Formation of reactive nitrogen oxides from urban grime photochemistry
Baergen, Alyson M.; Donaldson, D. James
2016-05-01
Impervious surfaces are ubiquitous in urban environments and constitute a substrate onto which atmospheric constituents can deposit and undergo photochemical and oxidative processing, giving rise to "urban grime" films. HNO3 and N2O5 are important sinks for NOx in the lower atmosphere and may be deposited onto these films, forming nitrate through surface hydrolysis. Although such deposition has been considered as a net loss of NOx from the atmosphere, there is increasing evidence that surface-associated nitrate undergoes further reaction. Here, we examine the gas phase products of the photochemistry of real, field-collected urban grime using incoherent broadband cavity-enhanced absorption spectroscopy (IBBCEAS). Gas phase nitrogen oxides are emitted upon illumination of grime samples and their production increases with ambient relative humidity (RH) up to 35 % after which the production becomes independent of RH. These results are discussed in the context of water uptake onto and evaporation from grime films.
2010-07-01
... coated or covered with dust, dirt, grime, grease, or another absorbent material. 761.375 Section 761.375... coated or covered with dust, dirt, grime, grease, or another absorbent material. (a) First wash. Cover..., absorbent pad until the surface appears dry. This cleaning should remove any residual dirt, dust, grime, or...
Interactions of ClO2 and H2O2 Fumigants with Dirt and Grime ...
Report The primary objective of this research was to evaluate the impact that dirt and grime, as present on unpainted subway concrete, may have on fumigation efficacy. Other objectives include determining which sampling procedure provides better recovery from grimed and cleaned concrete, and characterizing subway material before and after cleaning using a prescribed method from the New York City Metropolitan Transportation Authority (MTA).
Ver Schulz: metamorfoses de um Projeto Artístico
Dantas, élida Mara Alves
2014-01-01
Este estudo se configura como um mergulho no universo do multifacetado artista polonês Bruno Schulz (1892-1942), desenhista gráfico, pintor, ilustrador, poeta, crítico literário e escritor do entreguerras, nascido na cidade de Drohobycz e morto em uma de suas ruas durante a Segunda Guerra Mundial. Reconhecido mundialmente, embora pouco conhecido no Brasil, Schulz se destaca pela sua versatilidade, pelas peculiaridades de sua biografia, e, sobretudo, pela sua curta, mas significante produção l...
Nachruf für Hartmut Schulz : (13. Juli 1939 - 19. Juni 2003)
Klee, Rainer; Buttler, Karl Peter; Hodvina, Sylvain
2003-01-01
Am 19. Juni 2003 verstarb Hartmut Schulz, einer der Gründer der BVNH. Leben und Werk werden in einem durch Rainer Klee verfassten Nachruf gewürdigt. Es folgt eine von Karl Peter Buttler und Sylvain Hodvina erstellte Liste der Veröffentlichungen von Hartmut Schulz.
Directory of Open Access Journals (Sweden)
Luis S. Krausz
2007-05-01
Full Text Available Os escritores Bruno Schulz e Joseph Roth entraram para a história da literatura, respectivamente, como representantes da literatura polonesa e austríaca, como se pertencessem a mundos diversos. Entretanto ambos compartilharam de uma memória comum, que era a vida nas províncias orientais do Império Austro-Húngaro, nas cidades de Drohobycz e Brody, hoje pertencentes à Ucrânia. As obras de ficção de Schulz e de Roth fazem referência ao universo austro-húngaro e habsburgo, um reino milenar que via a si mesmo não simplesmente como uma realidade política, mas como um império que tinha como missão trazer a seus súditos uma forma de vida considerada superior do ponto de vista espiritual, ético e moral. A idéia do Sacro Império Romano Germânico, que se considerava portador de uma mensagem humana, subsistiu, até o século 20, no longo reinado do Kaiser Francisco José e neste sentido a 1ª Guerra Mundial significa não simplesmente o desmembramento político do Império Austro-Húngaro em seus diferentes componentes, mas também a falência de uma idéia de Estado que transcendia à esfera do meramente político para tornar-se um lar espiritual e cultural para seus súditos. O mundo que sobreveio à 1ª Guerra Mundial é marcado pelas tendências fáustico-titânicas de um individualismo materialista, que devota todas suas energias à produção e à acumulação de capital, e é sobre este novo mundo que Schulz e Roth olham em suas obras, sempre do ponto de vista de um universo anterior, marcado pela nostalgia de um exílio irreversível. Palavras-chave: Nostalgia. Exílio. Império Habsburgo. Joseph Roth. Bruno Schulz. Bruno Schulz and Joseph Roth figure in the history of literature as Representatives of Polish and Austrian literature, respectively, as if they were part of different worlds. However, both share a common memory: the life in the eastern provinces of the Austrian-Hungarian Empire, in the cities of Drohobycz
Masochisms. Mythologizing as an Aesthetics of Crisis in the Work of Bruno Schulz
Directory of Open Access Journals (Sweden)
Janis Augsburger
2011-01-01
Full Text Available The study Masochisms. Mythologizing as an Aesthetics of Crisis in the Work of Bruno Schulz, parts of which have been translated below, presents the thesis that in the work of B. Schulz the phenomenon of mythologizing is connected with masochism – a concept conceived of as a historical, cultural and aesthetic interpretative category. The combination of the two phenomena makes it possible to notice some relationships between Schulz’s literary and graphic works which have not been recognized yet. The author discusses some psychoanalytical, sociological, historical and philosophical notions of masochism applicable to a literary text. She tries to describe the “masochistic aesthetics” appearing in Schulz’s short stories (on the narrative level: lack of motion, suspense, tension and in his graphics (theatricalization, lack of eye contact between the figures and shows how this aesthetics integrates the prose of Schulz, his Idolatrous Book and his illustrations for the short story The Book.
