in Iran Abstract PDF · Vol 10, ...
Metode Penafsiran Ibn al-‘Arabî dalam Ahkâm al-Qur’ân
Directory of Open Access Journals (Sweden)
Saiful Fahmi
2015-09-01
Full Text Available This paper will explain the concept of ontological Ibn al-‘Arabi of interpretation, the general idea of the book Ahkâm al-Qur’ân that includes methods, patterns, sources of interpretation, interpretation elements and characteristics that distinguish it from the interpreters other. Ontological view regarding the interpretation that was never a logical consequence of the importance of the final carry was critical of the existing interpretation of the results so far, so it is legitimate to question whether Ahkâm al-Qur’ân is still relevant to the demands of his time or not? Whether in it there is coercion-coercion and preconceptions-ideological Ibn al-‘Arabî or not? Given, Ahkâm al-Qur’ân is reproduced in the 5th century AH, where the fight discourse between the schools of thought Islam was at its height. While Ibn al-‘Arabi is an intellectual who embrace genuine Mâlikî School, so it brought the prejudice that he is stuck in an ideological reason
Afrique Science: Revue Internationale des Sciences et Technologie ...
African Journals Online (AJOL)
Degré d'impact des aménagements hydrauliques sur le ruissellement et le transport solide dans une région semi aride : cas des micro-bassins dans le haut Isser, Algérie · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Keddar, B Touaïbia, M Arabi ...
Lifescience Database Archive (English)
Full Text Available D09722 Drug Sapacitabine (USAN/INN) ... C26H42N4O5 D09722.gif ... Antineoplastic ... DG01...958 ... Nucleic acid derivative, antineoplastic ... DG01439 ... Arabinofuranosyl type antineoplastic ... DG01439 ... Arabi...nofuranosyl type antineoplastic Unclassified ... DG02018 ... Antimetabolite ... DG01958 ... Nucleic acid derivative, antineoplastic... ... DG01439 ... Arabinofuranosyl type antineoplastic ... nucleoside analo
CTC Sentinel. Volume 9, Issue 2, February 2016
2016-06-02
Islamic State side. See Derek Henry Flood: “The Islamic State Raises Its Black Flag Over The Caucasus,” CTC Sentinel 8:6 (2015): pp. 1-4. Dr. Guido...Qalamun,” [Hezbollah Holds Funeral for Child Killed in Al-Qalamun], Al-Araby Al-Jadid, April 28, 2015. 2 Lin Jenkins , “Isis video shows killing of
Bistability of mangrove forests and competition with freshwater plants
Jiang, Jiang; Fuller, Douglas O; Teh, Su Yean; Zhai, Lu; Koh, Hock Lye; DeAngelis, Donald L.; Sternberg, L.D.S.L.
2015-01-01
Halophytic communities such as mangrove forests and buttonwood hammocks tend to border freshwater plant communities as sharp ecotones. Most studies attribute this purely to underlying physical templates, such as groundwater salinity gradients caused by tidal flux and topography. However, a few recent studies hypothesize that self-reinforcing feedback between vegetation and vadose zone salinity are also involved and create a bistable situation in which either halophytic dominated habitat or freshwater plant communities may dominate as alternative stable states. Here, we revisit the bistability hypothesis and demonstrate the mechanisms that result in bistability. We demonstrate with remote sensing imagery the sharp boundaries between freshwater hardwood hammock communities in southern Florida and halophytic communities such as buttonwood hammocks and mangroves. We further document from the literature how transpiration of mangroves and freshwater plants respond differently to vadose zone salinity, thus altering the salinity through feedback. Using mathematical models, we show how the self-reinforcing feedback, together with physical template, controls the ecotones between halophytic and freshwater communities. Regions of bistability along environmental gradients of salinity have the potential for large-scale vegetation shifts following pulse disturbances such as hurricane tidal surges in Florida, or tsunamis in other regions. The size of the region of bistability can be large for low-lying coastal habitat due to the saline water table, which extends inland due to salinity intrusion. We suggest coupling ecological and hydrologic processes as a framework for future studies.
Directory of Open Access Journals (Sweden)
Jing Cao
2016-02-01
Full Text Available Reverse transcription quantitative real-time polymerase chain reaction (qRT-PCR is a powerful analytical technique for the measurement of gene expression, which depends on the stability of the reference gene used for data normalization. Suaeda aralocaspica, an annual halophyte with heteromorphic seeds and possessing C4 photosynthesis pathway without Kranz anatomy, is an ideal plant species to identify stress tolerance-related genes and compare relative expression at transcriptional level. So far, no molecular information is available for this species. In the present study, six traditionally used reference genes were selected and their expression stability in two types of seeds of S. aralocaspica under different experimental conditions was evaluated. Three analytical programs, geNorm, NormFinder and BestKeeper, were used to assess and rank the stability of reference gene expression. Results revealed that although some reference genes may display different transcriptional profiles between the two types of seeds, β-TUB and GAPDH appeared to be the most suitable references under different developmental stages and tissues. GAPDH was the appropriate reference gene under different germination time points and salt stress conditions, and ACTIN was suitable for various abiotic stress treatments for the two types of seeds. For all the sample pools, β-TUB served as the most stable reference gene, whereas 18S rRNA and 28S rRNA performed poorly and presented as the least stable genes in our study. UBQ seemed to be unsuitable as internal control under different salt treatments. In addition, the expression of a photosynthesis-related gene (PPDK of C4 pathway and a salt tolerance-related gene (SAT of S. aralocaspica were used to validate the best performance reference genes. This is the first systematic comparison of reference gene selection for qRT-PCR work in S. aralocaspica and these data will facilitate further studies on gene expression in this species
Directory of Open Access Journals (Sweden)
Lucie Maršálová
2016-08-01
Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H
Lifescience Database Archive (English)
Full Text Available D02368 Drug Gemcitabine (USAN/INN) ... C9H11F2N3O4 D02368.gif ... Antineoplastic ... DG01...958 ... Nucleic acid derivative, antineoplastic ... DG01439 ... Arabinofuranosyl type antineoplastic ... DG01439 ... Arabi...nofuranosyl type antineoplastic Unclassified ... DG02018 ... Antimetabolite ... DG01958 ... Nucleic acid derivative, antineoplastic... ... DG01439 ... Arabinofuranosyl type antineoplastic Same as: C07650 ATC
Directory of Open Access Journals (Sweden)
Yadav Narendra
2012-10-01
Full Text Available Abstract Background Soil salinity adversely affects plant growth and development and disturbs intracellular ion homeostasis resulting cellular toxicity. The Salt Overly Sensitive 1 (SOS1 gene encodes a plasma membrane Na+/H+ antiporter that plays an important role in imparting salt stress tolerance to plants. Here, we report the cloning and characterisation of the SbSOS1 gene from Salicornia brachiata, an extreme halophyte. Results The SbSOS1 gene is 3774 bp long and encodes a protein of 1159 amino acids. SbSOS1 exhibited a greater level of constitutive expression in roots than in shoots and was further increased by salt stress. Overexpressing the S. brachiata SbSOS1 gene in tobacco conferred high salt tolerance, promoted seed germination and increased root length, shoot length, leaf area, fresh weight, dry weight, relative water content (RWC, chlorophyll, K+/Na+ ratio, membrane stability index, soluble sugar, proline and amino acid content relative to wild type (WT plants. Transgenic plants exhibited reductions in electrolyte leakage, reactive oxygen species (ROS and MDA content in response to salt stress, which probably occurred because of reduced cytosolic Na+ content and oxidative damage. At higher salt stress, transgenic tobacco plants exhibited reduced Na+ content in root and leaf and higher concentrations in stem and xylem sap relative to WT, which suggests a role of SbSOS1 in Na+ loading to xylem from root and leaf tissues. Transgenic lines also showed increased K+ and Ca2+ content in root tissue compared to WT, which reflect that SbSOS1 indirectly affects the other transporters activity. Conclusions Overexpression of SbSOS1 in tobacco conferred a high degree of salt tolerance, enhanced plant growth and altered physiological and biochemical parameters in response to salt stress. In addition to Na+ efflux outside the plasma membrane, SbSOS1 also helps to maintain variable Na+ content in different organs and also affect the other
Volkov, Vadim
2015-01-01
Ion transport is the fundamental factor determining salinity tolerance in plants. The Review starts from differences in ion transport between salt tolerant halophytes and salt-sensitive plants with an emphasis on transport of potassium and sodium via plasma membranes. The comparison provides introductory information for increasing salinity tolerance. Effects of salt stress on ion transport properties of membranes show huge opportunities for manipulating ion fluxes. Further steps require knowledge about mechanisms of ion transport and individual genes of ion transport proteins. Initially, the Review describes methods to measure ion fluxes, the independent set of techniques ensures robust and reliable basement for quantitative approach. The Review briefly summarizes current data concerning Na(+) and K(+) concentrations in cells, refers to primary thermodynamics of ion transport and gives special attention to individual ion channels and transporters. Simplified scheme of a plant cell with known transport systems at the plasma membrane and tonoplast helps to imagine the complexity of ion transport and allows choosing specific transporters for modulating ion transport. The complexity is enhanced by the influence of cell size and cell wall on ion transport. Special attention is given to ion transporters and to potassium and sodium transport by HKT, HAK, NHX, and SOS1 proteins. Comparison between non-selective cation channels and ion transporters reveals potential importance of ion transporters and the balance between the two pathways of ion transport. Further on the Review describes in detail several successful attempts to overexpress or knockout ion transporters for changing salinity tolerance. Future perspectives are questioned with more attention given to promising candidate ion channels and transporters for altered expression. Potential direction of increasing salinity tolerance by modifying ion channels and transporters using single point mutations is discussed and
2012-01-01
Background Soil salinity adversely affects plant growth and development and disturbs intracellular ion homeostasis resulting cellular toxicity. The Salt Overly Sensitive 1 (SOS1) gene encodes a plasma membrane Na+/H+ antiporter that plays an important role in imparting salt stress tolerance to plants. Here, we report the cloning and characterisation of the SbSOS1 gene from Salicornia brachiata, an extreme halophyte. Results The SbSOS1 gene is 3774 bp long and encodes a protein of 1159 amino acids. SbSOS1 exhibited a greater level of constitutive expression in roots than in shoots and was further increased by salt stress. Overexpressing the S. brachiata SbSOS1 gene in tobacco conferred high salt tolerance, promoted seed germination and increased root length, shoot length, leaf area, fresh weight, dry weight, relative water content (RWC), chlorophyll, K+/Na+ ratio, membrane stability index, soluble sugar, proline and amino acid content relative to wild type (WT) plants. Transgenic plants exhibited reductions in electrolyte leakage, reactive oxygen species (ROS) and MDA content in response to salt stress, which probably occurred because of reduced cytosolic Na+ content and oxidative damage. At higher salt stress, transgenic tobacco plants exhibited reduced Na+ content in root and leaf and higher concentrations in stem and xylem sap relative to WT, which suggests a role of SbSOS1 in Na+ loading to xylem from root and leaf tissues. Transgenic lines also showed increased K+ and Ca2+ content in root tissue compared to WT, which reflect that SbSOS1 indirectly affects the other transporters activity. Conclusions Overexpression of SbSOS1 in tobacco conferred a high degree of salt tolerance, enhanced plant growth and altered physiological and biochemical parameters in response to salt stress. In addition to Na+ efflux outside the plasma membrane, SbSOS1 also helps to maintain variable Na+ content in different organs and also affect the other transporters activity indirectly
Directory of Open Access Journals (Sweden)
Vadim eVolkov
2015-10-01
Full Text Available Ion transport is the fundamental factor determining salinity tolerance in plants. The Review starts from differences in ion transport between salt tolerant halophytes and salt-sensitive plants with an emphasis on transport of potassium and sodium via plasma membranes. The comparison provides introductory information for increasing salinity tolerance. Effects of salt stress on ion transport properties of membranes show huge opportunities for manipulating ion fluxes. Further steps require knowledge about mechanisms of ion transport and individual genes of ion transport proteins. Initially, the Review describes methods to measure ion fluxes, the independent set of techniques ensures robust and reliable basement for quantitative approach. The Review briefly summarises current data concerning Na+ and K+ concentrations in cells, refers to primary thermodynamics of ion transport and gives special attention to individual ion channels and transporters. Simplified scheme of a plant cell with known transport systems at the plasma membrane and tonoplast helps to imagine the complexity of ion transport and allows to choose specific transporters for modulating ion transport. The complexity is enhanced by the influence of cell size and cell wall on ion transport. Special attention is given to ion transporters and to potassium and sodium transport by HKT, HAK, NHX and SOS1 proteins. Comparison between nonselective cation channels and ion transporters reveals potential importance of ion transporters and the balance between the two pathways of ion transport. Further on the Review describes in detail several successful attempts to overexpress or knockout ion transporters for changing salinity tolerance. Future perspectives are questioned with more attention given to promising candidate ion channels and transporters for altered expression. Potential direction of increasing salinity tolerance by modifying ion channels and transporters using single point mutations is
El nombre Al ŶamīI y la Presencia de la Belleza
Directory of Open Access Journals (Sweden)
Pablo Beneito
2013-11-01
Full Text Available Beauty, according to Ibn Arabi, is pronounced to men in two ways: on one hand, by the elevation and power of the divine presence, named Majesty of Beauty, which we must respond through a spiritual state of privacy to accomplish balance during both contemplation and a correct apprehension; on the other hand, through proximity, aspect of Beauty, that should be received with fear for a proper response to God's expansion towards us, achieving in consequence, our gathering with Him. Those who love because of the divine love, contemplate the wisdom echoed in both: the universe as well as in themselves. Ibn Arabi also explained the application of these names to the reading of the Koran. The Prophet sustained the importance of spiritual embellishment achieved by a correct conduct and the contemplation of Beauty, this last one characterized by making all things likable and knowledgeable. Everything is inclined to be self loved, but this is only possible because of Reality's divinity; since God created the world to His image, it is considered as a mirror in which He contemplates and loves Himself.
Burnout Syndrome in Pediatric Practice
Al-Youbi, Reem A.; Jan, Mohammed M.
2013-01-01
Objectives: Burnout is a common work-related syndrome consisting of emotional exhaustion, depersonalization and diminished feelings of personal accomplishment. Burnout influences the performance and efficiency of the healthcare professionals and therefore the quality of the care provided. This study aims to assess the burnout rates and potential determinants in pediatrics.Methods: A cross-sectional, descriptive study involving physicians practicing pediatrics in the Jeddah area of Saudi Arabi...
Higher degradation of L-Cys by O-acetylserine-thiolyases in Sarcocornia than Salicornia
Kurmanbayeva, Assylay
2017-07-26
Salicornia and Sarcocornia are almost identical halophytes whose edible succulent shoots hold promise for commercial production in saline water. Enhanced sulfur nutrition may be beneficial to crops naturally grown on high sulfate. However, little is known about sulfate nutrition in halophytes. Here we show that Salicornia europaea (ecotype RN) exhibits a significant increase in biomass and organic-S accumulation in response to supplemental sulfate, while Sarcocornia fruticosa (ecotype VM) does not, instead exhibiting increased sulfate accumulation. We investigated the role of two pathways on organic-S and biomass accumulation in Salicornia and Sarcoconia: the sulfate reductive pathway that generates cysteine and L-cysteine desulfhydrase that degrades cysteine to H2S, NH3 and pyruvate. The major function of O-acetylserine-(thiol) lyase (OAS-TL; EC 2.5.1.47) is the formation of L-cysteine, but our study shows that the OAS-TL A and B of both halophytes are enzymes that also degrade L-cysteine to H2S. This activity was significantly higher in Sarcocornia than in Salicornia, especially upon sulfate supplementation. The activity of the sulfate reductive pathway key enzyme, adenosine 5\\'-phosphosulfate reductase (APR, EC 1.8.99.2), was significantly higher in Salicornia than in Sarcocornia. These results suggest that the low organic-S level in Sarcocornia is the result of high L-cysteine degradation rate by OAS-TLs, whereas, the greater organic-S and biomass accumulation in Salicornia is the result of higher APR activity and low L-cysteine degradation rate, resulting in higher net cysteine biosynthesis. These results present an initial road map for halophyte growers to attain better growth rates and nutritional value of Salicornia and Sarcocornia.
Higher degradation of L-Cys by O-acetylserine-thiolyases in Sarcocornia than Salicornia
Kurmanbayeva, Assylay; Bekturova, Aizat; Srivastava, Sudhakar; Soltabayeva, Aigerim; Khan, Mohammad Suhail; Salazar, Octavio; Fedoroff, Nina V.; Asatryan, Armine; Ventura, Yvonne; Sagi, Moshe
2017-01-01
Salicornia and Sarcocornia are almost identical halophytes whose edible succulent shoots hold promise for commercial production in saline water. Enhanced sulfur nutrition may be beneficial to crops naturally grown on high sulfate. However, little is known about sulfate nutrition in halophytes. Here we show that Salicornia europaea (ecotype RN) exhibits a significant increase in biomass and organic-S accumulation in response to supplemental sulfate, while Sarcocornia fruticosa (ecotype VM) does not, instead exhibiting increased sulfate accumulation. We investigated the role of two pathways on organic-S and biomass accumulation in Salicornia and Sarcoconia: the sulfate reductive pathway that generates cysteine and L-cysteine desulfhydrase that degrades cysteine to H2S, NH3 and pyruvate. The major function of O-acetylserine-(thiol) lyase (OAS-TL; EC 2.5.1.47) is the formation of L-cysteine, but our study shows that the OAS-TL A and B of both halophytes are enzymes that also degrade L-cysteine to H2S. This activity was significantly higher in Sarcocornia than in Salicornia, especially upon sulfate supplementation. The activity of the sulfate reductive pathway key enzyme, adenosine 5'-phosphosulfate reductase (APR, EC 1.8.99.2), was significantly higher in Salicornia than in Sarcocornia. These results suggest that the low organic-S level in Sarcocornia is the result of high L-cysteine degradation rate by OAS-TLs, whereas, the greater organic-S and biomass accumulation in Salicornia is the result of higher APR activity and low L-cysteine degradation rate, resulting in higher net cysteine biosynthesis. These results present an initial road map for halophyte growers to attain better growth rates and nutritional value of Salicornia and Sarcocornia.
Directory of Open Access Journals (Sweden)
Sankarsan Roy
2016-10-01
Full Text Available Sunderbans, the UNESCO World Heritage Site is one of the largest mangrove forests in the World. This unique tidal halophytic mangrove ecosystem is also spread over the neighbouring country- Bangladesh. This ecosystem supports a variety of halophytic mangrove species and provides shelter and food to many faunal components (Chakraborty, 2011. Till date, several studies have been made on dipteran fauna from SBR which was altogether compiled by Mitra (2013. Further, Mitra et al. (2014, 2015 added some more records of the Diptera from this area. Apart from documenting the dipteran insects, we attempted here their functional contribution towards sustainability of this sensitive ecosystem.
Kurmanbayeva, Assylay; Bekturova, Aizat; Soltabayeva, Aigerim; Asatryan, Armine; Ventura, Yvonne; Salazar, Octavio; Fedoroff, Nina
2017-01-01
Salicornia and Sarcocornia are almost identical halophytes whose edible succulent shoots hold promise for commercial production in saline water. Enhanced sulfur nutrition may be beneficial to crops naturally grown on high sulfate. However, little is known about sulfate nutrition in halophytes. Here we show that Salicornia europaea (ecotype RN) exhibits a significant increase in biomass and organic-S accumulation in response to supplemental sulfate, whereas Sarcocornia fruticosa (ecotype VM) does not, instead exhibiting increased sulfate accumulation. We investigated the role of two pathways on organic-S and biomass accumulation in Salicornia and Sarcoconia: the sulfate reductive pathway that generates Cys and l-Cys desulfhydrase that degrades Cys to H2S, NH3, and pyruvate. The major function of O-acetyl-Ser-(thiol) lyase (OAS-TL; EC 2.5.1.47) is the formation of l-Cys, but our study shows that the OAS-TL A and OAS-TL B of both halophytes are enzymes that also degrade l-Cys to H2S. This activity was significantly higher in Sarcocornia than in Salicornia, especially upon sulfate supplementation. The activity of the sulfate reductive pathway key enzyme, adenosine 5′-phosphosulfate reductase (APR, EC 1.8.99.2), was significantly higher in Salicornia than in Sarcocornia. These results suggest that the low organic-S level in Sarcocornia is the result of high l-Cys degradation rate by OAS-TLs, whereas the greater organic-S and biomass accumulation in Salicornia is the result of higher APR activity and low l-Cys degradation rate, resulting in higher net Cys biosynthesis. These results present an initial road map for halophyte growers to attain better growth rates and nutritional value of Salicornia and Sarcocornia. PMID:28743765
Kurmanbayeva, Assylay; Bekturova, Aizat; Srivastava, Sudhakar; Soltabayeva, Aigerim; Asatryan, Armine; Ventura, Yvonne; Khan, Mohammad Suhail; Salazar, Octavio; Fedoroff, Nina; Sagi, Moshe
2017-09-01
Salicornia and Sarcocornia are almost identical halophytes whose edible succulent shoots hold promise for commercial production in saline water. Enhanced sulfur nutrition may be beneficial to crops naturally grown on high sulfate. However, little is known about sulfate nutrition in halophytes. Here we show that Salicornia europaea (ecotype RN) exhibits a significant increase in biomass and organic-S accumulation in response to supplemental sulfate, whereas Sarcocornia fruticosa (ecotype VM) does not, instead exhibiting increased sulfate accumulation. We investigated the role of two pathways on organic-S and biomass accumulation in Salicornia and Sarcoconia : the sulfate reductive pathway that generates Cys and l-Cys desulfhydrase that degrades Cys to H 2 S, NH 3 , and pyruvate. The major function of O -acetyl-Ser-(thiol) lyase (OAS-TL; EC 2.5.1.47) is the formation of l-Cys, but our study shows that the OAS-TL A and OAS-TL B of both halophytes are enzymes that also degrade l-Cys to H 2 S. This activity was significantly higher in Sarcocornia than in Salicornia , especially upon sulfate supplementation. The activity of the sulfate reductive pathway key enzyme, adenosine 5'-phosphosulfate reductase (APR, EC 1.8.99.2), was significantly higher in Salicornia than in Sarcocornia These results suggest that the low organic-S level in Sarcocornia is the result of high l-Cys degradation rate by OAS-TLs, whereas the greater organic-S and biomass accumulation in Salicornia is the result of higher APR activity and low l-Cys degradation rate, resulting in higher net Cys biosynthesis. These results present an initial road map for halophyte growers to attain better growth rates and nutritional value of Salicornia and Sarcocornia . © 2017 American Society of Plant Biologists. All Rights Reserved.
Reference: 398 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available modulate the photosynthetic potential of plant cells. Identification of genes required for light-induced chloroplast movement... is beginning to define the molecular machinery that controls these movement...s. In this work, we describe plastid movement impaired 2 (pmi2), a mutant in Arabidopsis (Arabi...dopsis thaliana) that displays attenuated chloroplast movements under intermediate and high light intensitie...s while maintaining a normal movement response under low light intensities. In wi
General properties of grapevine viruses occurring in Hungary
Eszter Cseh; András Takács; László Kocsis; Richard Gáborjányi
2012-01-01
The past fifty years important advances have been made in the field of grapevine virus research, including characterization of pathogens and control measurements. Still the occurrence of Grapevine fanleaf virus (GFLV), Arabis mosaic virus (ArMV), Tomato black ring virus (TBRV), Grapevine chrome mosaic virus (GCMV), Alfalfa mosaic virus (AMV), Grapevine Bulgarian latent virus (GBLV), Grapevine fleck virus (GFkV), Grapevine leafroll- associated viruses (GLRaV1-4), Grapevine virus A (GVA), Grape...
Abdominal Pain-Predominant Functional Gastrointestinal Disorders in Jordanian School Children
Altamimi, Eyad M.; Al-Safadi, Mohammad H.
2014-01-01
Background Recurrent abdominal pain (RAP) is a common complaint in children. Significant portion of them are of functional origin. This study aimed to assess the prevalence of abdominal pain-predominant functional gastrointestinal disorder (FGID) and its types in Jordanian school children. Methods This is a school-based survey at south Jordan. Information using the self-reporting form of the Questionnaire on Pediatric Gastrointestinal Symptoms-Rome III Version (QPGS-RIII) - the official Arabi...
Screening of 18 species for digestate phytodepuration.
Pavan, Francesca; Breschigliaro, Simone; Borin, Maurizio
2015-02-01
This experiment assesses the aptitude of 18 species in treating the digestate liquid fraction (DLF) in a floating wetland treatment system. The pilot system was created in NE Italy in 2010 and consists of a surface-flow system with 180 floating elements (Tech-IA®) vegetated with ten halophytes and eight other wetland species. The species were transplanted in July 2011 in basins filled with different proportions of DLF/water (DLF/w); periodic increasing of the DLF/w ratio was imposed after transplanting, reaching the worst conditions for plants in summer 2012 (highest EC value 7.3 mS cm/L and NH4-N content 225 mg/L). It emerged that only Cynodon dactylon, Typha latifolia, Elytrigia atherica, Halimione portulacoides, Salicornia fruticosa, Artemisia caerulescens, Spartina maritima and Puccinellia palustris were able to survive under the system conditions. Halophytes showed higher dry matter production than other plants. The best root development (up to 40-cm depth) was recorded for Calamagrostis epigejos, Phragmites australis, T. latifolia and Juncus maritimus. The highest nitrogen (10-15 g/m(2)) and phosphorus (1-4 g/m(2)) uptakes were obtained with P. palustris, Iris pseudacorus and Aster tripolium. In conclusion, two halophytes, P. palustris and E. atherica, present the highest potential to be used to treat DLF in floating wetlands.
Tiwari, Vivekanand; Chaturvedi, Amit Kumar; Mishra, Avinash; Jha, Bhavanath
2015-01-01
The SbASR-1 gene, cloned from a halophyte Salicornia brachiata, encodes a plant-specific hydrophilic and stress responsive protein. The genome of S. brachiata has two paralogs of the SbASR-1 gene (2549 bp), which is comprised of a single intron of 1611 bp, the largest intron of the abscisic acid stress ripening [ASR] gene family yet reported. In silico analysis of the 843-bp putative promoter revealed the presence of ABA, biotic stress, dehydration, phytohormone, salinity, and sugar responsive cis-regulatory motifs. The SbASR-1 protein belongs to Group 7 LEA protein family with different amino acid composition compared to their glycophytic homologs. Bipartite Nuclear Localization Signal (NLS) was found on the C-terminal end of protein and localization study confirmed that SbASR-1 is a nuclear protein. Furthermore, transgenic groundnut (Arachis hypogaea) plants over-expressing the SbASR-1 gene constitutively showed enhanced salinity and drought stress tolerance in the T1 generation. Leaves of transgenic lines exhibited higher chlorophyll and relative water contents and lower electrolyte leakage, malondialdehyde content, proline, sugars, and starch accumulation under stress treatments than wild-type (Wt) plants. Also, lower accumulation of H2O2 and O2.- radicals was detected in transgenic lines compared to Wt plants under stress conditions. Transcript expression of APX (ascorbate peroxidase) and CAT (catalase) genes were higher in Wt plants, whereas the SOD (superoxide dismutase) transcripts were higher in transgenic lines under stress. Electrophoretic mobility shift assay (EMSA) confirmed that the SbASR-1 protein binds at the consensus sequence (C/G/A)(G/T)CC(C/G)(C/G/A)(A/T). Based on results of the present study, it may be concluded that SbASR-1 enhances the salinity and drought stress tolerance in transgenic groundnut by functioning as a LEA (late embryogenesis abundant) protein and a transcription factor. PMID:26158616
Réforme du secteur de la sécurité dans les pays arabes | CRDI ...
International Development Research Centre (IDRC) Digital Library (Canada)
L'ARI analysera le secteur de la sécurité dans huit pays (l'Algérie, l'Égypte, l'Iraq, la Jordanie, le Liban, le Maroc, la Palestine et l'Arabie Saoudite), puis élaborera un programme de réformes fondé sur une compréhension interne des enjeux. Ce projet favorisera également un débat éclairé sur la réforme du secteur de la ...
γ-irradiation resistance and UV-sensitivity of extremely thermophilic archebacteria and eubacteria
International Nuclear Information System (INIS)
Kopylov, V.M.; Bonch-Osmolovskaya, E.A.; Svetlichnyi, V.A.; Miroshnichenko, M.L.; Skobkin, V.S.
1993-01-01
Cells of extremely thermophilic sulfur-dependent archebacteria Desulfurococcus amylolyticus Z533 and Thermococcus stelleri K15 are resistant to γ-irradiation. These archebacteria survive γ-irradiation at a dose of up to 5 kGy but are no longer viable after 8-9 kGy. Comparison of the survival profiles showed that archebacteria are 12 to 25 times more resistant to γ-irradiation at moderate doses (LD 50 and LD 90 ) than E. coli K12 but are 2 to 2.5 times more sensitive than D. radiodurans. γ-irradiation at a dose of 1 to 2.5 kGy killed extremely thermophilic anaerobic eubacteria Thermotoga maritima 2706 and Thermodesulfobacterium P. All extreme thermophiles studied were more sensitive to UV-irradiation than E. coli
La population des villes sudarabiques préislamiques : entre ‘aṣabiyya et ḥaḍarî
Directory of Open Access Journals (Sweden)
Jérémie Schiettecatte
2012-03-01
Full Text Available L’identité des populations d’Arabie du Sud préislamique est traitée par le biais des données épigraphiques. Ces dernières donnent un aperçu de la manière dont se définissent les populations urbaines. Dans un premier temps (viiie-iie s. av. J.‑C., celles-ci se définissent par le lien de parenté. Au tournant de l’ère chrétienne en revanche, à travers toute l’Arabie du Sud, l’identité se décline progressivement par un rattachement à la ville d’appartenance, au sol. Cette évolution chronologique nous amène à relativiser l’ancienne dichotomie selon laquelle l’identité des populations des Hautes-Terres se définit par le lien au sol et celle des Basses-Terres par le lien du sang. Par ailleurs, cette évolution semble aller de pair avec une transformation profonde de la société où le domaine de la parenté fait place à de nouvelles formes de hiérarchie dans les relations de dominance et d’appropriation des ressources. Cette transformation pourrait avoir été le moteur de cette évolution de l’identité des populations urbaines sudarabiques.
Song, Jie; Wang, Baoshan
2015-02-01
As important components in saline agriculture, halophytes can help to provide food for a growing world population. In addition to being potential crops in their own right, halophytes are also potential sources of salt-resistance genes that might help plant breeders and molecular biologists increase the salt tolerance of conventional crop plants. One especially promising halophyte is Suaeda salsa, a euhalophytic herb that occurs both on inland saline soils and in the intertidal zone. The species produces dimorphic seeds: black seeds are sensitive to salinity and remain dormant in light under high salt concentrations, while brown seeds can germinate under high salinity (e.g. 600 mm NaCl) regardless of light. Consequently, the species is useful for studying the mechanisms by which dimorphic seeds are adapted to saline environments. S. salsa has succulent leaves and is highly salt tolerant (e.g. its optimal NaCl concentration for growth is 200 mm). A series of S. salsa genes related to salt tolerance have been cloned and their functions tested: these include SsNHX1, SsHKT1, SsAPX, SsCAT1, SsP5CS and SsBADH. The species is economically important because its fresh branches have high value as a vegetable, and its seed oil is edible and rich in unsaturated fatty acids. Because it can remove salts and heavy metals from saline soils, S. salsa can also be used in the restoration of salinized or contaminated saline land. Because of its economic and ecological value in saline agriculture, S. salsa is one of the most important halophytes in China. In this review, the value of S. salsa as a source of food, medicine and forage is discussed. Its uses in the restoration of salinized or contaminated land and as a source of salt-resistance genes are also considered. © The Author 2014. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
The Role of Na+ and K+ Transporters in Salt Stress Adaptation in Glycophytes
Directory of Open Access Journals (Sweden)
Dekoum V. M. Assaha
2017-07-01
Full Text Available Ionic stress is one of the most important components of salinity and is brought about by excess Na+ accumulation, especially in the aerial parts of plants. Since Na+ interferes with K+ homeostasis, and especially given its involvement in numerous metabolic processes, maintaining a balanced cytosolic Na+/K+ ratio has become a key salinity tolerance mechanism. Achieving this homeostatic balance requires the activity of Na+ and K+ transporters and/or channels. The mechanism of Na+ and K+ uptake and translocation in glycophytes and halophytes is essentially the same, but glycophytes are more susceptible to ionic stress than halophytes. The transport mechanisms involve Na+ and/or K+ transporters and channels as well as non-selective cation channels. Thus, the question arises of whether the difference in salt tolerance between glycophytes and halophytes could be the result of differences in the proteins or in the expression of genes coding the transporters. The aim of this review is to seek answers to this question by examining the role of major Na+ and K+ transporters and channels in Na+ and K+ uptake, translocation and intracellular homeostasis in glycophytes. It turns out that these transporters and channels are equally important for the adaptation of glycophytes as they are for halophytes, but differential gene expression, structural differences in the proteins (single nucleotide substitutions, impacting affinity and post-translational modifications (phosphorylation account for the differences in their activity and hence the differences in tolerance between the two groups. Furthermore, lack of the ability to maintain stable plasma membrane (PM potentials following Na+-induced depolarization is also crucial for salt stress tolerance. This stable membrane potential is sustained by the activity of Na+/H+ antiporters such as SOS1 at the PM. Moreover, novel regulators of Na+ and K+ transport pathways including the Nax1 and Nax2 loci regulation of SOS1
El nombre Al ŶamīI y la Presencia de la Belleza
Pablo Beneito
2013-01-01
Beauty, according to Ibn Arabi, is pronounced to men in two ways: on one hand, by the elevation and power of the divine presence, named Majesty of Beauty, which we must respond through a spiritual state of privacy to accomplish balance during both contemplation and a correct apprehension; on the other hand, through proximity, aspect of Beauty, that should be received with fear for a proper response to God's expansion towards us, achieving in consequence, our gathering with Him. Those who love...
Directory of Open Access Journals (Sweden)
Satyavani Kaliamurthi
2014-08-01
Full Text Available Objective: To document the hypoglycemic and wound healing plant species especially halophytes and associates were carried out in the coastal village of Kodiyampalayam (Southeast coast of India. Methods: The data were collected during the month of December 2011 to November 2012 with personal interviews and group discussion of local coastal fisher women community and traditional practitioner. Results: The results indicated the traditional knowledge of 33 medicinal plant species, photographs, vernacular name, habit, active part and their mode of action. Among these, Citrullus colocynthis, Coccinia grandis, Rhizophora apiculata, Rhizophora mucronata, Bruguiera cylindrica, Excoecaria agallocha and Andrographis paniculata were discovered in huge number. Conclusions: This study concludes medicinal uses of halophytes and associates in the coastal area. It will be needed scientific validation for development of novel therapeutic agents.
Ability of salt marsh plants for TBT remediation in sediments
Carvalho, P. N.; Basto, M. C.; Moreira da Silva, M.; Machado, A.; Bordalo, A.; Vasconcelos, M. T.
2010-01-01
The capability of Halimione portulacoides, Spartina maritima, and Sarcocornia fruticosa (halophytes very commonly found in salt marshes from Mediterranean areas) for enhancing remediation of tributyltin (TBT) from estuarine sediments was investigated, using different experimental conditions.
A comparative study of salt tolerance parameters in 11 wild relatives of Arabidopsis thaliana
Orsini, Francesco; D'Urzo, Matilde Paino; Inan, Gunsu; Serra, Sara; Oh, Dong-Ha; Mickelbart, Michael V.; Consiglio, Federica; Li, Xia; Jeong, Jae Cheol; Yun, Dae-Jin; Bohnert, Hans J.; Bressan, Ray A.; Maggio, Albino
2010-01-01
improved owing to active development of advanced tools in molecular, genomics, and bioinformatics analyses. However, the full potential of investigative power has not been fully exploited, because the use of halophytes as model systems in plant salt
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Sexual conflict in plants · N. G. Prasad S. .... Single-nucleotide polymorphisms in the B7H3 gene are not associated with human autoimmune myasthenia gravis ... Antioxidative response mechanisms in halophytes: their role in stress defence.
A comparative study of salt tolerance parameters in 11 wild relatives of Arabidopsis thaliana
Orsini, Francesco
2010-07-01
Salinity is an abiotic stress that limits both yield and the expansion of agricultural crops to new areas. In the last 20 years our basic understanding of the mechanisms underlying plant tolerance and adaptation to saline environments has greatly improved owing to active development of advanced tools in molecular, genomics, and bioinformatics analyses. However, the full potential of investigative power has not been fully exploited, because the use of halophytes as model systems in plant salt tolerance research is largely neglected. The recent introduction of halophytic Arabidopsis-Relative Model Species (ARMS) has begun to compare and relate several unique genetic resources to the well-developed Arabidopsis model. In a search for candidates to begin to understand, through genetic analyses, the biological bases of salt tolerance, 11 wild relatives of Arabidopsis thaliana were compared: Barbarea verna, Capsella bursa-pastoris, Hirschfeldia incana, Lepidium densiflorum, Malcolmia triloba, Lepidium virginicum, Descurainia pinnata, Sisymbrium officinale, Thellungiella parvula, Thellungiella salsuginea (previously T. halophila), and Thlaspi arvense. Among these species, highly salt-tolerant (L. densiflorum and L. virginicum) and moderately salt-tolerant (M. triloba and H. incana) species were identified. Only T. parvula revealed a true halophytic habitus, comparable to the better studied Thellungiella salsuginea. Major differences in growth, water transport properties, and ion accumulation are observed and discussed to describe the distinctive traits and physiological responses that can now be studied genetically in salt stress research. 2010 The Author.
Czech Academy of Sciences Publication Activity Database
Danihelka, Jiří
2008-01-01
Roč. 43, č. 1 (2008), s. 1-16 ISSN 1211-5258 R&D Projects: GA MŠk(CZ) LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : history of botany * halophytes * exsiccate series Subject RIV: EF - Botanics
Comparative effects of neutral salt and alkaline salt stress on seed ...
African Journals Online (AJOL)
ajl user 4
2012-04-27
Apr 27, 2012 ... 0991-8583259. Abbreviations: AsA, Ascorbic acid; Car, carotenoids; CAT, ... the most critical stages in the life cycle of plants when ... 2008a). The mechanisms for adaptation of the halophyte to salt ..... Plant Soil, 39: 205-207.
WAQI’U TA’LIIM AL-NATSRI AL-ARABY BI INDONESIA
Directory of Open Access Journals (Sweden)
Mohammad Ahsanuddin
2016-07-01
Full Text Available This research is to describe the teaching and learning of Arabic prose with regard to goals, themes, methods, media, and evaluation, as well as prose analysis examples made by both teacher and student. The research method used is descriptive-qualitative. The subjects are students at the Arabic Department who have taken Prose Analysis (Dirasah Natsriyyah course. The result of the research shows that prose is an expression what lies in human’s heart. The goals of the learning is to understand theories used to analyze prose, and to apply them in text analysis. The themes studied included the understanding of prose, acquintance with some theoretical approaches for analysis, such as structuralism, semiotics, etc. The methods of learning employed are lecture, text analysis, and assignment. The media of learning used is power point. The evaluation is undertaken throughout the process of learning, in addition to what the students had achieved in their exams.
DIRASAH AL-USLUB WA AL-USLUBIYAH FI NAQD AL-ARABY
Directory of Open Access Journals (Sweden)
Habibullah Ali Ibrahim Ali
2015-08-01
Full Text Available In this study, we addressed method and style in Arabic criticism. By the efforts of Arab critics of old and new issue, the subjects of study were as follows: First, the stylistic origins. It means a stylistic in linguistic and rhetoric and literary criticism and other related; Second, analysis of stylistic levels where we focus on stylistic study premises for literary texts; Third, a study of the method in the old Arab criticism, in this part of the study, we noted some efforts by Arab critics about stylistic and their relevance studies in this stylistic aspect; Fourth, the stylistic of contemporary Arab criticism. This aspect of the survey stood at some critics of contemporary Arab studies in Stylistics, as stated what distinguishes each study than other studies. It is included as an appendix in whale most important results achieved in this study.
Addio a Fubini, fisico di pace tra ebrei e arabi
Molinari, Ida
2005-01-01
Professor at the Torino University, Sergio Fubini was not only a theorician physicist very well known in the field of elementar particles and the theory of strings. He was aslo a Wise person, with hebrew humour and italian modesty
La finance islamique: fondements, theorie et realite.
MARTENS, André
2001-01-01
L’Islam interdit le riba , mot arabe signifiant à la fois usure et intérêt. L’interdiction du rib figure dans la loi islamique, née dans l’Arabie du Moyen Âge. Elle est à la base de la finance islamique qui connut une expansion remarquable durant la deuxième moitié du XX e siècle. Nous nous interrogeons sur les origines de cette interdiction, sur les problèmes que connaît actuellement la finance islamique et sur ses perspectives d’avenir.
Un relief en bronze sabéen d’inspiration proche-orientale
Directory of Open Access Journals (Sweden)
Iris Gerlach
2003-09-01
Full Text Available Dans l’étude des relations interculturelles entre l’Arabie du Sud et la région syro-palestinienne d’une part, la Mésopotamie d’autre part, l’examen du tracé des voies commerciales et l’exploitation des sources assyriennes mentionnant les royaumes sudarabiques ou leurs monarques apparaissaient jusqu’ici comme essentiels. Par ailleurs, une étude approfondie des écrits des auteurs classiques a également été entreprise. Hérodote (Histoire, III, 107, Strabon (Géographie, XVI, 765 sq. et Pline l’...
Defining the next generation modeling of coastal ecotone dynamics in response to global change
Jiang, Jiang; DeAngelis, Donald L.; Teh, Su-Y; Krauss, Ken W.; Wang, Hongqing; Haidong, Li; Smith, Thomas; Koh, Hock L.
2016-01-01
Coastal ecosystems are especially vulnerable to global change; e.g., sea level rise (SLR) and extreme events. Over the past century, global change has resulted in salt-tolerant (halophytic) plant species migrating into upland salt-intolerant (glycophytic) dominated habitats along major rivers and large wetland expanses along the coast. While habitat transitions can be abrupt, modeling the specific drivers of abrupt change between halophytic and glycophytic vegetation is not a simple task. Correlative studies, which dominate the literature, are unlikely to establish ultimate causation for habitat shifts, and do not generate strong predictive capacity for coastal land managers and climate change adaptation exercises. In this paper, we first review possible drivers of ecotone shifts for coastal wetlands, our understanding of which has expanded rapidly in recent years. Any exogenous factor that increases growth or establishment of halophytic species will favor the ecotone boundary moving upslope. However, internal feedbacks between vegetation and the environment, through which vegetation modifies the local microhabitat (e.g., by changing salinity or surface elevation), can either help the system become resilient to future changes or strengthen ecotone migration. Following this idea, we review a succession of models that have provided progressively better insight into the relative importance of internal positive feedbacks versus external environmental factors. We end with developing a theoretical model to show that both abrupt environmental gradients and internal positive feedbacks can generate the sharp ecotonal boundaries that we commonly see, and we demonstrate that the responses to gradual global change (e.g., SLR) can be quite diverse.
Background/Question/Methods: Salinity is one of the main abiotic factors in salt marshes. Studies rooted to analyzed salinity tolerance of halophytes may help to relate their physiological tolerances with distribution limits in the field. Climate change-induced sea level rise and higher temperatures...
Gesteelde zoutmelde [Halimione pedunculata (L.) Aellen] op Texel
Westhoff, V.; Schaminée, J.H.J.
1989-01-01
Halimione pedunculata, one of the rarest halophytes of the Netherlands, was known from the southwestern estuaries, as well as from the Westfriesian islands of Terschelling, Ameland and Schiermonnikoog. Its absence from Texel was remarkable. On 6 September 1988, the authors observed and collected the
Molecular responses and expression analysis of genes in a ...
African Journals Online (AJOL)
Haloxylon ammodendron (C.A Mey.) Bunge is a xero-halophytic desert shrub with excellent drought resistance and salt tolerance. To decipher the molecular responses involved in its drought resistance, the cDNA-AFLP (amplified fragment length polymorphism) technique was employed to identify genes expressed ...
Aviation Fueling: A Cleaner, Greener Approach
Hendricks, Robert C.; Bushnell, Dennis M.; Shouse, Dale T.
2010-01-01
Projected growth of aviation depends on fueling where specific needs must be met. Safety is paramount, and along with political, social, environmental and legacy transport systems requirements, alternate aviation fueling becomes an opportunity of enormous proportions. Biofuels sourced from halophytes, algae, cyanobacteria, and weeds using wastelands, waste water, and seawater have the capacity to be drop-in fuel replacements for petroleum fuels. Biojet fuels from such sources solves the aviation CO2 emissions issue and do not compete with food or freshwater needs. They are not detrimental to the social or environmental fabric and use the existing fuels infrastructure. Cost and sustainable supply remains the major impediments to alternate fuels. Halophytes are the near-term solution to biomass/biofuels capacity at reasonable costs; they simply involve more farming, at usual farming costs. Biofuels represent a win-win approach, proffering as they do at least the ones we are studying massive capacity, climate neutral-to-some sequestration, and ultimately, reasonable costs.