KF-1 ubiquitin ligase: an anxiety suppressor
Directory of Open Access Journals (Sweden)
Tamotsu Hashimoto-Gotoh
2009-05-01
Full Text Available Anxiety is an instinct that may have developed to promote adaptive survival by evading unnecessary danger. However, excessive anxiety is disruptive and can be a basic disorder of other psychiatric diseases such as depression. The KF-1, a ubiquitin ligase located to the endoplasmic reticulum (ER, may prevent excessive anxiety; kf-1−/− mice exhibit selectively elevated anxiety-like behavior against light or heights. Thus, KF-1 may degrade some target proteins, responsible for promoting anxiety, through the ER-associated degradation pathway, similar to Parkin in Parkinson's disease (PD. Parkin, another ER-ubiquitin ligase, prevents the degeneration of dopaminergic neurons by degrading the target proteins responsible for PD. Molecular phylogenetic studies have revealed that the prototype of kf-1 appeared in the very early phase of animal evolution but was lost, unlike parkin, in the lineage leading up to Drosophila. Therefore, kf-1−/− mice, be a powerful tool for elucidating the molecular mechanisms involved in emotional regulation, and for screening novel anxiolytic/antidepressant compounds.
Passings to note: Paul Michael Packman, MD; S. Charles Schulz, MD.
Black, Donald W
2018-02-01
One of the keys to the success of Annals of Clinical Psychiatry has always been the tireless efforts of our dedicated Editorial Board. We recently lost 2 longtime Editorial Board members, Drs. Paul Michael Packman and S. Charles Schulz. Both will be greatly missed.
Mitigating Observation Perturbation Sampling Errors in the Stochastic EnKF
Hoteit, Ibrahim
2015-03-17
The stochastic ensemble Kalman filter (EnKF) updates its ensemble members with observations perturbed with noise sampled from the distribution of the observational errors. This was shown to introduce noise into the system and may become pronounced when the ensemble size is smaller than the rank of the observational error covariance, which is often the case in real oceanic and atmospheric data assimilation applications. This work introduces an efficient serial scheme to mitigate the impact of observations’ perturbations sampling in the analysis step of the EnKF, which should provide more accurate ensemble estimates of the analysis error covariance matrices. The new scheme is simple to implement within the serial EnKF algorithm, requiring only the approximation of the EnKF sample forecast error covariance matrix by a matrix with one rank less. The new EnKF scheme is implemented and tested with the Lorenz-96 model. Results from numerical experiments are conducted to compare its performance with the EnKF and two standard deterministic EnKFs. This study shows that the new scheme enhances the behavior of the EnKF and may lead to better performance than the deterministic EnKFs even when implemented with relatively small ensembles.
Mitigating Observation Perturbation Sampling Errors in the Stochastic EnKF
Hoteit, Ibrahim; Pham, D.-T.; El Gharamti, Mohamad; Luo, X.
2015-01-01
The stochastic ensemble Kalman filter (EnKF) updates its ensemble members with observations perturbed with noise sampled from the distribution of the observational errors. This was shown to introduce noise into the system and may become pronounced when the ensemble size is smaller than the rank of the observational error covariance, which is often the case in real oceanic and atmospheric data assimilation applications. This work introduces an efficient serial scheme to mitigate the impact of observations’ perturbations sampling in the analysis step of the EnKF, which should provide more accurate ensemble estimates of the analysis error covariance matrices. The new scheme is simple to implement within the serial EnKF algorithm, requiring only the approximation of the EnKF sample forecast error covariance matrix by a matrix with one rank less. The new EnKF scheme is implemented and tested with the Lorenz-96 model. Results from numerical experiments are conducted to compare its performance with the EnKF and two standard deterministic EnKFs. This study shows that the new scheme enhances the behavior of the EnKF and may lead to better performance than the deterministic EnKFs even when implemented with relatively small ensembles.
Directory of Open Access Journals (Sweden)
Peter Ay
2009-05-01
Full Text Available Review of the edited volume: Manfred Schulz (ed.: Entwicklungsträger in der DR Kongo. Entwicklungen in Politik, Wirtschaft, Religion, Zivilgesellschaft und Kultur, Wien: Lit-Verlag 2007(= Spektrum 100; Berliner Reihe zu Gesellschaft, Wirtschaft und Politik in Entwicklungsländern 2007, ISBN 978-3825804251,755 pages. Besprechung des Sammelbandes: Manfred Schulz (Hrsg.: Entwicklungsträger in der DR Kongo. Entwicklungen in Politik, Wirtschaft, Religion, Zivilgesellschaft und Kultur, Wien: Lit-Verlag 2007 (= Spektrum 100; Berliner Reihe zu Gesellschaft, Wirtschaft und Politik in Entwicklungsländern, ISBN 978-3825804251, 755 Seiten.