Structure of Living Soil Cover of the White Sea
Directory of Open Access Journals (Sweden)
Moseev Dmitriy Sergeevich
2016-12-01
Full Text Available The living soil of the Dry Sea gulf's coast in the South-East part of the White Sea's Dvina Bay is practically a blind spot. The bay is a unique water body in respect of plant communities. The majority of halophytes typical for the White Sea coast grows here. There are differences between plant communities of the East and West shores of the Dry Sea gulf. The East coast has developed communities with domination of Phragmites australis, the West coast is occupied by communities of psammophytonis levees with a predominance of Leymus arenarius. For the first time ever, the article provides a classification of halophytic vegetation of the gulf's marshes, which highlighted the prodromus containing ten associations, consisting of seven formations of the type grass vegetation, many of which are rare. The research results can be used to develop environmental protection measures during the construction of a deep sea port in the Dry Sea gulf.
Aviation Fueling: A Cleaner, Greener Approach
Directory of Open Access Journals (Sweden)
Robert C. Hendricks
2011-01-01
Full Text Available Projected growth of aviation depends on fueling where specific needs must be met. Safety is paramount, and along with political, social, environmental, and legacy transport systems requirements, alternate aviation fueling becomes an opportunity of enormous proportions. Biofuels—sourced from halophytes, algae, cyanobacteria, and “weeds” using wastelands, waste water, and seawater—have the capacity to be drop-in fuel replacements for petroleum fuels. Biojet fuels from such sources solve the aviation CO2 emissions issue and do not compete with food or freshwater needs. They are not detrimental to the social or environmental fabric and use the existing fuels infrastructure. Cost and sustainable supply remain the major impediments to alternate fuels. Halophytes are the near-term solution to biomass/biofuels capacity at reasonable costs; they simply involve more farming, at usual farming costs. Biofuels represent a win-win approach, proffering as they do—at least the ones we are studying—massive capacity, climate neutral-to-some sequestration, and ultimately, reasonable costs.
Czech Academy of Sciences Publication Activity Database
Hroudová, Zdenka; Zákravský, Petr; Flegrová, Monika
2014-01-01
Roč. 112, Jan. 2014 (2014), s. 66-75 ISSN 0304-3770 R&D Projects: GA AV ČR IAA6005905 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : halophytes * stress tolerance * wetlands Subject RIV: EF - Botanics Impact factor: 1.608, year: 2014
Vera-Estrella, Rosario; Barkla, Bronwyn J; Pantoja, Omar
2014-12-05
Halophytes have evolved unique molecular strategies to overcome high soil salinity but we still know very little about the main mechanisms that these plants use to complete their lifecycle under salinity stress. One useful approach to further our understanding in this area is to directly compare the response to salinity of two closely related species which show diverse levels of salt tolerance. Here we present a comparative proteomic study using DIGE of leaf microsomal proteins to identify salt-responsive membrane associated proteins in Arabidopsis thaliana (a glycophyte) and Thellungiella salsuginea (a halophyte). While a small number of distinct protein abundance changes were observed upon salt stress in both species, the most notable differences were observed between species and specifically, in untreated plants with a total of 36 proteins displaying significant abundance changes. Gene ontology (GO) term enrichment analysis showed that the majority of these proteins were distributed into two functional categories; transport (31%) and carbohydrate metabolism (17%). Results identify several novel salt responsive proteins in this system and support the theory that T. salsuginea shows a high degree of salt-tolerance because molecular mechanisms are primed to deal with the stress. This intrinsic ability to anticipate salinity stress distinguishes it from the glycophyte A. thaliana. There is significant interest in understanding the molecular mechanisms that plants use to tolerate salinity as soil salinization is becoming an increasing concern for agriculture with high soil Na(+) levels leading to reduced yields and economic loss. Much of our knowledge on the molecular mechanisms employed by plants to combat salinity stress has come from work on salt-sensitive plants, but studies on naturally occurring highly salt-resistant plants, halophytes, and direct comparisons between closely related glycophytes and halophytes, could help to further our understanding of salinity
Flora and vegetation of the Saint David and Lewis Springs Cienegas, Cochise County, Arizona
Elizabeth Makings
2013-01-01
In the Sky Island region, cienegas are rare marshlands amidst arid surroundings where groundwater perennially intersects the surface. Their unique physical properties give rise to a characteristic plant community dominated by wetland graminoids. Evaporation usually causes the water to be alkaline, and vegetation around a cienega commonly includes halophytes and other...
Analysis of oilseed of Halophytic species
Directory of Open Access Journals (Sweden)
Parto Roshandel
2015-07-01
Full Text Available Seeds of Atriplex griffithii, Haloxylon ammodendron, Salicornia europaea and Salsola yazdiana were analyzed to determine their potential as sources of edible oil. The quantity of total oil varied from 13.8% in Atriplex griffithii to 20.9% in H. ammodendron. The proportion of unsaturated fatty acids were higher (62-73.8%, with the highest values of α-linoleic acid (18.6%, linoleic acid (28.6% and oleic acid (19.7% in the seeds of A. griffithii, H. ammodendron and S. europaea, respectively. Results of physicochemical evaluation of the extracted oils ranged as follows: iodine values, 99.8-106.5 (g I2/100 g; saponification value, 188-283 (mg KOH/1g of oil; peroxide value, 9-13 (meq./kg and refractive index, 1.4750- 1.4761. Amongst these oilseeds, S. europaea (containing 73.8% unsaturated fatty acids but not erucic acid was the highest in quality for human consumption followed by H. ammodendron.
Polymorphisms of the prion protein gene Arabi sheep breed in Iran ...
African Journals Online (AJOL)
Ovine scrapie is a neurodegenerative disease caused by polymorphisms of the prion protein gene (Prnp); especially the amino acid residue alterations at codons 136, 154, and 174, in sheep have been found to be associated with susceptibility to scrapie disease. We studied Prnp polymorphisms in local sheep of ...
Polymorphisms of the prion protein gene Arabi sheep breed in Iran
African Journals Online (AJOL)
Novin
2011-11-09
Nov 9, 2011 ... Key words: Prion protein gene (Prnp), polymorphisms, susceptibility, scrapie. INTRODUCTION. Scrapie is an invariably fatal .... consists of a DNA denaturation step (5 min at 95°C), followed by 30 amplification cycles ...
Short Communication Assessing the ability of fodder beet ( Beta ...
African Journals Online (AJOL)
A pot experiment was carried out to determine the sodium (Na) absorption ability of halophytic fodder beet (Beta vulgaris L. ʽBrigadierʼ) irrigated with water enriched to Na levels found in winery wastewater. Treatments comprised (1) soil without plants irrigated with untreated water or (2) Na-enriched water, and (3) fodder ...
Localization and composition of seed oils of Crithmum maritimum L ...
African Journals Online (AJOL)
GREGORY
2010-09-27
Sep 27, 2010 ... 1Laboratoire d'Adaptation des Plantes aux Stress Abiotiques, Centre de ... was rich with oleic acid (78.6%), low level of palmitic acid (4.8%) and non negligible amount of linoleic ... soils, only some halophytes can support these conditions. ... Mature fruits were collected in December 2007 from plants in the.
Enzymatic regulation of organic acid metabolism in an alkali-tolerant ...
African Journals Online (AJOL)
Chloris virgata, an alkali-tolerant halophyte, was chosen as the test material for our research. The seedlings of C. virgata were treated with varying salt and alkali stress. First, the composition and content of organic acids in shoots were analyzed and the results indicated that there was not only a significant increase in total ...
Directory of Open Access Journals (Sweden)
Sylvie MATHÉ
2003-06-01
Full Text Available Stendhal, dans “De l’Amour” (1822 — cette physiologie qu’il considéra toute sa vie comme son œuvre principale, où il exposait cette science du bonheur pour lui si essentielle —, consacre un chapitre à l’amour aux États-Unis (chapitre 50, entre autres chapitres sur l’Italie, l’Angleterre, l’Espagne, la Provence ou encore l’Arabie. S’interrogeant sur l’amour et sur la poursuite du bonheur chère aux Américains, il écrit : On dirait que la source de la sensibilité se tarit chez ces gens-là. Ils...
Directory of Open Access Journals (Sweden)
Siwon Lee
2013-09-01
Full Text Available For quarantine purpose, we developed the RT- and nested PCR module of Tomato black ring virus (TBRV, Arabis mosaic virus (ArMV, Cherry leafroll virus (CLRV and Grapevine fanleaf virus (GFLV. The PCR modules, developed in this study make diagnosis more convenient and speedy because of same PCR condition. And also, the methods are more accurate because it can check whether the result is contamination or not using the mutation-positive control. We discard or return the 27 cases of Nepovirus infection seed by employing the module past 3 years. This study provides a rapid and useful method for detection of four quarantine plant viruses.
Agabi, C.
2012-01-01
Entre Essaouira au Nord et Agadir au Sud, s’étend le vaste pays haha peuplé de Berbères en partie arabisés. Cette région voit s’affaisser les dernières pentes du Haut Atlas occidental qui tombe assez brusquement dans l’Océan, entre le cap Ghir et les hauteurs qui dominent le port d’Agadir. Le pays haha est un vaste plateau qui verrouille au Sud-Ouest le Haouz* de Marrakech. Il est partout profondément raviné par des oueds généralement à sec ou qui écoulent rapidement les eaux de pluie qui n’o...
La classificazione aristotelica delle scienze in Pietro d'Abano
Directory of Open Access Journals (Sweden)
Enrico Berti
2014-12-01
Full Text Available La classificazione delle scienze di Pietro d'Abano costituisce un'interessante riformulazione della classificazione analoga, proposta da Aristotele in Metaph. VI, e della teoria degli abiti dianoetici, proposta da Aristotele in Eth. Nic. VI. Come risulta dal Conciliator per quanto concerne la medicina e dal Lucidator per quanto concerne l'astronomia, Pietro segue la classificazione aristotelica e le interpretazioni che di essa erano state date nel medioevo (dottrina dei tre gradi di astrazione e distinzione tra methodus compositiva e methodus resolutiva, aggiungendovi come contributo originale l'introduzione di una parte pratica sia nella medicina che nell'astronomia (astronomia iudicialis, dove quest'ultima deriva da Tolomeo e dagli Arabi.
HALOFYTNÍ ROSTLINY A JEJICH MOŽNÉ VYUŽITÍ VE FYTOREMEDIACÍCH
Czech Academy of Sciences Publication Activity Database
Moťková, Kateřina; Podlipná, Radka; Vaněk, Tomáš; Kafka, Z.
2014-01-01
Roč. 108, č. 6 (2014), s. 586-591 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) OC10028 Institutional support: RVO:61389030 Keywords : halophytic plants * phytoremediation * heavy metals Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides Impact factor: 0.272, year: 2014 http://www.chemicke-listy.cz/docs/full/2014_06_586-591.pdf
NaCl salinity affects lateral root development in Plantago maritima
Rubinigg, M; Wenisch, J; Elzenga, JTM; Stulen, [No Value
2004-01-01
Root growth and morphology were assessed weekly in hydroponically-grown seedlings of the halophyte Plantago maritima L. during exposure to 0, 50, 100 and 200 mM NaCl for 21 d. Relative growth rate was reduced by 25% at 200 mM NaCl. The lower NaCl treatments did not affect relative growth rates.
Energy Technology Data Exchange (ETDEWEB)
Landrum, P.F.; Crosby, D.G.
1981-01-01
1. The disposition of an aromatic amine and three aromatic nitro compounds was investigated in the sea urchin, Strongylocentrotus purpuratus. 2. The sea urchin rapidly eliminated injected compounds. The elimination rate constants decreased in the order p-toluidine greater than p-nitroanisole . p-nitrophenol greater than p-nitrotoluene. The fraction of total injected compound eliminated in 8 h was lowest for p-nitrophenol less than p-toluidine less than p-nitrotoluene less than p-nitroanisole. 3. Biotransformation for the sea urchin was primarily reduction of the nitro group followed by acetylation of the amine. 4. Other animals, starfish (Pisaster ochraceus), sea cucumber (Cucumaria miniata), gum boot chiton (Cryptochiton stelleri) and mussels (Mytilus californianus), injected with p-nitroanisole exhibited a trend toward oxidative biotransformation. 5. Elimination of parent compound was the major pathway for reducing body burden of xenobiotics for the invertebrates studied. 6. p-Toluidine oxidizes during analysis and was thus not suitable for studying biotransformation.
Directory of Open Access Journals (Sweden)
Mustofa Umar
2016-09-01
Full Text Available Abstract: The main purpose of this article (research is to provide the unity of coherent conceptual frameworks between religion and science on the discourse about the origins of the universe. Contemporary cosmological theories reveal the continuing encounter between physics and theology (religion. The concepts of modern physics show surprising parallels to the ideas expressed in the religious philosophies that the basic features of their worldview are the same. Mystical traditions are present in all religions and they also can be found in the theory of modern physics on the holistic conception of reality. It obviously indicates a new “paradigm”— a new vision of reality. By the “antinomic” principles of light, both religion and science, ontologically, can trace the beginning of the universe, and also unveil the deepest secrets of the laws of physics. Light as the basic ontology of reality in the hadith texts has been used by muslem theosophists (sufi to formulate their theories of the universe creation, especially, in the sufism of Ibn Arabi. His cosmological concepts are essentially similar to the scientific conceptions of cosmology and completely in accordance with the laws of physics in the very heart of the cosmos itself. At the moment, the integration of religion and science has arrived at the same holistic conception of reality. As the pillar of civilization, both are expected to go hand in hand and form a powerful force for social change in the new conceptual frameworks for ways of life, thought, and consciousness. Abstrak: Tujuan utama dari artikel (riset ini adalah untuk membuktikan terdapatnya kesatuan kerangka konseptual yang koheren antara agama dan sains tentang persoalan muasal alam semesta. Teori-teori kosmologi modern menunjukkan adanya titik temu yang berkelanjutan antara sains dan teologi (agama. Konsep-konsep fisika modern memperlihatkan kesejajaran yang menakjubkan terhadap ide-ide yang diungkapkan dalam filsafat
Directory of Open Access Journals (Sweden)
Tatyana I. Tsymbalyuk
2012-03-01
Full Text Available The pollen morphology of Suaeda acuminata , S. prostratа and Tamarix ramosissima from Ukrainian flora has been studied with light and scanning electron microscopy. The main morphological features of pollen grains of three taxa, which spread within halophytes vegetation, are determined. The results has considered as potential useful for identification of the fossil pollen under paleopalynological or paleoecological study.
Anticancer Drugs from Marine Flora: An Overview
Sithranga Boopathy, N.; Kathiresan, K.
2010-01-01
Marine floras, such as bacteria, actinobacteria, cyanobacteria, fungi, microalgae, seaweeds, mangroves, and other halophytes are extremely important oceanic resources, constituting over 90% of the oceanic biomass. They are taxonomically diverse, largely productive, biologically active, and chemically unique offering a great scope for discovery of new anticancer drugs. The marine floras are rich in medicinally potent chemicals predominantly belonging to polyphenols and sulphated polysaccharide...
Kansen voor beschermde tuinbouw in Saoedi-Arabie en de Verenigde Arabische Emiraten
Wijnands, J.H.M.; Maaswinkel, R.H.M.
2007-01-01
Beschermde tuinbouw heeft potentie in de Golfstaten. De overheden streven naar diversificatie van de economie om in de toekomst minder afhankelijk van olie-inkomsten te zijn. De huidige situatie van de keten van beschermde teelten wordt geanalyseerd met Porters diamant. Ontwikkelingsstrategieën voor
L’Arabie du Sud antique vue de l’intérieur :
Directory of Open Access Journals (Sweden)
Rémy Crassard
2007-03-01
Full Text Available Le Yémen a vu se développer ces dernières années des programmes de prospections et fouilles menés exclusivement par les Yéménites, jusqu’alors réalisés par les missions étrangères en coopération avec les équipes du GOAM et des universités yéménites. Parallèlement, une nouvelle génération des chercheurs formés aux universités de Sanaa et d’Aden ou aux universités étrangères s’est constituée. Nombreux ouvrages de recherches sur l’archéologie et l’histoire de Yémen préislamique, rédigés en langue arabe, ont vu le jour. Ces ouvrage font apparaître pour la première fois une approche de l’histoire du Yémen préislamique fondée, non pas sur les mythes et les légendes, mais sur l’archéologie et l’épigraphie. Cette nouvelle vision de l’histoire proposée par les chercheurs Yéménites doit faire face à une école traditionnelle, bien ancrée dans la mentalité de la population, qui défend une lecture légendaire de l’histoire du Yémen avant l’Islam.Ancient South Arabia as Seen from the Inside: The Archeological Excavations of the Yemeni ResearchersThough until recently, prospecting and archeological excavations have been carried out mostly by foreign expeditions (with the collaboration of the research teams from the Antiquities Department, during the past few years there have been programs in Yemen run exclusively by Yemeni institutions.Simultaneously, a new generation of researchers has appeared who graduated not from foreign universities but received their education at the universities of Sanaa, Aden and Dhamar. Numerous archeological and historical studies of the pre-Islamic period of Yemen were published in Arabic. For the first time, such studies adopt a methodology based not on myths and legends but on the strictly scientific data of archeology and epigraphy. Being in conflict with a more traditional school, which still dominates collective mentality and which defends a legendary reading of the history of Yemen before Islam, this new vision of history proposed by Yemeni researchers tends to influence more and more profoundly the Yemeni educated public.
The Role of the Introductory Matter in Bilingual Dictionaries of English and Arabic
Directory of Open Access Journals (Sweden)
Hashan Al-Ajmi
2011-10-01
Full Text Available
Abstract: Monolingual and bilingual dictionaries for learners of English as foreign language differ from each other in many aspects. Among the differences are the types of information a dictionary provides outside the A?Z word list, especially in its introductory matter. Yet, dictionary introductions have been referred to rather peripherally in the literature on dictionary users and uses. Within the context of lexicographic practice, this study aims to outline the differences between EFL learner's dictionaries and bilingual English?Arabic dictionaries, and to determine to what extent a given set of popular dictionaries provide varied and sufficient information in their introductions. Three categories of dictionaries will be the subject of comparison: EFL dictionaries, European bilingual dictionaries, and bilingual dictionaries in the Arab world.
Keywords: BILINGUAL DICTIONARY, INTRODUCTORY MATTER, ENGLISH?ARABIC, EFL LEARNER'S DICTIONARY, ORIENTALIST DICTIONARY
Opsomming: Die rol van die inleidende gedeelte in tweetalige woordeboekevan Engels en Arabies. Eentalige en tweetalige woordeboeke vir aanleerders vanEngels as vreemde taal verskil in baie opsigte van mekaar. Een van die verskille is die tipes inligtingwat 'n woordeboek buite die A–Z-woordelys verskaf, veral in die inleidende gedeelte. Tog isdaar slegs in die verbygaan na woordeboekinleidings in die literatuur oor woordeboekgebruikersen -gebruik verwys. Hierdie studie het dit ten doel om, binne die konteks van die leksikografiesepraktyk, die verskille uit te stippel tussen EVT-aanleerderswoordeboeke en tweetalige Engels–Arabiesewoordeboeke, en te bepaal in watter mate 'n gegewe groep gewilde woordeboeke veelsoortigeen genoegsame inligting in hul inleidings verskaf. Drie kategorieë woordeboeke sal die onderwerpvan hierdie vergelyking vorm: EVT-woordeboeke, Europese tweetalige woordeboeke entweetalige woordeboeke binne die Arabiese w
Erhardt, Georg; Shuiep, El Tahir Salih; Lisson, Maria; Weimann, Christina; Wang, Zhaoxin; El Zubeir, Ibtisam El Yas Mohamed; Pauciullo, Alfredo
2016-06-01
Milk samples of 193 camels (Camelus dromedarius) from different regions of Sudan were screened for casein variability by isoelectric focusing. Kappa-casein and beta-casein were monomorphic, whereas three protein patterns named αs1-casein A, C, and D were identified. The major allele A revealed frequencies of 0.79 (Lahaoi), 0.75 (Shanbali), 0.90 (Arabi Khali), and 0.88 (Arabi Gharbawi) in the different ecotypes. CSN1S1*C shows a single G > T nucleotide substitution in the exon 5, leading to a non-synonymous amino acid exchange (p.Glu30 > Asp30) in comparison to CSN1S1*A and D. At cDNA level, no further single nucleotide polymorphisms could be identified in CSN1S1* A, C, and D, whereas the variants CSN1S1*A and CSN1S1*C are characterized by missing of exon 18 compared to the already described CSN1S1*B, as consequence of DNA insertion of 11 bp at intron 17 which alter the pre-mRNA spliceosome machinery. A polymerase chain-restriction fragment length polymorphism method (PCR-RFLP) was established to type for G > T nucleotide substitution at genomic DNA level. The occurrence and differences of IgE-binding epitopes and bioactive peptides between αs1-casein A, C, and D after digestion were analyzed in silico. The amino acid substitutions and deletion affected the arising peptide pattern and thus modifications between IgE-binding epitopes and bioactive peptides of the variants were found. The allergenic potential of these different peptides will be investigated by microarray immunoassay using sera from milk-sensitized individuals, as it was already demonstrated for bovine αs1-casein variants.
Louis Massignon l'amour mystique ou l'extase dans l'abandon
Jacques Keryell
2008-01-01
Parler de Massignon et de son Amour de Dieu n'est pas chose aisée. En effet, si les mystiques musulmans des premiers siècles de l'hégire ont été les hérauts de cet Amour : Al-Hallâj, Râbia al-Adawiyya, Al-Niffâri, Ibn Arabi, Ansâri, Al-Ghazâli, l'Amour de Dieu comme tel, n'est pas au cœur du "ilm al kalâm", de la théologie musulmane traditionnelle. Pour Massignon, langue et spiritualité étaient intimement liées. Si je devais me placer dans une perspective musulmane, je dirais que Louis Massig...
Physiological and biochemical responses of halophyte Kalidium ...
African Journals Online (AJOL)
Administrator
2011-09-21
Sep 21, 2011 ... Peroxidase (POD) activity was determined by methyl catechol reaction. Fresh leaf tissue (2.5 g) with 4 ml phosphate buffer (50. mM, pH 5.5) was ground into homogenate on ice bath, then centrifugated in 3000 rpm at 4°C for 10 min to get crude extract of. POD. 1 ml of methyl catechol (50 mM) was brought to ...
Stable Agrobacterium -mediated transformation of the halophytic ...
African Journals Online (AJOL)
RT-RCR analysis was conducted using salt stressed transgenic plants, and the results suggested that 2-Cys Prx had low transcription levels under non-stressed conditions, and increased transcription after 6 h of 200 mM NaCl stress. This gene continued to demonstrate high levels of transcription until 6 h after withdrawal of ...
Pitzschke, Andrea
2016-01-01
Among potential climate change-adapted crops for future agriculture, quinoa (Chenopodium quinoa), a facultative halophyte plant with exceptional nutritional properties, stands out as a prime candidate. This work examined how quinoa deals with extreme situations during seed rehydration. A seed-borne microbiome was discovered and its potential role in early development and stress resistance investigated.Methods involved germination and drought exposure assays, histochemical detection of reactiv...
2009-01-01
that M. cer- ifera experienced a drought response, as seen in decreases in stomatal conductance, photosynthesis , and RWC relative to earlier in the...halophytic seagrass . However, Iva frutescens generally only occurs at elevations where the roots are not subject to prolonged water table flooding...sensing: 2. Measurement of leaf and canopy reflectance changes at 531 nm and their relationship with photosynthesis and chlorophyll fluorescence. Remote
Occurrence of organohalogens at the Dead Sea Basin
Tubbesing, Christoph; Kotte, Karsten; Keppler, Frank; Krause, Torsten; Bahlmann, Enno; Schöler, Heinfried
2013-04-01
Most arid and semi-arid regions are characterized by evaporites, which are assured sources for volatile organohalogens (VOX) [1]. These compounds play an important role in tropospheric and stratospheric chemistry. The Dead Sea between Israel and Jordan is the world's most famous and biggest all-season water covered salt lake. In both countries chemical plants like the Dead Sea Works and the Arab Potash Company are located at the southern part of the Dead Sea and mine various elements such as bromine and magnesium. Conveying sea water through constructed evaporation pans multifarious salts are enriched and precipitated. In contrast, the Northern basin and main part of the Dead Sea has remained almost untouched by industrial salt production. Its fresh water supply from the Jordan River is constantly decreasing, leading to further increased salinity. During a HALOPROC campaign (Natural Halogenation Processes in the Environment) we collected various samples including air, soils, sediments, halophytic plants, ground- and seawater from the Northern and Southern basin of the Israeli side of the Dead Sea. These samples were investigated for the occurrence of halocarbons using different analytical techniques. Most samples were analyzed for volatile organohalogens such as haloalkanes using gas chromatography- mass spectrometry (GC-MS). Interestingly, there is a strong enrichment of trihalomethanes (THM), especially all chlorinated and brominated ones and also the iodinated compound dichloroiodomethane were found in the Southern basin. In addition, volatile organic carbons (VOC) such as ethene and some other alkenes were analyzed by a gas chromatography-flame ionisation detector (GC-FID) to obtain further information about potential precursors of halogenated compounds. Halophytic plants were investigated for their potential to release chloromethane and bromomethane but also for their stable carbon and hydrogen isotope composition. For this purpose, a plant chamber was
Persistence of Gulf War oil versus intertidal morphology and sediments - one year later
International Nuclear Information System (INIS)
Montello, T.M.; Hayes, M.O.; Michel, J.; Al-Momen, A.H.; Al-Mansi, A.M.; Aurand, D.V.
1993-01-01
A study of the persistence of oil in the intertidal habitats of the Saudi Arabian coast was carried out one year after the Gulf war spill in conjunction with the National Oceanic and Atmospheric Administration ship Mt. Mitchell's ROPME Sea Cruise. A total of 10 kilometers of transects were surveyed at 20 stations, representing heavily oiled sheltered beaches, tidal flats, algal mats, halophyte saltmarshes, and mangroves at the heads of bays
Aviation Fueling: A Cleaner, Greener Approach
Hendricks, Robert C.; Bushnell, Dennis M.; Shouse, Dale T.
2011-01-01
Projected growth of aviation depends on fueling where specific needs must be met. Safety is paramount, and along with political, social, environmental, and legacy transport systems requirements, alternate aviation fueling becomes an opportunity of enormous proportions. Biofuels—sourced from halophytes, algae, cyanobacteria, and “weeds” using wastelands, waste water, and seawater—have the capacity to be drop-in fuel replacements for petroleum fuels. Biojet fuels from such sources solve the avi...
Ramey, Andy M.; Pearce, John M.; Reeves, A.B.; Franson, J. Christian; Petersen, Margaret R.; Ip, Hon S.
2011-01-01
Avian influenza virus (AIV) prevalence and sequence data were analyzed for Steller's eiders (Polysticta stelleri) to assess the role of this species in transporting virus genes between continents and maintaining a regional viral reservoir with sympatric northern pintails (Anas acuta). AIV prevalence was 0.2% at Izembek Lagoon and 3.9% at Nelson Lagoon for Steller's eiders and 11.2% for northern pintails at Izembek Lagoon. Phylogenetic analysis of 13 AIVs from Steller's eiders revealed that 4.9% of genes were of Eurasian origin. Seven subtypes were detected, including two also observed in northern pintails. No AIV strains were highly similar (> 99%) at all gene segments between species; however, highly similar individual genes were detected. The proportion of highly similar genes was greater within rather than between species. Steller's eiders likely transport AIV genes between continents through long-distance migratory movements. Differences in AIV prevalence, subtype distribution, and the proportion of highly similar genes suggest limited AIV exchange between Steller's eiders and northern pintails at Alaska Peninsula coastal lagoons during autumn.
The perfect man in the literary opus of John Climacus and Ibn Arabi
Directory of Open Access Journals (Sweden)
Rašić Dunja
2015-01-01
Full Text Available In search of the perfect man of the Islamic and Christian mysticisms, this paper also discusses the nature of mystical knowledge, to whose domain the perfect man, as the highest model of human existence and spiritual life, indisputably belongs. This study belongs to the philosophical discipline of comparative philosophy. Hence, searching for the lost paradise of human existence, still remembering the taste of bliss of residence filled only with infinite happiness, this paper will consider the extent to which the methodology of Paul Masson-Oursel and Henry Corbin, as two well-known comparative philosophy research methods can try to measure their strength with cryptic teachings of mysticism.
Directory of Open Access Journals (Sweden)
Hui-Juan Gao
2017-12-01
Full Text Available Haloxylon ammodendron, a perennial xero-halophyte, is an essential species for investigating the effects of drought on desert tree. To gain a comprehensive knowledge on the responses of H. ammodendron to drought stress, we specially performed the molecular and physiological analysis of H. ammodendron in response to −0.75 MPa osmotic stress for six and 24 h in lab condition via RNA-seq and digital gene expression (DGE. In total, 87,109 unigenes with a mean length of 680 bp and 13,486 potential simple sequence repeats (SSRs were generated, and 3353 differentially expressed genes (DEGs in shoots and 4564 in roots were identified under stress. These DEGs were mainly related to ion transporters, signal transduction, ROS-scavenging, photosynthesis, cell wall organization, membrane stabilization and hormones. Moreover, the physiological changes of inorganic ions and organic solute content, peroxidase (POD activity and osmotic potential were in accordance with dynamic transcript profiles of the relevant genes. In this study, a detailed investigation of the pathways and candidate genes identified promote the research on the molecular mechanisms of abiotic stress tolerance in the xero-halophytic species. Our data provides valuable genetic resources for future improvement of forage and crop species for better adaptation to abiotic stresses.
Ecological Effects of Roads on the Plant Diversity of Coastal Wetland in the Yellow River Delta
Directory of Open Access Journals (Sweden)
Yunzhao Li
2014-01-01
Full Text Available The 26 sample sites in 7 study plots adjacent to asphalt road and earth road in coastal wetland in the Yellow River Delta were selected to quantify plant diversity using quadrat sampling method in plant bloom phase of July and August 2012. The indice of βT and Jaccard’s coefficient were applied to evaluate the species diversity. The results showed that the plant diversities and alien plants were high in the range of 0–20 m to the road verge. There were more exotics and halophytes in plots of asphalt roadside than that of earth roadside. However, proportion of halophytes in habitats of asphalt roadsides was lower than that of earth roadside. By comparing β-diversity, there were more common species in the asphalt roadsides than that in the earth roadsides. The similarity of plant communities in studied plots of asphalt roadsides and earth roadsides increased with increasing the distance to road verge. The effect range of roads for plant diversity in study region was about 20 m to road verge. Our results indicate that the construction and maintenance of roads in wetland could increase the plant species diversities of communities and risk of alien species invasion.
Jha, Anupama; Joshi, Mukul; Yadav, Narendra Singh; Agarwal, Pradeep K; Jha, Bhavanath
2011-03-01
Salinity causes multifarious adverse effects to plants. Plants response to salt stress involves numerous processes that function in coordination to alleviate both cellular hyperosmolarity and ion disequilibrium. A Na(+)/H(+) antiporter NHX1 gene has been isolated from a halophytic plant Salicornia brachiata in this study. Predicted amino acid sequence similarity, protein topology and the presence of functional domains conserved in SbNHX1 classify it as a plant vacuolar NHX gene. The SbNHX1 cDNA has an open reading frame of 1,683 bp, encoding a polypeptide of 560 amino acid residues with an estimated molecular mass 62.44 kDa. The SbNHX1 shows high amino acid similarity with other halophytic NHX gene and belongs to Class-I type NHXs. TMpred suggests that SbNHX1 contains 11 strong transmembrane (TM). Real time PCR analysis revealed that SbNHX1 transcript expresses maximum at 0.5 M. Transcript increases gradually by increasing the treatment duration at 0.5 M NaCl, however, maximum expression was observed at 48 h. The overexpression of SbNHX1 gene in tobacco plant showed NaCl tolerance. This study shows that SbNHX1 is a potential gene for salt tolerance, and can be used in future for developing salt tolerant crops.
Marasco, Ramona; Mapelli, Francesca; Rolli, Eleonora; Mosqueira Santillá n, Marí a José
2016-01-01
Halophytes classified under the common name of salicornia colonize salty and coastal environments across tidal inundation gradients. To unravel the role of tide-related regimes on the structure and functionality of root associated bacteria, the rhizospheric soil of Salicornia strobilacea (synonym of Halocnemum strobilaceum) plants was studied in a tidal zone of the coastline of Southern Tunisia. Although total counts of cultivable bacteria did not change in the rhizosphere of plants grown along a tidal gradient, significant differences were observed in the diversity of both the cultivable and uncultivable bacterial communities. This observation indicates that the tidal regime is contributing to the bacterial species selection in the rhizosphere. Despite the observed diversity in the bacterial community structure, the PGP potential of cultivable rhizospheric bacteria, assessed through in vitro and in vivo tests, was equally distributed along the tidal gradient. Root colonization tests with selected strains proved that halophyte rhizospheric bacteria (i) stably colonize S. strobilacea rhizoplane and the plant shoot suggesting that they move from the root to the shoot and (ii) are capable of improving plant growth. The versatility in the root colonization, the overall PGP traits and the in vivo plant growth promotion under saline condition suggest that such beneficial activities likely take place naturally under a range of tidal regimes.
Marasco, Ramona
2016-04-01
Halophytes classified under the common name of salicornia colonize salty and coastal environments across tidal inundation gradients. To unravel the role of tide-related regimes on the structure and functionality of root associated bacteria, the rhizospheric soil of Salicornia strobilacea (synonym of Halocnemum strobilaceum) plants was studied in a tidal zone of the coastline of Southern Tunisia. Although total counts of cultivable bacteria did not change in the rhizosphere of plants grown along a tidal gradient, significant differences were observed in the diversity of both the cultivable and uncultivable bacterial communities. This observation indicates that the tidal regime is contributing to the bacterial species selection in the rhizosphere. Despite the observed diversity in the bacterial community structure, the PGP potential of cultivable rhizospheric bacteria, assessed through in vitro and in vivo tests, was equally distributed along the tidal gradient. Root colonization tests with selected strains proved that halophyte rhizospheric bacteria (i) stably colonize S. strobilacea rhizoplane and the plant shoot suggesting that they move from the root to the shoot and (ii) are capable of improving plant growth. The versatility in the root colonization, the overall PGP traits and the in vivo plant growth promotion under saline condition suggest that such beneficial activities likely take place naturally under a range of tidal regimes.
Novel water filtration of saline water in the outermost layer of mangrove roots.
Kim, Kiwoong; Seo, Eunseok; Chang, Suk-Kyu; Park, Tae Jung; Lee, Sang Joon
2016-02-05
The scarcity of fresh water is a global challenge faced at present. Several desalination methods have been suggested to secure fresh water from sea water. However, conventional methods suffer from technical limitations, such as high power consumption, expensive operating costs, and limited system durability. In this study, we examined the feasibility of using halophytes as a novel technology of desalinating high-concentration saline water for long periods. This study investigated the biophysical characteristics of sea water filtration in the roots of the mangrove Rhizophora stylosa from a plant hydrodynamic point of view. R. stylosa can grow even in saline water, and the salt level in its roots is regulated within a certain threshold value through filtration. The root possesses a hierarchical, triple layered pore structure in the epidermis, and most Na(+) ions are filtered at the first sublayer of the outermost layer. The high blockage of Na(+) ions is attributed to the high surface zeta potential of the first layer. The second layer, which is composed of macroporous structures, also facilitates Na(+) ion filtration. This study provides insights into the mechanism underlying water filtration through halophyte roots and serves as a basis for the development of a novel bio-inspired desalination method.
Ecological Effects of Roads on the Plant Diversity of Coastal Wetland in the Yellow River Delta
Li, Yunzhao; Du, Siyao; Han, Guangxuan; Qu, Fanzhu; Wang, Guangmei; Fu, Yuqin; Zhan, Chao
2014-01-01
The 26 sample sites in 7 study plots adjacent to asphalt road and earth road in coastal wetland in the Yellow River Delta were selected to quantify plant diversity using quadrat sampling method in plant bloom phase of July and August 2012. The indice of β T and Jaccard's coefficient were applied to evaluate the species diversity. The results showed that the plant diversities and alien plants were high in the range of 0–20 m to the road verge. There were more exotics and halophytes in plots of asphalt roadside than that of earth roadside. However, proportion of halophytes in habitats of asphalt roadsides was lower than that of earth roadside. By comparing β-diversity, there were more common species in the asphalt roadsides than that in the earth roadsides. The similarity of plant communities in studied plots of asphalt roadsides and earth roadsides increased with increasing the distance to road verge. The effect range of roads for plant diversity in study region was about 20 m to road verge. Our results indicate that the construction and maintenance of roads in wetland could increase the plant species diversities of communities and risk of alien species invasion. PMID:25147872
Huang, Jianzi; Lu, Xiang; Yan, Hao; Chen, Shouyi; Zhang, Wanke; Huang, Rongfeng; Zheng, Yizhi
2012-01-01
Semi-mangroves form a group of transitional species between glycophytes and halophytes, and hold unique potential for learning molecular mechanisms underlying plant salt tolerance. Millettia pinnata is a semi-mangrove plant that can survive a wide range of saline conditions in the absence of specialized morphological and physiological traits. By employing the Illumina sequencing platform, we generated ∼192 million short reads from four cDNA libraries of M. pinnata and processed them into 108 ...
Pandey, Sonika; Patel, Manish Kumar; Mishra, Avinash; Jha, Bhavanath
2016-01-01
Cumin is an annual, herbaceous, medicinal, aromatic, spice glycophyte that contains diverse applications as a food and flavoring additive, and therapeutic agents. An efficient, less time consuming, Agrobacterium-mediated, a tissue culture-independent in planta genetic transformation method was established for the first time using cumin seeds. The SbNHX1 gene, cloned from an extreme halophyte Salicornia brachiata was transformed in cumin using optimized in planta transformation method. The SbN...
Aviation Fueling: A Cleaner, Greener Approach
2011-01-01
Considered a noxious weed, it produces 5–10 kg-biomass/m2-yr (similar to macroalgae ), a source of pyrolysis fuels with beneficial water treatment International...donax) pro- duce 23–50 ton/acre. It tolerates some salinity and brackish waters and also overwhelms native vegetation. Seaweed, a macroalgae , has...halophytes, algae, cyanobacteria, and “weeds” using wastelands, waste water , and seawater— have the capacity to be drop-in fuel replacements for
Improved methodologies for extraction of salt in halophytes
Directory of Open Access Journals (Sweden)
Tiago Morais
2014-06-01
This method yield rates in Salicornia appear to be higher than the expected based on previous publication. The data suggests other elements of interest may be differently distributed between the two genera. A nutritional profile, which we intend to do, may elucidate about the contents of vegetable salt.
Antioxidative response mechanisms in halophytes: their role in ...
Indian Academy of Sciences (India)
changes in ionic and water balance cause molecular damage and growth arrest. ... An optimal supply of CO2 determines the availability of. NADP to leaves via the ...... plasts in the plant cell, but could also leak into the cytosol, resulting in ...
Toderich, Kristina; Khujanazarov, Timur; Aralova, Dildora; Shuyskaya, Elena; Gismatulina, Liliya; Boboev, Hasan
2017-04-01
The working hypothesis of this article support an indication of declining water quality, increasing soils salinity and higher production costs in the Bukhara oasis- a borderline lands between the sandy Kyzylkum Desert and irrigated zone in the lower stream of Zarafshan River Basin. The pollution of waters and soils with toxic metals is the major environmental problem in these agro-ecological zones. Conventional remediation approaches usually do not ensure adequate results. The mobility of toxic pollutants can be highly facilitated by the chemical properties of soils and the aridity of the climate. The impact of these factors of land degradation induces reduction in biodiversity and yields losses of agricultural crops and wild desert plant communities. A recent survey showed that the chemical composition of the drainage effluents is sulfate-chloride-hydrocarbonate - magnesium-sodium-calcium with high level of mineralization 4200 - 18800 ppm. Concentration of chloride and sulfate, detected both in drainage effluents and ground water, is 10 times higher than maximum allowable concentration (MAC); and traces of heavy metals, such as strontium, selenium, arsenic, lead, zinc, uranium are 2 times higher than MAC. Distribution of boron showed a strong correlation with those of arsenic and antimony. Aluminum has a significant correlation with arsenic and lead distribution. Antimony correlates significantly with zinc and arsenic, while copper and iron (Fe57) also well correlate with each other. Because these metals rarely exist in natural environment, it is presumed that they are caused both by the usage of some chemicals at the agricultural field in harvest season and by the discharge of some technogenic chemicals from industry. The desalinated/treated wastewater were used to irrigate high value crops and the waste brine is transformed into a resource that was used to grow aquatic species (fish, algae) and irrigate halophytic species with benefits for livestock, farmers and
DIFFICULTIES THAT ARAB STUDENTS FACE IN LEARNING ENGLISH
Directory of Open Access Journals (Sweden)
Kassem BAHEEJ
2015-11-01
Full Text Available Jordan English is not used in everyday situations. Arab students face problems of learning English, both in writing and in speech. They find it hard to learn English in their native country, where language is Arabic. The only way to learn English in Jordan is through formal training, ie inside the classroom foreign language teachers are native speakers of Arabic. There is little opportunity to learn English through natural interaction in the target language. This is possible only when students are faced with native speakers of English who come to the country as tourists, and this happens very rarely.DIFICULTĂŢI CU CARE SE CONFRUNTĂ STUDENŢII ARABI CARE ÎNVAŢĂ LIMBA ENGLEZĂ În Iordania, limba engleză nu este utilizată în situaţii cotidiene. Studenţii arabi se confruntă cu probleme de învăţare a limbii engleze, atât în scris, cât şi în vorbire. Lor le vine greu să înveţe limba engleză în ţara lor natală, dat fiind că limba maternă este araba. Singura modalitate de a învăţa limba engleză în Iordania este prin instruire formală, adică în sala de clasă în care profesorii de limbă străină sunt vorbitori nativi de limbă arabă. Există puţine şanse de a învăţa limba engleză prin interacţiune naturală în limba-ţintă. Acest lucru este posibil numai atunci când elevii conversează cu vorbitori nativi de limbă engleză, care vin în ţară în calitate de turişti, ceea ce se întâmplă foarte rar.
International Nuclear Information System (INIS)
Charbaji, T.; Khalifa, Kh.; Al-Ain, F.
2003-01-01
Seeds of two barley varieties [Arabi Abiad (AA) and Pakistani PK 30163 (PK)] were irradiated with 0 and 15 Gy doses of gamma irradiation. Then, they were sown on salty soil (16.8-18 dS/m) and irrigated with salty water (7-8 dS/m). Gamma irradiation significantly increased the % of seedling emergence of PK only. At the heading stage, gamma irradiation decreased the % of total N of PK and increased shoot dry weight, Mg++ and P content and the % of total N of AA. K+ content of PK was lower than that of AA. At harvest stage, gamma irradiation increased total and grain yields and harvest index of PK; however, straw yield and 1,000 grain weight of AA were higher than those of PK [it
Czech Academy of Sciences Publication Activity Database
Přerostová, Sylva; Dobrev, Petre; Gaudinová, Alena; Hošek, Petr; Soudek, Petr; Knirsch, Vojtěch; Vaňková, Radomíra
2017-01-01
Roč. 264, NOV (2017), s. 188-198 ISSN 0168-9452 R&D Projects: GA ČR(CZ) GA16-14649S; GA ČR GA17-04607S; GA MŠk LD15093 Grant - others:European Regional Development Fund(XE) CZ.2.16/3.1.00/24014 Institutional support: RVO:61389030 Keywords : Abscisic acid * Auxin * Cytokinin * Halophyte * Phytohormone * Salt stress Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 3.437, year: 2016
Directory of Open Access Journals (Sweden)
Ramona Marasco
2016-08-01
Full Text Available Halophytes classified under the common name of salicornia colonize salty and coastal environments across tidal inundation gradients. To unravel the role of tide-related regimes on the structure and functionality of root associated bacteria, the rhizospheric soil of Salicornia strobilacea (synonym of Halocnemum strobilaceum plants was studied in a tidal zone of the coastline of Southern Tunisia. Although total counts of cultivable bacteria did not change in the rhizosphere of plants grown along a tidal gradient, significant differences were observed in the diversity of both the cultivable and uncultivable bacterial communities. This observation indicates that the tidal regime is contributing to the bacterial species selection in the rhizosphere. Despite the observed diversity in the bacterial community structure, the PGP potential of cultivable rhizospheric bacteria, assessed through in vitro and in vivo tests, was equally distributed along the tidal gradient. Root colonization tests with selected strains proved that halophyte rhizospheric bacteria (i stably colonize S. strobilacea rhizoplane and the plant shoot suggesting that they move from the root to the shoot and (ii are capable of improving plant growth. The versatility in the root colonization, the overall PGP traits and the in vivo plant growth promotion under saline condition suggest that such beneficial activities likely take place naturally under a range of tidal regimes.
Marasco, Ramona; Mapelli, Francesca; Rolli, Eleonora; Mosqueira, Maria J; Fusi, Marco; Bariselli, Paola; Reddy, Muppala; Cherif, Ameur; Tsiamis, George; Borin, Sara; Daffonchio, Daniele
2016-01-01
Halophytes classified under the common name of salicornia colonize salty and coastal environments across tidal inundation gradients. To unravel the role of tide-related regimes on the structure and functionality of root associated bacteria, the rhizospheric soil of Salicornia strobilacea (synonym of Halocnemum strobilaceum) plants was studied in a tidal zone of the coastline of Southern Tunisia. Although total counts of cultivable bacteria did not change in the rhizosphere of plants grown along a tidal gradient, significant differences were observed in the diversity of both the cultivable and uncultivable bacterial communities. This observation indicates that the tidal regime is contributing to the bacterial species selection in the rhizosphere. Despite the observed diversity in the bacterial community structure, the plant growth promoting (PGP) potential of cultivable rhizospheric bacteria, assessed through in vitro and in vivo tests, was equally distributed along the tidal gradient. Root colonization tests with selected strains proved that halophyte rhizospheric bacteria (i) stably colonize S. strobilacea rhizoplane and the plant shoot suggesting that they move from the root to the shoot and (ii) are capable of improving plant growth. The versatility in the root colonization, the overall PGP traits and the in vivo plant growth promotion under saline condition suggest that such beneficial activities likely take place naturally under a range of tidal regimes.
Impact of logging on a mangrove swamp in South Mexico: cost / benefit analysis
Directory of Open Access Journals (Sweden)
Cristian Tovilla Hernández
2001-06-01
Full Text Available Environmental changes caused by logging in a mangrove swamp were studied in Barra de Tecoanapa, Guerrero, Mexico. Original forest included Rhizophora mangle, Laguncularia racemosa, Avicennia germinans and halophytic vegetation, and produced wood (164.03 m3/ha and organic matter (3.9 g/m2/day. A total of 3.5 tons of wood per year were harvested from this area. Later, an average of 2 555 kg of maize per planting cycle were obtained (market value of 88 USD. Succession when the area was abandoned included strictly facultative and glycophyte halophytes (16 families, Cyperaceae and Poaceae were the best represented. After logging, temperatures increased 13 °C in the soil and 11°C in the air, whereas salinity reached 52 psu in the dry season. These modified soil color and sand content increased from 42.6 to 63.4%. Logging was deleterious to species, habitat, biogeochemical and biological cycles, organic matter production, seeds, young plants, genetic exchange conservation of soil and its fertility, coastal protection, and aesthetic value; 3 000 m2 had eroded as the river advanced towards the deforested area (the cost/benefit analysis showed a ratio of 246: 1. There was long-term economic loss for the community and only 30% of the site has recovered after five years.
Marasco, Ramona; Mapelli, Francesca; Rolli, Eleonora; Mosqueira, Maria J.; Fusi, Marco; Bariselli, Paola; Reddy, Muppala P.; Cherif, Ameur; Tsiamis, George; Borin, Sara; Daffonchio, Daniele
2016-01-01
Halophytes classified under the common name of salicornia colonize salty and coastal environments across tidal inundation gradients. To unravel the role of tide-related regimes on the structure and functionality of root associated bacteria, the rhizospheric soil of Salicornia strobilacea (synonym of Halocnemum strobilaceum) plants was studied in a tidal zone of the coastline of Southern Tunisia. Although total counts of cultivable bacteria did not change in the rhizosphere of plants grown along a tidal gradient, significant differences were observed in the diversity of both the cultivable and uncultivable bacterial communities. This observation indicates that the tidal regime is contributing to the bacterial species selection in the rhizosphere. Despite the observed diversity in the bacterial community structure, the plant growth promoting (PGP) potential of cultivable rhizospheric bacteria, assessed through in vitro and in vivo tests, was equally distributed along the tidal gradient. Root colonization tests with selected strains proved that halophyte rhizospheric bacteria (i) stably colonize S. strobilacea rhizoplane and the plant shoot suggesting that they move from the root to the shoot and (ii) are capable of improving plant growth. The versatility in the root colonization, the overall PGP traits and the in vivo plant growth promotion under saline condition suggest that such beneficial activities likely take place naturally under a range of tidal regimes.
Marasco, Ramona
2016-08-22
Halophytes classified under the common name of salicornia colonize salty and coastal environments across tidal inundation gradients. To unravel the role of tide-related regimes on the structure and functionality of root associated bacteria, the rhizospheric soil of Salicornia strobilacea (synonym of Halocnemum strobilaceum) plants was studied in a tidal zone of the coastline of Southern Tunisia. Although total counts of cultivable bacteria did not change in the rhizosphere of plants grown along a tidal gradient, significant differences were observed in the diversity of both the cultivable and uncultivable bacterial communities. This observation indicates that the tidal regime is contributing to the bacterial species selection in the rhizosphere. Despite the observed diversity in the bacterial community structure, the plant growth promoting (PGP) potential of cultivable rhizospheric bacteria, assessed through in vitro and in vivo tests, was equally distributed along the tidal gradient. Root colonization tests with selected strains proved that halophyte rhizospheric bacteria (i) stably colonize S. strobilacea rhizoplane and the plant shoot suggesting that they move from the root to the shoot and (ii) are capable of improving plant growth. The versatility in the root colonization, the overall PGP traits and the in vivo plant growth promotion under saline condition suggest that such beneficial activities likely take place naturally under a range of tidal regimes.
Soil and fertilizer amendments and edge effects on the floral succession of pulverized fuel ash
Energy Technology Data Exchange (ETDEWEB)
Shaw, P. [Roehampton University, London (United Kingdom). Whitelands College
2009-01-15
Plots of fresh pulverized fuel ash (PFA, an industrial waste) were inoculated with soils from existing PFA sites and fertilizers in a factorial design, then left unmanaged for 12 years during which time the floral development and soil chemistry were monitored annually. For the first 3 years, the site supported a sparse mix of chenopods (including the scarce Chenopodium glaucum) and halophytes. As salinity declined, ruderals, legumes, and grasses plus the fire-site moss Funaria hygrometrica colonized, followed by Festuca arundinacea grassland (NVC community MG12) and Hippophae rhamnoides scrub. Dactylorhiza incarnata (orchidacea) appeared after 7 years, but only in plots that had received soil from existing orchid colonies. Four years later, a larger second generation of Dactylorhiza appeared, but only in the central zone of the site where vegetation was thinnest. By year 12, the site was dominated by coarse grasses and scrub, with early successional species persisting only in the sparsely vegetated center, where nitrate levels were lowest. This edge effect is interpreted as centripetal encroachment, a process of potentially wider concern for the conservation of low-fertility habitat patches. Overall, seed bank inoculation seems to have introduced few but desirable species (D. incarnata, Pyrola rotundifolia, some halophytes, and annuals), whereas initial application of organic fertilizer had long-lasting ({ge} 10 years) effects on cover and soil composition.
Gu, Chunsun; Xu, Sheng; Wang, Zhiquan; Liu, Liangqin; Zhang, Yongxia; Deng, Yanming; Huang, Suzhen
2018-04-01
As a halophyte, Iris lactea var. chinensis (I. lactea var. chinensis) is widely distributed and has good drought and heavy metal resistance. Moreover, it is an excellent ornamental plant. I. lactea var. chinensis has extensive application prospects owing to the global impacts of salinization. To better understand its molecular mechanism involved in salt resistance, the de novo sequencing, assembly, and analysis of I. lactea var. chinensis roots' transcriptome in response to salt-stress conditions was performed. On average, 74.17% of the clean reads were mapped to unigenes. A total of 121,093 unigenes were constructed and 56,398 (46.57%) were annotated. Among these, 13,522 differentially expressed genes (DEGs) were identified between salt-treated and control samples Compared to the transcriptional level of control, 7037 DEGs were up-regulated and 6539 down-regulated. In addition, 129 up-regulated and 1609 down-regulated genes were simultaneously detected in all three pairwise comparisons between control and salt-stressed libraries. At least 247 and 250 DEGs encoding transcription factors and transporter proteins were identified. Meanwhile, 130 DEGs regarding reactive oxygen species (ROS) scavenging system were also summarized. Based on real-time quantitative RT-PCR, we verified the changes in the expression patterns of 10 unigenes. Our study identified potential salt-responsive candidate genes and increased the understanding of halophyte responses to salinity stress. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
Xiang Gao
Full Text Available Salinity is a widespread environmental problem limiting productivity and growth of plants. Halophytes which can adapt and resist certain salt stress have various mechanisms to defend the higher salinity and alkalinity, and epigenetic mechanisms especially DNA methylation may play important roles in plant adaptability and plasticity. In this study, we aimed to investigate the different influences of various single salts (NaCl, Na2SO4, NaHCO3, Na2CO3 and their mixed salts on halophyte Chloris. virgata from the DNA methylation prospective, and discover the underlying relationships between specific DNA methylation variations and specific cations/anions through the methylation-sensitive amplification polymorphism analysis. The results showed that the effects on DNA methylation variations of single salts were ranked as follows: Na2CO3> NaHCO3> Na2SO4> NaCl, and their mixed salts exerted tissue-specific effects on C. virgata seedlings. Eight types of DNA methylation variations were detected and defined in C. virgata according to the specific cations/anions existed in stressful solutions; in addition, mix-specific and higher pH-specific bands were the main type in leaves and roots independently. These findings suggested that mixed salts were not the simple combination of single salts. Furthermore, not only single salts but also mixed salts showed tissue-specific and cations/anions-specific DNA methylation variations.
Gao, Xiang; Cao, Donghui; Liu, Jie; Wang, Xiaoping; Geng, Shujuan; Liu, Bao; Shi, Decheng
2013-01-01
Salinity is a widespread environmental problem limiting productivity and growth of plants. Halophytes which can adapt and resist certain salt stress have various mechanisms to defend the higher salinity and alkalinity, and epigenetic mechanisms especially DNA methylation may play important roles in plant adaptability and plasticity. In this study, we aimed to investigate the different influences of various single salts (NaCl, Na2SO4, NaHCO3, Na2CO3) and their mixed salts on halophyte Chloris. virgata from the DNA methylation prospective, and discover the underlying relationships between specific DNA methylation variations and specific cations/anions through the methylation-sensitive amplification polymorphism analysis. The results showed that the effects on DNA methylation variations of single salts were ranked as follows: Na2CO3> NaHCO3> Na2SO4> NaCl, and their mixed salts exerted tissue-specific effects on C. virgata seedlings. Eight types of DNA methylation variations were detected and defined in C. virgata according to the specific cations/anions existed in stressful solutions; in addition, mix-specific and higher pH-specific bands were the main type in leaves and roots independently. These findings suggested that mixed salts were not the simple combination of single salts. Furthermore, not only single salts but also mixed salts showed tissue-specific and cations/anions-specific DNA methylation variations.
Zou, Changsong; Chen, Aojun; Xiao, Lihong; Muller, Heike M; Ache, Peter; Haberer, Georg; Zhang, Meiling; Jia, Wei; Deng, Ping; Huang, Ru; Lang, Daniel; Li, Feng; Zhan, Dongliang; Wu, Xiangyun; Zhang, Hui; Bohm, Jennifer; Liu, Renyi; Shabala, Sergey; Hedrich, Rainer; Zhu, Jian-Kang; Zhang, Heng
2017-01-01
Chenopodium quinoa is a halophytic pseudocereal crop that is being cultivated in an ever-growing number of countries. Because quinoa is highly resistant to multiple abiotic stresses and its seed has a better nutritional value than any other major cereals, it is regarded as a future crop to ensure global food security. We generated a high-quality genome draft using an inbred line of the quinoa cultivar Real. The quinoa genome experienced one recent genome duplication about 4.3 million years ago, likely reflecting the genome fusion of two Chenopodium parents, in addition to the γ paleohexaploidization reported for most eudicots. The genome is highly repetitive (64.5% repeat content) and contains 54 438 protein-coding genes and 192 microRNA genes, with more than 99.3% having orthologous genes from glycophylic species. Stress tolerance in quinoa is associated with the expansion of genes involved in ion and nutrient transport, ABA homeostasis and signaling, and enhanced basal-level ABA responses. Epidermal salt bladder cells exhibit similar characteristics as trichomes, with a significantly higher expression of genes related to energy import and ABA biosynthesis compared with the leaf lamina. The quinoa genome sequence provides insights into its exceptional nutritional value and the evolution of halophytes, enabling the identification of genes involved in salinity tolerance, and providing the basis for molecular breeding in quinoa. PMID:28994416
International Nuclear Information System (INIS)
Marques, B.; Lillebo, A.I.; Pereira, E.; Duarte, A.C.
2011-01-01
In this study two time scales were looked at: a yearlong study was completed, and a 180-day decay experiment was done. Juncus maritimus and Scirpus maritimus have different life cycles, and this seems to have implications in the Hg-contaminated salt marsh sediment chemical environment, namely Eh and pH. In addition, the belowground biomass decomposition rates were faster for J. maritimus, as well as the biomass turnover rates. Results show that all these species-specific factors have implications in the mercury dynamics and sequestration. Meaning that J. maritimus belowground biomass has a sequestration capacity for mercury per square metre approximately 4-5 times higher than S. maritimus, i.e., in S. maritimus colonized areas Hg is more extensively exchange between belowground biomass and the rhizosediment. In conclusion, J. maritimus seems to provide a comparatively higher ecosystem service through phytostabilization (Hg complexation in the rhizosediment) and through phytoaccumulation (Hg sequestration in the belowground biomass). - Graphical abstract: Display Omitted Highlights: → Potentially halophytes auto-remediate systems by reducing Hg availability. → Species-specific factors have implications in the Hg dynamics and sequestration. → Ecosystem services are provided through phytostabilization and/or phytoaccumulation. → J. maritimus provide a comparatively higher ecosystem service. → In S. maritimus rhizosediment Hg is more extensively exchange with the halophyte. - Juncus maritimus provide an ecosystem service through Hg-phytostabilization and Hg-phytoaccumulation.
Phosphorus use efficiency of the gum arabi tree (Acacia senegal (L) Willd) in Sudan
International Nuclear Information System (INIS)
Elamin, K.H.; Mustafa, A.F.
1996-01-01
This study was conducted to identify gum arabic tree (Acacia senegal L. Willd) provenances with high efficiency for phosphorus uptake and use. Thirteen provenances were collected from different habitats with the gum belt of the Sudan. A preliminary trial was conducted during the period 1989-1992 at the Gezira Agricultural Research Station in Wad Medani. This study revealed that there are clear genotypic differences in phosphorus use efficiency, nitrogen yield and dry matter production. All the provenances tested also exhibited a high ability for survival under the dry climatic conditions as prevailing in the gum belt of Sudan. Based on differences in phosphorus use efficiency observed in the preliminary study, 4 provenances were selected for a detailed study. Provenance 11 and 2 represented the highly efficient group, provenance 7 the moderately efficient group and provenance 13 the low efficient group. The detailed study revealed that provenance 11 is superior to all others in terms of biomass production as well as in phosphorus use efficiency. Although the ability to take up phosphorus was low, this was compensated by having a high root length density enabling the tree to take up a quantity of phosphorus similar to that taken up by other provenances. The high ability to convert the absorbed phosphorus into a greater quantity of dry matter made this provenance the best in phosphorus use efficiency. These results suggest that provenance 11 may be a suitable candidate to be introduced into the gum belt of Sudan in support of its rehabilitation programme. (author). 13 refs, 4 figs, 5 tabs
Phosphorus use efficiency of the gum arabi tree (Acacia senegal (L) Willd) in Sudan
Energy Technology Data Exchange (ETDEWEB)
Elamin, K H; Mustafa, A F [Gezira Agricultural Research Centre, Wad Medani (Sudan). Forestry Research Section
1996-07-01
This study was conducted to identify gum arabic tree (Acacia senegal L. Willd) provenances with high efficiency for phosphorus uptake and use. Thirteen provenances were collected from different habitats with the gum belt of the Sudan. A preliminary trial was conducted during the period 1989-1992 at the Gezira Agricultural Research Station in Wad Medani. This study revealed that there are clear genotypic differences in phosphorus use efficiency, nitrogen yield and dry matter production. All the provenances tested also exhibited a high ability for survival under the dry climatic conditions as prevailing in the gum belt of Sudan. Based on differences in phosphorus use efficiency observed in the preliminary study, 4 provenances were selected for a detailed study. Provenance 11 and 2 represented the highly efficient group, provenance 7 the moderately efficient group and provenance 13 the low efficient group. The detailed study revealed that provenance 11 is superior to all others in terms of biomass production as well as in phosphorus use efficiency. Although the ability to take up phosphorus was low, this was compensated by having a high root length density enabling the tree to take up a quantity of phosphorus similar to that taken up by other provenances. The high ability to convert the absorbed phosphorus into a greater quantity of dry matter made this provenance the best in phosphorus use efficiency. These results suggest that provenance 11 may be a suitable candidate to be introduced into the gum belt of Sudan in support of its rehabilitation programme. (author). 13 refs, 4 figs, 5 tabs.
Dunham, Kylee; Grand, James B.
2016-10-11
The Alaskan breeding population of Steller’s eiders (Polysticta stelleri) was listed as threatened under the Endangered Species Act in 1997 in response to perceived declines in abundance throughout their breeding and nesting range. Aerial surveys suggest the breeding population is small and highly variable in number, with zero birds counted in 5 of the last 25 years. Research was conducted to evaluate competing population process models of Alaskan-breeding Steller’s eiders through comparison of model projections to aerial survey data. To evaluate model efficacy and estimate demographic parameters, a Bayesian state-space modeling framework was used and each model was fit to counts from the annual aerial surveys, using sequential importance sampling and resampling. The results strongly support that the Alaskan breeding population experiences population level nonbreeding events and is open to exchange with the larger Russian-Pacific breeding population. Current recovery criteria for the Alaskan breeding population rely heavily on the ability to estimate population viability. The results of this investigation provide an informative model of the population process that can be used to examine future population states and assess the population in terms of the current recovery and reclassification criteria.
Characteristics of rose mosaic diseases
Directory of Open Access Journals (Sweden)
Marek S. Szyndel
2013-12-01
Full Text Available Presented review of rose diseases, associated with the mosaic symptoms, includes common and yellow rose mosaic, rose ring pattern, rose X disease, rose line pattern, yellow vein mosaic and rose mottle mosaic disease. Based on symptomatology and graft transmissibility of causing agent many of those rose disorders are called "virus-like diseases" since the pathogen has never been identified. However, several viruses were detected and identified in roses expressing mosaic symptoms. Currently the most prevalent rose viruses are Prunus necrotic ringspot virus - PNRSV, Apple mosaic virus - ApMV (syn. Rose mosaic virus and Arabis mosaic virus - ArMV Symptoms and damages caused by these viruses are described. Tomato ringspot virus, Tobacco ringspot virus and Rose mottle mosaic virus are also mentioned as rose pa thogcns. Methods of control of rose mosaic diseases are discussed.
Occurrence of nepoviruses in Rubus species in the Czech Republic.
Spak, J; Kubelková, D; Honetslegrová-Fránová, J
1997-06-01
The occurrence of arabis mosaic virus (AMV), raspberry ringspot virus (RRV), tomato black ring virus (TBRV), strawberry latent ringspot virus (SLRV) and cherry leaf roll virus (CLRV) in cultivated and wild plants of raspberry and blackberry has been studied in the Czech Republic in 1993-1996. Five hundred and seventy samples were collected at 51 localities and assayed by double antibody sandwich enzyme-linked immunosorbent assay (DAS-ELISA). The results represent the first evidence on the occurrence of AMV, RRV, TBRV and SLRV in cultivated Rubus species in the Czech Republic. Isolates AMV M20 and TBRV ML15 which were successfully transmitted by mechanical inoculation and characterized by reactions of differential host plants and by electron microscopy are the first isolates from Rubus from this territory. CLRV was not detected in either cultivated or wild Rubus species.
Bethe ansatz and ordinary differential equation correspondence for degenerate Gaudin models
El Araby, Omar; Gritsev, Vladimir; Faribault, Alexandre
2012-03-01
In this work, we generalize the numerical approach to Gaudin models developed earlier by us [Faribault, El Araby, Sträter, and Gritsev, Phys. Rev. BPRBMDO1098-012110.1103/PhysRevB.83.235124 83, 235124 (2011)] to degenerate systems, showing that their treatment is surprisingly convenient from a numerical point of view. In fact, high degeneracies not only reduce the number of relevant states in the Hilbert space by a non-negligible fraction, they also allow us to write the relevant equations in the form of sparse matrix equations. Moreover, we introduce an inversion method based on a basis of barycentric polynomials that leads to a more stable and efficient root extraction, which most importantly avoids the necessity of working with arbitrary precision. As an example, we show the results of our procedure applied to the Richardson model on a square lattice.
Dubcovsky, J; Galvez, AF; Dvořák, J
1994-01-01
Lophopyrum elongatum is a facultative halophyte related to wheat. Eleven unique clones corresponding to genes showing enhanced mRNA accumulation in the early stages of salt stress were previously isolated from a L. elongatum salt-stressed-root cDNA library. The chromosomal distribution of genes complementary to these clones in several genomes of the tribe Triticeae and their copy number in the L. elongatum and wheat genomes are reported. Genes complementary to clones pESI4, pESI14, pESI15, pE...
Nutrient cycling in salt marshes: An ecosystem service to reduce eutrophication
DEFF Research Database (Denmark)
Lillebø, A. I.; Sousa, A. I.; Flindt, M. R.
2013-01-01
and sequestration in salt marshes. This chapter will thus emphasise that salt marsh halophytes have a crucial role on nutrient cycling and sequestration, providing ecological services that contribute to maintain the ecosystem health. © 2012 Nova Science Publishers, Inc. All rights reserved.......Salt marshes are classified as sensitive habitat under the Habitats Directive (92/43/EEC), which aims to promote the maintenance of biodiversity. Worldwide, the reduction of salt marsh areas, as a result of anthropogenic disturbance is of major concern, and several studies on the ecology...
Halophyte filters as saline treatment wetlands; Applicators and constraints
Gaag, J.J.; Paulissen, M.P.C.P.; Slim, P.A.
2010-01-01
Purification of wastewater rich in nutrients and organic pollutants is essential for the protection of receiving waters and to enable water reuse. This report investigates the possibilities and constraints of constructed wetlands for treatment of slightly saline wastewater from aquaculture systems. As the body of literature for saline treatment wetlands is relatively small, the reports starts with a summary of processes in freshwater systems. It is then explained that these processes are also...
Trends in savanna structure and composition along an aridity gradient in the Kalahari
CSIR Research Space (South Africa)
Scholes, RJ
2002-06-01
Full Text Available Rooyen 1998). Sa- line areas such as the vast Makgadigadi pan support halophytic shrubs and grasses or are bare. Non-saline pans, for example at Nxai pan, support sedge- and grasslands, sometimes with tree clumps on slightly more elevated ground... being larger than about 20 mm (major axis); fine-leafed is smaller than 20 mm, and usually less than 2 mm. Deciduous means that > 90% of all tree and shrub leaves are lost for at least three months, evergreen means that > 80% of tree leaf is retained...
General properties of grapevine viruses occurring in Hungary
Directory of Open Access Journals (Sweden)
Eszter Cseh
2012-03-01
Full Text Available The past fifty years important advances have been made in the field of grapevine virus research, including characterization of pathogens and control measurements. Still the occurrence of Grapevine fanleaf virus (GFLV, Arabis mosaic virus (ArMV, Tomato black ring virus (TBRV, Grapevine chrome mosaic virus (GCMV, Alfalfa mosaic virus (AMV, Grapevine Bulgarian latent virus (GBLV, Grapevine fleck virus (GFkV, Grapevine leafroll- associated viruses (GLRaV1-4, Grapevine virus A (GVA, Grapevine virus B (GVB and Grapevine rupestris stem pitting- associated virus (GRSPaV have been reported in Hungary and characterized by conventional methods as woody indexing, herbaceous indexing and serological methods. Among grapevine viruses the Grapevine line pattern virus (GLPV seems to be uncial; because it was reported only in Hungary. Causal agents of several grapevine diseases, like enation, vein necrosis and vein mosaic remained undiscovered. These virus-like diseases occurred only sporadically, without economic importance.
2013-09-12
... concerning: (1) Georgia rockcress's biology, range, and population trends, including: (a) Biological or... sound data, assumptions, and analyses. The peer reviewers have expertise in the species' biology, field... in micro-disturbances, such as sloughing soils with limited accumulation of leaf litter or canopy gap...
Highlighting the mechanisms by which proline can confer tolerance to salt stress in cakile maritima
International Nuclear Information System (INIS)
Messedi, D.; Farhani, F.; Hamed, K.B.; Trabelsi, N.; Ksouri, R.; Chedly Abdelly, C.; Athar, H.U.R.
2016-01-01
Cakile maritima is an oleaginous halophyte growing in the sandy dunes along the Tunisian coast. In order to investigate the role of proline in inducing high salinity tolerance (200 and 400 mM NaCl) in this halophyte, we studied several aspects of the salt responses of C. maritma under exogenous proline supply (20 mM). Salinity levels above 100 mM, reduced growth, photosynthetic activity, and quantum yield of photosystem II (FPSII), while increasing the non photochemical quenching (NPQ). Significant inhibition of the linear electron transport rate (ETR) was also observed in plants grown at 400 mM NaCl. In addition, polyphenol content, total antioxidant and DPPH scavenging activities increased due to increasing salinity stress, and the concentration of malondialdehyde (MDA) also increased. The application of proline counteracted all these adverse effects of salt stress in plants grown at 200 mM NaCl, while it improved some of these physiological attributes at 400 mM NaCl. In addition, contribution of Na+ for the osmotic adjustment decreased in the leaves of salt treated plants supplied with proline exogenously. Exogenous application of proline induced the accumulation of potassium, proline and soluble carbohydrates in salt stressed plants, particularly at 400 mM. This explained the reason of growth enhancement induced by proline application. All together, our Results showed that the beneficial effect of exogenous proline on the response of C. maritima to salinity was due to its role in the protection of chloroplast structures, antioxidant defenses and osmotic adjustment. (author)
Pereira, Catarina Guerreiro; Barreira, Luísa; Bijttebier, Sebastiaan; Pieters, Luc; Neves, Vanessa; Rodrigues, Maria João; Rivas, Ricardo; Varela, João; Custódio, Luísa
2017-10-25
Several medicinal plants are currently used by the food industry as functional additives, for example botanical extracts in herbal drinks. Moreover, the scientific community has recently begun focusing on halophytes as sources of functional beverages. Helichrysum italicum subsp. picardii (everlasting) is an aromatic halophyte common in southern Europe frequently used as spice and in traditional medicine. In this context, this work explored for the first time H. italicum subsp. picardii as a potential source of innovative herbal beverages with potential health promoting properties. For that purpose, infusions and decoctions were prepared from roots, vegetative aerial-organs (stems and leaves) and flowers and evaluated for in vitro antioxidant and anti-diabetic activities. Samples were also assessed for toxicity in different mammalian cell lines and chemically characterized by spectrophotometric methods and ultra-high performance liquid chromatography-photodiode array-mass-spectrometry (UHPLC-PDA-MS). Results were expressed relating to 'a cup-of-tea' and compared with those obtained with green tea (Camellia sinensis) and rooibos tisane (Aspalathus linearis). Tisanes from the everlasting's above-ground organs, particularly flowers, have high polyphenolic content and several phenolics were identified; the main compounds were chlorogenic and quinic acids, dicaffeoylquinic-acid isomers and gnaphaliin-A. The antioxidant activity of beverages from the everlasting's above-ground organs matched or surpassed that of green tea and rooibos. Its anti-diabetic activity was moderate and toxicity low. Overall, our results suggest that the everlasting is a potential source of innovative and functional herbal beverages. Copyright © 2017 Elsevier B.V. All rights reserved.
Atia, Abdallah; Debez, Ahmed; Barhoumi, Zouhaier; Smaoui, Abderrazak; Abdelly, Chedly
2009-08-01
Impaired germination is common among halophyte seeds exposed to salt stress, partly resulting from the salt-induced reduction of the growth regulator contents in seeds. Thus, the understanding of hormonal regulation during the germination process is a main key: (i) to overcome the mechanisms by which NaCl-salinity inhibit germination; and (ii) to improve the germination of these species when challenged with NaCl. In the present investigation, the effects of ABA, GA(3), NO(-)(3), and NH(+)(4) on the germination of the oilseed halophyte Crithmum maritimum (Apiaceae) were assessed under NaCl-salinity (up to 200 mM NaCl). Seeds were collected from Tabarka rocky coasts (N-W of Tunisia). The exogenous application of GA(3), nitrate (either as NaNO(3) or KNO(3)), and NH(4)Cl enhanced germination under NaCl salinity. The beneficial impact of KNO(3) on germination upon seed exposure to NaCl salinity was rather due to NO(-)(3) than to K(+), since KCl failed to significantly stimulate germination. Under optimal conditions for germination (0 mM NaCl), ABA inhibited germination over time in a dose dependent manner, but KNO(3) completely restored the germination parameters. Under NaCl salinity, the application of fluridone (FLU) an inhibitor of ABA biosynthesis, stimulated substantially seed germination. Taken together, our results point out that NO(-)(3) and GA(3) mitigate the NaCl-induced reduction of seed germination, and that NO(-)(3) counteracts the inhibitory effect of ABA on germination of C. maritimum.
Directory of Open Access Journals (Sweden)
Solange Alemán
2017-04-01
Full Text Available Is recorded the species of crabs brachyuran Ucides occidentalis (mangrove crab and Cardisoma crassum (Blue crab or without mouth in the mangroves of San Pedro (Piura, expanding its geographical distribution south of Tumbes, which was the known limit. The habitat of these species is characterized by the presence of two varieties of mangrove trees, Jeli white (Laguncularia racemosa and salty Jeli (Avicenia germinans and halophytic shrub called glass (Batis maritima, it observing that the depth of the burrows is shallow (< 60 cm. Biometric information and some biological aspects of the collected specimens are also presented.
La strana storia della luce e del colore
Guzzi, Rodolfo
2011-01-01
Sino al 1600 la luce era oggetto di studio degli scienziati ed il colore dei filosofi. Questa dicotomia fu superata dall’Esperimentum Crucis di Newton che spiego’ come la luce contenesse il colore. Il libro analizza le teorie che furono sviluppate dai greci, per evolversi successivamente nelle teorie degli scienziati arabi e approdare al medio evo. Con l’Esperimentum Crucis Newton dimostro’ che la luce conteneva i colori primari. Tra gli esperimenti che egli fece ci furono anche quelli sulla percezione che risultarono sbagliati; solo Goethe capi’ quale era la vera portata di quegli esperimenti e li rifece dando una interpretazione che, oggi, sappiamo essere vera, ma che a quel tempo fu alquanto osteggiata. Nel frattempo la comunita’ scientifica progrediva sul concetto di visione e di sensazione, poiche’ gli strumenti di indagine si raffinavano. Bisogna pero’ arrivare ai giorni nostri per avere una spiegazione sul comportamento della luce e del colore e come questa viene percepita da noi. Solo ...
Treille, Daniel
2015-01-01
Un professeur de philosophie, paisible et casanier, se voit suggérer un insolite travail de recherche sur les antiquités éthiopiennes. Pris au jeu, voulant se mesurer à une mystérieuse rivale qui le précède en tout, il se trouve vite entraîné de plus en plus loin de son quotidien, vers Paris, Rome et jusqu’à la Corne de l’Afrique, l’une des plus fascinantes, mais aussi des plus « chaudes » régions du monde. En réalité, manipulé de bout en bout, acteur involontaire du Grand Jeu que se livrent de grandes puissances, il tombe de piège en piège. « Pâtissant plus qu’agissant », comme aurait dit son maître Spinoza, il connaîtra encore, bien malgré lui, Somalie et Arabie, pour échouer finalement en Asie Centrale.
The customization of APACHE II for patients receiving orthotopic liver transplants
Moreno, Rui
2002-01-01
General outcome prediction models developed for use with large, multicenter databases of critically ill patients may not correctly estimate mortality if applied to a particular group of patients that was under-represented in the original database. The development of new diagnostic weights has been proposed as a method of adapting the general model – the Acute Physiology and Chronic Health Evaluation (APACHE) II in this case – to a new group of patients. Such customization must be empirically tested, because the original model cannot contain an appropriate set of predictive variables for the particular group. In this issue of Critical Care, Arabi and co-workers present the results of the validation of a modified model of the APACHE II system for patients receiving orthotopic liver transplants. The use of a highly heterogeneous database for which not all important variables were taken into account and of a sample too small to use the Hosmer–Lemeshow goodness-of-fit test appropriately makes their conclusions uncertain. PMID:12133174
Nursing in Saudi Arabia: Reflections on the experiences of South African nurses
Directory of Open Access Journals (Sweden)
Dalena van Rooyen
2010-03-01
Opsomming Die doel van die studie was om die lewenservarings van Suid-Afrikaanse verpleegkundiges wat in die Koningkryk van Saoedi-Arabië werksaam en woonagtig is, te beskryf en daaroor te besin. 'n Kwalitatiewe, verkennende, beskrywende en kontekstuele navorsingsontwerp of strategie van ondersoek, vanuit 'n fenomenologiese benadering, is vir die doel ingespan. Data is ingesamel aan die hand van individuele onderhoude met deelnemers wat aan die kriteria vir insluiting by die steekproef voldoen het en persoonlike joernale wat deur hierdie deelnemers bygehou is. Data- ontleding is volgens die beskrywende metode van Tesch (in Creswell 1994 gedoen. Die hooftema voortspruitend uit die navorsing was dié van ‘kulturele diversiteit’. Verdere temas ten opsigte van verpleegkundiges se godsdienstige/geestelike, omgewings-, emosionele/psigiese en professionele ervarings is ook geïdentifseer. 'n Literatuurkontrole is onderneem om die navorsingsbevindinge te verifieer. Beperkings is uitgelig, en gevolgtrekkings en aanbevelings gerig op verpleegkundige navorsing, onderrig en praktyk is gemaak.
Louis Massignon l'amour mystique ou l'extase dans l'abandon
Directory of Open Access Journals (Sweden)
Jacques Keryell
2008-09-01
Full Text Available Parler de Massignon et de son Amour de Dieu n'est pas chose aisée. En effet, si les mystiques musulmans des premiers siècles de l'hégire ont été les hérauts de cet Amour : Al-Hallâj, Râbia al-Adawiyya, Al-Niffâri, Ibn Arabi, Ansâri, Al-Ghazâli, l'Amour de Dieu comme tel, n'est pas au cœur du "ilm al kalâm", de la théologie musulmane traditionnelle. Pour Massignon, langue et spiritualité étaient intimement liées. Si je devais me placer dans une perspective musulmane, je dirais que Louis Massignon se situe dans la ligne de la "wahdat al shuhûd", celle de "l'unicité du témoignage" ou Dieu se témoigne Lui-même en son mystère dans le cœur du soufi.
Seed oil content and fatty acid composition of annual halophyte ...
African Journals Online (AJOL)
ajl yemi
2011-12-19
Dec 19, 2011 ... 1State Key Laboratory of Desert and Oasis Ecology, Xinjiang Institute of Ecology and Geography, Chinese Academy of. Sciences, Urumqi 830011, China. 2Graduate University of ... of S. acuminata: brown with soft coarse seed coat and black with rigid smooth seed coat (Ding et al., 2010). Brown and black ...
Seed oil content and fatty acid composition of annual halophyte ...
African Journals Online (AJOL)
Suaeda acuminata produces two morphologically distinct types of seeds on the same plant. This study was conducted to compare oil content and fatty acid composition of the two seed morphs. Though oil characteristics between dimorphic seeds showed statistically significant difference, these differences were relatively ...
The Treatment of Terms Relating to Islam and the Arab World in English Dictionaries
Directory of Open Access Journals (Sweden)
Hashan Al-Ajmi
2011-10-01
Full Text Available
Abstract: This article investigates the treatment of vocabulary items relating to Islam and the Arab world in three major English dictionaries: Longman Dictionary of Contemporary English, New Oxford Dictionary of English, and Merriam-Webster's Collegiate Dictionary. The three dictionaries are compared with regard to their inclusion of 73 Arabic items (including loanwords used in texts on Islam and the Middle East at the Google news file. With religion as theme, eight of these terms have been examined and compared across their entries in these three dictionaries to determine the closeness of the lexicographic description of these terms to their original meanings among native speakers of Arabic and to detect, from these speakers' viewpoint, any deficiencies in the defining language of their respective entries. The examination of the definitions of terms relating to Islam and the Arab world in the three dictionaries has revealed a number of pitfalls that may require editorial reconsideration. These include circularity, insufficient information, negative contexts, very general definitions, ambiguity, incomplete information, narrow definitions and encyclopedic re-dundancy.
Keywords: ARABIC LOANWORDS, CULTURAL TERMS, DEFINITION, ISLAM, REPRE-SENTATION, LEXICOGRAPHY
Opsomming: Die behandeling van terme betreffende Islam en die Arabie-se wêreld in Engelse woordeboeke. Hierdie artikel ondersoek die behandeling van woordeskatitems betreffende Islam en die Arabiese wêreld in drie vooraanstaande Engelse woor-deboeke: Longman Dictionary of Contemporary English, New Oxford Dictionary of English, en Merriam-Webster's Collegiate Dictionary. Die drie woordeboeke word vergelyk met betrekking tot hul opname van 73 Arabiese items (insluitende leenwoorde wat in tekste oor Islam en die Midde-Ooste in die Google-nuuslêers gebruik word. Met godsdiens as tema, is agt van hierdie terme ondersoek en vergelyk met hul inskrywing in dié drie woordeboeke om
Chaudhary, Doongar R; Seo, Juyoung; Kang, Hojeong; Rathore, Aditya P; Jha, Bhavanath
2018-05-01
High and fluctuating salinity is characteristic for coastal salt marshes, which strongly affect the physiology of halophytes consequently resulting in changes in stable isotope distribution. The natural abundance of stable isotopes (δ 13 C and δ 15 N) of the halophyte plant Salicornia brachiata and physico-chemical characteristics of soils were analysed in order to investigate the relationship of stable isotope distribution in different populations in a growing period in the coastal area of Gujarat, India. Aboveground and belowground biomass of S. brachiata was collected from six different populations at five times (September 2014, November 2014, January 2015, March 2015 and May 2015). The δ 13 C values in aboveground (-30.8 to -23.6 ‰, average: -26.6 ± 0.4 ‰) and belowground biomass (-30.0 to -23.1 ‰, average: -26.3 ± 0.4 ‰) were similar. The δ 13 C values were positively correlated with soil salinity and Na concentration, and negatively correlated with soil mineral nitrogen. The δ 15 N values of aboveground (6.7-16.1 ‰, average: 9.6 ± 0.4 ‰) were comparatively higher than belowground biomass (5.4-13.2 ‰, average: 7.8 ± 0.3 ‰). The δ 15 N values were negatively correlated with soil available P. We conclude that the variation in δ 13 C values of S. brachiata was possibly caused by soil salinity (associated Na content) and N limitation which demonstrates the potential of δ 13 C as an indicator of stress in plants.
Maughan, P J; Turner, T B; Coleman, C E; Elzinga, D B; Jellen, E N; Morales, J A; Udall, J A; Fairbanks, D J; Bonifacio, A
2009-07-01
Salt tolerance is an agronomically important trait that affects plant species around the globe. The Salt Overly Sensitive 1 (SOS1) gene encodes a plasma membrane Na+/H+ antiporter that plays an important role in germination and growth of plants in saline environments. Quinoa (Chenopodium quinoa Willd.) is a halophytic, allotetraploid grain crop of the family Amaranthaceae with impressive nutritional content and an increasing worldwide market. Many quinoa varieties have considerable salt tolerance, and research suggests quinoa may utilize novel mechanisms to confer salt tolerance. Here we report the cloning and characterization of two homoeologous SOS1 loci (cqSOS1A and cqSOS1B) from C. quinoa, including full-length cDNA sequences, genomic sequences, relative expression levels, fluorescent in situ hybridization (FISH) analysis, and a phylogenetic analysis of SOS1 genes from 13 plant taxa. The cqSOS1A and cqSOS1B genes each span 23 exons spread over 3477 bp and 3486 bp of coding sequence, respectively. These sequences share a high level of similarity with SOS1 homologs of other species and contain two conserved domains, a Nhap cation-antiporter domain and a cyclic-nucleotide binding domain. Genomic sequence analysis of two BAC clones (98 357 bp and 132 770 bp) containing the homoeologous SOS1 genes suggests possible conservation of synteny across the C. quinoa sub-genomes. This report represents the first molecular characterization of salt-tolerance genes in a halophytic species in the Amaranthaceae as well as the first comparative analysis of coding and non-coding DNA sequences of the two homoeologous genomes of C. quinoa.
Shabala, Lana; Mackay, Alex; Tian, Yu; Jacobsen, Sven-Erik; Zhou, Daowei; Shabala, Sergey
2012-09-01
Two components of salinity stress are a reduction in water availability to plants and the formation of reactive oxygen species. In this work, we have used quinoa (Chenopodium quinoa), a dicotyledonous C3 halophyte species displaying optimal growth at approximately 150 mM NaCl, to study mechanisms by which halophytes cope with the afore-mentioned components of salt stress. The relative contribution of organic and inorganic osmolytes in leaves of different physiological ages (e.g. positions on the stem) was quantified and linked with the osmoprotective function of organic osmolytes. We show that the extent of the oxidative stress (UV-B irradiation) damage to photosynthetic machinery in young leaves is much less when compared with old leaves, and attribute this difference to the difference in the size of the organic osmolyte pool (1.5-fold difference under control conditions; sixfold difference in plants grown at 400 mM NaCl). Consistent with this, salt-grown plants showed higher Fv/Fm values compared with control plants after UV-B exposure. Exogenous application of physiologically relevant concentrations of glycine betaine substantially mitigated oxidative stress damage to PSII, in a dose-dependent manner. We also show that salt-grown plants showed a significant (approximately 30%) reduction in stomatal density observed in all leaves. It is concluded that accumulation of organic osmolytes plays a dual role providing, in addition to osmotic adjustment, protection of photosynthetic machinery against oxidative stress in developing leaves. It is also suggested that salinity-induced reduction in stomatal density represents a fundamental mechanism by which plants optimize water use efficiency under saline conditions. Copyright © Physiologia Plantarum 2012.
Utilization of saline water and land: Reclaiming lost resources
International Nuclear Information System (INIS)
Naqvi, Mujtaba
2001-01-01
There is an abundance of saline water on the globe. Large tracts of land are arid and/or salt-affected, and a large number of plant species are known to be salt-tolerant. It would seem obvious that salt tolerant plants (halophytes) have a role in utilizing the two wasted resources, saline water and wastelands. We will briefly describe how these resources can be fruitfully utilized and how the IAEA has helped several countries to demonstrate the possibility of cultivating salt tolerant plant species on arid saline wastelands for economic and environmental benefit. After some brief introductory remarks we will discuss the results of the project
DEFF Research Database (Denmark)
Hariadi, Yuda; Marandon, Karl; Tian, Yu
2011-01-01
or by the gradual increase of NaCl levels in the irrigation water. For both methods, the optimal plant growth and biomass was achieved between 100 mM and 200 mM NaCl, suggesting that quinoa possess a very efficient system to adjust osmotically for abrupt increases in NaCl stress. Up to 95% of osmotic adjustment......Cl-induced activation of H+-ATPase is needed to restore otherwise depolarized membrane potential and prevent further K+ leak from the cytosol. Taken together, this work emphasizes the role of inorganic ions for osmotic adjustment in halophytes and calls for more in-depth studies of the mechanisms of vacuolar Na...
Ben Hmidene, Asma; Hanaki, Mizuho; Murakami, Kazuma; Irie, Kazuhiro; Isoda, Hiroko; Shigemori, Hideyuki
2017-01-01
The prevention of amyloid aggregation is promising for the treatment of age-related diseases such as Alzheimer's (AD) and type 2 diabetes (T2D). Ten antioxidant flavonoids isolated from the medicinal halophyte Tamarix gallica were tested for their amyloid aggregation inhibition potential. Glucuronosylated flavonoids show relatively strong inhibitory activity of Amyloid β (Aβ) and human islet amyloid polypeptide (hIAPP) aggregation compared to their aglycone analogs. Structure-activity relationship of the flavonoids suggests that the catechol moiety is important for amyloid aggregation inhibition, while the methylation of the carboxyl group in the glucuronide moiety and of the hydroxyl group in the aglycone flavonoids decreased it.
Directory of Open Access Journals (Sweden)
Laura J Jurgens
Full Text Available Mass mortalities in natural populations, particularly those that leave few survivors over large spatial areas, may cause long-term ecological perturbations. Yet mass mortalities may remain undocumented or poorly described due to challenges in responding rapidly to unforeseen events, scarcity of baseline data, and difficulties in quantifying rare or patchily distributed species, especially in remote or marine systems. Better chronicling the geographic pattern and intensity of mass mortalities is especially critical in the face of global changes predicted to alter regional disturbance regimes. Here, we couple replicated post-mortality surveys with preceding long-term surveys and historical data to describe a rapid and severe mass mortality of rocky shore invertebrates along the north-central California coast of the northeastern Pacific Ocean. In late August 2011, formerly abundant intertidal populations of the purple sea urchin (Strongylocentrotus purpuratus, a well-known ecosystem engineer, and the predatory six-armed sea star (Leptasterias sp. were functionally extirpated from ~100 km of coastline. Other invertebrates, including the gumboot chiton (Cryptochiton stelleri the ochre sea star (Pisaster ochraceus, and subtidal populations of purple sea urchins also exhibited elevated mortality. The pattern and extent of mortality suggest the potential for long-term population, community, and ecosystem consequences, recovery from which may depend on the different dispersal abilities of the affected species.