Mice lacking the kf-1 gene exhibit increased anxiety- but not despair-like behavior
Directory of Open Access Journals (Sweden)
Atsushi Tsujimura
2008-09-01
Full Text Available KF-1 was originally identified as a protein encoded by human gene with increased expression in the cerebral cortex of a patient with Alzheimer’s disease. In mouse brain, kf-1 mRNA is detected predominantly in the hippocampus and cerebellum, and kf-1 gene expression is elevated also in the frontal cortex of rats after chronic antidepressant treatments. KF-1 mediates E2-dependent ubiquitination and may modulate cellular protein levels as an E3 ubiquitin ligase, though its target proteins are not yet identified. To elucidate the role of kf-1 in the central nervous system, we generated kf-1 knockout mice by gene targeting, using Cre-lox recombination. The resulting kf-1−/− mice were normal and healthy in appearance. Behavioral analyses revealed that kf-1−/− mice showed significantly increased anxiety-like behavior compared with kf-1+/+ littermates in the light/dark transition and elevated plus maze tests; however, no significant differences were observed in exploratory locomotion using the open field test or in behavioral despair using the forced swim and tail suspension tests. These observations suggest that KF-1 suppresses selectively anxiety under physiological conditions probably through modulating protein levels of its unknown target(s. Interestingly, kf-1−/− mice exhibited significantly increased prepulse inhibition, which is usually reduced in human schizophrenic patients. Thus, the kf-1−/− mice provide a novel animal model for elucidating molecular mechanisms of psychiatric diseases such as anxiety/depression, and may be useful for screening novel anxiolytic/antidepressant compounds.
Colloidal Stability in Asymmetric Electrolytes: Modifications of the Schulze-Hardy Rule.
Trefalt, Gregor; Szilagyi, Istvan; Téllez, Gabriel; Borkovec, Michal
2017-02-21
The Schulze-Hardy rule suggests a strong dependence of the critical coagulation concentration (CCC) on the ionic valence. This rule is addressed theoretically and confronted with recent experimental results. The commonly presented derivation of this rule assumes symmetric electrolytes and highly charged particles. Both assumptions are incorrect. Symmetric electrolytes containing multivalent ions are hardly soluble, and experiments are normally carried out with the well-soluble salts of asymmetric electrolytes containing monovalent and multivalent ions. In this situation, however, the behavior is completely different whether the multivalent ions represent the counterions or co-ions. When these ions represent the counterions, meaning that the multivalent ions have the opposite sign than the charge of the particle, they adsorb strongly to the particles. Thereby, they progressively reduce the magnitude of the surface charge with increasing valence. In fact, this dependence of the charge density on the counterion valence is mainly responsible for the decrease of the CCC with the valence. In the co-ion case, where the multivalent ions have the same sign as the charge of the particle, the multivalent ions are repelled from the particles, and the surfaces remain highly charged. In this case, the inverse Schulze-Hardy rule normally applies, whereby the CCC varies inversely proportional to the co-ion valence.
New KF-PP-SVM classification method for EEG in brain-computer interfaces.
Yang, Banghua; Han, Zhijun; Zan, Peng; Wang, Qian
2014-01-01
Classification methods are a crucial direction in the current study of brain-computer interfaces (BCIs). To improve the classification accuracy for electroencephalogram (EEG) signals, a novel KF-PP-SVM (kernel fisher, posterior probability, and support vector machine) classification method is developed. Its detailed process entails the use of common spatial patterns to obtain features, based on which the within-class scatter is calculated. Then the scatter is added into the kernel function of a radial basis function to construct a new kernel function. This new kernel is integrated into the SVM to obtain a new classification model. Finally, the output of SVM is calculated based on posterior probability and the final recognition result is obtained. To evaluate the effectiveness of the proposed KF-PP-SVM method, EEG data collected from laboratory are processed with four different classification schemes (KF-PP-SVM, KF-SVM, PP-SVM, and SVM). The results showed that the overall average improvements arising from the use of the KF-PP-SVM scheme as opposed to KF-SVM, PP-SVM and SVM schemes are 2.49%, 5.83 % and 6.49 % respectively.
Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM
International Nuclear Information System (INIS)
1986-11-01
Nuclear fusion is one of the main activities of the Karlsruhe Nuclear Research Center (KfK). It is organized as a project under the Directorate of Reactor Development and Safety. The work of KfK concentrates on technology aspects of nuclear fusion with magnetic confinement. It is part of the European Fusion Programme where KfK participates as an association to EURATOM. Close links have been established to the Max Planck Institute for Plasma Physics (IPP). In the Entwicklungsgemeinschaft Kernfusion KfK and IPP cooperate for the development of future fusion experiments joining the experience gained in plasma physics (IPP) and materials, safety, and nuclear technology (KfK), respectively. As in the present strategy of the European Fusion Programme the Next European Tokamak (NET) is foreseen as the major next step, most of the activities of KfK address this subject. In addition to the contributions to NET, studies are carried out to innovate INTOR, the worldwide cooperation for an experimental reactor under the auspices of IAEA. Furthermore, the Entwicklungsgemeinschaft Kernfusion has evaluated the feasibility of a fusion reactor with a stellarator confinement. (orig./GG)
KfK Nuclear Safety Project. First semiannual report 1985
International Nuclear Information System (INIS)
1985-11-01
The semiannual progress report 1985/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1985 in the nuclear safety field by KfK institutes and departements and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics: work performed, results obtained and plans for future work. (orig./HP) [de
Directory of Open Access Journals (Sweden)
R. Nikravesh
2015-02-01
Full Text Available Christian Norberg- Schulz explained his ideas about the phenomenology of architecture, indebted to Martin Heidegger’s opinionsand believed that one of the main strategies for identification of the place is creating meaningful environments. Schulz can be considered as one of theorists who created new ideas in architecture after Gideon and believed that considering to other scientific fields is necessary to achieve the true nature of architecture. In fact the phenomenological approach can be understood as an interdisciplinary species that explain about existence and cognition in other fields like designing different spaces. Accordingly emphasizing on interdisciplinary trends and studies can help to identify and understand the multiple issues and by studying the different approaches, the scientific expansion of the problem’s aspects will be possible. This article with an Interdisciplinary and phenomenological point of view and due to the main ideas of Norberg- Schulz, analyses the concept of place and space and also the importance of concerning about children’s spaces. So at first a brief knowledge about the book of Norberg-Schulz in phenomenological approach will be achieved and by studying the opinions of other theorists, some results about the importance of considering the concept of genius loci in architectural spaces will be achieved. In this document, by using the descriptive- analytical method and by means of data collection, including studies, library and documentation, the relating concepts and strategies of improving the quality of children’s spaces, is analyzed. According to this article, It could be said that meanings, culture and history of a place, include identifying factors that cause creating memories and a sense of belonging to the place for individuals and thus the formation of their personality in childhood. So one of the main tasks of modern architects is creating a sense of space in children’s spaces and reminding
Hut, Rolf; Amisigo, Barnabas A.; Steele-Dunne, Susan; van de Giesen, Nick
2015-12-01
Reduction of Used Memory Ensemble Kalman Filtering (RumEnKF) is introduced as a variant on the Ensemble Kalman Filter (EnKF). RumEnKF differs from EnKF in that it does not store the entire ensemble, but rather only saves the first two moments of the ensemble distribution. In this way, the number of ensemble members that can be calculated is less dependent on available memory, and mainly on available computing power (CPU). RumEnKF is developed to make optimal use of current generation super computer architecture, where the number of available floating point operations (flops) increases more rapidly than the available memory and where inter-node communication can quickly become a bottleneck. RumEnKF reduces the used memory compared to the EnKF when the number of ensemble members is greater than half the number of state variables. In this paper, three simple models are used (auto-regressive, low dimensional Lorenz and high dimensional Lorenz) to show that RumEnKF performs similarly to the EnKF. Furthermore, it is also shown that increasing the ensemble size has a similar impact on the estimation error from the three algorithms.
Electric conductivity of salt melts containing KCL, KF and K2TaF7
International Nuclear Information System (INIS)
Agulyanskij, A.I.; Stangrit, P.T.; Konstantinov, V.I.
1978-01-01
Given are electric conductivity measurement results depending on the temperature and composition of the molten KF-K 2 TaF 7 , KCl-K 2 TaF 7 systems and also melts close in their composition to industrial electrolytes, KCl-KF (in mass ratio of 2:1) with addition of K 2 TaF 7 up to 25 mass%. Presented are electric conductivity molecular isotherms of the KF-K 2 TaF 7 , KCl-K 2 TaF 7 systems at 800 deg C and specific electric conductivity dependence of KCl-KF-K 2 TaF 7 melts on K 2 TaF 7 composition at 800 deg C and 900 deg C. Proceeding from the shape of molecular and specific electric conductivity isotherms a conclusion is made about existence of the following tantalum-containing ions: TaF 7 2- , TaF 6 - and TaF 6 Cl 2- in the investigated melts
Velocity of sound in, and adiabatic compressibility of, Molten LiF-NaF, LiF-KF, NaF-KF mixtures
International Nuclear Information System (INIS)
Minchenko, V.I.; Konovalov, Y.V.; Smirnov, M.V.
1986-01-01
The authors measured the velocity of sound as a function of temperature at 1.5 zHM frequency in LiF-NaF, NaF-KF, LiF-KF melts over the entire range of their compositions. The measurements were made by comparison of the phases of a reference pulse signal and a signal reflected from the bottom of the crucible. The specified temperatures were maintained constant within plus or minus 1 degree. The sound conductor consisted of a cylindrical rod of sintered beryllium oxide, which does not interact with test melts. The study shows that the velocity of sound decreases linearly with increase of the temperature. The values of the constants of the empirical equations are presented in a table, with indication of the temperature range. The dependence of the velocity of sound on composition of the melts is shown, where isotherms for 1250 K are given as an example. Variation of the composition by 1-2 mole % leads to increase or decrease of the velocity of sound by 5-10 m
Micelle-derived catalysts for extended Schulz-Flory
Energy Technology Data Exchange (ETDEWEB)
Abrevaya, H.