Hollmén, Tuula E.; DebRoy, Chitrita; Flint, Paul L.; Safine, David E.; Schamber, Jason L.; Riddle, Ann E.; Trust, Kimberly A.
2011-01-01
In Alaska, sea ducks winter in coastal habitats at remote, non-industrialized areas, as well as in proximity to human communities and industrial activity. We evaluated prevalence and characteristics of Escherichia coli strains in faecal samples of Steller's eiders (Polysticta stelleri; n = 122) and harlequin ducks (Histrionicus histrionicus; n = 21) at an industrialized site and Steller's eiders (n = 48) at a reference site, and compared these strains with those isolated from water samples from near-shore habitats of ducks. The overall prevalence of E. coli was 16% and 67% in Steller's eiders and harlequin ducks, respectively, at the industrialized study site, and 2% in Steller's eiders at the reference site. Based on O and H antigen subtyping and genetic characterization by enterobacterial repetitive intergenic consensus polymerase chain reaction and pulsed-field gel electrophoresis, we found evidence of avian pathogenic E. coli (APEC) strains associated with both species and detected E. coli strains carrying virulence genes associated with mammals in harlequin ducks. Steller's eiders that carried APEC had lower serum total protein and albumin concentrations, providing further evidence of pathogenicity. The genetic profile of two E. coli strains from water matched an isolate from a Steller's eider providing evidence of transmission between near-shore habitats and birds.
Hollmén, Tuula E; Debroy, Chitrita; Flint, Paul L; Safine, David E; Schamber, Jason L; Riddle, Ann E; Trust, Kimberly A
2011-04-01
In Alaska, sea ducks winter in coastal habitats at remote, non-industrialized areas, as well as in proximity to human communities and industrial activity. We evaluated prevalence and characteristics of Escherichia coli strains in faecal samples of Steller's eiders (Polysticta stelleri; n = 122) and harlequin ducks (Histrionicus histrionicus; n = 21) at an industrialized site and Steller's eiders (n = 48) at a reference site, and compared these strains with those isolated from water samples from near-shore habitats of ducks. The overall prevalence of E. coli was 16% and 67% in Steller's eiders and harlequin ducks, respectively, at the industrialized study site, and 2% in Steller's eiders at the reference site. Based on O and H antigen subtyping and genetic characterization by enterobacterial repetitive intergenic consensus polymerase chain reaction and pulsed-field gel electrophoresis, we found evidence of avian pathogenic E. coli (APEC) strains associated with both species and detected E. coli strains carrying virulence genes associated with mammals in harlequin ducks. Steller's eiders that carried APEC had lower serum total protein and albumin concentrations, providing further evidence of pathogenicity. The genetic profile of two E. coli strains from water matched an isolate from a Steller's eider providing evidence of transmission between near-shore habitats and birds. © 2010 Society for Applied Microbiology and Blackwell Publishing Ltd.
Maritime Halophyte Species from Southern Portugal as Sources of Bioactive Molecules
DEFF Research Database (Denmark)
Rodrigues, Maria João; Gangadhar, Katkam N.; Vizetto-Duarte, Catarina
2014-01-01
-ethylbenzothiazoline-6-sulphonic acid) (ABTS) radical was obtained in the ether extract of J. acutus (IC50 = 0.4 mg/mL) and H. portulacoides (IC50 = 0.9 mg/mL). The maximum total phenolic content (TPC) was found in the methanol extract of M. edule (147 mg gallic acid equivalents (GAE)/g) and in the ether extract of J......,1-diphenyl-2-picrylhydrazyl (DPPH) radical were the methanol extracts of M. edule (IC50 = 0.1 mg/mL) and J. acutus (IC50 = 0.4 mg/mL), and the ether extracts of J. acutus (IC50 = 0.2 mg/mL) and A. macrostachyum (IC50 = 0.3 mg/mL). The highest radical scavenging activity (RSA) against the 2,2'-azino-bis (3...... activity and selectivity was obtained with the ether extract of J. acutus. Juncunol was identified as the active compound and for the first time was shown to display selective in vitro cytotoxicity towards various human cancer cells....
February 2013 critical care journal club
Directory of Open Access Journals (Sweden)
Robbins RA
2013-02-01
Full Text Available No abstract available. Article truncated after 150 words. Ferguson ND, Cook DJ, Guyatt GH, Mehta S, Hand L, Austin P, Zhou Q, Matte A, Walter SD, Lamontagne F, Granton JT, Arabi YM, Arroliga AC, Stewart TE, Slutsky AS, Meade MO; the OSCILLATE Trial Investigators and the Canadian Critical Care Trials Group. High-Frequency Oscillation in Early Acute Respiratory Distress Syndrome. N Engl J Med. 2013;368:795-805. Young D, Lamb SE, Shah S, Mackenzie I, Tunnicliffe W, Lall R, Rowan K, Cuthbertson BH; the OSCAR Study Group. High-Frequency Oscillation for Acute Respiratory Distress Syndrome. N Engl J Med. 2013;368:806-13. Malhotra A, Drazen JM. High-Frequency Oscillatory Ventilation on Shaky Ground. N Engl J Med. 2013;368:863-5. Two articles and an accompanying editorial, the later co-authored by none less than the editor, appeared in the New England Journal of Medicine this week. These all dealt with the use of high-frequency oscillatory ventilation (HFOV in the adult respiratory distress syndrome (ARDS. As the editorial points …
Ghanem-Sabanadzovic, Nina Abou; Sabanadzovic, Sead; Digiaro, Michele; Martelli, Giovanni P
2005-05-01
The nucleotide sequence of RNA-2 of Grapevine Anatolian ringspot virus (GARSV) and Grapevine deformation virus (GDefV), two recently described nepoviruses, has been determined. These RNAs are 3753 nt (GDefV) and 4607 nt (GARSV) in size and contain a single open reading frame encoding a polyprotein of 122 kDa (GDefV) and 150 kDa (GARSV). Full-length nucleotide sequence comparison disclosed 71-73% homology between GDefV RNA-2 and that of Grapevine fanleaf virus (GFLV) and Arabis mosaic virus (ArMV), and 62-64% homology between GARSV RNA-2 and that of Grapevine chrome mosaic virus (GCMV) and Tomato black ring virus (TBRV). As previously observed in other nepoviruses, the 5' non-coding regions of both RNAs are capable of forming stem-loop structures. Phylogenetic analysis of the three proteins encoded by RNA-2 (i.e. protein 2A, movement protein and coat protein) confirmed that GDefV and GARSV are distinct viruses which can be assigned as definitive species in subgroup A and subgroup B of the genus Nepovirus, respectively.
Phytosanitary evaluation of olive germplasm in Albania
Directory of Open Access Journals (Sweden)
M. Luigi
2009-09-01
Full Text Available A survey on viruses was carried out in 2008 in the main olive-growing areas of Albania (Kruja, Sauk and Vlora. Fifty samples from 14 local and 2 exotic olive cultivars were collected from 10 commercial orchards and one collection field and inspected for Arabis mosaic virus (ArMV, Cherry leaf roll virus (CLRV, Strawberry latent ringspot virus (SLRV, Olive latent virus 1 (OLV-1, Olive leaf yellowing-associated virus (OLYaV, Cucumber mosaic virus (CMV, Olive latent virus-2 (OLV-2 and Tobacco necrosis virus strain D (TNV-D by a one-step RT-PCR assay using virus-specifi c primers. None of these viruses were found in the source plants except SLRSV and OLYaV, which were detected in a ‘K. M. Berat’ olive tree grown in the collection field. These findings are important because the incidence of olive virus diseases is low in Albania but high in other Mediterranean countries. Thus, all efforts should be to directed to maintaining the Albanian olive germplasm pathogen-free and in the best agronomical and phytosanitary condition possible.
Effect Of Gamma Radiation On Plant Mineral Content And Yield Of Barley Grown Under Saline Conditions
International Nuclear Information System (INIS)
Charabaji, T.; Khalifa, K.; Al-Ain, F.
2004-01-01
A field experiment was conducted at Al-Hijanah, an area located at about 35 km south east of Damascus. Seeds of two barley varieties [Arabi Abiad (AA) and Pakistani PK 30163 (PK)] were irradiated with 2 doses 0 and 15 Gy of gamma irradiation. They were sown on saline soil (16.4-18.7 dS/m) and irrigated with saline water ( 7-8 dS/m) A dose of 15 Gy of gamma irradiation was shown to positively effect the percent germination of PK but had no similar effect on AA. -Physiological Maturity Stage: The same dose (15 Gy) increased shoot dry weight, but had a negative effect on K + and Na + contents in the PK variety. As for the AA variety, Mg ++ and P contents were increased, whereas Na + and Cl- were slightly decreased. -Harvest Stage: Gamma irradiation had a positive effect on total yield, grain yield, nitrogen yield and harvest index of the PK variety. A positive effect was produced on straw yield, 1000-grain weight and N% of a Avariety. (Authors)
Directory of Open Access Journals (Sweden)
Ahmed M. Abbas
2015-10-01
Full Text Available Experimental studies to determine the nature of ecological interactions between invasive and native species are necessary for conserving and restoring native species in impacted habitats. Theory predicts that species boundaries along environmental gradients are determined by physical factors in stressful environments and by competitive ability in benign environments, but little is known about the mechanisms by which hydrophytes exclude halophytes and the life history stage at which these mechanisms are able to operate. The ongoing invasion of the South American Spartina densiflora in European marshes is causing concern about potential impacts to native plants along the marsh salinity gradient, offering an opportunity to evaluate the mechanisms by which native hydrophytes may limit, or even prevent, the expansion of invasive halophytes. Our study compared S. densiflora seedling establishment with and without competition with Phragmites australis and Typha domingensis, two hydrophytes differing in clonal architecture. We hypothesized that seedlings of the stress tolerant S. densiflora would be out-competed by stands of P. australis and T. domingensis. Growth, survivorship, biomass patterns and foliar nutrient content were recorded in a common garden experiment to determine the effect of mature P. australis and T. domingensis on the growth and colonization of S. densiflora under fresh water conditions where invasion events are likely to occur. Mature P. australis stands prevented establishment of S. densiflora seedlings and T. domingensis reduced S. densiflora establishment by 38%. Seedlings grown with P. australis produced fewer than five short shoots and all plants died after ca. 2 yrs. Our results showed that direct competition, most likely for subterranean resources, was responsible for decreased growth rate and survivorship of S. densiflora. The presence of healthy stands of P. australis, and to some extent T. domingensis, along river channels
Miyazaki, S; Koga, R; Bohnert, H J; Fukuhara, T
1999-03-01
Ten transcripts (Mpc1-10) homologous to protein phosphatases of the 2C family have been isolated from the halophyte Mesembryanthemum crystallinum (common ice plant). Transcripts range in size from 1.6 to 2.6 kb, and encode proteins whose catalytic domains are between 24% and 62% identical to that of the Arabidopsis PP2C, ABI1. Transcript expression is tissue specific. Two isoforms are present only in roots (Mpc1 and Mpc5), three in young leaves (Mpc6, 8 and 9), two in old leaves (Mpc6 and Mpc8), and two in post-flowering leaves (Mpc8 and Mpc9). Mpc2 is strongly expressed in roots and also in seeds, meristematic tissues and mature flowers. Mpc3 is specific for leaf meristems, and Mpc4 is found in root and leaf meristems. Mpc7 is restricted to meristematic tissues. Mpc10 is only present in mature flowers. Mpc2 (in roots and leaves), Mpc5 (in roots) and Mpc8 (weakly in leaves) are induced by salinity stress and drought conditions with different kinetics in different tissues, but other Mpcs are downregulated by stress. Cold stress (4 degrees C) leads to a decline in Mpc5 and Mp6, but low temperature provoked a long-term (days) increase in Mpc2 levels in leaves and a transient increase (less than 24 h) in roots. Four full-length transcripts have been obtained. In each case, after over-expression in E. coli, the isolated proteins exhibited (Mg2+-dependent, okadeic acid-insensitive) protein phosphatase activity, although activity against 32P-phosphocasein varied among different PP2Cs. Determination of tissue developmental and stress response specificity of PP2C will facilitate functional studies of signal-transducing enzymes in this halophytic organism.
International Nuclear Information System (INIS)
Le Xuan Tham; Vo Huy Dang; Noriko, S.
2002-01-01
Effect of salinity stress (NaCl) and glycinebetaine on typical non-halophyte plants - rice (Oryza sativa L.) was examined for the growth, net photosynthesis and transpiration functions of seedlings. Using 22 Na, the inhibition of net uptake and translocation of sodium of seedlings stressed at 0.15% NaCl in solution and previously treated with exogenous glycinebetaine was observed by positron-emitting tracer imaging system, namely PETIS for diagnosis of early responses of plants to salt stress. Effects of exogenous glycinebetaine on rice plants stressed with salinity via osmotic protection and particularly stabilization of membrane permeability to inhibit Na uptake and translocation were discussed in connection with promising potentials of PETIS for researches on plants. (Author)
DEFF Research Database (Denmark)
Shabala, Sergey; Hariadi, Yuda; Jacobsen, Sven-Erik
2013-01-01
old seedlings. Six weeks after the treatment commenced, leaf sap Na and K content and osmolality, stomatal density, chlorophyll fluorescence characteristics, and xylem sap Na and K composition were measured. Responses to salinity differed greatly among the varieties. All cultivars had substantially...... increased K+ concentrations in the leaf sap, but the most tolerant cultivars had lower xylem Na+ content at the time of sampling. Most tolerant cultivars had lowest leaf sap osmolality. All varieties reduced stomata density when grown under saline conditions. All varieties clustered into two groups...... to the xylem, and reduced stomata density are important physiological traits contributing to genotypic differences in salinity tolerance in quinoa, a halophyte species from Chenopodium family....
The changes in contents of Salt Marsh Species and the importance of Edaphic Physiochemical Factors
International Nuclear Information System (INIS)
Kutbay, Hamdi G.; Demir, M.
2001-01-01
The changes in nutrient contents of some halophytic plants which occurred in a salt marsh located in the vicinity of Bafra town, on the north coast of Turkey during the growing seasons were investigated. Contents of So4, Cl, Na, K, Ca and Mg changed during the growing season in most species. High correlation coefficients were obtained between plant ion and soil ion contents. It has been found that the most prevalent ion was Na in the plant and soil samples. It was also shown that species diversity was quite low in the study area, and species diversity was highly correlated with so4/Cl ratio, electrical conductivity and pH. (author)
Directory of Open Access Journals (Sweden)
Aldama GR
2013-01-01
Full Text Available Morphometric characteristics of a tropical shallow reservoir situated in the Southern Mexican Highlands were studied. Seventeen morphometric parameters were measured. Results of the morphometric parameters showed that this reservoir presented a soft and roughness bottom, with an ellipsoid form and a concave depression that allow the mix up of water and sediments, causing turbidity and broken thermal gradients; its slight slopes allowed the colonization of submerged macrophyte and halophyte plants and they improve the incidence of sunlight on water surface increasing evaporation and primary productivity. Tropical shallow reservoirs have fluctuations in area and volume according to the amount of rainfall, the effect of evaporation, the temperature levels, lost of volume due to irrigation, and other causes.
Analysis of Roman glass from Albania by PIXE–PIGE method
International Nuclear Information System (INIS)
Šmit, Ž.; Tartari, F.; Stamati, F.; Vevecka Priftaj, A.; Istenič, J.
2013-01-01
A series of 31 Roman glasses dated to the 1st–4th c. AD from the present Albania was analyzed by the combined PIXE–PIGE method. The analysis shows typical natron-based glass of the Roman period, though statistical treatment using principal component analysis and bivariate plots reveals four distinct groups, which are qualified by increased levels of potassium, magnesium and titanium–manganese–iron oxides, respectively. MgO content may exceed 2% and reach the level commonly accepted for halophytic plant-ash glass. The groups are formed on account of mineral impurities in the sand, which gives support to the thesis of multiple production centers of raw glass in the imperial age
Viability of the Alaskan breeding population of Steller’s eiders
Dunham, Kylee; Grand, James B.
2016-10-11
The U.S. Fish and Wildlife Service is tasked with setting objective and measurable criteria for delisting species or populations listed under the Endangered Species Act. Determining the acceptable threshold for extinction risk for any species or population is a challenging task, particularly when facing marked uncertainty. The Alaskan breeding population of Steller’s eiders (Polysticta stelleri) was listed as threatened under the Endangered Species Act in 1997 because of a perceived decline in abundance throughout their nesting range and geographic isolation from the Russian breeding population. Previous genetic studies and modeling efforts, however, suggest that there may be dispersal from the Russian breeding population. Additionally, evidence exists of population level nonbreeding events. Research was conducted to estimate population viability of the Alaskan breeding population of Steller’s eiders, using both an open and closed model of population process for this threatened population. Projections under a closed population model suggest this population has a 100 percent probability of extinction within 42 years. Projections under an open population model suggest that with immigration there is no probability of permanent extinction. Because of random immigration process and nonbreeding behavior, however, it is likely that this population will continue to be present in low and highly variable numbers on the breeding grounds in Alaska. Monitoring the winter population, which includes both Russian and Alaskan breeding birds, may offer a more comprehensive indication of population viability.
Effects of long-term salinity on the growth of the halophyte Spartina ...
African Journals Online (AJOL)
use
2011-12-07
Dec 7, 2011 ... studies of the salinity tolerance of salt marsh plants are very important and ... In April 2009, seeds were rinsed with fresh water to remove salts, sown into ..... EP, Guntenspergen GP, Brown JJ, Nelson SG (2006). Salt tolerance.
Effects of long-term salinity on the growth of the halophyte Spartina ...
African Journals Online (AJOL)
use
2011-12-07
Dec 7, 2011 ... randomized design in a glass-covered greenhouse with natural temperature and light. The interior of the greenhouse ceiling was draped with 30% shade ... Scientific, Great Amwell, Herts, UK) in the growth chamber. Statistical ...
APPLIED PHYTO-REMEDIATION TECHNIQUES USING HALOPHYTES FOR OIL AND BRINE SPILL SCARS
Energy Technology Data Exchange (ETDEWEB)
M.L. Korphage; Bruce G. Langhus; Scott Campbell
2003-03-01
Produced salt water from historical oil and gas production was often managed with inadequate care and unfortunate consequences. In Kansas, the production practices in the 1930's and 1940's--before statewide anti-pollution laws--were such that fluids were often produced to surface impoundments where the oil would segregate from the salt water. The oil was pumped off the pits and the salt water was able to infiltrate into the subsurface soil zones and underlying bedrock. Over the years, oil producing practices were changed so that segregation of fluids was accomplished in steel tanks and salt water was isolated from the natural environment. But before that could happen, significant areas of the state were scarred by salt water. These areas are now in need of economical remediation. Remediation of salt scarred land can be facilitated with soil amendments, land management, and selection of appropriate salt tolerant plants. Current research on the salt scars around the old Leon Waterflood, in Butler County, Kansas show the relative efficiency of remediation options. Based upon these research findings, it is possible to recommend cost efficient remediation techniques for slight, medium, and heavy salt water damaged soil. Slight salt damage includes soils with Electrical Conductivity (EC) values of 4.0 mS/cm or less. Operators can treat these soils with sufficient amounts of gypsum, install irrigation systems, and till the soil. Appropriate plants can be introduced via transplants or seeded. Medium salt damage includes soils with EC values between 4.0 and 16 mS/cm. Operators will add amendments of gypsum, till the soil, and arrange for irrigation. Some particularly salt tolerant plants can be added but most planting ought to be reserved until the second season of remediation. Severe salt damage includes soil with EC values in excess of 16 mS/cm. Operators will add at least part of the gypsum required, till the soil, and arrange for irrigation. The following seasons more gypsum will be added and as the soil EC is reduced, plants can be introduced. If rapid remediation is required, a sufficient volume of topsoil, or sand, or manure can be added to dilute the local salinity, the bulk amendments tilled into the surface with added gypsum, and appropriate plants added. In this case, irrigation will be particularly important. The expense of the more rapid remediation will be much higher.
Analysis of glass from the post-Roman settlement Tonovcov grad (Slovenia) by PIXE–PIGE and LA-ICP-MS
Energy Technology Data Exchange (ETDEWEB)
Šmit, Ž., E-mail: ziga.smit@fmf.uni-lj.si [Faculty of Mathematics and Physics, University of Ljubljana, Jadranska 19, SI-1000 Ljubljana (Slovenia); Jožef Stefan Institute, Jamova 39, SI-1001 Ljubljana (Slovenia); Milavec, T. [Department of Archaeology, Faculty of Arts, University of Ljubljana, Zavetiška 5, SI-1000 Ljubljana (Slovenia); Fajfar, H. [Jožef Stefan Institute, Jamova 39, SI-1001 Ljubljana (Slovenia); Rehren, Th. [UCL Qatar, Education City, P.O. Box 23689, Doha (Qatar); Lankton, J.W. [UCL Institute of Archaeology, 31-34 Gordon Square, London WC1H 0PY (United Kingdom); Gratuze, B. [IRAMAT-Centre Ernest-Babelon, CNRS Université d’Orléans, 3D rue de la Ferollerie, 45071 Orléans Cedex 2 (France)
2013-09-15
The combined PIXE–PIGE method was used for the analysis of 43 glass fragments from the archaeological site Tonovcov grad in western Slovenia, with 10 of these additionally being analysed by LA-ICP-MS. The glass objects were attributed to the Late Antique production of the 4th–7th c. AD, with two examples of early Roman glass and three glass beads, one of them presumably of oriental origin. The analysis showed typical natron-type glass, produced in the Levantine region around the river Belus, and a few examples of HIMT glass, which could be recognized also in several other recycled objects. Only one glass bead, found in Early Medieval context, was made of the ash of halophytic plants.
Biofuels as an Alternative Energy Source for Aviation-A Survey
McDowellBomani, Bilal M.; Bulzan, Dan L.; Centeno-Gomez, Diana I.; Hendricks, Robert C.
2009-01-01
The use of biofuels has been gaining in popularity over the past few years because of their ability to reduce the dependence on fossil fuels. As a renewable energy source, biofuels can be a viable option for sustaining long-term energy needs if they are managed efficiently. We investigate past, present, and possible future biofuel alternatives currently being researched and applied around the world. More specifically, we investigate the use of ethanol, cellulosic ethanol, biodiesel (palm oil, algae, and halophytes), and synthetic fuel blends that can potentially be used as fuels for aviation and nonaerospace applications. We also investigate the processing of biomass via gasification, hydrolysis, and anaerobic digestion as a way to extract fuel oil from alternative biofuels sources.
Directory of Open Access Journals (Sweden)
Ocimar Ferreira de Andrade
2016-04-01
Full Text Available The sources of contamination related to the exploration, production, storage, transport, distribution and disposal of petroleum, and its products, carry risks that threaten fragile coastal environments, little studied and, thus, in need of attention from the scientific community. On the other hand, symbiont mechanisms essential for the very existence of many plant species, and their relation to contaminated soils, remain unknown. Despite the identification of several species of AMF halophytes soil communities in sandbanks, one can infer their bioremediation potential from studies in other types of soil, which, however, report the same genera of fungi as participants in mycorrhizoremediation processes of polluted soil. This study focuses on the application of biotechnology using Arbuscular Mycorrhizal Fungi (AMF in soils impacted by petroleum hydrocarbons.
Kronberg, P. (Principal Investigator)
1974-01-01
The author has identified the following significant results. ERTS-1 MSS imagery covering the Afar-Triangle/Ethiopia and adjacent regions (Ethiopian Plateau, Somali Plateau, and parts of Yemen and Saudi Arabi) was applied to the mapping of lithologic and structural units of the test area at a scale 1:1,000,000. Results of the geological evaluation of the ERTS-1 imagery of the Afar have proven the usefullness of this type of satellite data for regional geological mapping. Evaluation of the ERTS images also resulted in new aspects of the structural setting and tectonic development of the Afar-Triangle, where three large rift systems, the oceanic rifts of the Red Sea and Gulf of Aden and the continental East African rift system, seem to meet each other. Surface structures mapped by ERTS do not indicate that the oceanic rift of the Gulf of Aden (Sheba Ridge) continues into the area of continental crust west of the Gulf of Tadjura. ERTS data show that the Wonji fault belt of the African rift system does not enter or cut through the central Afar. The Aysha-Horst is not a Horst but an autochthonous spur of the Somali Plateau.
Revisiting of The negative and positive theologies in the Gradation of existence theory
Directory of Open Access Journals (Sweden)
Hamed Naji
2016-09-01
Full Text Available The negative and positive theologies are two intellectually compaction positions that have attracted most Islamic thinkers since the early Islamic period. Tashbih and tanzih means likening and cleansing or purifying respectively. These two technical words in theology describe human encounter with God. Accordingly Asharites tends towards Positive theology and Mutazale and Shiite tend towards Negative Theology. There are some Shiete thinkers, however, to compromise this situation. Based on different assumptions and presuppositions we can discern the following compromised versions: 1. Mild Anthrophomorphism: based on the communality of God and human attributes and reflections on Human contingency and God's necessity 2. Prevalence of existence and its unity: based on Ibn Arabi's mystical philosophy 3. Gradation of existence: based on Sadra's transcendental philosophy By looking at the most over-looked fundamental principles of Transcendental Philosophy, I will take a look the possible reconciliations of Negative and Positive theology in this paper. At the end, I will argue for its most plausible version
Effect of UV-C irradiation on growth, sporulation and pathogenicity of cochliobolus sativus isolates
International Nuclear Information System (INIS)
Jawhar, M.; Arabi, M.I.E.
1999-12-01
More than 30 isolates of Cochliobolus sativus, the causal agent of common root rot disease; were collected from different regions of Syria. Seven of them were exposed to UV-C light for 40 or 60 h . at a dose rate of 2.52x10 -3 W/cm 2 . A significant increases in the mycelium growth and sporulation were detected (p<0.001). Within the studied range of UV wave length, these two parameters were increased upon increasing the period of exposure to UV-C light. The pathogenicity of four isolates was evaluated after 60 h. of UV irradiation. The response to UV irradiation varied among these isolates, and resulted in an increase in their virulence level (as assessed by evaluating disease severity on sub-crown internodes). Five barley genotypes possessing different levels of resistance to C. sativus were studied. Arabi Abiad was the most susceptible cultivar whereas, Taka 76 line was moderately susceptible. It is concluded that it is possible to implement the positive effect of low doses of UV-C in stimulating the sporulation of fungi, which are difficult to sporulate on artificial media. (author)
New Approach in Religious Studies with Special Reference to Muhammad Abid al-Jabiri
Directory of Open Access Journals (Sweden)
Nirwan Syafrin
2014-11-01
Full Text Available Beginning from the nineteenth century, Arab-Muslim intelligentsias marched to reform their societies. Many things since then have been carried out. They put forward various proposals, advanced numerous ideas and concepts and established several institutions. Nevertheless, their condition has yet improved. In some context, it even deteriorates. Triggered by this situation, a number of Arab and Muslim scholars then embark on a new reform project. But at this time, their reform attempt is materialized in the form of intellectual and cultural project. For they believe that the basic problem and crisis beset their society lies in their understanding of turâts. Thus, unless this understanding is corrected, no genuine reform would be able to be materialized. Muhammad ‘Abid al-Jabiri, a Moroccan scholar, is one of the many Arab scholars who have taken this course. For this purpose, he constructed his own project which he names Naqd al-‘Aql al-‘Arabi. This article specifically attempts to shed light on conceptual apparatus and methods that he uses which this study finds to have originated from different schools of thought of western philosophy and social sciences, important of which is Marxism and postmodernism.
Directory of Open Access Journals (Sweden)
Mehdi Aghamohammadi
2017-04-01
Full Text Available One of the conspicuous features of the twentieth-century West was silence. This idea could be supported by examining reflections of Ludwig Wittgenstein, Fritz Mauthner, John Cage, Samuel Beckett, Ihab Hassan, Franz Kafka, Wassily Kandinsky, Jean-Paul Sartre, Virginia Woolf, Wolfgang Iser, Jacques Derrida, and Pierre Macherey. To me, silence is not a mere theory, but rather a phenomenon from which we can get practical benefits. I believe silence is an eye, eye of knowledge. We can broaden our knowledge of the world through silence. To convey the idea that silence is an eye, I have concocted the word slence, where has replaced the letter i and stands for the eye. This means knowledge can enable us to see, thereby acquiring knowledge of, what used to be invisible, and accordingly unknowable. In other words, through silence, we can achieve a certain type of literacy. I substantiate this claim by exploring the Horus myth, Ojo de Dios, John Cage’s 4' 33", the nature of Expressionist paintings, Hinduism, thoughts of Hermes Trismegistus and Ibn al-Arabi, and practices of Mohammad, the prophet of Islam.
International Nuclear Information System (INIS)
Andret-Link, Peggy; Schmitt-Keichinger, Corinne; Demangeat, Gerard; Komar, Veronique; Fuchs, Marc
2004-01-01
The viral determinants involved in the specific transmission of Grapevine fanleaf virus (GFLV) by its nematode vector Xiphinema index are located within the 513 C-terminal residues of the RNA2-encoded polyprotein, that is, the 9 C-terminal amino acids of the movement protein (2B MP ) and contiguous 504 amino acids of the coat protein (2C CP ) [Virology 291 (2001) 161]. To further delineate the viral determinants responsible for the specific spread, the four amino acids that are different within the 9 C-terminal 2B MP residues between GFLV and Arabis mosaic virus (ArMV), another nepovirus which is transmitted by Xiphinema diversicaudatum but not by X. index, were subjected to mutational analysis. Of the recombinant viruses derived from transcripts of GFLV RNA1 and RNA2 mutants that systemically infected herbaceous host plants, all with the 2C CP of GFLV were transmitted by X. index unlike none with the 2C CP of ArMV, regardless of the mutations within the 2B MP C-terminus. These results demonstrate that the coat protein is the sole viral determinant for the specific spread of GFLV by X. index
Journalism and Literature in the Egyptian Revolution of 1882
Directory of Open Access Journals (Sweden)
José Maurício Saldanha Álvarez
2014-09-01
Full Text Available This article analyzes the news reports written by the Portuguese novelist and journalist Eça de Queirós about the crisis in 1881-1882 that resulted in the bombing of Alexandria, Egypt, by a British fleet. First, following Barbie Zelizer, we examine the communication of this historical event by analyzing how the news reports covering the event were written, taking into account the literary form commonly used during the period. For Zelizer, figures could not be trusted, and the plot and storyline were preferable. Second, as proposed by Hallin and Mancini, we analyze media practices during the period and compare the practices of the British and Luso-Brazilian print media. Eça appropriated information broadcasts by British journalists and reformulated them for his readers, emphasizing the key issues that lurked beneath the events of 1881-1882. Third, we analyze how the Egyptian army and Colonel Arabi went from being demonized to a position of heroes in modern Egypt through reports by the Brazilian periodical Gazeta de Noticias that were published in 1882 in Rio de Janeiro and were considered the culmination of its journalistic activities.
Directory of Open Access Journals (Sweden)
Avinash Mishra
2017-04-01
Full Text Available An obligate halophyte, Salicornia brachiata grows in salt marshes and is considered to be a potential resource of salt- and drought-responsive genes. It is important to develop an understanding of the mechanisms behind enhanced salt tolerance. To increase this understanding, a novel SbSRP gene was cloned, characterized, over-expressed, and functionally validated in the model plant Nicotiana tabacum. The genome of the halophyte S. brachiata contains two homologs of an intronless SbSRP gene of 1,262 bp in length that encodes for a stress-related protein. An in vivo localization study confirmed that SbSRP is localized on the plasma membrane. Transgenic tobacco plants (T1 that constitutively over-express the SbSRP gene showed improved salinity and osmotic stress tolerance. In comparison to Wild Type (WT and Vector Control (VC plants, transgenic lines showed elevated relative water and chlorophyll content, lower malondialdehyde content, lower electrolyte leakage and higher accumulation of proline, free amino acids, sugars, polyphenols, and starch under abiotic stress treatments. Furthermore, a lower build-up of H2O2 content and superoxide-radicals was found in transgenic lines compared to WT and VC plants under stress conditions. Transcript expression of Nt-APX (ascorbate peroxidase, Nt-CAT (catalase, Nt-SOD (superoxide dismutase, Nt-DREB (dehydration responsive element binding factor, and Nt-AP2 (apetala2 genes was higher in transgenic lines under stress compared to WT and VC plants. The results suggested that overexpression of membrane-localized SbSRP mitigates salt and osmotic stress in the transgenic tobacco plant. It was hypothesized that SbSRP can be a transporter protein to transmit the environmental stimuli downward through the plasma membrane. However, a detailed study is required to ascertain its exact role in the abiotic stress tolerance mechanism. Overall, SbSRP is a potential candidate to be used for engineering salt and osmotic
Distribution of oil from the Gulf War spill within intertidal habitats - one year later
International Nuclear Information System (INIS)
Hayes, M.O.; Michel, J.; Montelo, T.M.; Al-Mansi, A.M.; Jensen, J.R.; Narumalani, S.; Aurand, D.V.; Al-Momen, A.H.; Thayer, G.W.
1993-01-01
Results of a land-based intertidal survey of the impacts of the Gulf War oil spill on the Saudi Arabian coast, carried out from 1 March to 4 April 1992 in conjunction with Leg II of the NOAA ship Mt. Mitchell's ROPME Sea cruise, show that there is a striking correlation between the near shore geomorphology and the persistence of intertidal oil. Significant quantities of oil (measured in millions of gallons) remained in the sediments of the sheltered tidal flat/marsh areas, and significant erosion of oiled sediments has occurred along many of the outer exposed areas. A massive asphalt pavement, tens of meters wide and over 20 kilometers long, which is believed to have formed as a result of the Nowruz spill of 1983, occurs along the outer coast of the Abu Ali headland. Along certain other exposed outer sand beaches, conditions are conducive to the formation and preservation of a similar asphalt pavement as a result of the Gulf War spill. The most severely impacted areas studied were several halophyte marsh algal mat complexes and mudflats at the heads of sheltered bays, where all the halophytes were dead and there was no sign of living epibiota in the mid to upper intertidal areas. Before the spill, burrowing infauna, such as crabs and polychaetes, occurred in large numbers in these sheltered areas. The previously occupied burrows were heavily oiled, with some containing liquid black oil to depths of over 40 cm. The deep penetration of oil into the burrows and probable slow weathering rates of the oil could result in many years of pollution of these sheltered habitats. Depths of penetration of oil into bubble sand exceeding 40 cm were found at several localities. This deep oil will also remain in the sediment for many years, because of the slow erosion rates that occur in these sheltered environments. Many unoiled portions were rich in epifaunal and infaunal populations of invertebrates and plants. Shorebirds were observed feeding in these unoiled areas
Directory of Open Access Journals (Sweden)
Gavin Archbald
2014-06-01
Full Text Available Non-native sea lavenders (Limonium spp. are invasive in salt marshes of southern California and were first documented in the San Francisco Estuary (the estuary in 2007. In this study, we mapped distributions of L. ramosissimum subsp. provinciale (LIRA and L. duriusculum within the estuary and investigated how the invasion potential of the more common species, LIRA, varies with elevation and edaphic conditions. We contacted colleagues and conducted field searches to find and then map sea lavender populations. In addition, we measured LIRA’s elevational range at three salt marshes. Across this range we measured (1 soil properties: salinity, moisture, bulk density, and texture; and (2 indicators of invasion potential: LIRA size, seed production, percent cover, spread (over 1 year, recruitment, and competition with native halophytes (over 6 months. We found LIRA in 15,144 m2 of upper salt marsh habitat in central and south San Francisco bays and L. duriusculum in 511 m2 in Richardson and San Pablo bays. LIRA was distributed from mean high water (MHW to 0.42 m above mean higher high water (MHHW. In both spring and summer, soil moisture and salinity were lowest at higher elevations within LIRA’s range, which corresponded with greater rosette size, inflorescence and seed production (up to 17,400 seeds per plant, percent cover, and recruitment. LIRA cover increased on average by 11% in 1 year across marshes and elevations. Cover of the native halophytes Salicornia pacifica, Jaumea carnosa, and Distichlis spicata declined significantly at all elevations if LIRA were present in plots (over a 6-month, fall–winter period. Results suggest LIRA’s invasion potential is highest above MHHW where salinity and moisture are lower, but that LIRA competes with native plants from MHW to above MHHW. We recommend removal efforts with emphasis on the salt marsh-terrestrial ecotone where LIRA seed output is highest.
A phytogeographic survey of Southern Benin
Directory of Open Access Journals (Sweden)
G. Paradis
1983-11-01
Full Text Available Southern Benin has a dry subequatoriai climate with a rainfall gradient from 850 mm in the west to 1 500 mm in the east, the geomorphology is varied and the vegetation has been subjected to strong human influence. There are numerous plant formations, namely: 1, forest islands which are probably relics of the primitive vegetation and include (a dense semi-deciduous forests of several types, (b swamp forests of two types, (c periodically flooded forest of two types, (d Lophira lanceolata (Hutchinson & Dalziel, 1954-72 woodlands and (e mangrove swamps; 2, formations which are probably derived and include (a thickets of several types, (b tree savannas and shrub savannas, (c grassy savannas and prairies varying according to soil characteristics and (d halophytic grasslands; and 3, floating vegetation on fresh-water lakes.
Duberstein, Jamie A.; Krauss, Ken W.; Kennish, Michael J.
2015-01-01
A forested wetland (swamp) is a forest where soils are saturated or flooded for at least a portion of the growing season, and vegetation, dominated by trees, is adapted to tolerate flooded conditions. A tidal freshwater forested wetland is a forested wetland that experiences frequent but short-term surface flooding via tidal action, with average salinity of soil porewater less than 0.5 g/l. It is known locally as tidal várzea in the Amazon delta, Brazil. A tidal saltwater forested wetland (mangrove forest) is a forested wetland that experiences frequent but short-term surface flooding via tidal action, with average salinity often exceeding 3 g/l and reaching levels that can exceed seawater. Mangrove ecosystems are composed of facultative halophytes that generally experience better growth at moderate salinity concentrations.
Heckenroth, Alma; Rabier, Jacques; Laffont-Schwob, Isabelle
2014-05-01
In arid and semi-arid Mediterranean coastal areas, metals and metalloids (MM) pollution coming from unreclaimed brownfields has increased the negative environmental stresses leading to ecosystems degradations as soil erosion and losses of organic matter and biodiversity. On these sites, maintaining or restoring a local vegetation cover is considered as a key step to stop the degradation cycle. Furthermore, in a context of high pollution occurring in natural areas, phytoremediation is considered as an attractive alternative to conventional soil remediation techniques, the first reducing pollution transfers, improving the soil quality. In protected or natural areas, it is also important to perceive then design phytoremediation as a way to assist ecosystems recovery, using the restoration ecology concepts. However, only few works in the literature deal with the potential use of native Mediterranean plant species for phytoremediation. On the South-East coast of Marseille (France), the activity of the former smelting factory of l'Escalette, ceased since 1925. However, its brownfield is still a source of pollution by trace metals and metalloids for abiotic and biotic components of the surrounding massif. This massif hosts a rich biodiversity with rare and protected plant species despite the metallic pollution and this area has been included in the recently created first peri-urban French National Park of Calanques. In this context, an integrated research project is being conducted with local actors and stakeholders, from the selection of native plant species, assessment and optimization of phytostabilization capacities of selected species, to the development of ecological engineering techniques well adapted to local constraints and phytostabilization field trials. The first part of this study has been conducted on two areas, corresponding to different pollution pattern, plant communities and environmental drivers: a halophytic area, characterized by typical coastal
Feeding Value of Silybum marianum for Sheep and its Effect on Fiber and Protein Digestion
Directory of Open Access Journals (Sweden)
Ali Mojadam
2016-04-01
Full Text Available Introduction Due to scarcity of forage and water resources and high feed prices in Iran, it seems that the utilization of native and cheap forage resources for ruminants is important. The Milk thistle (Silybum marianum is distributed in different regions of Iran included: Gonbad Kavoos, Gorgan, Nodeh Kalardasht, Dareh Hezareh, Dasht Mugan, Poshtkoh, Mollassani, Shush, Hamidieh, Ramhormuz, Izeh and Kazeroon. The Silybum marianum seed extract and whole plant contain many compounds including Silybin A and B, Silychristin, Apigenin, deoxy silydianin (flavonolignans. Seeds of this plant has about 20 to 25 percent oil, which oleic acids (31.85 %, linoleic acid (45.36 % percent and palmitic acid (8.25 % are the major fatty acids of Silybum marianum seed. Also, the Silybum marianum contains flavonoids and anti-nutritional compounds such as tannins and nitrates. Tannins, unsaturated oils and other anti-nutritional compounds may have negative effects on the digestion of fiber and protein fractions. Tannins can make complexes with large number of nutrients, such as carbohydrates, proteins, bacterial cell membrane protein and carbohydrates, and even digestive enzymes. The Silybum marianum plants are native to northern areas of Ahvaz and abundantly growth as self-propelled. The farm animals in these area (sheep, goats, camels, water buffalo and native cows, etc. graze this plant as well as the manual feeding, but there is little known about its effects on the health, performance and digestibility of nutrients (in particular on the fiber and protein, due to existing the tannin and unsaturated oils in it in those animals, and no research work has been done about Silybum marianum. Therefore, this experiment was conducted to determine the feeding value of Silybum marianum and to measure its effects on rumen fermentation and digestion of fiber (straw and protein constituents (soybean meal feedstuff in Arabi sheep. Materials and Methods Twelve male Arabi sheep
Reed, J.A.; Flint, Paul L.
2007-01-01
We studied the movements and foraging effort of radio-marked Steller's Eiders (Polysticta stelleri) and Harlequin Ducks (Histrionicus histrionicus) to evaluate habitat quality in an area impacted by industrial activity near Dutch Harbor, Alaska. Foraging effort was relatively low, with Steller's Eiders foraging only 2.7 ± 0.6 (SE) hours per day and Harlequin Ducks 4.1 ± 0.5 hours per day. Low-foraging effort during periods of high-energetic demand generally suggests high food availability, and high food availability frequently corresponds with reductions in home range size. However, the winter ranges of Harlequin Ducks did not appear to be smaller than usual, with the mean range size in our study (5.5 ± 1.1 km2) similar to that reported by previous investigators. The mean size of the winter ranges of Steller's Eiders was similar (5.1 ± 1.3 km2), but no comparable estimates are available. Eutrophication of the waters near Dutch Harbor caused by seafood processing and municipal sewage effluent may have increased populations of the invertebrate prey of these sea ducks and contributed to their low-foraging effort. The threat of predation by Bald Eagles (Haliaeetus leucocephalus) that winter near Dutch Harbor may cause Steller's Eiders and Harlequin Ducks to move further offshore when not foraging, contributing to an increase in range sizes. Thus, the movement patterns and foraging behavior of these ducks likely represent a balance between the cost and benefits of wintering in a human-influenced environment.
DEFF Research Database (Denmark)
Colmer, T D; Vos, H; Pedersen, Ole
2009-01-01
pergranulata subsp. pergranulata (syn. Halosarcia pergranulata subsp. pergranulata). Growth and total sugars in succulent stems were assessed as a function of time after submergence. Underwater net photosynthesis, dark respiration, total sugars, glycinebetaine, Na(+), Cl(-) and K(+), in succulent stems, were...... assessed in a NaCl dose-response experiment. KEY RESULTS: Submerged plants ceased to grow, and tissue sugars declined. Photosynthesis by succulent stems was reduced markedly when underwater, as compared with in air. Capacity for underwater net photosynthesis (P(N)) was not affected by 10-400 mM Na......Cl, but it was reduced by 30 % at 800 mM. Dark respiration, underwater, increased in succulent stems at 200-800 mM NaCl, as compared with those at 10 mM NaCl. On an ethanol-insoluble dry mass basis, K(+) concentration in succulent stems of submerged plants was equal to that in drained controls, across all Na...
Lamdan, Netta Li; Attia, Ziv; Moran, Nava; Moshelion, Menachem
2012-04-01
Tolerance to boron (B) is still not completely understood. We tested here the hypothesis that Thellungiella halophila, an Arabidopsis thaliana-related 'extremophile' plant, with abundance of B in its natural environment, is tolerant to B, and examined the potential mechanisms of this tolerance. With 1-10 mm B applied ([B](ext)) to Thellungiella and Arabidopsis grown in hydroponics, the steady-state accumulated B concentration ([B](int)) in the root was below [B](ext), and was similar in both, suggesting both extrude B actively. Whether grown in soil or hydroponically, the shoot [B](int) was higher in Arabidopsis than in Thellungiella, suggesting more effective net B exclusion by Thellungiella root. Arabidopsis exhibited toxicity symptoms including reduced shoot fresh weight (FW), but Thellungiella was not affected, even at similar levels of shoot-accumulated [B](int) (about 10 to 40 mm B in 'shoot water'), suggesting additional B tolerance mechanism in Thellungiella shoot. At [B](ext) = 5 mm, the summed shoot concentration of the potentially B-binding polyhydroxyl metabolites (malic acid, fructose, glucose, sucrose and citric acid) in Arabidopsis was below [B](int) , but in Thellungiella it was over twofold higher than [B](int) , and therefore likely to allow appreciable 1:2 boron-metabolite complexation in the shoot. This, we suggest, is an important component of Thellungiella B tolerance mechanism. © 2011 Blackwell Publishing Ltd.