1986-01-01
The objective of this program is to develop a synthesis gas conversion catalyst with higher selectivity to liquid fuels, while maintaining catalytic activity and stability at least equivalent relative to state-of-the-art precipitated iron catalysts. During this quarter, the emphasis in the program has been the investigation of the hydrocarbon cutoff hypothesis with supported ruthenium catalysts. An alumina-supported catalyst with smaller than 20[Angstrom] ruthenium particles was tested under conditions of maximal water gas shift activity. During this test more than 90% of the water made in the Fischer-Tropsch synthesis reaction was converted to H[sub 2]. However, the extent of ruthenium metal agglomeration was not reduced. Accordingly, it was not possible to conclude whether hydrocarbon cutoff occurs with smaller than 20[Angstrom] ruthenium particles on [gamma]-alumina. A ruthenium catalyst prepared on Y-type zeolite had 20[Angstrom] or smaller ruthenium particles according to STEM examination and a 15[Angstrom] average ruthenium metal particle size according to EXAFS examination. The ruthenium metal particle size was stable during the test with this catalyst. The hydrocarbon product distribution was Anderson-Schulz-Flory with no cutoff up to a carbon number of 160. A well-dispersed titania-supported ruthenium catalyst is going to be evaluated during the next quarter in order to determine whether hydrocarbon cutoff occurs.
Directory of Open Access Journals (Sweden)
Seonhyeop Shin
2015-06-01
Full Text Available The elastic properties of KF-substituted perovskite lead titanate (PbTiO3 were investigated by dielectric measurements and Brillouin light scattering. The ferroelectric phase transition occurred at substantially lower temperature due to KF substitution, which was attributed to the modification of the covalency in Pb–O and Ti–O bonds. The longitudinal acoustic (LA mode of KF-substituted PbTiO3 showed a frequency softening in the paraelectric phase, which was accompanied by increasing acoustic damping. This indicated that polarization fluctuations responsible for the acoustic anomalies were enhanced by KF substitution.
Density of salt melts containing KF, KCl, K2TaF7 and Ta2O5
International Nuclear Information System (INIS)
Agulyanskij, A.I.; Stangrit, P.T.; Konstantinov, V.I.
1978-01-01
The results of density measurements by hydrostatic weighing are given for molten K 2 TaF 7 - KF, K 2 TaF 7 -KCL, K 2 TaF 7 - KF - KCl and K 2 TaF 7 - KF - KCl - Ta 2 O 5 mixtures depending on their temperature and composition. The density of the last two systems was measured at compositions close to those of commercial electrolytes. The obtained specific volume - composition dependencies show that no interaction is taking place in the mixtures studied. It is, therefore, believed that, in the K 2 TaF 7 - KF melt, tantalum is mainly present as a complex TaF 7 2- ion, and, in the K 2 TaF 7 - KCl mlt, a certain amount of TaF 6 - ions may be formed along with TaF 7 2-
Je třeba číst z letu těch ptáků : o kabalistické interpretaci Bruna Schulze
Czech Academy of Sciences Publication Activity Database
Fottová, Magdaléna
2017-01-01
Roč. 10, č. 40 (2017), s. 24-29 ISSN 1803-8077 Institutional support: RVO:68378068 Keywords : Schulz, Bruno * Panas, Władysław * Jewish literature * Kabbalah Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures
The contribution of thermal radiation to the thermal conductivity of porous UO2
International Nuclear Information System (INIS)
Bakker, K.; Kwast, H.; Cordfunke, E.H.P.
1995-01-01
The influence of cylindrical, spherical and ellipsoidal inclusions on the overall thermal conductivity was computed with the finite element technique. The results of these calculations were compared with equations that describe the effect of inclusions on the overall thermal conductivity. The analytical equation of Schulz [B. Schulz, KfK-1988 (1974)] that describes the effect of inclusions on the overall thermal conductivity is in good agreement with the results of the finite element computations. This good agreement shows that among a variety of porosity correction formulas, the equation of Schulz gives the best description of the effect of inclusions on the overall thermal conductivity. This equation and the results of finite element calculations allow us to compute the contribution of radiation to the overall thermal conductivity of UO 2 with oblate ellipsoidal porosity. The present radiation calculations show that Hayes and Peddicord [S.L. Hayes and K.L. Peddicord, J. Nucl. Mater. 202 (1993) 87] overestimated the contribution of thermal radiation to the thermal conductivity. ((orig.))
Ensemble singular vectors and their use as additive inflation in EnKF
Directory of Open Access Journals (Sweden)
Shu-Chih Yang
2015-07-01
Full Text Available Given an ensemble of forecasts, it is possible to determine the leading ensemble singular vector (ESV, that is, the linear combination of the forecasts that, given the choice of the perturbation norm and forecast interval, will maximise the growth of the perturbations. Because the ESV indicates the directions of the fastest growing forecast errors, we explore the potential of applying the leading ESVs in ensemble Kalman filter (EnKF for correcting fast-growing errors. The ESVs are derived based on a quasi-geostrophic multi-level channel model, and data assimilation experiments are carried out under framework of the local ensemble transform Kalman filter. We confirm that even during the early spin-up starting with random initial conditions, the final ESVs of the first analysis with a 12-h window are strongly related to the background errors. Since initial ensemble singular vectors (IESVs grow much faster than Lyapunov Vectors (LVs, and the final ensemble singular vectors (FESVs are close to convergence to leading LVs, perturbations based on leading IESVs grow faster than those based on FESVs, and are therefore preferable as additive inflation. The IESVs are applied in the EnKF framework for constructing flow-dependent additive perturbations to inflate the analysis ensemble. Compared with using random perturbations as additive inflation, a positive impact from using ESVs is found especially in areas with large growing errors. When an EnKF is ‘cold-started’ from random perturbations and poor initial condition, results indicate that using the ESVs as additive inflation has the advantage of correcting large errors so that the spin-up of the EnKF can be accelerated.