Xie, Tian; Cui, Baoshan; Li, Shanze
2017-10-15
Important to conserve plant species in coastal wetlands throughout their life cycle. All life stages in these habitats are exposed to varying tidal cycles. It is necessary to investigate all life stages as to how they respond to varying tidal regimes. We examine three wetlands containing populations of an endangered halophyte species, each subjected to different tidal regimes: (1). wetlands completely closed to tidal cycles; (2). wetlands directly exposed to tidal cycles (3). wetlands exposed to a partially closed tidal regime. Our results showed that the most threatened stage varied between wetlands subjected to these varying tidal regimes. We hypothesis that populations of this species have adapted to these different tidal regimes. Such information is useful in developing management options for coastal wetlands and modifying future barriers restricting tidal flushing. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Wang, L.; Wang, H. L.; Tian, C. Y.; Huang, Z. Y.
2016-01-01
The production of two or more seed types by a single plant is known as seed heteromorphism. There have been many comparisons of seed traits or growth between plants grown from heteromorphic seeds. However, information is scarce regarding the mineral contents of adult plants from heteromorphic seeds. We herein present biomass and mineral profiles of adult plants grown from dimorphic seeds (non-dormant brown seeds and black seeds with non-deep physiological dormancy) of the annual desert halophyte Suaeda aralocaspica at different nutrient and salinity levels. Although nutrient and salinity treatments affected dry weight and mineral content, there were no significant differences among S. aralocaspica seed-dimorphic plants under the same experimental conditions. This study is one of the few to compare the physiological responses between seed-heteromorphic plants, and reveals that mineral status corresponds with growth performance in these plants. (author)
Analysis of early medieval glass beads - Glass in the transition period
Energy Technology Data Exchange (ETDEWEB)
Smit, Ziga, E-mail: ziga.smit@ijs.si [Faculty of Mathematics and Physics, University of Ljubljana, Jadranska 19, SI-1000 Ljubljana (Slovenia); Jozef Stefan Institute, Jamova 39, P.O.B. 3000, SI-1001 Ljubljana (Slovenia); Knific, Timotej [National Museum of Slovenia, Presernova 20, SI-1000 Ljubljana (Slovenia); Jezersek, David [Jozef Stefan Institute, Jamova 39, P.O.B. 3000, SI-1001 Ljubljana (Slovenia); Istenic, Janka [National Museum of Slovenia, Presernova 20, SI-1000 Ljubljana (Slovenia)
2012-05-01
Glass beads from graves excavated in Slovenia and dated archaeologically to the 7th-10th century AD were analysed by the combined PIXE-PIGE method. The results indicate two groups of glass; natron glass made in the Roman tradition and glass made with alkalis from the ash of halophytic plants, which gradually replaced natron glass after c. 800 AD. The alkalis used in the second group of glass seem to be in close relation to a variant of the Venetian white glass that appeared several centuries later. The origin of this glass may be traced to glass production in Mesopotamia and around the Aral Sea. All the mosaic beads with eye decoration, as well as most of the drawn-segmented and drawn-cut beads analysed, are of plant-ash glass, which confirms their supposed oriental origin.
Allegory of the East: The pact with the Devil in Tawfiq al-Hakim
Directory of Open Access Journals (Sweden)
Roberta Tanzi
2011-11-01
Full Text Available 1. Scopo L’obiettivo di questo lavoro è quello di indagare le modalità e la fenomenologia della penetrazione di un mito profondamente occidentale — come quello di Faust — nella produzione di uno tra i più noti scrittori e drammaturghi arabi del Novecento: Tawfiq al-Hakim, concentrandosi in particolare su una sua novella del 1938, Ahd al-Shaytān (Il patto col diavolo. 2. Metodologia La novella, scelta in quanto exemplum rappresentativo di una pratica corrente nella produzione dell’autore, ovvero la rifunzionalizzazione di argomenti e personaggi mitologici di varia derivazione, viene analizzata nella prospettiva di una rivisitazione della leggenda di Faust e del suo patrimonio tematico e iconografico. La sua analisi permette di rilevare le tappe di un percorso assai interessante: quello della penetrazione e integrazione di un mito dell’Occidente moderno nella tradizione araba, considerato alla luce degli effetti che l’interazione con gli elementi tradizionali e autoctoni di quel patrimonio producono sul processo di assimilazione. 3. Risultati In quest’ottica, il corpus di Tawfiq al-Hakim appare fondante, non solo in virtù della sua familiarità con la trattazione di temi mitici provenienti anche dalla tradizione occidentale, ma per gli elementi di novità ed esclusività che da quella trattazione emergono.
Designing viable cropping options for salt-affected lands
Shabala, Sergey; Meinke, Holger
2017-04-01
Salinity cost agricultural sector over 27Bln pa in lost opportunities and is an issue that crosses all spatial and temporal scales - from individual fields, farms, catchments, landscapes to national and global levels. Salinity manifests itself in many forms and often leads to further soil degradation such as erosion, nutrient and soil organic matter depletion, and a loss of (soil) biodiversity. Salinity may also cause major disturbance to ecosystems due to its impact on resources (e.g. pollution of aquifers). In extreme cases it can turn previously highly productive areas into wastelands. An increasing global population and unprecedented urban sprawls are now putting additional pressures on our soil and water resources, particularly in regions where urbanisation directly competes with agriculture for access to land and water. And although everyone agrees that avoiding soil salinity in the first instance would be the most effective way of combating it, reality is that the amount of saline land and water resources is rapidly increasing, and will continue to increase, especially in developing countries. Purposefully designing our cropping systems that can cope with various levels of salinity could be one answer to this increasing problem. In this work we review some of the key cropping options that can be deployed to either avoid, reduce or remediate salt-affected lands. We argue that for these measures to be most effective an ongoing science - policy - society dialogue is required to ensure that policy frameworks that govern land and water management are conducive to reducing salinity or even assist in restoring affected areas. We first consider several case studies highlighting the extent of the problem using ongoing salinity hotspots around the globe. We then look at halophytes as a possible biological tools to remediate already saline sols, and discuss prospects of mixed (halophytes and glycophytes) cropping solutions for various agricultural systems at different
Directory of Open Access Journals (Sweden)
Mighri, Z.
2007-01-01
Full Text Available Salt marsh plants were tested for their insecticidal activities against adults and larvae of Tribolium confusum. Sixteen aerial part extracts of Frankenia laevis, Statice echioides, Suaeda fructicosa and Tamarix boveana were obtained using organic solvents of increasing polarity and tested for their insect growth, antifeedant and toxicity effects. Responses varied with plant material, extract type, insect stage and exposition time. Larval growth inhibition was significantly induced by chloroformic, ethyl acetate extracts of F. laevis, S. echioides and T. boveana, and petroleum ether extract of F. laevis. On the other hand, all extracts of S. fructicosa and the methanolic ones of the four plants tested didn't show any significant activity. In addition, ethyl acetate extracts of F. laevis, S. echioides and T. boveana and petroleum ether extract of F. laevis presented antifeedant property. S. fructicosa seemed to be, however, slightly attractive to the flour beetle. For all extracts, mortality was higher for larvae than adults. By using ethyl acetate extracts of F. laevis, S. echioides and T. boveana, and petroleum ether extract of F. laevis, mortality reached respectively 97, 87, 97 and 80%, when applied at a dose of 1%, mixed with the insect diet.
The Mechanisms of Salinity Tolerance in the Xero-halophyte Blue Panicgrass (Panicum antidotale Retz
Directory of Open Access Journals (Sweden)
Hamid R. ESHGHIZADEH
2012-05-01
Full Text Available Identifying the physiological traits associated with salt tolerance is important in optimal management of biosaline systems and optimum utilization of saline water resources in dry and saline areas. Therefore, some indices of photosynthetic activity, dry matter production and accumulation of sodium and potassium ions in Blue panicgrass (Panicum antidotale Retz were evaluated in five levels of salinity treatment (0, 70, 140, 210 and 280 mM NaCl solution under greenhouse conditions. The results showed that at 28 and 35 days after salt stress, plant leaf area reduced in the highest salinity treatment, 93 and 96% respectively, compared with control. Leaf stomatal conductance, CO2 fixation and quantum efficiency of photosystem II were decreased by increasing salinity. It caused also a reduction in chlorophyll content (Chl a, Chl b in leaves of Blue panicgrass. Content of carotenoids showed binary patterns to different salinity levels, slightly increased in 70-140 mM NaCl and decreased again in 210-280 mM, respectively. Increasing levels of salinity, increased sodium content in both roots and shoots but the shoots potassium content decreased. Decline in photosynthesis indices caused the reduction of root and shoot dry weight. This decrease resulted from lower leaf area (r=0.91**, lower stomatal conductance (r=0.78**, lower CO2 fixed in photosynthesis (r=0.63**, lower quantum efficiency of photosystem II (r=0.54** and lower Chl a (r=0.45**, respectively. Data analysis base on using stepwise regression introduced leaf area (?=0.560, chlorophyll a content (?=0.245 and shoot potassium content (?= 0.264 as main effective components of salinity tolerance in Blue panicgrass.
Leaf anatomical traits determine the 18O enrichment of leaf water in coastal halophytes
Liang, J.; Lin, G., Sr.; Sternberg, L. O.
2017-12-01
Foliar anatomical adaptations to high-salinity environment in mangroves may be recorded by leaf water isotopes. Recent studies observed that a few mangrove species have lower 18O enrichment of leaf water (ΔL) relative to source water than the adjacent terrestrial trees, but what factors actually control this phenomenon is still disputable at present. To resolve this issue, we collected 15 species of true mangrove plants, 14 species of adjacent freshwater trees and 4 species of semi-mangrove plants at five study sites on the southeastern coast of China. Leaf stomatal density and pore size, water content, ΔL and other related leaf physiological traits were determined for the selected leaves of these plants. Our results confirmed that ΔL values of mangroves were generally 3 4 ‰ lower than those of the adjacent freshwater or semi-mangrove species. Higher leaf water per area (LWC) and lower leaf stomatal density (LS) of mangroves played co-dominant roles in lowering ΔL through elongating effective leaf mixing length by about 20%. The Péclet model incorporated by LWC and LS performed well in predicting ΔL. The demonstrated general law between leaf anatomy and ΔL in this paper based on a large pool of species bridges the gap between leaf functional traits and metabolic proxies derived ΔL, which will have considerable potential applications in vegetation succession and reconstruction of paleoclimate research.
International Nuclear Information System (INIS)
Kumari, D.; Sohail, M.; Jahangeer, S.; Abideen, Z.; Khan, M.A.
2017-01-01
Fungi elaborate a variety of plant-hydrolyzing enzymes including cellulases, xylanases, pectinases and amylases. Although these enzymes have potential biotechnological applications, their production at industrial level is limited because of higher costs of the purified substrates. Hence, the present study was aimed to explore the novel, natural and cheaper substrates for enzyme production. Indigenously isolated fungal strains of Aspergillus sp. were grown on banana-peels, grapefruit-peels, pomegranate-peels, sugarcane bagasse, Eucalyptus camaldulensis-leaves and shoots of two halophytic plants including Halopyrum mucronatum and Desmostachya bipinnata under solid-state fermentation (SSF) and submerged fermentation (Smf) conditions. The crude enzyme preparation was screened for cellulase (endoglucanase, beta-glucosidase and filter-paperase), hemicellulase (xylanase), pectinase and amylase production. The results revealed that among all investigated enzymes, the xylanase titers were highest using D. bipinnata- shoots and H. mucronatum- shoots as substrates under solid state fermentation conditions, suggesting their exploitation at commercial scale. (author)
Effect of low doses of gamma radiation on barley tolerance grown under saline conditions
International Nuclear Information System (INIS)
Charbaji, T.; Khalifa, Kh; Al-Ain, F.
2003-01-01
A field experiment was conducted at Al-Hijanah, an area located at about 35 km south east of Damascus. Seeds of two barley varieties [White Arabi (WA) and Pakistani 30163 (PK) were irradiated with 2 doses 0 and 15 Gy of gamma irradiation. Then, they were shown on salty soil (17.6-18,9 m mos/cm) and irrigated with salty water (5.12-5.75 m mos/cm). A dose of 15 Gy of gamma irradiation was shown to positively affect the percent germination of PK but had no similar effect on WA. The results were obtained at 3 different growth stages: first, the heading stage, 15 Gy dose increased shoots dry weight, Mg ++ , P content and percent of WA, whereas N percent of PK was decreased. When the seeds were irradiated by the same dose. K + content in WA was significantly higher than that in PK. Second, physiological maturity stage, the same dose (15 Gy) increased shoot dry, but affected negatively K + and Na + contents in PK variety. As for WA variety, Mg ++ and P contents were increased, whereas Na + and Cl - were slightly decreased. Third, harvest stage, gamma irradiation had a positive effect on total yield, grain yield, nitrogen yield and harvest index of PK variety. A positive effect was produced on straw yield, 1000-grain weight, and nitrogen yield of WA variety. (author)
Directory of Open Access Journals (Sweden)
Ramazan Çakmakçı
2018-01-01
Full Text Available Coruh valley has an important biological diversity in term of plants, flora-fauna, wildlife and ecosystems. These regions contain the landraces, wild and weedy relatives, other wild, herbaceous and flowering trees, herbaceous flowering plants, medicinal and aromatic and flowering and ornamental shrubs plants species which are especially economically important plant for floriculture, eco-tourism, botanical tourism and nature tourism. Many important medicinal and aromatic and ornamental plants species are found in this region and naturally grow. It is considered that Acantholimon, Achillea, Alkanna, Allium, Amygdalus, Angelica, Anemone, Anthemis, Arabis, Arctium, Artemisia, Asparagus, Asperula, Astragalus, Calamintha, Calendula, Calutea, Campanula, Capparis, Cardamine, Centaurea, Cephalanthera, Cephalaria, Chelidonium, Chenopodium, Chysanthemum, Colchicum, Consolida, Coriandrum, Cornus, Coronilla, Cerasus, Cotoneaster, Crataegus, Crocus, Cyclamen, Dactylorhiza, Digitalis, Dianthus, Draba, Echinops, Equisetum, Ferula, Filipendula, Fritillaria, Fumaria, Gagea, Galanthus, Galium, Genista, Gentiana, Geranium, Geum, Gladiolus, Glychirrza, Helichrysum, Hesperis, Hypericum, İnula, İris, Isatis, Juniperus, Lilium, Linaria, Linum, lysimachia, Malus, Malva, Marrubium, Melissa, Mentha, Micromeria, Morina, Muscari, Mysotis, Narcissus, Neotchichatchewia, Nepeta, Onobrychis, Orchis, Ornithogalum, Origanum, Paeonia, Papaver, Pedicularis, Peganum, Phelypaea, Platanthera, Plantago, Pilosella, Pelargonium, Potentilla, Polygonum, Polygala, Primula, Punica, Prunus, Pyrus, Ranunculus, Rhamnus, Rhododendron, Rhus, Rosa, Rubia, Rubus, Rumex, Salvia, Sambucus, Satureja, Scilla, Scorzonera, Scutellaria, Sedum, Sempervivum, Sideritis, Sophora, Sorbus, Stachys, Tanecetum, Teucrium, Thymus, Trigonella, Tulipa, Tussilago, Uechtriitzia, Vaccinium, Verbascum, Verbena, Veronica, Viburnum and Ziziphora species commonly found in the region may be may be evaluated economically.
Sufism Scholars Network in the Middle East, India, and Indonesia
Directory of Open Access Journals (Sweden)
Dwi Afrianti
2016-03-01
Full Text Available The history of Islam in Indonesia cannot be separated from the affected of local culture, religion, belief earlier, and culture of the spreader of Islam which are also influenced by religion and beliefs held previously, as well as the entry period into certain areas of different life times, willingness to form the teachings of the scholars/king. All of this shows the complexity of the uniqueness of Islam in Indonesian as the majority religion among diverse religions in Indonesia. Sufism are directly involved in the spread of Islam in Indonesia with a unique teaching that facilitate the engaging of non-Muslim communities into Islam, compromise or blends Islam with religious and beliefs practices rather than local beliefs change from an international network to the local level. The terms and the elements of the pre-Islamic culture are used to explain Islam itself. Islamic history of Sundanese, there is a link in teachings of Wihdat al-Wujud of Ibn al-‘Arabi who Sufism Scholar that connected between the international Islamic networks scholars and Sundanese in Indonesia. It is more popular, especially in the congregation of Thariqat Syattariyah originated from India, and it is widespread in Indonesia such as Aceh, Minangkabau and also Pamijahan-Tasikmalaya that brought by Abdul Muhyi since 17th century ago.
Chemical studies on the polysaccharides of Salicornia brachiata.
Sanandiya, Naresh D; Siddhanta, A K
2014-11-04
A group of 12 polysaccharide extracts were prepared from the tips, stem and roots of an Indian halophyte Salicornia brachiata Roxb. obtained by sequential extractions with cold water (CW), hot water (HW), aqueous ammonium oxalate (OX) and aqueous sodium hydroxide (ALK) solutions. Monosaccharide composition analysis revealed that all the polysaccharide extract samples consisted primarily of rhamnose, arabinose, mannose, galactose, glucose, whereas ribose and xylose were present only in some of the extracts. All the extracts exhibited low apparent viscosity (1.47-2.02 cP) and sulphate and contained no prominent toxic metal ions. Fucose was detected only in OX extract of the roots. These polysaccharides were found to be heterogeneous and highly branched (glycoside linkage analysis, size-exclusion chromatography, (13)C-NMR, FT-IR, circular dichroism and optical rotation data). Physico-chemical analyses of these polysaccharides including uronic acid, sulphate and protein contents were also carried out. This constitutes the first report on the profiling of Salicornia polysaccharides. Copyright © 2014 Elsevier Ltd. All rights reserved.
Germination responses of limonium insigne (coss.) kuntze to salinity and temperature
International Nuclear Information System (INIS)
Isabel, C.; Fernandez, D.; Luque, E.G.; Mercado, F.G.
2015-01-01
Limonium insigne (Plumbaginaceae) is a perennial halophyte endemic to the SE of the Iberian Peninsula. Experiments were conducted to determine the effects of different salinities (0, 100, 200 and 400 mM NaCl) on the seed germination of L. insigne under different temperature regimes (20/10, 25/15, 30/20 and 35/25 degree C), both in a 14 h light and 10 h dark photoperiod. Seed germination of L. insigne was affected significantly by salinity levels, temperature and their interaction. Maximum germination was observed in the least saline media (100 mM NaCl) and distilled water (0 mM NaCl) at 20/10 degree C temperature. No seeds germinated at concentrations higher than 200 mM NaCl at the highest temperature (35/25 degree C). The increase in salinity delayed the beginning and ending of germination, reduced final germination percentage and increased mean time to germination. The rate of germination decreased with an increase in salinity and temperature. (author)
Ecological Performances of Plant Species of Halophilous Hydromorphic Ecosystems
Directory of Open Access Journals (Sweden)
Maria Speranza
2015-12-01
Full Text Available Coastal wetlands are very special environments, characterized by soils permanently or seasonally saturated by salt or brackish water. They host microorganisms and plants able to adapt to anoxic conditions. This paper proposes a review of recent scientific papers dealing with the study of coastal wetlands from different points of view. Some studies examine the species composition and the pattern of the spatial distribution of plant communities, depending on the depth of the salt water table, as well as on other related factors. A significant number of studies analyse instead the coastal wetlands in their ability for the phytoremediation (phytostabilisation and/or phytoextraction and highlight the importance of interactions between the rhizosphere of the halophytes and the physical environment. Finally, more recent studies consider the plant species of the coastal wetlands as a source of useful products (food, feed, oils and expose the results of promising researches on their cultivation.
Zhang, L Q; Niu, Y D; Huridu, H; Hao, J F; Qi, Z; Hasi, A
2014-07-24
In order to obtain a salt-tolerant perennial alfalfa (Medicago sativa L.), we transferred the halophyte Salicornia europaea L. Na(+)/H(+) antiporter gene, SeNHX1, to alfalfa by using the Agrobacterium-mediated transformation method. The transformants were confirmed by both PCR and RT-PCR analyses. Of 197 plants that were obtained after transformation, 36 were positive by PCR analysis using 2 primer pairs for the CaMV35S-SeNHX1 and SeNHX1-Nos fragments; 6 plants survived in a greenhouse. RT-PCR analysis revealed that SeNHX1 was expressed in 5 plants. The resultant transgenic alfalfa had better salt tolerance. After stress treatment for 21 days with 0.6% NaCl, the chlorophyll and MDA contents in transgenic plants were lower, but proline content and SOD, POD, and CAT activities were higher than those in wild-type plants. These results suggest that the salt tolerance of transgenic alfalfa was improved by the overexpression of the SeNHX1 gene.
Seawater/Saline Agriculture for Energy, Warming, Water, Rainfall, Land, Food and Minerals
Bushnell, Dennis
2006-01-01
The combination of the incipient demise of cheap oil and increasing evidence of Global Warming due to anthropogenic fossil carbon release has reinvigorated the need for and efforts on Renewable energy sources, especially for transportation applications. Biomass/Bio-diesel appears to have many benefits compared to Hydrogen, the only other major renewable transportation fuel candidate. Biomass Production is currently limited by available arable land and fresh water. Halophyte Plants and seawater irrigation proffer a wholly new biomass production mantra using wastelands and very plentiful seawater. Such an approach addresses many-to-most of the major emerging Societal Problems including Land, Water, Food, Warming and Energy. For many reasons, including seawater agriculture, portions of the Sahara appear to be viable candidates for future Biomass Production. The apparent nonlinearity between vegetation cover and atmospheric conditions over North Africa necessitates serious coupled boundary layer Meteorology and Global Circulation Modeling to ensure that this form of Terra Forming is Favorable and to avoid adverse Unintended Consequences.
Extraction of inland Nypa fruticans (Nipa Palm) using Support Vector Machine
Alberto, R. T.; Serrano, S. C.; Damian, G. B.; Camaso, E. E.; Biagtan, A. R.; Panuyas, N. Z.; Quibuyen, J. S.
2017-09-01
Mangroves are considered as one of the major habitats in coastal ecosystem, providing a lot of economic and ecological services in human society. Nypa fruticans (Nipa palm) is one of the important species of mangroves because of its versatility and uniqueness as halophytic palm. However, nipas are not only adaptable in saline areas, they can also managed to thrive away from the coastline depending on the favorable soil types available in the area. Because of this, mapping of this species are not limited alone in the near shore areas, but in areas where this species are present as well. The extraction process of Nypa fruticans were carried out using the available LiDAR data. Support Vector Machine (SVM) classification process was used to extract nipas in inland areas. The SVM classification process in mapping Nypa fruticans produced high accuracy of 95+%. The Support Vector Machine classification process to extract inland nipas was proven to be effective by utilizing different terrain derivatives from LiDAR data.
Anticancer drugs from marine flora: an overview.
Sithranga Boopathy, N; Kathiresan, K
2010-01-01
Marine floras, such as bacteria, actinobacteria, cyanobacteria, fungi, microalgae, seaweeds, mangroves, and other halophytes are extremely important oceanic resources, constituting over 90% of the oceanic biomass. They are taxonomically diverse, largely productive, biologically active, and chemically unique offering a great scope for discovery of new anticancer drugs. The marine floras are rich in medicinally potent chemicals predominantly belonging to polyphenols and sulphated polysaccharides. The chemicals have displayed an array of pharmacological properties especially antioxidant, immunostimulatory, and antitumour activities. The phytochemicals possibly activate macrophages, induce apoptosis, and prevent oxidative damage of DNA, thereby controlling carcinogenesis. In spite of vast resources enriched with chemicals, the marine floras are largely unexplored for anticancer lead compounds. Hence, this paper reviews the works so far conducted on this aspect with a view to provide a baseline information for promoting the marine flora-based anticancer research in the present context of increasing cancer incidence, deprived of the cheaper, safer, and potent medicines to challenge the dreadful human disease.
Anticancer Drugs from Marine Flora: An Overview
Directory of Open Access Journals (Sweden)
N. Sithranga Boopathy
2010-01-01
Full Text Available Marine floras, such as bacteria, actinobacteria, cyanobacteria, fungi, microalgae, seaweeds, mangroves, and other halophytes are extremely important oceanic resources, constituting over 90% of the oceanic biomass. They are taxonomically diverse, largely productive, biologically active, and chemically unique offering a great scope for discovery of new anticancer drugs. The marine floras are rich in medicinally potent chemicals predominantly belonging to polyphenols and sulphated polysaccharides. The chemicals have displayed an array of pharmacological properties especially antioxidant, immunostimulatory, and antitumour activities. The phytochemicals possibly activate macrophages, induce apoptosis, and prevent oxidative damage of DNA, thereby controlling carcinogenesis. In spite of vast resources enriched with chemicals, the marine floras are largely unexplored for anticancer lead compounds. Hence, this paper reviews the works so far conducted on this aspect with a view to provide a baseline information for promoting the marine flora-based anticancer research in the present context of increasing cancer incidence, deprived of the cheaper, safer, and potent medicines to challenge the dreadful human disease.
International Nuclear Information System (INIS)
Wang, L.; Li, W.; Yang, H.; Wu, W.; Ma, L.; Huang, T.; Wang, X.
2016-01-01
Limonium bicolor (Bag.) Kuntze is a perennial herb belonging to the Plumbaginaceae family. It is a typical recretohalophyte as well as a medicinal plant, distributing at saline soil areas in coastal areas and grasslands. In this paper,physiological mechanisms of L. bicolor to defend salt stress and effects of salinity on medicinal ingredients were investigated. The effects of different NaCl concentrations on the number of salt glands, Na/sup +/ content, dry weight and water content in tissues, gas exchange parameters involving net CO/sub 2/ assimilation rate, stomatal conductance, intercellular CO/sub 2/ concentration and transpiration rate, malondialdehyde content and electrolyte leakage, activities of superoxide dismutase, peroxidase and catalase and accumulations of secondary metabolites such as total phenolic, total flavonoid, gallic acid and myricetrin of leaves were determined. The results show that 100 and 200 mM NaCl induced facilitated effects in L. bicolor reflected in the increase in dry weight, tissue water content, net CO/sub 2/ assimilation rate, the number of salt glands, activity of superoxide dismutase, and content of gallic acid and myricetrin. The 300 mM NaCl treatment resulted in obviously decline in gas exchange parameters, and significant increases in Na/sup +/ levels, malondialdehyde level and electrolyte leakage. It was suggested that increased salt tolerance of L. bicolor was due to the corresponding resistance mechanisms involving an increased number of salt glands, enhanced activities of antioxidant enzymes, and an accelerated accumulation of secondary metabolites. What's more, the results on effects of salinity on medicinal ingredients in L. bicolor under different salt concentrations could provide theoretical basis for the standardization cultivation technique of L. bicolor. (author)
Directory of Open Access Journals (Sweden)
Radia Benzehra
2011-10-01
leksikografiese inligting te wees as wat verwag is. Daar sal ook getoon word hoe die resensies toekomstige kopers se keuse kan bepaal oor watter Engels–Arabiese of Arabies–Engelse woordeboek aan hul behoeftes sal voldoen. Met die Amazon-resensies as uitgangspunt, wy die artikel 'n afdeling aan die ondersoek van die mikrostrukturele eienskappe van sommige leksikale inskrywings in die Oxford English– Arabic Dictionary of Current Usage (OEAD. Om meer oor die woordeboek se mikrostruktuur te wete te kom, ontleed die volgende afdeling 'n voorafgekose lys van 113 leksikale eenhede in 'n poging om die woordeboek te toets vir die hoeveelheid inligting wat dit verskaf wat betref sommige hoëfrekwensie-items. Die artikel handel meestal oor die OEAD uit die gesigspunt van enkoderende Engelssprekende gebruikers. Die Modern Language Association het onlangs berig dat daar vanaf 1998 tot 2002 'n 92%-toename in die aantal Arabiese programme dwarsoor die Verenigde State was, vandaar die dringende behoefte aan woordeboeke vir Engelssprekende gebruikers as teikengroep. Die artikel suggereer dat 'n taalkundige hersiening van die OEAD dit meer sistematies en gebruikersvriendelik sal maak.
Sleutelwoorde: TWEETALIGE WOORDEBOEK, DEKODERENDE GEBRUIKERS, ENKODERENDE GEBRUIKERS, ENGELS–ARABIES, ENGELSSPREKENDE GEBRUIKERS, AANLEERDERS VAN ARABIES, LEKSIKOGRAFIE, MIKROSTRUKTUUR, RESENSIES, GEBRUIKERSVOORKEURE
The Life Cycle of Entzia, an Agglutinated Foraminifer from the Salt Marshes in Transylvania
Kaminski, Michael; Telespan, Andreea; Balc, Ramona; Filipescu, Sorin; Varga, Ildiko; Görög, Agnes
2013-04-01
The small salt marshes associated with Miocene salt domes in Transylvania are host to a variety of marine organisms, including communities of halophytic plants as well as an agglutinated foraminifer that is normally found in coastal salt marshes worldwide. Originally described as the species Entzia tetrastoma by Daday (1884), the foraminifer is more widely known by the name Jadammina macrescens (Brady, 1870). Because the genus name Entzia has priority over Jadammina, the valid name of this taxon is Entzia macrescens (Brady, 1870). In 2007, we discovered a living population of Entzia inhabiting a small salt marsh just outside the town of Turda in central Transylvania, only a kilometer from the famous Maria Theresa Salt Mine. This is the first discovery of a living population of Entzia in Transylvania since the species was originally described in 1884. To determine whether or not the specimens we found represent a breeding population, samples were collected from the marsh on a monthly basis over the span of a year. This species can be found among the roots of the halophytic plants, in the uppermost one or two centimeters of the mud. Sediment samples were preserved in Vodka with Rose Bengal to distinguish living and dead specimens, and examined quantitatively. To document the life cycle of the species the following metrics were carried out: test size, abundance, number of chambers, ratio between live and dead specimens, and the diameter of the proloculus. An increase in the mean diameter of specimens was found from October to December. However the mean diameter decreased again in January, which suggests that asexual reproduction had apparently taken place. Small specimens again appeared in March, when sexual reproduction is presumed to have taken place. The median proloculus diameter was smallest in April and May, but the monthly changes in mean proloculus size within the population over the span of a year are not significant. However, specimens with largest
Ability of salt marsh plants for TBT remediation in sediments.
Carvalho, Pedro N; Basto, M Clara P; Silva, Manuela F G M; Machado, Ana; Bordalo, A A; Vasconcelos, M Teresa S D
2010-07-01
The capability of Halimione portulacoides, Spartina maritima, and Sarcocornia fruticosa (halophytes very commonly found in salt marshes from Mediterranean areas) for enhancing remediation of tributyltin (TBT) from estuarine sediments was investigated, using different experimental conditions. The influence of H. portulacoides on degradation of the butyltin compounds was assessed in two different ways: (1) a 9-month ex situ study carried out in a site of Sado River estuary, center of Portugal, which used polluted sediments collected at other nonvegetated site from the same estuary; and (2) a 12-month laboratorial study, using both plant and sediment collected at a relatively clean site of Cávado River estuary, north of Portugal, the sediment being doped with TBT, DBT, and MBT at the beginning of the experiment. The role of both S. fruticosa and S. maritima on TBT remediation in sediments was evaluated in situ, in salt marshes from Marim channel of Ria Formosa lagoon, south of Portugal, which has large areas colonized by each one of these two plants. For estimation of microbial abundance, total cell counts of sediment samples were enumerated by the DAPI direct count method. Butyltin analyses in sediment were performed using a method previously validated, which consisted of headspace solid-phase micro-extraction combined with gas chromatography-mass spectrometry after in situ ethylation (with tetraethylborate). Sediments colonized both ex situ and at lab by H. portulacoides displayed TBT levels about 30% lower than those for nonvegetated sediments with identical initial composition, after 9-12 months of plant exposure. In addition, H. portulacoides showed to be able of stimulating bacterial growth in the plant rhizosphere, which probably included degraders of TBT. In the in situ study, which compared the levels of TBT, DBT, and MBT in nonvegetated sediment and in sediments colonized by either S. maritima or S. fruticosa from the same area, TBT and DBT were only
The Effectiveness of Dictionary Examples in Decoding: The Case of Kuwaiti Learners of English
Directory of Open Access Journals (Sweden)
Hashan Al-Ajmi
2011-10-01
Full Text Available
Abstract: This study tries to shed light on the role of dictionary examples in the comprehension of word meanings. An experimental procedure has been devised whereby two groups of students with English as major subject at Kuwait University were asked to provide the Arabic equivalents for ten English headwords. The first group was given a list of entries for these words copied from the Oxford Advanced Learner's Dictionary (OALD while the second group had to read the same list but without illustrative examples. Results indicate that the students' decoding performance was negatively affected by the presence of illustrative examples in the dictionary entry.
Keywords: ARABIC, BILINGUAL DICTIONARY, COMPREHENSION, EFL DICTIONARY,ILLUSTRATIVE EXAMPLE, MONOLINGUAL DICTIONARY, TRANSLATION
Opsomming: Die doeltreffendheid van woordeboekvoorbeelde by dekodering:Die geval van Koeweiti-aanleerders van Engels. Hierdie studie probeer ligwerp op die rol van woordeboekvoorbeelde by die verstaan van woordbetekenisse. 'n Eksperimentelemetode is ontwerp waarby twee groepe studente met Engels as hoofvak by die Universiteit vanKoeweit gevra is om Arabiese ekwivalente vir tien Engelse trefwoorde te verskaf. Aan die eerstegroep is 'n lys inskrywings van hierdie woorde oorgeneem uit die Oxford Advanced Learner's Dictionary(OALD gegee, terwyl die tweede groep dieselfde lys moes lees, maar sonder verduidelikendevoorbeelde. Resultate het aangedui dat die studente se dekoderende prestasie negatiefbeïnvloed is deur die teenwoordigheid van verduidelikende voorbeelde in die woordeboekinskrywing.
Sleutelwoorde: ARABIES, TWEETALIGE WOORDEBOEK, BEGRIP, EVT-WOORDEBOEK,VERDUIDELIKENDE VOORBEELD, EENTALIGE WOORDEBOEK, VERTALING
The secret gardener: vegetation and the emergence of biogeomorphic patterns in tidal environments.
Da Lio, Cristina; D'Alpaos, Andrea; Marani, Marco
2013-01-01
The presence and continued existence of tidal morphologies, and in particular of salt marshes, is intimately connected with biological activity, especially with the presence of halophytic vegetation. Here, we review recent contributions to tidal biogeomorphology and identify the presence of multiple competing stable states arising from a two-way feedback between biomass productivity and topographic elevation. Hence, through the analysis of previous and new results on spatially extended biogeomorphological systems, we show that multiple stable states constitute a unifying framework explaining emerging patterns in tidal environments from the local to the system scale. Furthermore, in contrast with traditional views we propose that biota in tidal environments is not just passively adapting to morphological features prescribed by sediment transport, but rather it is 'The Secret Gardener', fundamentally constructing the tidal landscape. The proposed framework allows to identify the observable signature of the biogeomorphic feedbacks underlying tidal landscapes and to explore the response and resilience of tidal biogeomorphic patterns to variations in the forcings, such as the rate of relative sea-level rise.
Zhang, Chengjun; Sale, Peter W G; Clark, Gary J; Liu, Wuxing; Doronila, Augustine I; Kolev, Spas D; Tang, Caixian
2015-12-01
Plants for the phytoextraction of heavy metals should have the ability to accumulate high concentrations of such metals and exhibit multiple tolerance traits to cope with adverse conditions such as coexistence of multiple heavy metals, high salinity, and drought which are the characteristics of many contaminated soils. This study compared 14 succulent species for their phytoextraction potential of Cd, Cr, Cu, Mn, Ni, Pb, and Zn. There were species variations in metal tolerance and accumulation. Among the 14 succulent species, an Australian native halophyte Carpobrotus rossii exhibited the highest relative growth rate (20.6-26.6 mg plant(-1) day(-1)) and highest tolerance index (78-93%), whilst Sedum "Autumn Joy" had the lowest relative growth rate (8.3-13.6 mg plant(-1) day(-1)), and Crassula multicava showed the lowest tolerance indices (phytoextraction of these heavy metals than other species. These findings suggest that Carpobrotus rossii is a promising candidate for phytoextraction of multiple heavy metals, and the aquatic or semiterrestrial Crassula helmsii is suitable for phytoextraction of Cd and Zn from polluted waters or wetlands.
Treichel, Siegfried; Bauer, Peter
1974-03-01
CO 2 -exchange, diurnal changes in malate- and ion concentrations of the halophytes Carpobrotus edulis, Crithmum maritimum, Mesembryanthemum nodiflorum, Salicornia fruticosa, Suaeda maritima, and Trifolium fragiferum were investigated after culture at different NaCl concentrations. In Carp. edulis and Mes. nodiflorum the diurnal rhythm of CO 2 -exchange is in accordance with that of crassulacean acid metabolism (CAM), in Sal. fruticosa, Crithm. maritimum, Suaeda maritima, and Trif. fragiferum with that of Benson-Calvin metabolism (C 3 ). Malate concentration and CO 2 uptake in the sap latter group are not influenced. On the other hand, Carp. edulis and Mes. nodiflorum show an accumulation of malate during the night, which can be interpreted as a further indication of CAM.The two species most resistant to NaCl, Carp. edulis and Sal. fruticosa, greatly differ very much in their NaCl content. NaCl concentration in Salicornia is four times higher than in Carpobrotus.The different metabolic properties studied might be of ecological importance for the plants in their natural habitats. The effect of NaCl on metabolic processes is discussed.
Leaf structural adaptations of two Limonium miller (Plumbaginales, Plumbaginaceae taxa
Directory of Open Access Journals (Sweden)
Zorić Lana N.
2013-01-01
Full Text Available Limonium gmelinii (Willd. O. Kuntze 1891 subsp. hungaricum (Klokov Soó is Pannonian endemic subspecies that inhabits continental halobiomes, while Limonium anfractum (Salmon Salmon 1924 is one of the indicators of halophyte vegetation of marine rocks and its distribution is restricted to the southern parts of Mediterranean Sea coast. In this work, micromorphological and anatomical characters of leaves of these two Limonium taxa were analyzed, in order to examine their adaptations to specific environmental conditions on saline habitats. The results showed that both taxa exhibited strong xeromorphic adaptations that reflected in flat cell walls of epidermal cells, thick cuticle, high palisade/spongy tissue ratio, high index of palisade cells, the presence of sclereid idioblasts in leaf mesophyll and mechanical tissue by phloem and xylem. Both taxa are crynohalophytes and have salt glands on adaxial and abaxial epidermis for excretion of surplus salt. Relatively high dimensions of mesophyll cells, absence of non-glandular hairs and unprotected stomata slightly increased above the level of epidermal cells, are also adaptations to increased salinity. [Projekat Ministarstva nauke Republike Srbije, br. 173002
Saline Agriculture in the 21st Century: Using Salt Contaminated Resources to Cope Food Requirements
Directory of Open Access Journals (Sweden)
Bruno Ladeiro
2012-01-01
Full Text Available With the continue increase of the world population the requirements for food, freshwater, and fuel are bigger every day. This way an urgent necessity to develop, create, and practice a new type of agriculture, which has to be environmentally sustainable and adequate to the soils, is arising. Among the stresses in plant agriculture worldwide, the increase of soil salinity is considered the major stress. This is particularly emerging in developing countries that present the highest population growth rates, and often the high rates of soil degradation. Therefore, salt-tolerant plants provide a sensible alternative for many developing countries. These plants have the capacity to grow using land and water unsuitable for conventional crops producing food, fuel, fodder, fibber, resin, essential oils, and pharmaceutical products. In addition to their production capabilities they can be used simultaneously for landscape reintegration and soil rehabilitation. This review will cover important subjects concerning saline agriculture and the crop potential of halophytes to use salt-contaminated resources to manage food requirements.
Directory of Open Access Journals (Sweden)
Célia Maria Maganhotto de Souza Silva
2008-10-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito da irrigação com rejeito da dessalinização, oriundo de tanques de produção de tilápia-rosa, sobre as propriedades químicas e microbiológicas de solos cultivados com erva-sal (Atriplex nummularia Lindl.. Quatro áreas foram usadas, das quais duas foram irrigadas com rejeito salino e cultivadas, durante um e cinco anos, com erva-sal. As outras duas áreas foram conduzidas sem irrigação: uma cultivada com vegetação natural e outra com a halófita. Avaliaram-se os parâmetros relativos à salinidade e sodicidade do solo, e também as seguintes características: carbono da biomassa microbiana (Cmic; relação Cmic/carbono orgânico; atividade das enzimas fosfatase ácida, fosfatase alcalina, beta-glucosidase, protease, L-asparaginase, L-glutaminase. A adição de sais afetou as propriedades físicas e químicas dos solos irrigados com rejeito salino, com tendência à salinização e sodificação. A salinidade afetou as propriedades microbiológicas nos solos irrigados, mas o cultivo da halófita favoreceu a produção das enzimas estudadas. O cultivo da erva-sal em áreas que recebem rejeito salino pela irrigação melhora a qualidade biológica dos solos e sua fertilidade, mas não impede a salinização.The objective of this work was to evaluate the effects of irrigation with saline effluents, from red tilapia production ponds, on chemical and microbiological properties of soils cultivated with saltbush (Atriplex nummularia Lindl. Four areas were used, from which two were irrigated with saline waste and cultivated with A. nummularia, during one and five years. The other two areas were not irrigated, and one was cultivated with natural vegetation and the other with the halophyte. The parameters related to soil salinity and sodicity were evaluated, as well as the following characteristics: microbial biomass carbon (Cmic; Cmic/organic carbon; the activity of acid and alcaline phosphatase
Energy Technology Data Exchange (ETDEWEB)
Kim, J. G.; Lee, B. H. [KAERI, Taejon (Korea, Republic of); Kim, J. H.; Youn, Y. D. [Hanyang Univ., Seoul (Korea, Republic of)
2003-10-01
Extracts from Salicornia herbacea with two extraction methods (using water or ethanol) were examined for their potential as a radioprotector. This plant accumulates a great amount of salt , Mg, Ca, Fe, and K and thus contains high levels of mineral in its body. It is famous as a remedial material for the constipation and glycosuria in folk medicine. The present study was designed to explore the in vivo antioxidant effects of water - and ethanol- extracts of S. herbacea. Both extracts of the plants were tested for their free radical scavenging activity with the DPPH assay. For the in vivo studies, male F344 rats (3 week- old) received po administration of both extracts 0.5 mg/ml during 5 days before whole- body irradiation. Six hours after irradiation, we measured the body and organ weight and collected blood. The levels of serum aspartate aminotransferase (AST), alanine aminotransferase (ALT) and lactate dehydrogenase (LDH), alkaline phosphatase (ALP) showed a similar pattern six hours after irradiation. In case of the water extract - dietary group after irradiation, the levels of all enzymes had a tendency to decrease toward to the base level. Therefore, the results reflects the antioxidant activity of S. herbacea extracts and its potential to protect against radiation damage.
Zhao, Guo-Yan; Zhao, Li-Ya; Xia, Zhi-Jie; Zhu, Jin-Lei; Liu, Di; Liu, Chun-Yue; Chen, Xiu-Lan; Zhang, Yu-Zhong; Zhang, Xi-Ying; Dai, Mei-Xue
2017-06-01
A Gram-stain-negative, rod-shaped bacterium, strain F01T, was isolated from leaves of Tamarix chinensis Lour. The isolate grew optimally at 30 °C, at pH 7.0 and with 5.0 % (w/v) NaCl, and showed a high tolerance to manganese, lead, nickel, ferrous ions and copper ions. The major fatty acids were C18 : 1ω7c and C16 : 0, and the predominant respiratory quinone was Q-9. Polar lipids were dominated by diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol, unidentified aminoglycolipids and phospholipids. The DNA G+C content was 65.8 %. Based on multilocus phylogenetic analysis, strain F01T belonged to the genus Salinicola, with highest 16S rRNA gene sequence similarity to Salinicola peritrichatus CGMCC 1.12381T (97.7 %). The level of DNA-DNA hybridization between strain F01T and closely related Salinicola strains was well below 70 %. According to the phenotypic, genetic and chemotaxonomic data, strain F01T is considered to represent a novel species in the genus Salinicola, for which the name Salinicola tamaricis sp. nov. is proposed. The type strain is F01T (=CCTCC AB 2015304T=KCTC 42855T).
Grundel, Ralph; Pavlovic, Noel B.; Sulzman, Christina L.
2000-01-01
The Karner blue butterfly, Lycaeides melissa samuelis, is an endangered species residing in savanna and barrens habitats in the Midwest and Northeast United States. To improve our understanding of nectar plant selection patterns by the Karner blue, we examined nectar plant choices made by 146 butterflies. Within observation areas of 2-m radius butterflies usually chose the nectar species with the greatest total number of flowers or flowering heads. This suggests that the Karner blue is opportunistic in selecting nectar plants. However, certain nectar species, including Arabis lyrata, Coreopsis lanceolata, Melilotus alba and Rubus flagellaris, were selected in a significant majority of cases when other nectar species were available nearby. At least in the case of R. flagellaris, this preference was not directly related to the species' local flower abundance. In a significant majority of cases (77.5%) adult Karner blues selected nectar plant species with yellow or white flowers over species with other-colored flowers. Comparison of nectar plant selections at Indiana Dunes National Lakeshore to selections from Michigan and Wisconsin suggests that the Karner blue most frequently chooses a suite of nectar plant species that includes A. lyrata, C. lanceolata, Euphorbia corollata, M. alba, Monarda punctata, Potentilla simplex, Rubus spp., Solidago speciosa and, perhaps, Asclepias tuberosa and Helianthus divaricatus. This suite includes plant species that readily flower in the sun and others that readily flower in the shade, an important consideration since Karner blues often move across the sun-shade interface.
Directory of Open Access Journals (Sweden)
Jeffery M. Saarela
2017-01-01
Full Text Available The Coppermine River in western Nunavut is one of Canada’s great Arctic rivers, yet its vascular plant flora is poorly known. Here, we report the results of a floristic inventory of the lower Coppermine River valley and vicinity, including Kugluk (Bloody Falls Territorial Park and the hamlet of Kugluktuk. The study area is approximately 1,200 km2, extending from the forest-tundra south of the treeline to the Arctic coast. Vascular plant floristic data are based on a review of all previous collections from the area and more than 1,200 new collections made in 2014. Results are presented in an annotated checklist, including citation of all specimens examined, comments on taxonomy and distribution, and photographs for a subset of taxa. The vascular plant flora comprises 300 species (311 taxa, a 36.6% increase from the 190 species documented by previous collections made in the area over the last century, and is considerably more diverse than other local floras on mainland Nunavut. We document 207 taxa for Kugluk (Bloody Falls Territorial Park, an important protected area for plants on mainland Nunavut. A total of 190 taxa are newly recorded for the study area. Of these, 14 taxa (13 species and one additional variety are newly recorded for Nunavut (Allium schoenoprasum, Carex capitata, Draba lonchocarpa, Eremogone capillaris subsp. capillaris, Sabulina elegans, Eleocharis quinqueflora, Epilobium cf. anagallidifolium, Botrychium neolunaria, Botrychium tunux, Festuca altaica, Polygonum aviculare, Salix ovalifolia var. arctolitoralis, Salix ovalifolia var. ovalifolia and Stuckenia pectinata, seven species are newly recorded for mainland Nunavut (Carex gynocrates, Carex livida, Cryptogramma stelleri, Draba simmonsii, Festuca viviparoidea subsp. viviparoidea, Juncus alpinoarticulatus subsp. americanus and Salix pseudomyrsinites and 56 range extensions are reported. The psbA-trnH and rbcL DNA sequence data were used to help identify the three Botrychium
Burger, Joanna; Gochfeld, Michael; Jewett, Stephen C
2007-05-01
Concentrations of 13 radionuclides (137Cs, 129I, 60Co, 152Eu, 90Sr, 99Tc, 241Am, 238Pu, 239,249Pu, 234U, 235U, 236U, 238U) were examined in seven species of invertebrates from Amchitka and Kiska Islands, in the Aleutian Chain of Alaska, using gamma spectroscopy, inductively coupled plasma mass spectroscopy, and alpha spectroscopy. Amchitka Island was the site of three underground nuclear test (1965-1971), and we tested the null hypotheses that there were no differences in radionuclide concentrations between Amchitka and the reference site (Kiska) and there were no differences among species. The only radionuclides where composite samples were above the Minimum Detectable Activity (MDA) were 137Cs, 241Am, 239,249Pu, 234U, 235U, 236U, and 238U. Green sea urchin (Strongylocentrotus polyacanthus), giant chiton (Cryptochiton stelleri), plate limpets (Tectura scutum) and giant Pacific octopus (Enteroctopus dofleini) were only tested for 137Cs; octopus was the only species with detectable levels of 137Cs (0.262 +/- 0.029 Bq/kg, wet weight). Only rock jingle (Pododesmus macroschisma), blue mussel (Mytilus trossulus) and horse mussel (Modiolus modiolus) were analyzed for the actinides. There were no interspecific differences in 241Am and 239,240Pu, and almost no samples above the MDA for 238Pu and 236U. Horse mussels had significantly higher concentrations of 234U (0.844 +/- 0.804 Bq/kg) and 238U (0.730 +/- 0.646) than the other species (both isotopes are naturally occurring). There were no differences in actinide concentrations between Amchitka and Kiska. In general, radionuclides in invertebrates from Amchitka were similar to those from uncontaminated sites in the Northern Hemisphere, and below those from the contaminated Irish Sea. There is a clear research need for authors to report the concentrations of radionuclides by species, rather than simply as 'shellfish', for comparative purposes in determining geographical patterns, understanding possible effects, and for
de Obaldia, Enrique Escobar; Jeong, Chanhue; Grunenfelder, Lessa Kay; Kisailus, David; Zavattieri, Pablo
2015-08-01
Many biomineralized organisms have evolved highly oriented nanostructures to perform specific functions. One key example is the abrasion-resistant rod-like microstructure found in the radular teeth of Chitons (Cryptochiton stelleri), a large mollusk. The teeth consist of a soft core and a hard shell that is abrasion resistant under extreme mechanical loads with which they are subjected during the scraping process. Such remarkable mechanical properties are achieved through a hierarchical arrangement of nanostructured magnetite rods surrounded with α-chitin. We present a combined biomimetic approach in which designs were analyzed with additive manufacturing, experiments, analytical and computational models to gain insights into the abrasion resistance and toughness of rod-like microstructures. Staggered configurations of hard hexagonal rods surrounded by thin weak interfacial material were printed, and mechanically characterized with a cube-corner indenter. Experimental results demonstrate a higher contact resistance and stiffness for the staggered alignments compared to randomly distributed fibrous materials. Moreover, we reveal an optimal rod aspect ratio that lead to an increase in the site-specific properties measured by indentation. Anisotropy has a significant effect (up to 50%) on the Young's modulus in directions parallel and perpendicular to the longitudinal axis of the rods, and 30% on hardness and fracture toughness. Optical microscopy suggests that energy is dissipated in the form of median cracks when the load is parallel to the rods and lateral cracks when the load is perpendicular to the rods. Computational models suggest that inelastic deformation of the rods at early stages of indentation can vary the resistance to penetration. As such, we found that the mechanical behavior of the system is influenced by interfacial shear strain which influences the lateral load transfer and therefore the spread of damage. This new methodology can help to elucidate
Mangrove Cultivation For Dealing With Coastal Abrasion Case Study Of Karangsong
Fatimatuzzahroh, Feti; Hadi, Sudharto P.; Purnaweni, Hartuti
2018-02-01
Coastal abrasion is consequence from destructive waves and sea current. One of cause is human intervention. The effort to solve of abrasion is by mangrove cultivation. Mangroves are halophyte plant that can restrain the sea wave. Mangrove cultivation required participation community that give awareness the importance of mangrove in coastal sustainability. Mangroves in coastal Karangsong, Indramayu west java, in 2007 was through abrasion approximately 127.30 ha. Mangrove cultivation in Karangsong has been replanting since 1998 to 2003, but there was no maintenance and management. In 2007 until 2015 Karangsong replanting mangroves and has been succeed. Karangsong became the center of mangrove study for west java area in 2015. This achievement is result of cooperation between community, NGO, and local government. In addition, this effort made not only overcome the abrasion problem but also give community awareness about the importance of mangrove cultivation in preventing coastal abrasion throughout community development. This paper reviews abrasion in Karangsong and the impact for local community and empowerment in mangrove cultivation. To achieve the success mangrove cultivation required community development approach from planning process, planting, maintenance and management.
Directory of Open Access Journals (Sweden)
Edgar Omar Rueda Puente
2010-12-01
Full Text Available The study and development of plant resources in arid-saline environments is increasing. Salicornia bigelovii is a halophyte of great interest. However, the productivity of these plants is limited by nitrogen availability. An alternative to chemical fertilizers are the plant growth promoting bacteria and mycorrhizae. In the present study was evaluated the effect of Glomus intraradices, three strains of rhizobacteria (Klebsiella pneumoniae, Bacillus amyloliquefaciens and Azospirillum halopraeferens and two soil types (clayey and sandy on Salicornia under greenhouse conditions. The inoculation of bacteria under conditions of sandy soil significantly stimulated growth and nutritional factor of Salicornia (NPK. Synergism was observed between G. intraradices and rhizobacteria. When inoculated bacteria in individually form, behaved with significant differences. There was synergism between G. intraradices and Klebsiella pneumoniae and A. halopraeferens in the uptake of N, the opposite happened with G. intraradices and Bacillus amyloliquefaciens with high significant values in the absorption of P and K. The soil was a determining factor in behavior and expression of the benefit of the microorganisms. Rhizobacteria and mycorrhiza in the study have potential for use as growth promoters in salicornia.
Bejarano, Adriana C; Michel, Jacqueline
2010-05-01
A large-scale assessment of polycyclic aromatic hydrocarbons (PAHs) from the 1991 Gulf War oil spill was performed for 2002-2003 sediment samples (n = 1679) collected from habitats along the shoreline of Saudi Arabia. Benthic sediment toxicity was characterized using the Equilibrium Partitioning Sediment Benchmark Toxic Unit approach for 43 PAHs (ESBTU(FCV,43)). Samples were assigned to risk categories according to ESBTU(FCV,43) values: no-risk (1 - 2 - 3 - 5). Sixty seven percent of samples had ESBTU(FCV,43) > 1 indicating potential adverse ecological effects. Sediments from the 0-30 cm layer from tidal flats, and the >30 - oiled halophytes and mangroves had high frequency of high-risk samples. No-risk samples were characterized by chrysene enrichment and depletion of lighter molecular weight PAHs, while high-risk samples showed little oil weathering and PAH patterns similar to 1993 samples. North of Safaniya sediments were not likely to pose adverse ecological effects contrary to sediments south of Tanaqib. Landscape and geomorphology has played a role on the distribution and persistence in sediments of oil from the Gulf War. Copyright 2009 Elsevier Ltd. All rights reserved.
Bioprospecting of Marine Macrophytes Using MS-Based Lipidomics as a New Approach.
Maciel, Elisabete; Costa Leal, Miguel; Lillebø, Ana Isabel; Domingues, Pedro; Domingues, Maria Rosário; Calado, Ricardo
2016-03-08
The marine environment supports a remarkable diversity of organisms which are a potential source of natural products with biological activities. These organisms include a wide variety of marine plants (from micro- to macrophytes), which have been used in the food and pharmaceutical industry. However, the biochemistry and biological activities of many of these macrophytes (namely macroalgae and halophytes, including seagrasses) are still far from being fully explored. Most popular bioactive components include polysaccharides, peptides, phenolics and fatty acids (FAs). Polar lipids (glycolipids, phospholipids and betaine lipids) are emerging as novel value-added bioactive phytochemicals, rich in n-3 FA, with high nutritional value and health beneficial effects for the prevention of chronic diseases. Polar lipids account various combinations of polar groups, fatty acyl chains and backbone structures. The polar lipidome of macrophytes is remarkably diverse, and its screening represents a significant analytical challenge. Modern research platforms, particularly mass spectrometry (MS)-based lipidomic approaches, have been recently used to address this challenge and are here reviewed. The application of lipidomics to address lipid composition of marine macrophytes will contribute to the stimulation of further research on this group and foster the exploration of novel applications.
Chemical Processing of Non-Crop Plants for Jet Fuel Blends Production
Kulis, M. J.; Hepp, A. F.; McDowell, M.; Ribita, D.
2009-01-01
The use of Biofuels has been gaining in popularity over the past few years due to their ability to reduce the dependence on fossil fuels. Biofuels as a renewable energy source can be a viable option for sustaining long-term energy needs if they are managed efficiently. We describe our initial efforts to exploit algae, halophytes and other non-crop plants to produce synthetics for fuel blends that can potentially be used as fuels for aviation and non-aerospace applications. Our efforts have been dedicated to crafting efficient extraction and refining processes in order to extract constituents from the plant materials with the ultimate goal of determining the feasibility of producing biomass-based jet fuel from the refined extract. Two extraction methods have been developed based on communition processes, and liquid-solid extraction techniques. Refining procedures such as chlorophyll removal and transesterification of triglycerides have been performed. Gas chromatography in tandem with mass spectroscopy is currently being utilized in order to qualitatively determine the individual components of the refined extract. We also briefly discuss and compare alternative methods to extract fuel-blending agents from alternative biofuels sources.
Singh, Natwar; Mishra, Avinash; Jha, Bhavanath
2014-08-15
Peroxisomal ascorbate peroxidase gene (SbpAPX) of an extreme halophyte Salicornia brachiata imparts abiotic stress endurance and plays a key role in the protection against oxidative stress. The cloned SbpAPX gene was transformed to local variety of peanut and about 100 transgenic plants were developed using optimized in vitro regeneration and Agrobacterium mediated genetic transformation method. The T0 transgenic plants were confirmed for the gene integration; grown under controlled condition in containment green house facility; seeds were harvested and T1 plants were raised. Transgenic plants (T1) were further confirmed by PCR using gene specific primers and histochemical GUS assay. About 40 transgenic plants (T1) were selected randomly and subjected for salt stress tolerance study. Transgenic plants remained green however non-transgenic plants showed bleaching and yellowish leaves under salt stress conditions. Under stress condition, transgenic plants continued normal growth and completed their life cycle. Transgenic peanut plants exhibited adequate tolerance under salt stress condition and thus could be explored for the cultivation in salt affected areas for the sustainable agriculture. Copyright © 2014 Elsevier B.V. All rights reserved.
Bioprospecting of Marine Macrophytes Using MS-Based Lipidomics as a New Approach
Directory of Open Access Journals (Sweden)
Elisabete Maciel
2016-03-01
Full Text Available The marine environment supports a remarkable diversity of organisms which are a potential source of natural products with biological activities. These organisms include a wide variety of marine plants (from micro- to macrophytes, which have been used in the food and pharmaceutical industry. However, the biochemistry and biological activities of many of these macrophytes (namely macroalgae and halophytes, including seagrasses are still far from being fully explored. Most popular bioactive components include polysaccharides, peptides, phenolics and fatty acids (FAs. Polar lipids (glycolipids, phospholipids and betaine lipids are emerging as novel value-added bioactive phytochemicals, rich in n-3 FA, with high nutritional value and health beneficial effects for the prevention of chronic diseases. Polar lipids account various combinations of polar groups, fatty acyl chains and backbone structures. The polar lipidome of macrophytes is remarkably diverse, and its screening represents a significant analytical challenge. Modern research platforms, particularly mass spectrometry (MS-based lipidomic approaches, have been recently used to address this challenge and are here reviewed. The application of lipidomics to address lipid composition of marine macrophytes will contribute to the stimulation of further research on this group and foster the exploration of novel applications.
Directory of Open Access Journals (Sweden)
S. Sabouri Rad
2016-05-01
Full Text Available Kochia (Kochia scoparia L. Schard is an annual, halophyte and drought resistant plant, that it can be irrigated with saline water and a valuable source for forage under drought and saline ecosystems. In order to evaluate germination characteristics of kochia, an experiment was conducted at Physiology laboratory of Ferdowsi University of Mashhad, Iran, during 2009. This experiment was conducted in a completely randomized design with four replications. Germination was evaluated at 5, 10, 15, 20, 25, 30, 35 and 40°C under dark germinator with 50-60 percentage relative humidity. The results showed that the highest germination percentage was obtained at 20-30°C and the lowest obtained at 40°C. The longest and the shortest period to 20 and 50 germination percentage were recorded to 5-10°C and 20-30°C, respectively. The longest and the shortest period to 80 percentage germination were belonging to 15 and 30°C, respectively. Based on Five Parameters Beta model, base, optimum and ceiling temperatures for kochia estimated 3.4, 25 and 43.3°C, respectively. However, seed of this plant is able to germinate in wide temperature range.
Volatile organic chemicals of a shore-dwelling cyanobacterial mat community.
Evans, W G
1994-02-01
The main components of a cyanobacterial mat community of a hypersaline lake shore consist of edaphic, mat-forming strains (ecophenes), and littoral strains ofOscillatoria animalis Agardh andO. subbrevis Schmidle, other microorganisms associated with these cyanobacteria, several species ofBembidion (Carabidae: Coleoptera), and two halophytic flowering plants:Puccinellia nuttalliana (salt meadow grass) andSalicornia europaea rubra (samphire). The volatile organic compounds of this community are a blend of those emitted by each of these components such as the C17 alka(e)nes, geosmin, 2-methylisoborneol,β-cyclocitral,β-ionone, dimethyl sulfide, and dimethyl trisulfide of cyanobacteria and associated microorganisms; alcohols, esters, and aldehydes usually associated with flowering plants; and possibly some insect-derived esters, particularly isopropyl tetradecanoate. The dominant compounds were: C11, C13, C15, and C17 alka(e)nes, methyl esters of C16 and C18:2 acids, isopropyl tetradecanoate, heptanal, 3-octanone and 2-nonanone, the acyclic terpene linalool, and the alcohols 1-heptanol, 1-hexanol, 1-octanol, 3-hexen-1-ol, and 2-octen-1-ol. It is concluded that this community may be distinguished from related communities by its repertoire of volatile organic compounds.
Parthasarathy, Meera; Pemaiah, Brindha; Natesan, Ravichandran; Padmavathy, Saralla R; Pachiappan, Jayaraman
2015-02-01
Salt glands are specialized organelles present in the leaf tissues of halophytes, which impart salt-tolerance capability to the plant species. These glands are usually identified only by their morphology using conventional staining procedures coupled with optical microscopy. In this work, we have employed scanning electrochemical microscopy to identify the salt glands not only by their morphology but also by their salt excretion behavior. Bermuda grass (Cynodon dactylon L.) species was chosen for the study as they are known to be salt-tolerant and contain salt glands on leaf surfaces. Scanning electrochemical microscopy performed in sodium chloride medium in the presence and absence of potassium ferrocyanide as redox mediator, reveals the identity of salt glands. More insight into the ion expulsion behavior of these glands was obtained by mapping lateral and vertical variations in ion concentrations using surface impedance measurements which indicated five times higher resistance over the salt glands compared to the surrounding tissues and bulk solution. The protocol could be used to understand the developmental processes in plants grown in different soil/water conditions in order to improve salt tolerance of food crops by genetic engineering and hence improve their agricultural productivity.
VEGETATION CHANGES OF SUNDARBANS BASED ON LANDSAT IMAGERY ANALYSIS BETWEEN 1975 AND 2006
Directory of Open Access Journals (Sweden)
MD. TARIQUL ISLAM
2014-06-01
Full Text Available The Sundarbans in Bangladesh and India is the largest single block of tidal halophytic mangrove forest in the world. This forest is threatened by effect of climate change and manmade activities. The aim of this paper is to show changes in vegetation cover of Sundarbans since 1975 using Landsat imagery. Normalized Difference Vegetation Index is applied to quantify and qualify density of vegetation on a patch of land. Estimated land area (excluded water body of this forest is 66% in Bangladesh, and 34% in India, respectively. Net erosion since 1975 to 2006 is ~5.9%. In vicinity of human settlement, areal changes are not observed since 1975. The mangrove forest is decreased by 19.3% due severe tropical cyclone in 1977 and 1988. Moreover, the dense forest is damaged by about 50%. However, more than 25 years is taken by Sundarbans to recover from damage by a severe tropical cyclone. The biodiversity of Sundarbans depends to fresh water flow through it. Therefore, the future of Sundarbans depends to the impact of climate change which has further effect to increasing intensity and frequency of severe tropical cyclone and salinity in water channels in Sundarbans.
Polle, Andrea; Chen, Shaoliang
2015-09-01
Saline and sodic soils that cannot be used for agriculture occur worldwide. Cultivating stress-tolerant trees to obtain biomass from salinized areas has been suggested. Various tree species of economic importance for fruit, fibre and timber production exhibit high salinity tolerance. Little is known about the mechanisms enabling tree crops to cope with high salinity for extended periods. Here, the molecular, physiological and anatomical adjustments underlying salt tolerance in glycophytic and halophytic model tree species, such as Populus euphratica in terrestrial habitats, and mangrove species along coastlines are reviewed. Key mechanisms that have been identified as mediating salt tolerance are discussed at scales from the genetic to the morphological level, including leaf succulence and structural adjustments of wood anatomy. The genetic and transcriptomic bases for physiological salt acclimation are salt sensing and signalling networks that activate target genes; the target genes keep reactive oxygen species under control, maintain the ion balance and restore water status. Evolutionary adaptation includes gene duplication in these pathways. Strategies for and limitations to tree improvement, particularly transgenic approaches for increasing salt tolerance by transforming trees with single and multiple candidate genes, are discussed. © 2014 John Wiley & Sons Ltd.
Man and climate in the Maya lowlands
Leyden, Barbara W.
1987-11-01
A 15-m sedimentary core from Lake Salpeten provides the first complete Holocene sequence for the lowlying Peten District, Guatemala. Today, Lake Salpeten is a brackish, calcium sulfate lake near saturation surrounded by tropical semievergreen forest. The basal pollen record depicts sparse juniper scrub surrounding a lake basin that held ephermal pools and halophytic marshes. The lake rapidly deepened to > 27 m in the early Holocene and may have been meromictic, because nearly 2 m of gypsum "mush" was deposited. Mesic forests were quickly established and persisted until the Maya entered the district 3000 yr ago and caused extensive deforestation. Any climatic information contained in the pollen record of the Maya period is thus masked, but a regional pollen sequence linked to the archaeological record is substantiated because environmental disturbance was pervasive. Local intensification of occupation and population growth are seen as an increased deposition of pollen of agricultural weeds and colluviation into the lake, while the Classic Maya collapse is marked by a temporary decline in Compositae pollen. Effects of perturbations induced by the Maya persist in the pollen and limnetic record 400 yr after the Spanish conquest.
Czech Academy of Sciences Publication Activity Database
Lutts, S.; Lefevre, Isabelle
2015-01-01
Roč. 115, č. 3 (2015), s. 509-528 ISSN 0305-7364 Institutional support: RVO:60077344 Keywords : Antioxidants * glycinebetaine * metal distribution * osmoprotectants Subject RIV: BO - Biophysics Impact factor: 3.982, year: 2015
Mencermati Sejarah Perkembangan Filsafat Islam
Directory of Open Access Journals (Sweden)
A. Khudori Soleh
2014-05-01
Full Text Available Although acknowledged that Greek philosophy gave great influence on the development of Islamic philosophy, but philosophy of Islam are not based on it, because; (1 to learn does not necessarily reflect a repetition, (2 every thought is not separated from their cultural context, (3 the real fact shows that Islamic rational thinking has established before the arrival of Greek philosophy. If so, where Islamic philosophical thought come from? The answer is from the Islamic tradition itself, from scientists who attempt to explain the teachings of the Muslim holy book. There are three measures relevant to philosophical reasoning: ta’wil method, explanation of musytarak meaning, and qiyâs. In addition, the demands on theological issues, to harmonize the views that seem contradictory and complex, for further systematized it in an integral metaphysical idea. From there developed methods and philosophical thought in Islam, long before the arrival of Greek philosophy through the process of translation. First of all it was accepted because it is needed to answer new problems which require rational thinking, then it was declined at the time of Ibn Hanbal because there are certain cases which considered deviant, it was developed again in the time of al-Farabi and Ibn Sina, then rejected and considered to cause disbelief in the al-Ghazali era, and it was developed again at the Ibn Rushd, then change lanes to work together with Sufism in the time of Suhrawardi and Ibn Arabi. Finally, tradition of philosophical thought in the Sunni world does not grow up but remains develop well within the Shiite community.
Mao, Yumei; Li, Xiaping; Dick, Warren A; Chen, Liming
2016-07-01
Salinization and sodicity are obstacles for vegetation reconstruction of coastal tidal flat soils. A study was conducted with flue gas desulfurization (FGD)-gypsum applied at rates of 0, 15, 30, 45 and 60Mg/ha to remediate tidal flat soils of the Yangtze River estuary. Exchangeable sodium percentage (ESP), exchangeable sodium (ExNa), pH, soluble salt concentration, and composition of soluble salts were measured in 10cm increments from the surface to 30cm depth after 6 and 18months. The results indicated that the effect of FGD-gypsum is greatest in the 0-10cm mixing soil layer and 60Mg/ha was the optimal rate that can reduce the ESP to below 6% and decrease soil pH to neutral (7.0). The improvement effect was reached after 6months, and remained after 18months. The composition of soluble salts was transformed from sodic salt ions mainly containing Na(+), HCO3(-)+CO3(2-) and Cl(-) to neutral salt ions mainly containing Ca(2+) and SO4(2-). Non-halophyte plants were survived at 90%. The study demonstrates that the use of FGD-gypsum for remediating tidal flat soils is promising. Copyright © 2016. Published by Elsevier B.V.
Eddy covarianace measurements in a hyper-arid and hyper-saline mangroves ecosystem
Perri, S.; Marpu, P.; Molini, A.; Armstrong, P.
2017-12-01
The natural environment of mangroves provides a number of ecosystem services for improving water quality, supporting healthy fisheries, and protecting the coasts. Also, their carbon storage is larger than any other forest type. Several authors have recognized the importance of mangroves in global carbon cycles. However, energy, water and carbon exchanges between ecosystem and atmosphere are still not completely understood. Eddy covariance measurements are extremely valuable to understand the role of the unique stressors of costal ecosystems in gas exchange. In particular, periodic flooding and elevated soil pore water salinity influence land-atmosphere interactions. Despites the importance of flux measurements in mangroves forests, such in-situ observations are extremely rare. Our research team set up an eddy covariance tower in the Mangrove National Park of Abu Dhabi, UAE. The study site (24.4509° N, 54.4288° E) is located in a dwarf Avicennia marina ecosystem experiencing extremely high temperatures and salinity. CO2 and H2O exchanges are estimated and related to water level and salinity measurements. This unique dataset will shed some light on the net ecosystem exchange (NEE) of carbon dioxide, on energy fluxes and on evapotranspiration rates for a halophyte ecosystem under severe salt-stress and high temperature.
Energy Technology Data Exchange (ETDEWEB)
Bejarano, Adriana C., E-mail: ABejarano@researchplanning.co [Research Planning Inc., 1121 Park St., Columbia, SC 29201 (United States); Michel, Jacqueline [Research Planning Inc., 1121 Park St., Columbia, SC 29201 (United States)
2010-05-15
A large-scale assessment of polycyclic aromatic hydrocarbons (PAHs) from the 1991 Gulf War oil spill was performed for 2002-2003 sediment samples (n = 1679) collected from habitats along the shoreline of Saudi Arabia. Benthic sediment toxicity was characterized using the Equilibrium Partitioning Sediment Benchmark Toxic Unit approach for 43 PAHs (ESBTU{sub FCV,43}). Samples were assigned to risk categories according to ESBTU{sub FCV,43} values: no-risk (<=1), low (>1-<=2), low-medium (>2-<=3), medium (>3-<=5) and high-risk (>5). Sixty seven percent of samples had ESBTU{sub FCV,43} > 1 indicating potential adverse ecological effects. Sediments from the 0-30 cm layer from tidal flats, and the >30-<60 cm layer from heavily oiled halophytes and mangroves had high frequency of high-risk samples. No-risk samples were characterized by chrysene enrichment and depletion of lighter molecular weight PAHs, while high-risk samples showed little oil weathering and PAH patterns similar to 1993 samples. North of Safaniya sediments were not likely to pose adverse ecological effects contrary to sediments south of Tanaqib. Landscape and geomorphology has played a role on the distribution and persistence in sediments of oil from the Gulf War. - Risk Assessment of PAHs in shoreline sediments 12 years after the Gulf War oil spill.
Discovery and Characterization of Two Novel Salt-Tolerance Genes in Puccinellia tenuiflora
Directory of Open Access Journals (Sweden)
Ying Li
2014-09-01
Full Text Available Puccinellia tenuiflora is a monocotyledonous halophyte that is able to survive in extreme saline soil environments at an alkaline pH range of 9–10. In this study, we transformed full-length cDNAs of P. tenuiflora into Saccharomyces cerevisiae by using the full-length cDNA over-expressing gene-hunting system to identify novel salt-tolerance genes. In all, 32 yeast clones overexpressing P. tenuiflora cDNA were obtained by screening under NaCl stress conditions; of these, 31 clones showed stronger tolerance to NaCl and were amplified using polymerase chain reaction (PCR and sequenced. Four novel genes encoding proteins with unknown function were identified; these genes had no homology with genes from higher plants. Of the four isolated genes, two that encoded proteins with two transmembrane domains showed the strongest resistance to 1.3 M NaCl. RT-PCR and northern blot analysis of P. tenuiflora cultured cells confirmed the endogenous NaCl-induced expression of the two proteins. Both of the proteins conferred better tolerance in yeasts to high salt, alkaline and osmotic conditions, some heavy metals and H2O2 stress. Thus, we inferred that the two novel proteins might alleviate oxidative and other stresses in P. tenuiflora.
Karimpour Reihan, Majid
2010-05-01
Increase of playas, decrease of water quality, soil and plant degradation is one of important problems in recent decays. Notwithstanding increase of playa wetlands- 4 million ha in our country- is perform some investigations about this biome and components and this lack of investigation is made degradation of water, soil, plant potentials and at least desertification. Then, management the biome and planning for sustainable development is very important because of sensitive this environments and has requirement to recognize ecological properties and components, so in this study, try to investigate fasting and latent this regions. At last for potentialization of region for rangeland, water and dry culture use, assessment and classification of region was performed with aim of FAO formula. According to this formula, environmental factors studied and performed grading and classifying. Basis on results, the region is not proper for dry farming and view of water farming and rangeland was settled in 5 and 6 classes. Latest result should be conserving the region. For this act, our introduced 13 halophyte plats with view of investigation of 20 factors. May god will, ganged this regions to good rangelands and forests of dry regions. Key words: Assessment of lands, Hoze Soltane of Qom, environmental factors, FAO, Compatible Plants, Reclamation strategies
ON PHYTOCOENOTICAL MAPPING OF CASPIAN DESERT REGION
Directory of Open Access Journals (Sweden)
I. SAFRONOVA
2004-05-01
Full Text Available The phytoecological map (l :2.500.000 for Desert Region, including the Caspian Lowland and the Mangyshlak. has been compiled. It gives an idea of latitudinal differentiation cf vegetation. Edaphic variants and lithological composition in low mountains. The legend has been constructed according to zonal-typological principle e using an ecological-phytocoenotic classification. Heterogeneity of vegetation is reflected by means of territoria1 units (complex, series, combination and additional marks above the vegetation background. In the northern subzone vegetation is fairly monotonous and characterized by prevalence of wormwood communities (Artemisia of subgenus Seriphidium, joined in three formations: Artemisia lerchiana, A. arenaria. A. pauciflora. Small areas are occupied by shrub deserts of Calligollum aphyllum and Tamarix ramosissima. To southward of 47° N in the middle subzone on the Caspian Lowland the communities of halophyte perennial saltworts essential1y dominate, and to less extent-wormwood communities of hemipsammophytic Artemisia terrae-albae and psammophytic Artemisia arenaria and A. lerchiana. Deserts of Mangyshlak are much diverse. Dwarf semishrubs are presented by species of perennial saltworts (Anabasis salsa, Nanophyton erinaceum,Arthrophytum lehnwnianum, Salsola orientaUs and wonnwood (Artemisia terrae-albae, A. gurganica. A. santolina. To southward of 43° N in the southern subzone dwarf semishrub Salsola gemmascens and Artemisia kemrudica corrnnunities prevail.
ON PHYTOCOENOTICAL MAPPING OF CASPIAN DESERT REGION
Directory of Open Access Journals (Sweden)
I. SAFRONOVA
2004-01-01
Full Text Available The phytoecological map (l :2.500.000 for Desert Region, including the Caspian Lowland and the Mangyshlak. has been compiled. It gives an idea of latitudinal differentiation cf vegetation. Edaphic variants and lithological composition in low mountains. The legend has been constructed according to zonal-typological principle e using an ecological-phytocoenotic classification. Heterogeneity of vegetation is reflected by means of territoria1 units (complex, series, combination and additional marks above the vegetation background. In the northern subzone vegetation is fairly monotonous and characterized by prevalence of wormwood communities (Artemisia of subgenus Seriphidium, joined in three formations: Artemisia lerchiana, A. arenaria. A. pauciflora. Small areas are occupied by shrub deserts of Calligollum aphyllum and Tamarix ramosissima. To southward of 47° N in the middle subzone on the Caspian Lowland the communities of halophyte perennial saltworts essential1y dominate, and to less extent-wormwood communities of hemipsammophytic Artemisia terrae-albae and psammophytic Artemisia arenaria and A. lerchiana. Deserts of Mangyshlak are much diverse. Dwarf semishrubs are presented by species of perennial saltworts (Anabasis salsa, Nanophyton erinaceum,Arthrophytum lehnwnianum, Salsola orientaUs and wonnwood (Artemisia terrae-albae, A. gurganica. A. santolina. To southward of 43° N in the southern subzone dwarf semishrub Salsola gemmascens and Artemisia kemrudica corrnnunities prevail.
Tamarix microRNA Profiling Reveals New Insight into Salt Tolerance
Directory of Open Access Journals (Sweden)
Jianwen Wang
2018-04-01
Full Text Available The halophyte tamarisk (Tamarix is extremely salt tolerant, making it an ideal material for salt tolerance-related studies. Although many salt-responsive genes of Tamarix were identified in previous studies, there are no reports on the role of post-transcriptional regulation in its salt tolerance. We constructed six small RNA libraries of Tamarix chinensis roots with NaCl treatments. High-throughput sequencing of the six libraries was performed and microRNA expression profiles were constructed. We investigated salt-responsive microRNAs to uncover the microRNA-mediated genes regulation. From these analyses, 251 conserved and 18 novel microRNA were identified from all small RNAs. From 191 differentially expressed microRNAs, 74 co-expressed microRNAs were identified as salt-responsive candidate microRNAs. The most enriched GO (gene ontology terms for the 157 genes targeted by differentially expressed microRNAs suggested that transcriptions factors were highly active. Two hub microRNAs (miR414, miR5658, which connected by several target genes into an organic microRNA regulatory network, appeared to be the key regulators of post-transcriptional salt-stress responses. As the first survey on the tamarisk small RNAome, this study improves the understanding of tamarisk salt-tolerance mechanisms and will contribute to the molecular-assisted resistance breeding.
The salt glands of Tamarix usneoides E. Mey. ex Bunge (South African Salt Cedar).
Wilson, Hayden; Mycock, David; Weiersbye, Isabel M
2017-06-03
Tamarix usneoides is a halophyte tree endemic to south-western Africa. This species is known to excrete a range of ions from specialized glandular structures on its leaves. To understand the mechanisms involved in the transport, sequestration and excretion of ions by the glands, a study was performed on salt gland distribution and ultrastructure. The glands are vesiculated trichomes, comprised of eight cells viz. two basal collecting cells and six excretory cells, partially bounded by a secondary cell wall that could serve as an impermeable barrier, forcing excess ions to move from the apoplast of the surrounding tissue into the cytoplasm of the basal excretory cells. It was hypothesized that the ions are moved across the excretory cells in endocytotic vesicles that fuse with the plasmalemma or form junctional complexes, allowing ion movement from one excretory cell to the next. In the apical cell, the vesicles fuse with the plasmalemma, releasing the ions into the network of cell wall ingrowths which channel the ions to the outside surface of the cell. This study shows that there are distinct structural adaptations for the processing of ions for excretion, although the mechanism by which ions enter the cells still needs to be determined.
The plasma membrane transport systems and adaptation to salinity.
Mansour, Mohamed Magdy F
2014-11-15
Salt stress represents one of the environmental challenges that drastically affect plant growth and yield. Evidence suggests that glycophytes and halophytes have a salt tolerance mechanisms working at the cellular level, and the plasma membrane (PM) is believed to be one facet of the cellular mechanisms. The responses of the PM transport proteins to salinity in contrasting species/cultivars were discussed. The review provides a comprehensive overview of the recent advances describing the crucial roles that the PM transport systems have in plant adaptation to salt. Several lines of evidence were presented to demonstrate the correlation between the PM transport proteins and adaptation of plants to high salinity. How alterations in these transport systems of the PM allow plants to cope with the salt stress was also addressed. Although inconsistencies exist in some of the information related to the responses of the PM transport proteins to salinity in different species/cultivars, their key roles in adaptation of plants to high salinity is obvious and evident, and cannot be precluded. Despite the promising results, detailed investigations at the cellular/molecular level are needed in some issues of the PM transport systems in response to salinity to further evaluate their implication in salt tolerance. Copyright © 2014 Elsevier GmbH. All rights reserved.
International Nuclear Information System (INIS)
Bejarano, Adriana C.; Michel, Jacqueline
2010-01-01
A large-scale assessment of polycyclic aromatic hydrocarbons (PAHs) from the 1991 Gulf War oil spill was performed for 2002-2003 sediment samples (n = 1679) collected from habitats along the shoreline of Saudi Arabia. Benthic sediment toxicity was characterized using the Equilibrium Partitioning Sediment Benchmark Toxic Unit approach for 43 PAHs (ESBTU FCV,43 ). Samples were assigned to risk categories according to ESBTU FCV,43 values: no-risk (≤1), low (>1-≤2), low-medium (>2-≤3), medium (>3-≤5) and high-risk (>5). Sixty seven percent of samples had ESBTU FCV,43 > 1 indicating potential adverse ecological effects. Sediments from the 0-30 cm layer from tidal flats, and the >30-<60 cm layer from heavily oiled halophytes and mangroves had high frequency of high-risk samples. No-risk samples were characterized by chrysene enrichment and depletion of lighter molecular weight PAHs, while high-risk samples showed little oil weathering and PAH patterns similar to 1993 samples. North of Safaniya sediments were not likely to pose adverse ecological effects contrary to sediments south of Tanaqib. Landscape and geomorphology has played a role on the distribution and persistence in sediments of oil from the Gulf War. - Risk Assessment of PAHs in shoreline sediments 12 years after the Gulf War oil spill.
Cho, Hyun-Dong; Lee, Ju-Hye; Jeong, Ji-Hye; Kim, Jae-Yong; Yee, Sung-Tae; Park, Seok-Kyu; Lee, Mi-Kyung; Seo, Kwon-Il
2016-03-15
Salicornia herbacea L. is a halophyte that grows in salt marshes and contains significant amounts of salts and minerals. Because it is known as a folk medication to treat diseases, various processed products such as powder, globular type of powder, laver and extract have been developed. However, it is difficult to process as a drink because of its high salinity. In the present study, glasswort vinegar (GV) containing high amounts of organic acids and minerals was developed via two-step fermentation with unpolished rice substrates and investigated its antioxidant and anti-fatigue activities. GV showed various free radical scavenging effects, reducing power, oxidized-LDL inhibition and superoxide dismutase-like activities. Compared with the control group (orally administered 7 g kg(-1) distilled water), the GV supplementation group showed increased running endurance and had higher glycogen accumulation in liver and muscles of rats exhausted by exercise. Furthermore, the GV-administered group demonstrated significantly elevated lactate and ATP metabolism, promoting enzyme activities such as muscle creatine kinase and lactate dehydrogenase, whereas serum fatigue biomarkers such as ammonia, lactate and inorganic acid were markedly decreased. These results indicate that GV can be used as a functional food for the development of a dietary beverage to alleviate fatigue. © 2015 Society of Chemical Industry.
International Nuclear Information System (INIS)
Fisher, D.D.; Schenk, H.J.; Thorsch, J.A.; Ferren, W.R. Jr.
1997-01-01
The halophytic genus Suaeda (Chenopodiaceae) includes species with the C3 and C4 photosynthetic pathways. North American species of this genus were investigated to determine whether C3 and C4 leaf anatomy are consistent within the two sections of Suaeda, Chenopodina and Limbogermen, present on this continent. All species from section Chenopodina were found to possess C3 anatomy, whereas all species from section Limbogermen were found to be C4 species. Characteristics of leaf anatomy and chloroplast ultrastructure are similar to those reported from C3 and C4 species, respectively, from the Eastern Hemisphere. All species from section Limbogermen have the suaedoid type of leaf anatomy, characterized by differentiation of the mesophyll into palisade parenchyma and a chlorenchymatous sheath surrounding central water-storage tissue, as well as leaf carbon isotope ratios of above -20. All species from section Chenopodina have austrobassioid leaf anatomy without a chlorenchymatous sheath and leaf carbon isotope ratio values of below -20. According to our literature review, the photosynthetic pathway has now been reported for about half (44) of the Suaeda species worldwide. The C3 and C4 photosynthetic syndromes are with few exceptions distributed along sectional or subsectional lines. These findings throw new light on the infrageneric taxonomy of this genus
Bioactive Secondary Metabolites from Schizogyne sericea (Asteraceae) Endemic to Canary Islands.
Venditti, Alessandro; Bianco, Armandodoriano; Muscolo, Camilla; Zorzetto, Christian; Sánchez-Mateo, Candelaria C; Rabanal, Rosa M; Quassinti, Luana; Bramucci, Massimo; Damiano, Silvia; Iannarelli, Romilde; Lupidi, Giulio; Papa, Fabrizio; Petrelli, Dezemona; Vitali, Luca A; Vittori, Sauro; Maggi, Filippo
2016-07-01
Schizogyne sericea (Asteraceae) is a halophytic shrub endemic to the Canary Islands and traditionally employed as analgesic, astringent, anti-inflammatory, and vulnerary. A comprehensive phytochemical investigation was conducted on the flowering aerial parts by analyzing both essential oil constituents and polar compounds. The essential oil was dominated by p-cymene, with the noteworthy occurrence of β-pinene and thymol esters. From the EtOH extract, eight compounds were isolated and structurally elucidated. Essential oil, polar fractions, and isolates (2), (4), and (5) were separately in vitro assayed for antiproliferative activity on human tumor cell lines (A375, MDA-MB 231, and HCT116) by MTT assay, for antioxidant potential by DPPH, ABTS, and FRAP assays, and for antimicrobial activity by the agar disk diffusion method. Results revealed that essential oil and compounds 1 and 2 exert a strong inhibition on tumor cells, and in some cases, higher than that of cisplatin. Fractions containing thymol derivatives (1 and 2) and caffeoylquinic acid derivatives 4 and 5 displayed antioxidant activity comparable to that of Trolox, making S. sericea extract an interesting natural product with potential applications as preservative or in the treatment of diseases in which oxidative stress plays an important role. © 2016 Wiley-VHCA AG, Zürich.
Pitzschke, Andrea
2016-01-01
Among potential climate change-adapted crops for future agriculture, quinoa (Chenopodium quinoa), a facultative halophyte plant with exceptional nutritional properties, stands out as a prime candidate. This work examined how quinoa deals with extreme situations during seed rehydration. Quinoa distinguishes itself from other plants in multiple ways. It germinates within minutes, even under extremely hostile conditions. Broken seeds/split embryos are able to regenerate. Furthermore, quinoa seedlings are resurrection-competent. These peculiarities became in part explainable upon discovery of seed-borne microorganisms. 100% of quinoa seeds, from different sources, are inhabited by diverse members of the genus Bacillus. These endophytes are motile and reside in all seedling organs, indicating vertical transmission. Owing to their high catalase activities and superoxide contents the bacteria potentially manipulate the host’s redox status. Superoxide-driven cell expansion enables quinoa to overcome a critical period in development, seedling establishment. Quinoa’s immediate confrontation with “foreign” reactive oxygen species and bacterial elicitors likely induces a naturally primed state, enabling plants to withstand extreme situations. The endophytic bacteria, which are cultivable and highly robust themselves, have high potential for application in agriculture, food (amylase) and cosmetics (catalase) industry. This work also discusses the potential of transferring quinoa’s microbiome to improve stress resistance in other plant species. PMID:26834724
Biotreatment of produced waters for volume reduction and contaminant removal
Energy Technology Data Exchange (ETDEWEB)
Negri, M.C.; Hinchman, R.R. [Argonne National Lab., IL (United States); Mollock, J. [Devon Energy Corp., Oklahoma City, OK (United States)
1997-10-01
Produced water is wastewater that is brought to the surface from natural gas wells during natural gas production. Its constituents, mostly salt, with traces of hydrocarbons and heavy metals, are a significant disposal problem. Argonne National Laboratory (ANL), in partnership with the Gas Research Institute (GRI), has developed a low-cost, low-tech method, in which green plants are used to reduce the volume of produced water. The authors have designed an engineered bioreactor system, which is modeled after natural saline wetland ecosystems. The plant bioreactor system maximizes plant evapotranspiration to reduce wastewater volume and, concurrently, may function as a biological filter to enhance contaminant degradation and immobilization in the root/rhizosphere zone. Halophyte plant species having high salt tolerance and high transpiration rates were selected after they tested them in greenhouse experiments. Models obtained by using their greenhouse findings reduced the volume of the wastewater (up to 6% salt) by 75% in about 8 days. A field demonstration of the bioreactor, designed on the basis of the results from the greenhouse study, is successfully under way at a natural gas well site in Oklahoma. The process could offer the petroleum industry a low-cost biological alternative to existing expensive options.