Electric conductivity of low-temperature molten electrolyte KF-AlF3 with additions of LiF and Al2O3
International Nuclear Information System (INIS)
Apisarov, A.P.; Kryukovskij, V.A.; Zajkov, Yu.P.; Red'kin, A.A.; Tkacheva, O.Yu.; Khokhlov, V.A.
2007-01-01
Electric conductivity of LiF, Al 2 O 3 doped KF-AlF 3 (Cryolite Ratio CR=1.3) molten electrolytes was estimated on the basis of empiric equations. Specific electric conductivity of KF-AlF 3 , KF-AIF 3 -AI 2 O 3 , KF-AlF 3 -LiF, KF-AlF 3 -LiF-Al 2 0 3 molten mixtures was measured in the range 687-797 Deg C. Cells with the pyrolytic boron nitride capillary and parallel molybdena electrodes were applied for the determination of electric conductivity. Comparison of calculated and experimental data of the specific electric conductivity of cryolite-alumina melts confirms that the offered model of the calculation adequate represents temperature and concentration dependencies, and it permits forecasting its change under the introduction of different additives in electrolyte [ru
International Nuclear Information System (INIS)
Guzmán-Vargas, Ariel; Santos-Gutiérrez, Teresa; Lima, Enrique; Flores-Moreno, Jorge L.; Oliver-Tolentino, Miguel A.; Martínez-Ortiz, María de J.
2015-01-01
Highlights: • MgCaAl hydrotalcite-like compounds were synthetized. • After KF impregnation and calcination fluorinated species were detected. • Fluorinated species were stables and actives. • LDH composition and KF load effect were evaluated in biodiesel production. - Abstract: In this work a series of MgCaAl hydrotalcite-like compounds were synthetized by coprecipitation method at constant pH. In order to obtain the catalysts, the samples were modified with KF by incipient wetness impregnation at different wt%, after that, they were dried and calcined to obtain the mixed oxides. The effect of divalent cations ratio and KF load were studied in the transesterification reaction of Jatropha curcas oil to obtain biodiesel employing an inedible oil. XRD analysis showed typical diffraction patterns of LDH, by nitrogen physisorption the LDH mesoporous structure was also confirmed, 27 Al NMR spectra showed bands at 10 and 88 ppm attributed to the Al coordination before and after thermal treatment. While for the impregnated samples after calcination the profiles exhibited the mixed oxide formation, in addition, another peaks appeared associated to the formation of various fluorinated species as shown by XRD, additionally, 19 F NMR showed a main signal at −180 ppm indicating the presence of active tetrahedral aluminum fluoride species. The reaction evolution was monitoring calculating the oil conversion to biodiesel by integration of the signal spectra using 1 H NMR spectroscopy. The results of catalytic tests in transesterification reaction showed a direct correlation between Mg/Ca ratio and KF content in the oil conversion to biodiesel, the higher conversion was achieved (90%) when Mg/Ca = 1 and KF load was 30 wt%
Energy Technology Data Exchange (ETDEWEB)
Guzmán-Vargas, Ariel, E-mail: aguzmanv@ipn.mx [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Santos-Gutiérrez, Teresa [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Lima, Enrique [IIM-Universidad Nacional Autónoma de México, Circuito exterior s/n, Cd. Universitaria, 04510 México DF (Mexico); Flores-Moreno, Jorge L. [UAM-Azcapotzalco, Área de Química de Materiales, Av. San Pablo 180, Col. Reynosa Tamaulipas, 02200 México DF (Mexico); Oliver-Tolentino, Miguel A.; Martínez-Ortiz, María de J. [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico)
2015-09-15
Highlights: • MgCaAl hydrotalcite-like compounds were synthetized. • After KF impregnation and calcination fluorinated species were detected. • Fluorinated species were stables and actives. • LDH composition and KF load effect were evaluated in biodiesel production. - Abstract: In this work a series of MgCaAl hydrotalcite-like compounds were synthetized by coprecipitation method at constant pH. In order to obtain the catalysts, the samples were modified with KF by incipient wetness impregnation at different wt%, after that, they were dried and calcined to obtain the mixed oxides. The effect of divalent cations ratio and KF load were studied in the transesterification reaction of Jatropha curcas oil to obtain biodiesel employing an inedible oil. XRD analysis showed typical diffraction patterns of LDH, by nitrogen physisorption the LDH mesoporous structure was also confirmed, {sup 27}Al NMR spectra showed bands at 10 and 88 ppm attributed to the Al coordination before and after thermal treatment. While for the impregnated samples after calcination the profiles exhibited the mixed oxide formation, in addition, another peaks appeared associated to the formation of various fluorinated species as shown by XRD, additionally, {sup 19}F NMR showed a main signal at −180 ppm indicating the presence of active tetrahedral aluminum fluoride species. The reaction evolution was monitoring calculating the oil conversion to biodiesel by integration of the signal spectra using {sup 1}H NMR spectroscopy. The results of catalytic tests in transesterification reaction showed a direct correlation between Mg/Ca ratio and KF content in the oil conversion to biodiesel, the higher conversion was achieved (90%) when Mg/Ca = 1 and KF load was 30 wt%.