Directory of Open Access Journals (Sweden)
Cattarin eTheerawitaya
2015-08-01
Full Text Available Acacia ampliceps (salt wattle, a leguminous shrub, has been introduced in salt-affected areas in northeast of Thailand for remediation of saline soils. However, the defense mechanisms underlying salt tolerance A. ampliceps are unknown. We investigated various physio-biochemical and morphological attributes of A. ampliceps in response to varying levels of salt treatment (200 to 600 mM NaCl. Seedlings of A. ampliceps (252 cm in plant height raised from seeds were treated with 200 mM (mild stress, 400 and 600 mM (extreme stress of salt treatment (NaCl under greenhouse conditions. Na+ and Ca2+ contents in the leaf tissues increased significantly under salt treatment, whereas K+ content declined in salt-stressed plants. Free proline and soluble sugar contents in plant grown under extreme salt stress (600 mM NaCl for 9 days significantly increased by 28.7 (53.33 mol g1 FW and 3.2 (42.11 mg g1 DW folds, respectively over the control, thereby playing a major role as osmotic adjustment. Na+ enrichment in the phyllode tissues of salt-stressed seedlings positively related to total chlorophyll degradation (R2=0.72. Photosynthetic pigments and chlorophyll fluorescence in salt-stressed plants increased under mild salt stress (200 mM NaCl. However, these declined under high level of salinity (400-600 mM NaCl, consequently resulting in reduced net photosynthetic rate (R2=0.81 and plant dry weight (R2= 0.91. The study concludes that A. ampliceps has an osmotic adjustment and Na+ compartmentation as effective salt defense mechanisms, and thus it could be an excellent species to grow in salt-affected soils.
Wang, L.; Baskin, J.M.; Baskin, C.C.; Cornelissen, J.H.C.; Dong, M.; Huang, Z.Y.
2012-01-01
Background: Maternal effects may influence a range of seed traits simultaneously and are likely to be context-dependent. Disentangling the interactions of plant phenotype and growth environment on various seed traits is important for understanding regeneration and establishment of species in natural
Wang, Lei; Baskin, Jerry M; Baskin, Carol C; Cornelissen, J Hans C; Dong, Ming; Huang, Zhenying
2012-09-25
Maternal effects may influence a range of seed traits simultaneously and are likely to be context-dependent. Disentangling the interactions of plant phenotype and growth environment on various seed traits is important for understanding regeneration and establishment of species in natural environments. Here, we used the seed-dimorphic plant Suaeda aralocaspica to test the hypothesis that seed traits are regulated by multiple maternal effects. Plants grown from brown seeds had a higher brown:black seed ratio than plants from black seeds, and germination percentage of brown seeds was higher than that of black seeds under all conditions tested. However, the coefficient of variation (CV) for size of black seeds was higher than that of brown seeds. Seeds had the smallest CV at low nutrient and high salinity for plants from brown seeds and at low nutrient and low salinity for plants from black seeds. Low levels of nutrients increased size and germinability of black seeds but did not change the seed morph ratio or size and germinability of brown seeds. High levels of salinity decreased seed size but did not change the seed morph ratio. Seeds from high-salinity maternal plants had a higher germination percentage regardless of level of germination salinity. Our study supports the multiple maternal effects hypothesis. Seed dimorphism, nutrient and salinity interacted in determining a range of seed traits of S. aralocaspica via bet-hedging and anticipatory maternal effects. This study highlights the importance of examining different maternal factors and various offspring traits in studies that estimate maternal effects on regeneration.
Ma, J.; Pendall, E.; Chen, F.
2008-12-01
SN, SOM, total SP and available SP in soil. The main soil factors affecting δ13C values in the desert halophyte R. soongorica were SWC and TDS. Leaf δ13C values was significantly correlated with the contents of LK, LWC, and proline (P<0.001). Correlation with the contents of LK content was most profound (r=0.793), followed by that with LWC (r=0.786), indicating that the variation of leaf δ13C value could reflect the degree of drought stress and the variation in leaf δ13C values of R. soongorica were likely caused by stomatal conductance, rather than by nutrient-related changes in photosynthetic efficiency under extremely low available water conditions. The observed significant correlations between foliar δ13C values in R. soongorica and SWC and soil TDS reinforced that R. soongorica is a super-halophyte in terms of adaptive strategies to arid environments.
Digiaro, Michele; Elbeaino, Toufic; Martelli, Giovanni Paolo
2007-04-01
Based on the nucleotide sequence homology of RNA-1 and RNA-2 of nepoviruses isolated from grapevines, three sets of degenerate primers, one for each of the three subgroups of the genus (A, B and C), were designed and proved effective for RT-PCR detection of subgroups in infected grapevines and herbaceous hosts. Primers designed specifically for detecting subgroup A species amplified a fragment of 255 bp from samples infected by Grapevine fanleaf virus (GFLV), Arabis mosaic virus (ArMV), Tobacco ringspot virus (TRSV) and Grapevine deformation virus (GDefV), but not from samples infected by other nepovirus species. Similarly, primers for detection of subgroup B nepoviruses amplified a 390 bp product from samples infected by Grapevine chrome mosaic virus (GCMV), Tomato black ring virus (TBRV), Grapevine Anatolian ringspot virus (GARSV) and Artichoke Italian latent virus (AILV). The third set of primers amplified a 640 bp fragment, only from samples infected by subgroup C nepoviruses, i.e Tomato ringspot virus (ToRSV) Grapevine Bulgarian latent virus (GBLV), and Grapevine Tunisian ringspot virus (GTRSV). These primers were able to detect simultaneously all viral species belonging to the same subgroup and to discriminate species of different subgroups. Multiplex-PCR detection of subgroup A and B nepoviruses was obtained using a specific primer (sense for subgroup A and antisense for subgroup B) for each of the species of the same subgroup in combination with the degenerate subgroup-specific primers. In this way it was possible to detect four different viral species in single samples containing mixtures of viruses of the same subgroup. In particular, for viruses of subgroup A (TRSV, GFLV, ArMV and GDefV) amplicons of 190, 259, 301 and 371 bp were obtained, whereas amplicons of 190, 278, 425 and 485 bp, respectively, were obtained from samples infected with viruses of subgroup B (GCMV, AILV, GARSV and TBRV).
Inter-Faith Reading of Perfect Man With Mystical Approach
Directory of Open Access Journals (Sweden)
Fatemeh Musavi
2010-12-01
Full Text Available The expression Insan –e kamil (perfect man is often said to have first been used by Muhyiddin ibn 'Arabi (1165 -1240AD, though the concept of the term is much older. In his theosophical teaching, the doctrine of insan e- kamil, is held a prominent place. After him two other great Sufis, Aziz Nasafi (1300AD and 'Abd al- karim ibn Ibrahim al- Jili (1366 – 1424 AD, each wrote a work on this very issue. These works are regarded as explanations of Ibn Arabi’s teachings on human perfection. In Islamic mysticism, Perfect man is the one who within their soul possesses all God's names and attributes. Thus the perfect man’s existence, reality and inner might become a clear mirror and a complete reflection of the Perfection, Beauty and Glory of the Essence of the One, so that he becomes Godlike. However, the idea of human perfectibility going back to other religions and human schools even before Islam. In Abrahimic religions there are some joint teachings that could be considered as main statements for the doctrine of Perfect Man In Jewish scriptures the notion of human creation in God's image suggests that the human being is able to be God's like and the perfection is available to him. However, Jews do not believe a perfect man. They hold that even Moses is not a perfect man. In Christianity, Although Jesus encourages his followers to be perfect like their heavenly fathers, the doctrine of original sin to be considered as an obstacle for human perfectibility.This essay examines some significant element in human perfectibility from the view points of some scholars of Judaism, Christianity and Islam and presents some similarities and differences of their view points.
Inter-Faith Reading of Perfect Man With Mystical Approach
Directory of Open Access Journals (Sweden)
Mohammadkazem Shaker
2011-01-01
Full Text Available The expression Insan –e kamil (perfect man is often said to have first been used by Muhyiddin ibn 'Arabi (1165 -1240AD, though the concept of the term is much older. In his theosophical teaching, the doctrine of insan e- kamil, is held a prominent place. After him two other great Sufis, Aziz Nasafi (1300AD and 'Abd al- karim ibn Ibrahim al- Jili (1366 – 1424 AD, each wrote a work on this very issue. These works are regarded as explanations of Ibn Arabi’s teachings on human perfection. In Islamic mysticism, Perfect man is the one who within their soul possesses all God's names and attributes. Thus the perfect man’s existence, reality and inner might become a clear mirror and a complete reflection of the Perfection, Beauty and Glory of the Essence of the One, so that he becomes Godlike. However, the idea of human perfectibility going back to other religions and human schools even before Islam. In Abrahimic religions there are some joint teachings that could be considered as main statements for the doctrine of Perfect Man In Jewish scriptures the notion of human creation in God's image suggests that the human being is able to be God's like and the perfection is available to him. However, Jews do not believe a perfect man. They hold that even Moses is not a perfect man. In Christianity, Although Jesus encourages his followers to be perfect like their heavenly fathers, the doctrine of original sin to be considered as an obstacle for human perfectibility.This essay examines some significant element in human perfectibility from the view points of some scholars of Judaism, Christianity and Islam and presents some similarities and differences of their view points.
Inter-Faith Reading of Perfect Man With Mystical Approach
Directory of Open Access Journals (Sweden)
Shaker, M.K
2011-01-01
Full Text Available The expression Insan –e kamil (perfect man is often said to have first been used by Muhyiddin ibn 'Arabi (1165 -1240AD, though the concept of the term is much older. In his theosophical teaching, the doctrine of insan e- kamil, is held a prominent place. After him two other great Sufis, Aziz Nasafi (1300AD and 'Abd al- karim ibn Ibrahim al- Jili (1366 – 1424 AD, each wrote a work on this very issue. These works are regarded as explanations of Ibn Arabi’s teachings on human perfection. In Islamic mysticism, Perfect man is the one who within their soul possesses all God's names and attributes. Thus the perfect man’s existence, reality and inner might become a clear mirror and a complete reflection of the Perfection, Beauty and Glory of the Essence of the One, so that he becomes Godlike. However, the idea of human perfectibility going back to other religions and human schools even before Islam. In Abrahimic religions there are some joint teachings that could be considered as main statements for the doctrine of Perfect Man In Jewish scriptures the notion of human creation in God's image suggests that the human being is able to be God's like and the perfection is available to him. However, Jews do not believe a perfect man. They hold that even Moses is not a perfect man. In Christianity, Although Jesus encourages his followers to be perfect like their heavenly fathers, the doctrine of original sin to be considered as an obstacle for human perfectibility.This essay examines some significant element in human perfectibility from the view points of some scholars of Judaism, Christianity and Islam and presents some similarities and differences of their view points.
DEFF Research Database (Denmark)
Alassali, Ayah; Cybulska, Iwona; Galvan, Alejandro Ríos
2017-01-01
-persica was collected and split into two fractions by wet fractionation; liquid (juice) and solid (pulp). Sugar contents were found to be 1.0–1.5% for the juice fraction and 50% (w/w) for the fresh pulp. Direct fermentation of the juice using Saccharomyces cerevisiae showed no salt inhibition of the yeast and ethanol...... yields of ~70% were achieved. A pretreatment study was carried out for the pulp fraction applying mild hydrothermal pretreatment. Cellulose convertibility was found to be significantly higher for severity factors above 2.00, and the highest ethanol yield (76.91 ± 3.03%) was found at process severity of 3...
Gholam Ali Jalali; Hossein Akbarian; Charles Rhoades; Hamed Yousefzadeh
2012-01-01
We compared soil properties beneath naturally-occurring patches of Lycium ruthenicum Murray (fam. Solanaceae) to evaluate the shrubâs potential to improve the fertility of saline soils. Soil pH, total nitrogen and carbon and extractable potassium, magnesium and phosphorus were respectively significantly higher in the A and B horizons of Lycium shrub patches...
Barkla, B. J.; Zingarelli, L.; Blumwald, E.; Smith, JAC.
1995-10-01
Tonoplast vesicles were isolated from leaf mesophyll tissue of the inducible Crassulacean acid metabolism plant Mesembryanthemum crystallinum to investigate the mechanism of vacuolar Na+ accumulation in this halophilic species. In 8-week-old plants exposed to 200 mM NaCl for 2 weeks, tonoplast H+-ATPase activity was approximately doubled compared with control plants of the same age, as determined by rates of both ATP hydrolysis and ATP-dependent H+ transport. Evidence was also obtained for the presence of an electroneutral Na+/H+ antiporter at the tonoplast that is constitutively expressed, since extravesicular Na+ was able to dissipate a pre-existing transmembrane pH gradient. Initial rates of H+ efflux showed saturation kinetics with respect to extravesicular Na+ concentration and were 2.1-fold higher from vesicles of salt-treated plants compared with the controls. Na+-dependent H+ efflux also showed a high selectivity for Na+ over K+, was insensitive to the transmembrane electrical potential difference, and was more than 50% inhibited by 200 [mu]M N-amidino-3,5-diamino-6-chloropyrazinecarboxamide hydrochloride. The close correlation between increased Na+/H+ antiport and H+-ATPase activities in response to salt treatment suggests that accumulation of the very high concentrations of vacuolar Na+ found in M. crystallinum is energized by the H+ electrochemical gradient across the tonoplast.
Connelly, Xana M.
1997-01-01
The red mangrove Rhizophora mangle L., is a halophytic woody spermatophyte common to the land-sea interface of tropical and subtropical intertidal zones. It has been reported that 60 to 75% of the coastline of the earth's tropical regions are lined with mangroves. Mangroves help prevent shoreline erosion, provide breeding, nesting and feeding areas for many marine animals and birds. Mangroves are important contributors of primary production in the coastal environment, and this is largely proportional to the standing crop of leaf chlorophylls. Higher intensities of ultraviolet radiation, resulting from stratospheric ozone depletion, can lead to a reduction of chlorophyll in terrestrial plants. Since the most common method for determining chlorophyll concentration is by extraction and this is labor intensive and time consuming, few studies on photosynthetic pigments of mangroves have been reported. Chlorophyll meter readings have been related to leaf chlorophyll content in apples and maples. It has also been correlated to nitrogen status in corn and cotton. Peterson et al., (1993) used a chlorophyll meter to detect nitrogen deficiency in crops and in determining the need for additional nitrogen fertilizer. Efforts to correlate chlorophyll meter measurements to chlorophyll content of mangroves have not been reported. This paper describes the use of a hand-held chlorophyll meter (Minolta SPAD-502) to determine the amount of red mangrove foliar chlorophyll present in the field.
The physiology of mangrove trees with changing climate
Lovelock, Catherine E.; Krauss, Ken W.; Osland, Michael J.; Reef, Ruth; Ball, Marilyn C.; Meinzer, Frederick C.; Niinemets, Ülo
2016-01-01
Mangrove forests grow on saline, periodically flooded soils of the tropical and subtropical coasts. The tree species that comprise the mangrove are halophytes that have suites of traits that confer differing levels of tolerance of salinity, aridity, inundation and extremes of temperature. Here we review how climate change and elevated levels of atmospheric CO2 will influence mangrove forests. Tolerance of salinity and inundation in mangroves is associated with the efficient use of water for photosynthetic carbon gain which unpins anticipated gains in productivity with increasing levels of CO2. We review evidence of increases in productivity with increasing CO2, finding that enhancements in growth appear to be similar to trees in non-mangrove habitats and that gains in productivity with elevated CO2 are likely due to changes in biomass allocation. High levels of trait plasticity are observed in some mangrove species, which potentially facilitates their responses to climate change. Trait plasticity is associated with broad tolerance of salinity, aridity, low temperatures and nutrient availability. Because low temperatures and aridity place strong limits on mangrove growth at the edge of their current distribution, increasing temperatures over time and changing rainfall patterns are likely to have an important influence on the distribution of mangroves. We provide a global analysis based on plant traits and IPCC scenarios of changing temperature and aridity that indicates substantial global potential for mangrove expansion.
Profiling of antioxidant potential and phytoconstituents of Plantago coronopus
Directory of Open Access Journals (Sweden)
C. G. Pereira
Full Text Available Abstract The halophyte species Plantago coronopus has several described ethnomedicinal uses, but few reported biological activities. This work carried out for the first time a comparative analysis of P. coronopus organs in terms of phenolic composition and antioxidant activity of organic and water extracts from roots, leaves and flowers. The leaves contents in selected nutrients, namely amino acids and minerals, are also described. Roots (ethyl acetate and methanol extracts had the highest radical scavenging activity (RSA towards 1,1-diphenyl-2-picrylhydrazyl (DPPH and 2,2’-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid (ABTS radicals, while leaves (hexane extract had higher RSA on nitric oxide radical and iron chelating ability. High performance liquid chromatography (HPLC analysis identified eighteen phenolics from which salicylic acid and epicatechin are here firstly described in Plantago species. Leaves had mineral levels similar to those of most vegetables, proving to be a good source for elements like calcium, sodium, iron and magnesium, and also for several of the essential amino acids justifying it use as food. Our results, especially those regarding the phenolics composition, can explain the main traditional uses given to this plantain and, altogether, emphasize the potential of P. coronopus as a source of bioactive molecules particularly useful for the prevention of oxidative stress-related diseases.
Yang, Hui; Hu, Jinxiang; Long, Xiaohua; Liu, Zhaopu; Rengel, Zed
2016-02-01
The interaction between roots and bacterial communities in halophytic species is poorly understood. Here, we used Jerusalem artichoke cultivar Nanyu 1 (NY-1) to characterise root distribution patterns and determine diversity and abundance of bacteria in the rhizosphere soil under variable salinity. Root growth was not inhibited within the salinity range 1.2 to 1.9 g salt/kg, but roots were mainly confined to 0-20 cm soil layer vertically and 0-30 cm horizontally from the plant centre. Root concentrations of K+, Na+, Mg2+ and particularly Ca2+ were relatively high under salinity stress. High salinity stress decreased soil invertase and catalase activity. Using a next-generation, Illumina-based sequencing approach, we determined higher diversity of bacteria in the rhizosphere soil at high than low salinity. More than 15,500 valid reads were obtained, and Proteobacteria, Acidobacteria, Bacteroidetes and Actinobacteria predominated in all samples, accounting for >80% of the reads. On a genus level, 636 genera were common to the low and high salinity treatments at 0-5 cm and 5-10 cm depth. The abundance of Steroidobacter and Sphingomonas was significantly decreased by increasing salinity. Higher Shannon and Chao 1 indices with increasing severity of salt stress indicated that high salt stress increased diversity in the bacterial communities.
Directory of Open Access Journals (Sweden)
Jiangtao Liu
2016-03-01
Full Text Available Achnatherum splendens is an important forage herb in Northwestern China. It has a high tolerance to salinity and is, thus, considered one of the most important constructive plants in saline and alkaline areas of land in Northwest China. However, the mechanisms of salt stress tolerance in A. splendens remain unknown. Next-generation sequencing (NGS technologies can be used for global gene expression profiling. In this study, we examined sequence and transcript abundance data for the root/leaf transcriptome of A. splendens obtained using an Illumina HiSeq 2500. Over 35 million clean reads were obtained from the leaf and root libraries. All of the RNA sequencing (RNA-seq reads were assembled de novo into a total of 126,235 unigenes and 36,511 coding DNA sequences (CDS. We further identified 1663 differentially-expressed genes (DEGs between the salt stress treatment and control. Functional annotation of the DEGs by gene ontology (GO, using Arabidopsis and rice as references, revealed enrichment of salt stress-related GO categories, including “oxidation reduction”, “transcription factor activity”, and “ion channel transporter”. Thus, this global transcriptome analysis of A. splendens has provided an important genetic resource for the study of salt tolerance in this halophyte. The identified sequences and their putative functional data will facilitate future investigations of the tolerance of Achnatherum species to various types of abiotic stress.
Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea.
Nakahara, Yoshiki; Sawabe, Shogo; Kainuma, Kenta; Katsuhara, Maki; Shibasaka, Mineo; Suzuki, Masanori; Yamamoto, Kosuke; Oguri, Suguru; Sakamoto, Hikaru
2015-01-01
Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1) a novel protein highly homologous to thaumatin-like proteins, (2) a novel coiled-coil protein of unknown function, and (3) a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.
Directory of Open Access Journals (Sweden)
Hidelblandi F. de Melo
2016-02-01
Full Text Available ABSTRACT Atriplex nummularia is a halophyte of great importance in the recovery of saline soils and is considered as a model plant to study biosaline scenarios. This study aimed to evaluate biometric parameters, biomass production and the accumulation of ions in A. nummularia grown under abiotic stresses. Cultivation was carried out in a Fluvic Neosol for 100 days, adopting two water regimes: 37 and 70% of field capacity. Plants were irrigated with saline solutions containing two types of salts (NaCl and a mixture of NaCl, KCl, MgCl2 and CaCl2 at six levels of electrical conductivity: 0, 5, 10, 20, 30 and 40 dS m-1, arranged in a 6 x 2 x 2 factorial with 4 replicates, forming 96 plots. At the end of the experiment, plants were divided into leaves, stem and roots, for the determination of fresh matter (FM, dry matter (DM and estimated leaf area (LA, besides the contents of Ca2+, Mg2+, Na+, K+ and Cl-. The type of salt did not influence plant growth or biomass production; however, it influenced the levels of Ca2+, Mg2+, Na+ and Cl- in the leaves and Mg2+, K+ and Cl- in the roots. Increase in salinity reduced the contents of Ca2+, Mg2+, Na+, K+ and Cl- for all treatments.
Coastal landforms and accumulation of mangrove peat increase carbon sequestration and storage.
Ezcurra, Paula; Ezcurra, Exequiel; Garcillán, Pedro P; Costa, Matthew T; Aburto-Oropeza, Octavio
2016-04-19
Given their relatively small area, mangroves and their organic sediments are of disproportionate importance to global carbon sequestration and carbon storage. Peat deposition and preservation allows some mangroves to accrete vertically and keep pace with sea-level rise by growing on their own root remains. In this study we show that mangroves in desert inlets in the coasts of the Baja California have been accumulating root peat for nearly 2,000 y and harbor a belowground carbon content of 900-34,00 Mg C/ha, with an average value of 1,130 (± 128) Mg C/ha, and a belowground carbon accumulation similar to that found under some of the tallest tropical mangroves in the Mexican Pacific coast. The depth-age curve for the mangrove sediments of Baja California indicates that sea level in the peninsula has been rising at a mean rate of 0.70 mm/y (± 0.07) during the last 17 centuries, a value similar to the rates of sea-level rise estimated for the Caribbean during a comparable period. By accreting on their own accumulated peat, these desert mangroves store large amounts of carbon in their sediments. We estimate that mangroves and halophyte scrubs in Mexico's arid northwest, with less than 1% of the terrestrial area, store in their belowground sediments around 28% of the total belowground carbon pool of the whole region.
Yeast functional screen to identify genes conferring salt stress tolerance in Salicornia europaea
Directory of Open Access Journals (Sweden)
Yoshiki eNakahara
2015-10-01
Full Text Available Salinity is a critical environmental factor that adversely affects crop productivity. Halophytes have evolved various mechanisms to adapt to saline environments. Salicornia europaea L. is one of the most salt-tolerant plant species. It does not have special salt-secreting structures like a salt gland or salt bladder, and is therefore a good model for studying the common mechanisms underlying plant salt tolerance. To identify candidate genes encoding key proteins in the mediation of salt tolerance in S. europaea, we performed a functional screen of a cDNA library in yeast. The library was screened for genes that allowed the yeast to grow in the presence of 1.3 M NaCl. We obtained three full-length S. europaea genes that confer salt tolerance. The genes are predicted to encode (1 a novel protein highly homologous to thaumatin-like proteins, (2 a novel coiled-coil protein of unknown function, and (3 a novel short peptide of 32 residues. Exogenous application of a synthetic peptide corresponding to the 32 residues improved salt tolerance of Arabidopsis. The approach described in this report provides a rapid assay system for large-scale screening of S. europaea genes involved in salt stress tolerance and supports the identification of genes responsible for such mechanisms. These genes may be useful candidates for improving crop salt tolerance by genetic transformation.
Oh, Dongha; Dassanayake, Maheshi; Haas, Jeffrey S.; Kropornika, Anna; Wright, Chris L.; D'Urzo, Matilde Paino; Hong, Hyewon; Ali, Shahjahan; Herná ndez, Á lvaro Gonzalez; Lambert, Georgina M.; Inan, Gü nsu; Galbraith, David; Bressan, Ray Anthony; Yun, Daejin; Zhu, Jian-Kang; Cheeseman, John McP; Bohnert, Hans Jü rgen
2010-01-01
and an uneven distribution of repeat sequences. T. parvula genome structure and DNA sequences were compared with orthologous regions from Arabidopsis and publicly available bacterial artificial chromosome sequences from Thellungiella salsuginea (previously
International Nuclear Information System (INIS)
Rasheed, A.; Hameed, A.; Khan, M.A.; Gul, B.
2015-01-01
Salsola drummondii Ulbr. is a perennial halophyte found in salt deserts of southern Balochistan, Pakistan. Experiments were conducted to study the effects of salinity (0, 200, 400, 600, 800 and 1000 mM NaCl), thermoperiod (10/20, 15/25, 20/30 and 25/35 degree C), light (12-h photoperiod and dark) and dormancy regulating chemicals (DRCs) on germination, recovery and viability of the seeds of S. drummondii. Seeds of S. drummondii germinated quickly in distilled water at different temperature regimes and increases in salinity decreased seed germination. Interestingly, few seeds could even germinate in 1000 mM NaCl treatment, which is about twice as high as seawater salinity. Seeds were partially photoblastic and showed relatively higher germination under 12-h photoperiod than in dark. Seeds showed poor recovery of germination from salinity and particularly when germinated in dark. Germination inhibition at high salinity (800 mM NaCl) under 12-h photoperiod was partially alleviated by the exogenous application of different DRCs, particularly fusicoccin. Moreover, all the DRCs, except GA4+7, ameliorated germination of salt stressed seeds under complete darkness and GA4 and fusicoccin were most effective. Our study shows that seeds of S. drummondii are highly tolerant to salinity and variation in temperature but partially photoblastic nature indicate that seeds will not germinate if buried under the soil. Seed germination under saline conditions can be improved by the use of DRCs particularly by application of fusicoccin. (author)
Huang, Jianzi; Lu, Xiang; Yan, Hao; Chen, Shouyi; Zhang, Wanke; Huang, Rongfeng; Zheng, Yizhi
2012-04-01
Semi-mangroves form a group of transitional species between glycophytes and halophytes, and hold unique potential for learning molecular mechanisms underlying plant salt tolerance. Millettia pinnata is a semi-mangrove plant that can survive a wide range of saline conditions in the absence of specialized morphological and physiological traits. By employing the Illumina sequencing platform, we generated ~192 million short reads from four cDNA libraries of M. pinnata and processed them into 108,598 unisequences with a high depth of coverage. The mean length and total length of these unisequences were 606 bp and 65.8 Mb, respectively. A total of 54,596 (50.3%) unisequences were assigned Nr annotations. Functional classification revealed the involvement of unisequences in various biological processes related to metabolism and environmental adaptation. We identified 23,815 candidate salt-responsive genes with significantly differential expression under seawater and freshwater treatments. Based on the reverse transcription-polymerase chain reaction (RT-PCR) and real-time PCR analyses, we verified the changes in expression levels for a number of candidate genes. The functional enrichment analyses for the candidate genes showed tissue-specific patterns of transcriptome remodelling upon salt stress in the roots and the leaves. The transcriptome of M. pinnata will provide valuable gene resources for future application in crop improvement. In addition, this study sets a good example for large-scale identification of salt-responsive genes in non-model organisms using the sequencing-based approach.
Response of Soil Fungi Community Structure to Salt Vegetation Succession in the Yellow River Delta.
Wang, Yan-Yun; Guo, Du-Fa
2016-10-01
High-throughput sequencing technology was used to reveal the composition and distribution of fungal community structure in the Yellow River Delta under bare land and four kinds of halophyte vegetation (saline seepweed, Angiospermae, Imperata and Apocynum venetum [A. venetum]). The results showed that the soil quality continuously improved with the succession of salt vegetation types. The soil fungi richness of mild-salt communities (Imperata and A. venetum) was relatively higher, with Shannon index values of 5.21 and 5.84, respectively. The soil fungi richness of severe-salt-tolerant communities (saline seepweed, Angiospermae) was relatively lower, with Shannon index values of 4.64 and 4.66, respectively. The UniFrac metric values ranged from 0.48 to 0.67 when the vegetation was in different succession stages. A total of 60,174 valid sequences were obtained for the five vegetation types, and they were classified into Ascomycota, Basidiomycota, Chytridiomycota, Glomeromycota and Mucoromycotina. Ascomycota had the greatest advantage among plant communities of Imperata and A. venetum, as indicated by relative abundances of 2.69 and 69.97 %, respectively. Basidiomycota had the greatest advantage among mild-salt communities of saline seepweed and Angiospermae, with relative abundances of 9.43 and 6.64 %, respectively. Soil physical and chemical properties were correlated with the distribution of the fungi, and Mucor was significantly correlated with soil moisture (r = 0.985; P Soil quality, salt vegetation and soil fungi were influenced by each other.
Stable bromine isotopic composition of methyl bromide released from plant matter
Horst, Axel; Holmstrand, Henry; Andersson, Per; Thornton, Brett F.; Wishkerman, Asher; Keppler, Frank; Gustafsson, Örjan
2014-01-01
Methyl bromide (CH3Br) emitted from plants constitutes a natural source of bromine to the atmosphere, and is a component in the currently unbalanced global CH3Br budget. In the stratosphere, CH3Br contributes to ozone loss processes. Studies of stable isotope composition may reduce uncertainties in the atmospheric CH3Br budget, but require well-constrained isotope fingerprints of the source end members. Here we report the first measurements of stable bromine isotopes (δ81Br) in CH3Br from abiotic plant emissions. Incubations of both KBr-fortified pectin, a ubiquitous cell-stabilizing macromolecule, and of a natural halophyte (Salicornia fruticosa), yielded an enrichment factor (ε) of -2.00 ± 0.23‰ (1σ, n = 8) for pectin and -1.82 ± 0.02‰ (1σ, n = 4) for Salicornia (the relative amount of the heavier 81Br was decreased in CH3Br compared to the substrate salt). For short incubations, and up to 10% consumption of the salt substrate, this isotope effect was similar for temperatures from 30 up to 300 °C. For longer incubations of up to 90 h at 180 °C the δ81Br values increased from -2‰ to 0‰ for pectin and to -1‰ for Salicornia. These δ81Br source signatures of CH3Br formation from plant matter combine with similar data for carbon isotopes to facilitate multidimensional isotope diagnostics of the CH3Br budget.
NASA's GreenLab Research Facility: A Guide for a Self-Sustainable Renewable Energy Ecosystem
Bomani, B. M. McDowell; Hendricks, R. C.; Elbuluk, Malik; Okon, Monica; Lee, Eric; Gigante, Bethany
2011-01-01
There is a large gap between the production and demand for energy from alternative fuel and alternative renewable energy sources. The sustainability of humanity, as we know it, directly depends on the ability to secure affordable fuel, food, and freshwater. NASA Glenn Research Center (Glenn) has initiated a laboratory pilot study on using biofuels as viable alternative fuel resources for the field of aviation, as well as utilizing wind and solar technology as alternative renewable energy resources. The GreenLab Research Facility focuses on optimizing biomass feedstock using algae and halophytes as the next generation of renewable aviation fuels. The unique approach in this facility helps achieve optimal biomass feedstock through climatic adaptation of balanced ecosystems that do not use freshwater, compete with food crops, or use arable land. In addition, the GreenLab Research Facility is powered, in part, by alternative and renewable energy sources, reducing the major environmental impact of present electricity sources. The ultimate goal is to have a 100 percent clean energy laboratory that, when combined with biomass feedstock research, has the framework in place for a self-sustainable renewable energy ecosystem that can be duplicated anywhere in the world and can potentially be used to mitigate the shortage of food, fuel, and water. This paper describes the GreenLab Research Facility at Glenn and its power and energy sources, and provides recommendations for worldwide expansion and adoption of the facility s concept.
Directory of Open Access Journals (Sweden)
José Luis ARREDONDO-FIGUEROA
2011-02-01
Full Text Available The morphometry, sediment and soil chemical characteristics of eleven dry tropical shallow reservoirs situated in Southern Mexican Highlands were studied. The reservoirs are located at 1104 to 1183 meters above sea level in a sedimentary area. Seventeen morphometric and eight sediment and soil chemical parameters were measured. The results of the morphometric parameters showed that these reservoirs presented a soft and roughness bottom, with an ellipsoid form and a concave depression that permit the mix up of water and sediments, causing turbidity and broken thermal gradients; their slight slopes allowed the colonization of submerged macrophyte and halophyte plants and improved the incidence of sunlight on water surface increasing evaporation and primary productivity. Dry tropical shallow reservoirs have fluctuations in area, and volume according to the amount of rainfall, the effect of evaporation, temperature, lost volume for irrigation, and other causes. The sand-clay was the most important sediment texture and their values fluctuated with the flooded periods. The concentration-dilution cycle showed a direct relationship in the percentage of organic matter in the soil as well as with pH, soil nitrogen and phosphorus. El Tilzate, El Candelero and El Movil were related by the shore development and high concentrations of organic matter and nitrogen in the soil. Finally, we emphasize the importance of this study, in relation to possible future changes in morphometrical parameters as a consequence of human impact.
Zhao, Ruifeng; Zhou, Huarong; Qian, Yibing; Zhang, Jianjun
2006-06-01
A total of 16 quadrants of wetlands and surrounding lands in the mid- and lower reaches of Tarim River were surveyed, and the data about the characteristics of plant communities and environmental factors were collected and counted. By using PCA (principal component analysis) ordination and regression procedure, the distribution patterns of plant communities and the relationships between the characteristics of plant community structure and environmental factors were analyzed. The results showed that the distribution of the plant communities was closely related to soil moisture, salt, and nutrient contents. The accumulative contribution rate of soil moisture and salt contents in the first principal component accounted for 35.70%, and that of soil nutrient content in the second principal component reached 25.97%. There were 4 types of habitats for the plant community distribution, i. e., fenny--light salt--medium nutrient, moist--medium salt--medium nutrient, mesophytic--medium salt--low nutrient, and medium xerophytic-heavy salt--low nutrient. Along these habitats, swamp vegetation, meadow vegetation, riparian sparse forest, halophytic desert, and salinized shrub were distributed. In the wetlands and surrounding lands of mid- and lower reaches of Tarim River, the ecological dominance of the plant communities was markedly and unitary-linearly correlated with the compound gradient of soil moisture and salt contents. The relationships between species diversity, ecological dominance, and compound gradient of soil moisture and salt contents were significantly accorded to binary-linear regression model.
Recent saltmarsh foraminiferal assemblages from Iceland
Lübbers, Julia; Schönfeld, Joachim
2018-01-01
This study reports for the first time boreal to subarctic intertidal foraminiferal assemblages from saltmarshes at Borgarnes and Faskrudsfjördur on Iceland. The composition of living and dead foraminiferal assemblages was investigated along transects from the tidal flat to the highest reach of halophytic plants. The foraminiferal assemblages from Borgarnes showed 18 species in the total foraminiferal assemblage of which only 7 species were recorded in the living fauna. The assemblages were dominated by agglutinated taxa, whereas 3 calcareous species were recorded, of which only Haynesina orbicularis was found in the living fauna. The distribution limit of calcifying species corresponds to the lower boundary of the lower saltmarsh vegetation zone. Furthermore, calcareous tests showed many features of dissolution, which is an indication of a carbonate corrosive environment. The species forming the dead assemblages were mainly derived from the ambient intertidal areas and were displaced by tidal currents into the saltmarsh. The foraminiferal assemblages from Faskrudsfjördur showed two species, of which only one species was recorded in the living fauna. The assemblage was dominated by the agglutinated foraminifer Trochaminita irregularis. The foraminiferal species recorded on Iceland were the same as commonly found elsewhere in Europa. Since no species was found which is endemic to North America, Iceland is considered part of the European bio province. The foraminiferal could have been immigrated to Iceland from Europe through warm water currents, migratory birds or marine traffic since the last Ice Age.
A Methodological Approach for Testing the Viability of Seeds Stored in Short-Term Seed Banks
Directory of Open Access Journals (Sweden)
Jose A. FORTE GIL
2017-12-01
Full Text Available Efficient management of ‘active’ seed banks – specifically aimed at the short-term storage at room temperature of seeds to be used locally in conservation/regeneration programmes of endemic or endangered plant species – requires establishing the optimal storage time to maintain high seed viability, for each stored species. In this work, germination of seeds of the halophytes Thalictrum maritimum, Centaurea dracunculifolia and Linum maritimum has been investigated. The seeds had been stored for different periods of time in the seed bank of ‘La Albufera’ Natural Park (Valencia, SE Spain after collection in salt marshes of the Park, where small populations of the three species are present. Seeds of T. maritimum and C. dracunculifolia have a relatively short period of viability at room temperature, and should not be stored for more than three years. On the other hand, L. maritimum seeds maintain a high germination percentage and can be kept at room temperature for up to 10 years. T. maritimum seeds, in contrast to those of the other two species, did not germinate in in vitro tests nor when sown directly on a standard substrate, unless a pre-treatment of the seeds was applied, mechanical scarification being the most effective. These results will help to improve the management of the seed bank, to generate more efficiently new plants for reintroduction and reinforcement of populations of these species in their natural ecosystems within the Natural Park.
The Hausa Lexicographic Tradition
Directory of Open Access Journals (Sweden)
Roxana Ma Newman
2011-10-01
grammatikale inligting, en die toereikendheid van sy definisies en illustratiewemateriaal. 'n Volledige lys van die leksikografiese werke is ingesluit.
Sleutelwoorde: AANLEER VAN TAAL, ARABIES, DIALEKTIESE VARIANTE, DUITS,ENGELS, ETIMOLOGIEË, FONETIESE TRANSKRIPSIE, FONOLOGIE, FRANS, GRAMMATIESEKATEGORIEË, HAUSA, LEENWOORDE, NAAMLYSTE, NEOLOGISMES, NIGER,NIGERIË, ORTOGRAFIE, RUSSIES, STANDAARDDIALEK, STANDAARDISERING,
Floristic changes at Khersan Glacier Territory, Alamkuh Mountain, Central Alborz, North of Iran
Directory of Open Access Journals (Sweden)
KOUROSH KAVOUSI
2016-02-01
Full Text Available Abstract. Kavousi K, Nejadsattari T, Asri Y, Ejtehadi H, Khavari-Nejad RA. 2016. Floristic changes at Khersan Glacier Territory, Alamkuh Mountain, Central Alborz, North of Iran. Biodiversitas 17: 11-15. Extensive investigation in subnival-nival area around Khersan glacier moraine introduced 71 vascular plant species. From this list 43 species have been listed in Noroozi (2001 in “ subnival-nival vascular plant species of Iran : a unique high mountain flora and its threat from climate warming ” and the others are new for subnival- nival area of Iran. Among this plant list 31 species had introduced with Kotschy (1861a,b, Bornmuller (1904, Melchior (1937, Klein (1982, european researchers and the other is named for the first time from Khersan glacier territory. Many species such as Astragalus macrosemius, Pseudocamelina kleinii, Crepis multicaulis subsp. congesta, Didymophysa fedtschenkoana and Draba melanopus due to glacier condition have very sensitive habitat, vulnerable and only gathered from restrict area with conservation value. Vegetation change happened in many nival and subnival area with upward movement in the same habitat and movement from lower altitude at alpine towards summit in subnival and nival. Carex oreophila, Campanula stevenii, Bromus barchystachyus, Oxytropis immersa, Erigeron uniflorus,Trachydium pauciradiatum, Scorzonera radicosa and some other species are surprisingly movement to subnival area and many nival and subnival species such as Didymophysa aucheri, Didymophysa fedtschenkoana, Dracocephalum aucheri and Arabis caucasica have come significantly upward in nival. The movement is different in all side of Khersan glacier moraine in north, south and the east (beside moraine tongue slops and limited with presence of soil natural generation and other ecological remarks. Limitation for soil generation starts at different altitude in northern, southern and eastern slopes of Khersan glacier valley. This study examined
Kewalian Dalam Tasawuf Nusantara
Directory of Open Access Journals (Sweden)
Yunasril Ali
2013-12-01
Full Text Available Abstract : This article discusses the doctrine of Sainthood (al-walāyah which has a strong basis in the Qur’an and adīth and it has been elaborated systematically through Ibn ‘Arabi’s vast and complex teachings. While in the study of Sufism in the archipelago, the term saint (walī has been known along with the spread of Islam began in the archipelago, and it refers to two meanings; as the person who has the occulties as the implications of the sanctity and walī as the ruler of a particular region. Regardless the definition and scope, the true doctrine of sainthood can not be separated from the teaching of the prophetic and apostolic message which implies the human world is not only the physical realm, but there is a metaphysical world that has not been known to human and from which the physical world is controlled.Keywords : saint (walī, miracles, Muhammadan light (Nūr Muhammadi, sainthood, prophethood, seal of the saint Abstrak : Artikel ini mendiskusikan dokrin Kewalian (al-walāyah yang mempunyai basis yang kuat dalam al-Qur’an dan hadis dan isu ini secara sistematis dibahas melalui ajaran Ibn ‘Arabi yang kompleks. Sementara dalam kajian tasawuf di Nusantara, sebutan wali ini sudah mulai dikenal bersamaan dengan masuknya Islam ke negeri ini yang mengacu kepada dua pengertian, wali sebagai orang yang memiliki kesaktian-kesaktian (occulties sebagai implikasi dari kekeramatan dan wali sebagai penguasa wilayah tertentu. Terlepas dari pengertian dan cakupannya, ajaran kewalian yang sesungguhnya tidak lepas dari ajaran tentang kenabian dan kerasulan yang menyiratkan pesan bahwa dunia manusia bukan hanya dunia material yang identik dengan kenikmatan hedonis, tetapi di balik dunia fisik terdapat dunia metafisik yang belum banyak diketahui manusia dan dari sanalah dunia fisik ini dikendalikan.Kata-kata Kunci : wali, karamah, Nur Muhammad, kewalian, kenabian, penutup para wali.
Reducing the time requirement of k-means algorithm.
Osamor, Victor Chukwudi; Adebiyi, Ezekiel Femi; Oyelade, Jelilli Olarenwaju; Doumbia, Seydou
2012-01-01
Traditional k-means and most k-means variants are still computationally expensive for large datasets, such as microarray data, which have large datasets with large dimension size d. In k-means clustering, we are given a set of n data points in d-dimensional space R(d) and an integer k. The problem is to determine a set of k points in R(d), called centers, so as to minimize the mean squared distance from each data point to its nearest center. In this work, we develop a novel k-means algorithm, which is simple but more efficient than the traditional k-means and the recent enhanced k-means. Our new algorithm is based on the recently established relationship between principal component analysis and the k-means clustering. We provided the correctness proof for this algorithm. Results obtained from testing the algorithm on three biological data and six non-biological data (three of these data are real, while the other three are simulated) also indicate that our algorithm is empirically faster than other known k-means algorithms. We assessed the quality of our algorithm clusters against the clusters of a known structure using the Hubert-Arabie Adjusted Rand index (ARI(HA)). We found that when k is close to d, the quality is good (ARI(HA)>0.8) and when k is not close to d, the quality of our new k-means algorithm is excellent (ARI(HA)>0.9). In this paper, emphases are on the reduction of the time requirement of the k-means algorithm and its application to microarray data due to the desire to create a tool for clustering and malaria research. However, the new clustering algorithm can be used for other clustering needs as long as an appropriate measure of distance between the centroids and the members is used. This has been demonstrated in this work on six non-biological data.
DARI ‘ABID AL-JABIRI TENTANG EPISTEMOLOGI ARAB ISLAM
Directory of Open Access Journals (Sweden)
Hasan Mahfudh
2016-12-01
Full Text Available Abstract: To deal with modernity, al-Ja>biri> offered an alternative reading mothods which was then called Qira>'ah mua's}irah (contemporary readings with its characteristics ja'lu al-maqru>' mu'a>s}ir li>nafsih wa mu'a>s}ir lana>. The method is defined into two steps: first, fas}l al-maqru>' 'an al-qa>ri> (subject took distance from the object study to obtain objectivity, second, was}l al-qa> ri> ' an al-maqru> '(the subject has a link himself with the object of study in order to actualize and measure the relevance of the present subject. Furthermore, al-Ja>biri> concluded that Arabic reasoning divided into three epistemological systems, first indication system (baya>ni> epistemology is a system that first appeared in Arab thinking. Nevertheless, al-Ja>biri> considered that this epistemology is strongly influenced by Badui (a'rabi>} so that it is not excessive called as hegemony, thus allowing it to be criticized. Second, 'Irfa>ni> system ('Irfa>ni>’s epistemology} in which knowledge is acquired through God exposure to His slaves (Kashf} after the spiritualists (riya>d}ah. Departing from here, al-Ja>biri> actually scientific obtained in this way failing to provide a convincing conclusion. Third, the burha>ni’s system (burha>ni> epistemology in which al-Ja>biri> is very skewed vision him- emphasized the innate potential source of knowledge is reasonable. Nevertheless, there are opposition who judge that al-Ja>biri> inconsistency against his own behavior, one hand he refused Marxist reading style of tura>ts, but on the other hand, the way he criticized 'Irfa> ni> and prioritized Burhani, then it is considered to be Marxist models. However, there are some scientists who considered that the discovery of al-Ja>biri> is one form of methodological revolution in reading tura> ts, the readings epistemologically useful to articulate the gap tradition (tura> ts and modernity. Keywords: Tradisi (Tura>th, Qira>’ah Mu’as}irah, Baya>ni>, Burha>ni> dan
Sun, Ning; Deng, Congliang; Zhao, Xiaoli; Zhou, Qi; Ge, Guanglu; Liu, Yi; Yan, Wenlong; Xia, Qiang
2014-02-01
In this study, a nucleic acid extraction method based on silica-coated magnetic particles (SMPs) and RT-qPCR assay was developed to detect Arabis mosaic virus (ArMV), Lily symptomless virus (LSV), Hop stunt viroid (HSVd) and grape yellow speckle viroid 1 (GYSVd-1). The amplification sequences of RT-qPCR were reversely transcribed in vitro as RNA standard templates. The standard curves covered six or seven orders of magnitude with a detection limit of 100 copies per each assay. Extraction efficiency of the SMPs method was evaluated by recovering spiked ssRNAs from plant samples and compared to two commercial kits (TRIzol and RNeasy Plant mini kit). Results showed that the recovery rate of SMPs method was comparable to the commercial kits when spiked ssRNAs were extracted from lily leaves, whereas it was two or three times higher than commercial kits when spiked ssRNAs were extracted from grapevine leaves. SMPs method was also used to extract viral nucleic acid from15 ArMV-positive lily leaf samples and 15 LSV-positive lily leaf samples. SMPs method did not show statistically significant difference from other methods on detecting ArMV, but LSV. The SMPs method has the same level of virus load as the TRIzol, and its mean virus load of was 0.5log10 lower than the RNeasy Plant mini kit. Nucleic acid was extracted from 19 grapevine-leaf samples with SMPs and the two commercial kits and subsequently screened for HSVd and GYSVd-1 by RT-qPCR. Regardless of HSVd or GYSVd-1, SMPs method outperforms other methods on both positive rate and the viroid load. In conclusion, SMPs method was able to efficiently extract the nucleic acid of RNA viruses or viroids, especially grapevine viroids, from lily-leaf or grapevine-leaf samples for RT-qPCR detection. Copyright © 2013 Elsevier B.V. All rights reserved.
Mangrove expansion and saltmarsh decline at mangrove poleward limits
Saintilan, Neil; Wilson, Nicholas C.; Rogers, Kerrylee; Rajkaran, Anusha; Krauss, Ken W.
2014-01-01
Mangroves are species of halophytic intertidal trees and shrubs derived from tropical genera and are likely delimited in latitudinal range by varying sensitivity to cold. There is now sufficient evidence that mangrove species have proliferated at or near their poleward limits on at least five continents over the past half century, at the expense of salt marsh. Avicennia is the most cold-tolerant genus worldwide, and is the subject of most of the observed changes. Avicennia germinans has extended in range along the US Atlantic coast and expanded into salt marsh as a consequence of lower frost frequency and intensity in the southern USA. The genus has also expanded into salt marsh at its southern limit in Peru, and on the Pacific coast of Mexico. Mangroves of several species have expanded in extent and replaced salt marsh where protected within mangrove reserves in Guangdong Province. In south-eastern Australia, the expansion of Avicennia marina into salt marshes is now well documented, and Rhizophora stylosa has extended its range southward, while showing strong population growth within estuaries along its southern limits in northern New South Wales. Avicennia marina has extended its range southwards in South Africa. The changes are consistent with the pole-ward extension of temperature thresholds co-incident with sea-level rise, although the specific mechanism of range extension might be complicated by limitations on dispersal or other factors. The shift from salt marsh to mangrove dominance on subtropical and temperate shorelines has important implications for ecological structure, function, and global change adaptation.
Jiang, Jiang; DeAngelis, Donald L.; Anderson, Gordon H.; Smith, Thomas J.
2014-01-01
Coastal mangrove–freshwater marsh ecotones of the Everglades represent transitions between marine salt-tolerant halophytic and freshwater salt-intolerant glycophytic communities. It is hypothesized here that a self-reinforcing feedback, termed a “vegetation switch,” between vegetation and soil salinity, helps maintain the sharp mangrove–marsh ecotone. A general theoretical implication of the switch mechanism is that the ecotone will be stable to small disturbances but vulnerable to rapid regime shifts from large disturbances, such as storm surges, which could cause large spatial displacements of the ecotone. We develop a simulation model to describe the vegetation switch mechanism. The model couples vegetation dynamics and hydrologic processes. The key factors in the model are the amount of salt-water intrusion into the freshwater wetland and the passive transport of mangrove (e.g., Rhizophora mangle) viviparous seeds or propagules. Results from the model simulations indicate that a regime shift from freshwater marsh to mangroves is sensitive to the duration of soil salinization through storm surge overwash and to the density of mangrove propagules or seedlings transported into the marsh. We parameterized our model with empirical hydrologic data collected from the period 2000–2010 at one mangrove–marsh ecotone location in southwestern Florida to forecast possible long-term effects of Hurricane Wilma (24 October 2005). The model indicated that the effects of that storm surge were too weak to trigger a regime shift at the sites we studied, 50 km south of the Hurricane Wilma eyewall, but simulations with more severe artificial disturbances were capable of causing substantial regime shifts.
International Nuclear Information System (INIS)
RIZK, M.A.
2010-01-01
This study aims to investigate the behaviour of cation uptake by Pakistani barley (genotype PK-30163) as affected by saline irrigation water, as well as cation distribution within the soil profile. This experiment was carried out at Soil and Water Research Department, Nuclear Research Centre, Atomic Energy Authority, Inshas, Egypt. The soil was transferred from Wadi Sudr (South Sinai, Egypt). It is salted affected soil (calcareous soil, EC = 4.3 dS/m) and was irrigated using ground water irrigation (12.5 dS/m). Nine used lysimeters were irrigated with three artificial saline water (0.3, 4 and 8 dS/m) using drip irrigation system. The irrigation schedule was carried out using neutron scattering technique according to the hydro physical properties of the soil. Pakistani barley (halophytic plant) was used to remove salts from the soil especially sodium cations. The cation uptake and cation distribution (Na, K, Ca, Mg) within the soil profile were studied.The data indicated that roots of barley collected within 0-15 cm layer showed high cation uptake that made the salt concentrations in this layer low. Sodium uptake ratio was 43, 37 and 47% from total cation uptake by using fresh water (0.3 dS/m), 4 and 8 dS/m, respectively. The maximum uptake for Na, K, Ca and Mg was 20.51, 19.13, 3.98 and 12.81 g/lys at 5.69, 3.05, 6.56 and 4.15 dS/m, respectively. It was found that Pakistani barley preferred Mg uptake rather than Ca uptake.
Directory of Open Access Journals (Sweden)
Maryam Safdarian
2017-06-01
Full Text Available Introduction: Halophiles and halotolerant microorganisms are some of the extremophiles that are able to grow in medium containing sodium chloride and have adapted to life in salinity environments. Halophiles bacteria in saline soils by maintaining the food chain, decomposition of organic matter and improvement of soil structure and fertility improve soil conditions. Materials and methods: In order to isolate the halotoletant bacteria, from the halophyte rhizosphere, four desert areas in Golestan province were sampled. To check the Extremophile of isolates, their resistance was tested for resistant to salinity, drought, temperature and PH. Also, plant growth promoting traits were measured. Results: Fromforty-five strains which were isolated, three strains (G3, G6 and G14 have demonstrated the ability of resistance to 35% salt. Isolates G6 and G3 phosphate solubiliziation power of 301 and 201 ppm, respectively. Isolated G6 micrograms produced auxin 20/7 Mg/ ml. G14 and G6 grow at 50 °C, pH = 10 and osmotic potential -0 /7MPa. While G3 strain grows at 50 °C, pH = 7/ 5 and osmotic potential -0/49. The three strains of the bacterial genera Bacillus and Pseudomonas, respectively. Discussion and conclusion: In this study, isolates due to the growth in concentrations of salt and saturated salt tolerance of extreme environmental conditions and are likely halotolerant or halophile bacteria and its potential for use in various fields of biotechnology including biotech, industrial enzyme production and biological fertilizers for saline soil improvement.
Soils and Vegetation of the Khaipudyr Bay Coast of the Barents Sea
Shamrikova, E. V.; Deneva, S. V.; Panyukov, A. N.; Kubik, O. S.
2018-04-01
Soils and vegetation of the coastal zone of the Khaipudyr Bay of the Barents Sea have been examined and compared with analogous objects in the Karelian coastal zone of the White Sea. The environmental conditions of these two areas are somewhat different: the climate of the Khaipudyr Bay coast is more severe, and the seawater salinity is higher (32-33‰ in the Khaipudyr Bay and 25-26‰ in the White Sea). The soil cover patterns of both regions are highly variable. Salt-affected marsh soils (Tidalic Fluvisols) are widespread. The complicated mesotopography includes high geomorphic positions that are not affected by tidal water. Under these conditions, zonal factors of pedogenesis predominate and lead to the development of Cryic Folic Histosols and Histic Reductaquic Cryosols. On low marshes, the concentrations of soluble Ca2+, K+ + Na+, Cl-, and SO2- 4 ions in the soils of the Khaipudyr Bay coast are two to four times higher than those in the analogous soils of Karelian coast. Cluster analysis of a number of soil characteristics allows separation of three soils groups: soils of low marshes, soils of middle-high marshes, and soils of higher positions developing under the impact of zonal factors together with the aerial transfer and deposition of seawater drops. The corresponding plant communities are represented by coastal sedge cenoses, forb-grassy halophytic cenoses, and zonal cenoses of hypoarctic tundra. It is argued that the grouping of marsh soils in the new substantivegenetic classification system of Russian soils requires further elaboration.
Dynamic control of osmolality and ionic composition of the xylem sap in two mangrove species.
López-Portillo, Jorge; Ewers, Frank W; Méndez-Alonzo, Rodrigo; Paredes López, Claudia L; Angeles, Guillermo; Alarcón Jiménez, Ana Luisa; Lara-Domínguez, Ana Laura; Torres Barrera, María Del Carmen
2014-06-01
• Premise of the study: Xylem sap osmolality and salinity is a critical unresolved issue in plant function with impacts on transport efficiency, pressure gradients, and living cell turgor pressure, especially for halophytes such as mangrove trees.• Methods: We collected successive xylem vessel sap samples from stems and shoots of Avicennia germinans and Laguncularia racemosa using vacuum and pressure extraction and measured their osmolality. Following a series of extractions with the pressure chamber, we depressurized the shoot and pressurized again after various equilibration periods (minutes to hours) to test for dynamic control of osmolality. Transpiration and final sap osmolality were measured in shoots perfused with deionized water or different seawater dilutions.• Key results: For both species, the sap osmolality values of consecutive samples collected by vacuum extraction were stable and matched those of the initial samples extracted with the pressure chamber. Further extraction of samples with the pressure chamber decreased sap osmolality, suggesting reverse osmosis occurred. However, sap osmolalities increased when longer equilibration periods after sap extraction were allowed. Analysis of expressed sap with HPLC indicated a 1:1 relation between measured osmolality and the osmolality of the inorganic ions in the sap (mainly Na + , K + , and Cl - ), suggesting no contamination by organic compounds. In stems perfused with deionized water, the sap osmolality increased to mimic the native sap osmolality.• Conclusions: Xylem sap osmolality and ionic contents are dynamically adjusted by mangroves and may help modulate turgor pressure, hydraulic conductivity, and water potential, thus being important for mangrove physiology, survival, and distribution. © 2014 Botanical Society of America, Inc.
Bencherif, Karima; Boutekrabt, Ammar; Fontaine, Joël; Laruelle, Fréderic; Dalpè, Yolande; Sahraoui, Anissa Lounès-Hadj
2015-11-15
Soil salinization is an increasingly important problem in many parts of the world, particularly under arid and semi-arid areas. Unfortunately, the knowledge about restoration of salt affected ecosystems using mycorrhizae is limited. The current study aims to investigate the impact of salinity on the microbial richness of the halophytic plant Tamarix articulata rhizosphere. Soil samples were collected from natural sites with increasing salinity (1.82-4.95 ds.m(-1)). Six arbuscular mycorrhizal fungi (AMF) species were isolated from the different saline soils and identified as Septoglomus constrictum, Funneliformis mosseae, Funneliformis geosporum, Funneliformis coronatum, Rhizophagus fasciculatus, and Gigaspora gigantea. The number of AMF spores increased with soil salinity. Total root colonization rate decreased from 65 to 16% but remained possible with soil salinity. Microbial biomass in T. articulata rhizosphere was affected by salinity. The phospholipid fatty acids (PLFA) C16:1ω5 as well as i15:0, a15:0, i16:0, i17:0, a17:0, cy17:0, C18:1ω7 and cy19:0 increased in high saline soils suggesting that AMF and bacterial biomasses increased with salinity. In contrast, ergosterol amount was negatively correlated with soil salinity indicating that ectomycorrhizal and saprotrophic fungal biomasses were reduced with salinity. Our findings highlight the adaptation of arbuscular and bacterial communities to natural soil salinity and thus the potential use of mycorrhizal T. articulata trees as an approach to restore moderately saline disturbed arid lands. Copyright © 2015 Elsevier B.V. All rights reserved.
Gargouri, Manel; Hamed, Houda; Akrouti, Amel; Christian, Magné; Ksouri, Riadh; El Feki, Abdelfattah
2017-11-01
Lead (Pb) is a very toxic metal present in the environment, causing disturbances of several functions. Preventive or curative effects of halophytic plants against these disorders may be a promising and safe therapeutic strategy. Thus, this study was designed to evaluate in vivo immunomodulatory and antioxidant effects of Sarcocornia perennis extract (Sp) against lead toxicity in rats. Groups of six animals each were treated with plant extract (via food), 6 g/L lead acetate (via drinking water) or a combination of both. At the end of the three-week period, rat exposure to lead caused reduction of liver weight but an increase of that of kidney. Moreover, lead intoxication-induced oxidative stress manifested by significant increases of inflammatory cytokines (except IL-10) and lipid peroxidation (TBARS), compared with the control group. Meanwhile, interleukin-10 (IL-10) and glutathione levels (GSH), as well as antioxidant activities of superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPx), were decreased. Considering liver and renal markers, lead treatment induced a significant increase in the activities of aminotransferases (AST, ALT), and in the levels of urea, creatinine and phosphorous, whereas total plasma protein, albumin and calcium levels were significantly decreased. S. perennis extract alone did not induce any significant changes in hepatic or renal markers, whereas the antioxidant markers were significantly increased. S. perennis supplementation significantly reduced the lead-induced elevation of serum IL-1ß, IL-6, TNF-α, IFN-γ and TBARS but increased the IL-10 and antioxidant enzyme activities. Overall, plant components ameliorated hepatorenal damages caused by lead.
Arzaluz, I O; Jones, R W
2001-12-01
The phenology and ecology of Hibiscus pernambucensis Arruda and its interaction and importance in maintaining populations of the boll weevil, Anthonomus grandis Boheman, were studied over a period of 3 yr in the Soconusco Region of the state of Chiapas, Mexico. H. pernambucensis is a small tree of Neotropical distribution, restricted to lowland areas, and generally associated with halophytic vegetation. This species is found exclusively along the shores of brackish estuaries, in or near mangrove swamps in southeastern Mexico. In this region, H. pernambucensis has a highly seasonal flowering pattern in which the greatest bud production occurs shortly after the start of the rainy season in May and the highest fruit production occurs in July and August. Boll weevil larvae were found in buds of H. pernambucensis during all months but February and densities of buds and weevils were highest from May through September. The percentage of buds infested with boll weevil larvae rarely exceeded 30%. Because plant densities and reproductive output of H. pernambucensis is relatively low and, consequently, the number of oviposition and larval development sites for boll weevils is limited, the importance of this plant as a source of boll weevils with potential of attacking commercial cotton is minimal in comparison with the quantity produced in cultivated cotton. However, the plant could be important as a reservoir of boll weevils in areas of boll weevil quarantine and eradication programs. The factors and circumstances that may have led to this apparent recent host shift of the boll weevil in this region are discussed.
Origins of mineral matter in peat marsh and peat bog deposits, Spain
Energy Technology Data Exchange (ETDEWEB)
Lopez-Buendia, A.M. [Unidad Tecnica del Marmol, AIDICO, Cami de Castella, 4, 03660 Novelda, Alicante (Spain); Whateley, M.K.G. [Rio Tinto Technical Services, Castlemead, Lower Castlemead, BS99 7YR Bristol (United Kingdom); Bastida, J.; Urquiola, M.M. [Dpto. Geologia, Univ. Valencia, Dr. Moliner 50. 46100 Burjasot, Valencia (Spain)
2007-07-02
The mineralogy of three back-barrier peat marshes (Torreblanca, Benicasim and Moncofar marshes) from Eastern Spain and one peat bog (Orihuela del Tremedal bog) from central east Spain have been investigated, using X-ray diffraction (XRD) and scanning electronic microscope (SEM) techniques. A combination of XRD methods was used to quantify the mineralogy of dried bulk peat samples. The water source in the peat marshes is both continental and marine. Water is highly mineralised. Water flow is both low and slow (accumulative system). The water source in the peat bog is continental, draining from the hill. The higher concentration of ions in the water of the back-barrier peat marshes leads to a higher concentration of authigenic minerals in the peat marshes compared to the peat bog. Three main mineral origins have been recognized, namely: detrital, syngenetic-epigenetic and biogenic. The more important contribution comes from the detrital system. Biogenic and bio-influenced minerals are the main non-detrital minerals in the peatlands. This paper discusses the biogenic origin of halite (and other minor halides and sulphates, such as, sylvite, carnalite, epsomite, glauberite, mirabilite and anhydrite?) from halophytic plants, as well as amorphous silica (opal-A) from sponge spicules and phytoliths of several plants. Pyrite in the peat bog has both syngenetic and epigenetic origins from plant decomposition and sulphur release. In the peat marsh the pyrite has a syngenetic origin from sulphate reduction (S{sub sulphate} {yields} S{sub pyritic}), and an epigenetic origin in the older peat, from plant decomposition (S{sub organic} {yields} S{sub pyritic}). (author)
Santos, D.; Duarte, B.; Caçador, I.
2015-12-01
The increasing metal pollution in salt marshes and its influence on the plants that inhabit these ecosystems, has become a major concern with serious implications on the species establishment. Juncus acutus is a highly common halophyte specie in Portuguese marshes. Seeds from his specie were exposed to a range of different Cd concentrations (0.05, 0.1, 0.5 and 1 μM) in order to evaluate the effects of acute Cd stress on seed germination and growth as well as on seedling pigment composition, photosynthetic apparatus and oxidative stress biomarkers. Seedling length was higher than in control in every Cd treatment, however biomass showed a decrease. It was also observed that increasing Cd treatments, lead to a proportional increase in the Cd tissue concentration. Also the Cd-substituted chlorophylls showed an increase with increasing Cd doses that were applied. This substitution results in a non-functional chlorophyll molecule, highly unstable under moderate light intensities which inevitably reduces the efficiency of the LHC II. As consequence, there was a decrease in the use-efficiency of the harvested energy, leading to a decay in the photosynthetic capacity and energy accumulation, which was dissipated as heat. As for the antioxidant enzymes, SOD and APX presented higher activity, responding to increasing cadmium concentrations. Thus, becomes evident that Cd affects negatively, both biochemically and photochemically, the establishment by seed process of J. acutus highlighting the potential of the use of this specie seed as potential sentinel and ecotoxicity test in extreme conditions.
Signatures of Biogeomorphic Feedbacks in Salt-Marsh Systems
D'Alpaos, Andrea; Marani, Marco
2015-04-01
Salt-marsh ecosystems which play a large role in the bio-geomorphological evolution of intertidal areas. Dense stands of halophytic vegetations which populate salt marshes largely control the dynamics of these ecosystems influencing marsh hydrodynamics and sediment transport through enhanced flow resistance and settling, and direct particle capture by plant stems. Moreover, plants are also known to increase vertical accretion through direct organic accretion. Field evidence and the results of biomorphodynamic models indeed show that the interplay between physical and biological processes generates some striking biological and morphological patterns at different scales. One such pattern, vegetation zonation, consists in a mosaic of vegetation patches, of approximately uniform composition, displaying sharp transitions in the presence of extremely small topographic gradients. Here we develop a two-dimensional model which describes the mutual interaction and adjustment between tidal flows, sediment transport and morphology mediated by vegetation influence. The model allows us describe the coupled evolution of marsh platforms and channel networks cutting through them. A number of different scenarios were modelled to analyze the changes induced in bio-geomorphic patterns by plants with different characteristics, within marshes characterized by different drainage densities, or subjected to changing environmental forcing such as rates of relative sea level rise and sediment supply. Model results emphasize that zonation patterns are a signature of bio-geomorphic feedbacks with vegetation acting as a landscape constructor which feeds back on, directly alters, and contributes to shape tidal environments. In addition, model results show that biogeomorphic feedbacks critically affect the response and the resilience of salt-marsh landscapes to changes in the environmental forcing.
Ruiz, Karina B.; Cicatelli, Angela; Guarino, Francesco; Jacobsen, Sven-Erik; Biondi, Stefania; Castiglione, Stefano
2017-04-01
Quinoa (Chenopodium quinoa Willd), an ancient Andean halophytic seed crop, exhibits exceptional resistance to salinity, drought, and cold. Consistent with the notion that such a resilient plant is likely to tolerate toxic levels of heavy metals as well and could, therefore, be employed for the clean-up of polluted soil (via phytoextraction or phytostabilization), the species' ability to take up, translocate, and tolerate chromium (CrIII) was investigated in a greenhouse pot experiment. A cultivar adapted to European conditions (cv. Titicaca) was grown on soil spiked with 500 mg kg-1 DW of Cr(NO3)3•9H2O, combined (or not) with 150 mM NaCl, or on soil grown with 150 mM NaCl alone. Plants were grown up to maturity (four months after sowing), and then plant biomass and concentrations of Na, Cr, and other elements (e.g., Fe and P) were evaluated in the plant organs. Soil Cr content (total and available fractions) was analysed at the start of the experiment, one week after the last addition of Cr and/or NaCl, and at the end of the trial. No visible toxic effects were observed under the different culture conditions. Results revealed that Cr was mainly accumulated in roots, while Na+ was translocated to the aerial parts. In order to compare plant stress responses under the different treatments (Cr, NaCl, Cr+NaCl), expression levels of several stress-related genes, together with those of a potential Cr transporter, were determined by quantitative real-time RT-PCR.
Zhou, C; Ma, Z Y; Zhu, L; Guo, J S; Zhu, J; Wang, J F
2015-12-17
The stress phytohormone abscisic acid (ABA) plays pivotal roles in plants' adaptive responses to adverse environments. Molybdenum cofactor sulfurases influence aldehyde oxidase activity and ABA biosynthesis. In this study, we isolated a novel EsMcsu1 gene encoding a molybdenum cofactor sulfurase from Eutrema salsugineum. EsMcus1 transcriptional patterns varied between organs, and its expression was significantly upregulated by abiotic stress or ABA treatment. Alfalfa plants that overexpressed EsMcsu1 had a higher ABA content than wild-type (WT) plants under drought stress conditions. Furthermore, levels of reactive oxygen species (ROS), ion leakage, and malondialdehyde were lower in the transgenic plants than in the WT plants after drought treatment, suggesting that the transgenic plants experienced less ROS-mediated damage. However, the expression of several stress-responsive genes, antioxidant enzyme activity, and osmolyte (proline and total soluble sugar) levels in the transgenic plants were higher than those in the WT plants after drought treatment. Therefore, EsMcsu1 overexpression improved drought tolerance in alfalfa plants by activating a series of ABA-mediated stress responses.
International Nuclear Information System (INIS)
Charbaji, T.; Arabi, M.I.; Jawhar, M.
2000-02-01
Seeds of two barley White Arabi (WA) Pakistani PK30163 (PK) were irradiated with three doses 0,15 and 20 Gy of gamma irradiation. Then they were cultured on (Coic-Lesaint) nutrient media containing several concentrations of NaCl (0, 10, 50, and 100 mmol). The irradiation doses did not affect the shoot growth of plants, whereas the combination between 15 Gy and 50 and 100 mmol NaCl decreased significantly the root growth. Doses of 0 and 20 Gy and 10 mmol NaCl had a positive effect on WA variety wet weight. The 20 Gy and 10 and 50 mmol NaCl significantly reduced the wet weight of PK variety. Dry weight of WA variety was decreased, when the seeds were irradiated by 15 Gy and cultured on media containing 10 and 50 mmol NaCl. WA and PK content of Ca ++ increased when weeds were irradiated by 15 Gy (WA) and 20 Gy (PK) and grown on media containing 10 mmol NaCl. The content of Mg ++ and K ++ of 2 varieties were increased, when seeds were cultured on media containing 10 mmol NaCl. Positive relationship was noticed between Na + and Cl - contents and NaCl concentrations in the media. The NaCl concentrations correlated with the irradiation, negatively effected the total N % of the WA variety, whereas in the absence of irradiation, 10 and 50 mmol NaCl had a positive effect on the total N % of PK variety. Similar effects were produced for the last variety with the dose of 15 Gy and NaCl concentrations in the media. Concentration of 100 mmol NaCl positively affect PO4 -- of unirradiated WA variety, but PO -- of all plants of PK variety was increased with 10 and 50 mmol NaCl. The content of SO4 -- of 2 varieties was increased, when the seeds were exposed to the irradiation of 15 and 20 Gy and cultured on a media containing 10 and 50 mmol NaCl. The ratio of Na/Cl, was generally different from 1 and the Cl - content was higher than Na + content, in seedlings of both barley varieties. (author)
Energy Technology Data Exchange (ETDEWEB)
Charbaji, T; Arabi, M I; Jawhar, M [Atomic Energy Commission, Damascus (Syrian Arab Republic). Dept. of Agriculture
2000-02-01
Seeds of two barley White Arabi (WA) Pakistani PK30163 (PK) were irradiated with three doses 0,15 and 20 Gy of gamma irradiation. Then they were cultured on (Coic-Lesaint) nutrient media containing several concentrations of NaCl (0, 10, 50, and 100 mmol). The irradiation doses did not affect the shoot growth of plants, whereas the combination between 15 Gy and 50 and 100 mmol NaCl decreased significantly the root growth. Doses of 0 and 20 Gy and 10 mmol NaCl had a positive effect on WA variety wet weight. The 20 Gy and 10 and 50 mmol NaCl significantly reduced the wet weight of PK variety. Dry weight of WA variety was decreased, when the seeds were irradiated by 15 Gy and cultured on media containing 10 and 50 mmol NaCl. WA and PK content of Ca{sup ++} increased when weeds were irradiated by 15 Gy (WA) and 20 Gy (PK) and grown on media containing 10 mmol NaCl. The content of Mg{sup ++} and K{sup ++} of 2 varieties were increased, when seeds were cultured on media containing 10 mmol NaCl. Positive relationship was noticed between Na{sup +} and Cl{sup -} contents and NaCl concentrations in the media. The NaCl concentrations correlated with the irradiation, negatively effected the total N % of the WA variety, whereas in the absence of irradiation, 10 and 50 mmol NaCl had a positive effect on the total N % of PK variety. Similar effects were produced for the last variety with the dose of 15 Gy and NaCl concentrations in the media. Concentration of 100 mmol NaCl positively affect PO4{sup --} of unirradiated WA variety, but PO{sup --} of all plants of PK variety was increased with 10 and 50 mmol NaCl. The content of SO4{sup --} of 2 varieties was increased, when the seeds were exposed to the irradiation of 15 and 20 Gy and cultured on a media containing 10 and 50 mmol NaCl. The ratio of Na/Cl, was generally different from 1 and the Cl{sup -} content was higher than Na{sup +} content, in seedlings of both barley varieties. (author)
Detection of viruses in olive trees in Croatian Istria
Directory of Open Access Journals (Sweden)
Marta LUIGI
2011-05-01
Full Text Available Normal 0 14 false false false IT ZH-TW X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabella normale"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Following identification of four viruses in a general survey of olive trees throughout Croatia, a detailed survey was conducted in 2009 in the field collection of the Institute of Agriculture and Tourism in Poreč (an important reservoir of Istrian native olive germplasm in order to evaluate the sanitary status of the most important Croatian Istria olive cultivars. Twenty five samples from symptomatic or symptomless trees were collected from five autochthonous and four exotic cultivars. All the samples were tested by RT-PCR for the presence of: Olive leaf yellowing associated virus (OLYaV, Cherry leaf roll virus (CLRV, Strawberry latent ring spot virus (SLRSV, Arabis mosaic virus (ArMV, Olive latent virus-1 (OLV-1, Cucumber mosaic virus (CMV, Olive latent virus-2 (OLV-2 and Tobacco necrosis virus D (TNV-D. Six of the 25 plants were found positive to CLRV; all infected plants showed leaf and fruit deformation and leaf yellowing. Four positive samples were from the native cv. Buža whereas the other two were from two exotic cultivars: Ascolana tenera and Frantoio. The presence of CLRV, either in native or imported plants, highlights the importance of strict phytosanitary regulations to prevent incursion of key
Cihan-ı Islam: A Journal Published as Propaganda During the First World War
Directory of Open Access Journals (Sweden)
Mehmet ÇANLI
2017-12-01
Full Text Available The Cihan-Islam Journal which started its publication life as part of Cemiyet-i Hayriye-i İslamiye (Hayriye-i İslamiye Community was published for propaganda reasons in the pre-First World War period. The Teşkilat-ı Mahsusa which was the intelligence organization of the Ottoman Empire financially supported and directed this journal and was also under the audition of the Ittihadists. The aim of publishing this journal was to raise awareness of the Muslim public living in India, Egypt and Iran which was under the occupation of the British Empire and to prevent the propaganda made against the Ottoman Empire by the British. The owner of this journal was Ebu Saidü’lArabi who was a leading figure among the Indian Muslims and an important person of the Teşkilat- Mahsusa. The journal was published in Istanbul from 9 April 1914 to October 1915. It continued to be published in Bağdat after this peroid. In this study the copies of the journal published in Istanbul have been examined and evaluated. The journal was published once a week starting in April, but as World War 1 broke out it was not published regularly. Only twenty-five copies could be obtained from the archives and libraries in Türkiye. The 25 copies of this journal was examined and evaluated in form and content. The headings of the news and arcticles in the journals have been given in the footnotes and the statistical quantity and evaluation of some of the news and articles have also been done. As a result of the changing policies in the course of the war, the founder and owner of the journal Ebu Said and The Teşkilat-Mahsusa or some Ittihadists had some conflicts of ideas. For this reason, the journal was attempted to be taken out of the hands of Ebu Said but this attempt failed. The journal began to be published in Bağdat starting from January 1916 because of these conflicts. The Uhuvvet Newspaper was published in Istanbul dating from November 1915 to function as this journal.
International Nuclear Information System (INIS)
Rayan, A M; Farghali, K A
2007-01-01
Under natural drought, some physiological parameters were measured in some wild species inhabiting the western desert of Egypt. Seasonal changes of nitrogen metabolites and Na/K ratio were detected in the investigated species. Effect of seasons, species, and their interaction played an important role on total free amino acids, soluble proteins and Na/K ratio at two oases (Dakhla and Kharga). Species diversity showed more effective variable in regulating such metabolites at Kharga oasis. Plants responded to their environment in two ways, either by increasing their water binding molecules or by preventing the formation of amino acids into proteins. Some of the halophytic and xerophytic species may adjust osmotically to stress by the contribution of nitrogen metabolites. On the other hand, Zygophyllum coccineum, the succulent plant, may adapt to environmental conditions through the accumulation of free amino acids. Correlation analysis between Na+/K+ ratio with free amino acids, soluble proteins and water content in Tamarix aphylla, Salsola imbricata, Balanites aegyptiaca, Trichodesma africanum, and Z. coccineum (Kharga) indicated changes in ionic fraction or accumulating soluble organic compounds which were osmotically active and contribute to osmotic adjustment. Correlations were found between chlorophyll content, ionic and nitrogen metabolites. In Acacia nilotica, Suaeda monoica and Z. coccineum at Dakhla oasis, changes in soluble proteins or ionic ratio could be caused by chlorophyll response to stress, while S. imbricata and T. aphylla may control cellular protein contents. On the other hand, the sharing of both free amino acids and ionic fraction may play an important role of osmoregulation in S. imbricata, Citrullus colocynthis and Z. coccineum at Kharga oasis. (author)
Salt tolerant green crop species for sodium management in space agriculture
Yamashita, Masamichi; Hashimoto, Hirofumi; Tomita-Yokotani, Kaori; Shimoda, Toshifumi; Nose, Akihiro; Space Agriculture Task Force, J.
Ecological system and materials recycling loop of space agriculture are quite tight compared to natural ecological system on Earth. Sodium management will be a keen issue for space agricul-ture. Human nutritional requirements include sodium salt. Since sodium at high concentration is toxic for most of plant growth, excreted sodium of human waste should be removed from compost fertilizer. Use of marine algae is promising for harvesting potassium and other min-erals required for plant growth and returning remained sodium to satisfy human need of its intake. Farming salt tolerant green crop species is another approach to manage sodium problem in both space and terrestrial agriculture. We chose ice plant and New Zealand spinach. These two plant species are widely accepted green vegetable with many recipe. Ice plant can grow at the salinity level of sea water, and contain sodium salt up to 30% of its dry mass. Sodium distributes mainly in its bladder cells. New Zealand spinach is a plant species found in the front zone of sea shore, and tolerant against high salinity as well. Plant body size of both species at harvest is quite large, and easy to farm. Capability of bio-remediation of high saline soil is examined with ice plant and New Zealand spinach. Incubation medium was chosen to contain high concentration of sodium and potassium at the Na/K ratio of human excreta. In case Na/K ratio of plant body grown by this medium is greatly higher than that of incubation medium or soil, these halophytes are effective to remediate soil for farming less tolerant plant crop. Experimental results was less positive in this context.
Effects of drought on birds and riparian vegetation in the Colorado River Delta, Mexico
Hinojosa-Huerta, Osvel; Nagler, Pamela L.; Carrillo-Guererro, Yamilett K.; Glenn, Edward P.
2013-01-01
The riparian corridor in the delta of the Colorado River in Mexico supports internationally important bird habitat. The vegetation is maintained by surface flows from the U.S. and Mexico and by a high, non-saline aquifer into which the dominant phreatophytic shrubs and trees are rooted. We studied the effects of a regional drought on riparian vegetation and avian abundance and diversity from 2002 to 2007, during which time surface flows were markedly reduced compared to the period from 1995 to 2002. Reduced surface flows led to a reduction in native tree cover but an increase in shrub cover, mostly due to an increase in Tamarix spp., an introduced halophytic shrub, and a reduction in Populus fremontii and Salix gooddingii trees. However, overall vegetation cover was unchanged at about 70%. Overall bird density and diversity were also unchanged, but riparian-obligate species tended to decrease in abundance, and generalist species increased. Although reduction in surface flows reduced habitat value and negatively impacted riparian-obligate bird species, portions of the riparian zone exhibited resilience. Surface flows are required to reduce soil salt levels and germinate new cohorts of native trees, but the main source of water supporting this ecosystem is the aquifer, derived from underflows from irrigated fields in the U.S. and Mexico. The long-term prospects for delta riparian habitats are uncertain due to expected reduced flows of river water from climate change, and land use practices that will reduce underflows to the riparian aquifer and increase salinity levels. Active restoration programs would be needed if these habitats are to be preserved for the future.
Mexico joins the venture: Joint Implementation and Greenhouse Gas Emissions
Energy Technology Data Exchange (ETDEWEB)
Imaz, M.; Gay, C.; Friedmann, R.; Goldberg, B.
1998-11-01
Joint Implementation (JI) and its pilot phase of Activities Implemented Jointly (AIJ) are envisioned as an economic way of reducing global emissions of greenhouse gases. This paper draws upon the Mexican experience with AIJ to identify Mexican concerns with AIJ/JI and proposed solutions to these. Three approved Mexican AIJ projects (Ilumex, Scolel Te, and Salicornia) are described in detail. The Ilurnex project promotes the use of compact fluorescent lamps in Mexican homes of the States of Jalisco and Nuevo Leon, to reduce electric demand. Scolel Te is a sustainable forest management project in Chiapas. Salicornia examines the potential for carbon sequestration with a Halophyte-based crop irrigated with saline waters in Sonora. These three projects are reviewed to clarify the issues and concerns that Mexico has with AIJ and JI and propose measures to deal with them. These initial Mexican AIJ projects show that there is a need for creation of standard project evaluation procedures, and criteria and institutions to oversee project design, selection, and implementation. Further JI development will be facilitated by national and international clarification of key issues such as additionality criteria, carbon-credit sharing, and valuation of non-GHG environmental and/or social benefits and impacts for AIJ projects. Mexico is concerned that JI funding could negatively impact official development assistance or that OECD countries will use JI to avoid taking significant GHG mitigation actions in their own countries. The lack of carbon credit trading in the AIJ stage must be removed to provide useful experience on how to share carbon credits. National or international guidelines are needed to ensure that a portion of the carbon credits is allocated to Mexico.
Tiwari, Vivekanand; Patel, Manish Kumar; Chaturvedi, Amit Kumar; Mishra, Avinash; Jha, Bhavanath
2016-01-01
Reactive oxygen or nitrogen species are generated in the plant cell during the extreme stress condition, which produces toxic compounds after reacting with the organic molecules. The glutathione-S-transferase (GST) enzymes play a significant role to detoxify these toxins and help in excretion or sequestration of them. In the present study, we have cloned 1023 bp long promoter region of tau class GST from an extreme halophyte Salicornia brachiata and functionally characterized using the transgenic approach in tobacco. Computational analysis revealed the presence of abiotic stress responsive cis-elements like ABRE, MYB, MYC, GATA, GT1 etc., phytohormones, pathogen and wound responsive motifs. Three 5'-deletion constructs of 730 (GP2), 509 (GP3) and 348 bp (GP4) were made from 1023 (GP1) promoter fragment and used for tobacco transformation. The single event transgenic plants showed notable GUS reporter protein expression in the leaf tissues of control as well as treated plants. The expression level of the GUS gradually decreases from GP1 to GP4 in leaf tissues, whereas the highest level of expression was detected with the GP2 construct in root and stem under control condition. The GUS expression was found higher in leaves and stems of salinity or osmotic stress treated transgenic plants than that of the control plants, but, lower in roots. An efficient expression level of GUS in transgenic plants suggests that this promoter can be used for both constitutive as well as stress inducible expression of gene(s). And this property, make it as a potential candidate to be used as an alternative promoter for crop genetic engineering.
Kim, Jae Hwan; Suk, Sujin; Jang, Woo Jung; Lee, Chang Hyung; Kim, Jong-Eun; Park, Jin-Kyu; Kweon, Mee-Hyang; Kim, Jong Hun; Lee, Ki Won
2017-07-01
High-fat and high-salt intakes are among the major risks of chronic diseases including obesity, nonalcoholic fatty liver disease (NAFLD), and nonalcoholic steatohepatitis (NASH). Salicornia is a halophytic plant known to exert antioxidant, antidiabetic, and hypolipidemic effects, and Salicornia-extracted salt (SS) has been used as a salt substitute. In this study, the effects of SS and purified salt (PS) on the aggravation of NAFLD/NASH were compared. C57BL/6J male mice (8-wk-old) were fed a high-fat diet (HFD) for 6 mo and divided into 3 dietary groups, which were additionally fed HFD, HFD + SS, and HFD + PS for 13 wk. PS induced aggravation of NAFLD/NASH in HFD-fed mice. Although the actual salt intake was same between the PS and SS groups as 1% of the diet (extrapolated from the World Health Organization [WHO] guideline), SS induced less liver injury and hepatic steatosis compared to PS. The hepatic mRNA expressions of inflammatory cytokines and fibrosis marker were significantly lower in the SS group than the PS group. Oxidative stress is one of the major causes of inflammation in NAFLD/NASH. Results of the component analysis showed that the major polyphenols that exhibited antioxidant activity in the Salicornia water extract were ferulic acid, caffeic acid, and isorhamnetin. These results suggest that even the level of salt intake recommended by WHO can accelerate the progression of liver disease in obese individuals consuming HFD. It is proposed that SS can be a salt substitute for obese individuals who consume HFD. © 2017 Institute of Food Technologists®.
Directory of Open Access Journals (Sweden)
Thaura Ghneim-Herrera
2017-06-01
Full Text Available We evaluated the yields of Oryza sativa L. ‘Nipponbare’ rice lines expressing a gene encoding an A20/AN1 domain stress-associated protein, AlSAP, from the halophyte grass Aeluropus littoralis under the control of different promoters. Three independent field trials were conducted, with drought imposed at the reproductive stage. In all trials, the two transgenic lines, RN5 and RN6, consistently out-performed non-transgenic (NT and wild-type (WT controls, providing 50–90% increases in grain yield (GY. Enhancement of tillering and panicle fertility contributed to this improved GY under drought. In contrast with physiological records collected during previous greenhouse dry-down experiments, where drought was imposed at the early tillering stage, we did not observe significant differences in photosynthetic parameters, leaf water potential, or accumulation of antioxidants in flag leaves of AlSAP-lines subjected to drought at flowering. However, AlSAP expression alleviated leaf rolling and leaf drying induced by drought, resulting in increased accumulation of green biomass. Therefore, the observed enhanced performance of the AlSAP-lines subjected to drought at the reproductive stage can be tentatively ascribed to a primed status of the transgenic plants, resulting from a higher accumulation of biomass during vegetative growth, allowing reserve remobilization and maintenance of productive tillering and grain filling. Under irrigated conditions, the overall performance of AlSAP-lines was comparable with, or even significantly better than, the NT and WT controls. Thus, AlSAP expression inflicted no penalty on rice yields under optimal growth conditions. Our results support the use of AlSAP transgenics to reduce rice GY losses under drought conditions.
Proposed REDD+ project for the Sundarbans: Legal and institutional issues
Directory of Open Access Journals (Sweden)
Saiful Karim
2013-07-01
Full Text Available Sundarbans, a Ramsar and World Heritage site, is the largest single block of tidal halophytic mangrove forest in the world covering parts of Bangladesh and India. Natural mangroves were very common along the entire coast of Bangladesh. However, all other natural mangrove forests, including the Chakaria Sundarbans with 21,000 hectares of mangrove, have been cleared for shrimp cultivation. Against this backdrop, the Forest Department of Bangladesh has developed project design documents for a project called ‘Collaborative REDD+ Improved Forest Management (IFM Sundarbans Project’ (CRISP to save the only remaining natural mangrove forest of the country. This project, involving conservation of 412,000 ha of natural mangrove forests, is expected to generate, over a 30-year period, a total emissions reduction of about 6.4 million tons of CO2. However, the successful implementation of this project involves a number of critical legal and institutional issues. It may involve complex legal issues such as forest ownership, forest use rights, rights of local people and carbon rights. It may also involve institutional reforms. Ensuring good governance of the proposed project is very vital considering the failure of the Asian Development Bank (ADB funded and Bangladesh Forest Department managed ‘Sundarbans Biodiversity Conservation Project’. Considering this previous experience, this paper suggests that a comprehensive legal and institutional review and reform is needed for the successful implementation of the proposed CRISP project. This paper argues that without ensuring local people’s rights and their participation, no project can be successful in the Sundarbans. Moreover, corruption of local and international officials may be a serious hurdle in the successful implementation of the project.
Directory of Open Access Journals (Sweden)
Andrea ePitzschke
2016-01-01
Full Text Available Among potential climate change-adapted crops for future agriculture, quinoa (Chenopodium quinoa, a facultative halophyte plant with exceptional nutritional properties, stands out as a prime candidate. This work examined how quinoa deals with extreme situations during seed rehydration. A seed-borne microbiome was discovered and its potential role in early development and stress resistance investigated.Methods involved germination and drought exposure assays, histochemical detection of reactive oxygen species, and diverse tests with seed(ling material to assess microbial occurrence, release and proliferation. Quinoa´s microbial partners were biochemically, microscopically and taxonomically characterized.Quinoa distinguishes itself from other plants in multiple ways. It germinates within minutes, even under extremely hostile conditions. Broken seeds/split embryos are able to regenerate. Furthermore, quinoa seedlings are resurrection-competent. These peculiarities became in part explainable upon discovery of seed-borne microorganisms. 100% of quinoa seeds, from different sources, are inhabited by bacteria of the genus Bacillus. These endophytes are mobile and reside in all seedling organs, indicating vertical transmission. Owing to their strong catalase activity and high superoxide contents they can modify host redox properties. One outcome is cell expansion, enabling quinoa to overcome a critical period in development, seedling establishment.Quinoa´s immediate confrontation with foreign ROS and bacterial elicitors likely induces a naturally primed state, enabling plants to withstand extreme situations. The endophytic bacteria, which are cultivable and highly robust themselves, have high potential for application in agriculture, food (amylase and cosmetics (catalase industry. An exciting question arising from this work is: Can quinoa´s microbiome be transferred to improve stress resistance in other plant species?