Facile preparation of highly pure KF-ZrF4 molten salt
Zong, Guoqiang; Cui, Zhen-Hua; Zhang, Zhi-Bing; Zhang, Long; Xiao, Ji-Chang
2018-03-01
The preparation of highly pure KF-ZrF4 (FKZr) molten salt, a potential secondary coolant in molten salt reactors, was realized simply by heating a mixture of (NH4)2ZrF6 and KF. X-ray diffraction analysis indicated that the FKZr molten salt was mainly composed of KZrF5 and K2ZrF6. The melting point of the prepared FKZr molten salt was 420-422 °C under these conditions. The contents of all metal impurities were lower than 20 ppm, and the content of oxygen was lower than 400 ppm. This one-step protocol avoids the need for a tedious procedure to prepare ZrF4 and for an additional purification process to remove oxide impurities, and is therefore a convenient, efficient and economic preparation method for high-purity FKZr molten salt.
Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke
2015-01-01
We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.
The Solubility of Aluminum in Cryolite-Based Electrolyte-Containing KF
Zhang, Yu; Yu, Jiangyu; Gao, Bingliang; Liu, Yibai; Hu, Xianwei; Shi, Zhongning; Wang, Zhaowen
2016-04-01
The solubility of aluminum in NaF-AlF3-CaF2-KF-A12O3 electrolyte system at 1253 K (980 °C) has been measured by the analysis of quenched samples saturated with aluminum. The content of the dissolved metal in the quenched melt was determined by collecting the volume of hydrogen gas when a finely crushed sample is treated with HCl. Addition of 0 to 5 pct KF has no obvious effect on the solubility of aluminum in cryolite-based melts with molar ratio of NaF/AlF3 (cryolite ratio) ranging from 2.2 to 3.0. The solubility of aluminum increases from 0.015 to 0.026 wt pct with cryolite ratio increases from 2.2 to 4.0 in the NaF-AlF3-5 wt pct CaF2-3 wt pct A12O3 electrolyte at 1253 K (980 °C). Aluminum solubility was affected by both chemical replacement reaction of Al + 3NaF = AlF3 + 3Na and physical dissolution.
Joint Parametric Fault Diagnosis and State Estimation Using KF-ML Method
DEFF Research Database (Denmark)
Sun, Zhen; Yang, Zhenyu
2014-01-01
The paper proposes a new method for a kind of parametric fault online diagnosis with state estimation jointly. The considered fault affects not only the deterministic part of the system but also the random circumstance. The proposed method first applies Kalman Filter (KF) and Maximum Likelihood (...
Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke
2015-03-26
We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.
User manual for the KfK code PCROSS
International Nuclear Information System (INIS)
Ravndal, S.; Oblozinsky, P.; Kelzenberg, S.; Cierjacks, S.
1991-08-01
The PCROSS code calculates the so-called 'pseudo' cross sections for sequential (x,n) reactions and merges them together with 'collapsed' cross sections for neutron induced reactions into one file of cross sections. The file is tailored to provide an input for the FISPACT inventory code that calculates the activation and related radiological quantities of material irradiated in a neutron flux. The present report describes the structure of the KfK code PCROSS, outlines the role of subroutines, and provides necessary information for a practical user of the code. (orig.) [de
Electrochemical behavior of boron in LiF-NaF-KF- melts
DEFF Research Database (Denmark)
Polyakova, L.P.; Bukatova, G.A.; Polyakova, E.G.
1996-01-01
The electrochemical reduction of B(III) to B(0) in KBF4-LiF-NaF-KF melts has been studied by voltammetric and chronopotentiometric methods, Glassy carbon, Pt, and Ag were used as working electrode materials. Only in the case of Ag was the reduction not complicated by interaction between boron...
El Gharamti, Mohamad; Valstar, Johan R.; Hoteit, Ibrahim
2014-01-01
Reactive contaminant transport models are used by hydrologists to simulate and study the migration and fate of industrial waste in subsurface aquifers. Accurate transport modeling of such waste requires clear understanding of the system's parameters, such as sorption and biodegradation. In this study, we present an efficient sequential data assimilation scheme that computes accurate estimates of aquifer contamination and spatially variable sorption coefficients. This assimilation scheme is based on a hybrid formulation of the ensemble Kalman filter (EnKF) and optimal interpolation (OI) in which solute concentration measurements are assimilated via a recursive dual estimation of sorption coefficients and contaminant state variables. This hybrid EnKF-OI scheme is used to mitigate background covariance limitations due to ensemble under-sampling and neglected model errors. Numerical experiments are conducted with a two-dimensional synthetic aquifer in which cobalt-60, a radioactive contaminant, is leached in a saturated heterogeneous clayey sandstone zone. Assimilation experiments are investigated under different settings and sources of model and observational errors. Simulation results demonstrate that the proposed hybrid EnKF-OI scheme successfully recovers both the contaminant and the sorption rate and reduces their uncertainties. Sensitivity analyses also suggest that the adaptive hybrid scheme remains effective with small ensembles, allowing to reduce the ensemble size by up to 80% with respect to the standard EnKF scheme. © 2014 Elsevier Ltd.
Energy Technology Data Exchange (ETDEWEB)
Singh, Bhaskar; Sharma, Yogesh C. [Banaras Hindu University, Department of Applied Chemistry, Institute of Technology, Varanasi (India); Birla, Ashish; Upadhyay, S.N. [Banaras Hindu University, Department of Chemical Engineering and Technology, Institute of Technology, Varanasi (India); Yaakob, Zahira [Universiti Kebangsaan Malaysia, Department of Chemical and Process Engineering, Selangor (Malaysia)
2012-12-15
Biodiesel has been developed using a heterogeneous catalyst potassium fluoride (KF) supported on hydrotalcite (HT) and waste frying oil (WFO) as feedstock. Hydrotalcite was synthesized by co-precipitation method using mixture of Mg(NO{sub 3}){sub 2}.6H{sub 2}O and Al(NO{sub 3}){sub 2}.9H{sub 2}O slowly added to a solution containing NaOH and Na{sub 2}CO{sub 3} and calcined at 500 C. KF was impregnated on hydrotalcite at KF/HT load ratio of 80:100 by addition of a small amount of water. Biodiesel was developed using KF/HT as heterogeneous catalyst by transesterification. Box-Behnken Design using Minitab 15.1 Statistical Software and Design-Expert (Demo version 8.0.6.1) software were used as statistical tool for design of experiments and optimization of fatty acid methyl ester yield. A high yield and conversion of biodiesel was obtained by optimization of variables affecting the reaction. The variables affected the reaction in the priority order of: catalyst amount >> molar ratio (methanol to oil) > reaction time. A 12:1 methanol to WFO molar ratio, 2.5 wt.% of catalyst at 60 C in 1 h reaction time gave a high fatty acid methyl ester yield of >98 %. The quantitative analysis of the product (i.e., biodiesel) was done on a Fourier-transform-nuclear magnetic resonance spectrometer. (orig.)
El Gharamti, Mohamad
2014-09-01
Reactive contaminant transport models are used by hydrologists to simulate and study the migration and fate of industrial waste in subsurface aquifers. Accurate transport modeling of such waste requires clear understanding of the system\\'s parameters, such as sorption and biodegradation. In this study, we present an efficient sequential data assimilation scheme that computes accurate estimates of aquifer contamination and spatially variable sorption coefficients. This assimilation scheme is based on a hybrid formulation of the ensemble Kalman filter (EnKF) and optimal interpolation (OI) in which solute concentration measurements are assimilated via a recursive dual estimation of sorption coefficients and contaminant state variables. This hybrid EnKF-OI scheme is used to mitigate background covariance limitations due to ensemble under-sampling and neglected model errors. Numerical experiments are conducted with a two-dimensional synthetic aquifer in which cobalt-60, a radioactive contaminant, is leached in a saturated heterogeneous clayey sandstone zone. Assimilation experiments are investigated under different settings and sources of model and observational errors. Simulation results demonstrate that the proposed hybrid EnKF-OI scheme successfully recovers both the contaminant and the sorption rate and reduces their uncertainties. Sensitivity analyses also suggest that the adaptive hybrid scheme remains effective with small ensembles, allowing to reduce the ensemble size by up to 80% with respect to the standard EnKF scheme. © 2014 Elsevier Ltd.
“All the Other Players Want to Look at My Pad”: Grime, Gaming, and Digital Identity
Directory of Open Access Journals (Sweden)
Rob Gallagher
2017-12-01
Full Text Available A fusion of jungle, garage, hip-hop and Jamaican sound system culture, grime emerged from the housing estates of East London in the early 2000s. The genre has always had strong ties to gaming, from producers who cut their compositional teeth on Mario Paint (Nintendo RD1, 1992 to MCs who incorporate videogame references into their lyrics, album titles and aliases. This article traces grime’s relationship with gaming from the genre’s inception to the present, focusing on two case studies: veteran London MC D Double E’s 2010 track “Street Fighter Riddim” and Senegalese-Kuwaiti musician Fatima Al Qadiri’s 2012 Desert Strike EP, a “soundtrack” to her experiences of the first Gulf War. Showing how players build videogames into their life stories and identities, these case studies affirm that gaming was never the exclusive preserve of “nerdy” white middle-class males while foregrounding the ludic dimensions of digital musicianship and the musical dimensions of digital play.
DEFF Research Database (Denmark)
Petersen, Kia Vest; Liu, Jianming; Chen, Jun
2017-01-01
producing ethanol as the sole fermentation product with a high yield corresponding to 83% of the theoretical maximum. The results clearly indicate the great potential of using the more metabolically diverse non-dairy L. lactis strains for bio-production based on xylose containing feedstocks.......The non-dairy lactic acid bacterium Lactococcus lactis KF147 can utilize xylose as the sole energy source. To assess whether KF147 could serve as a platform organism for converting second generation sugars into useful chemicals, we characterized growth and product formation for KF147 when grown...... the arcA gene encoding the arginine deiminase. The fermentation product profile suggested two routes for xylose degradation, the phosphoketolase pathway and the pentose phosphate pathway. Inactivation of the phosphoketolase pathway redirected the entire flux through the pentose phosphate pathway whereas...
Directory of Open Access Journals (Sweden)
Federica Sandri
2017-06-01
Full Text Available Pseudomonas pseudoalcaligenes KF707 is a soil bacterium which is known for its capacity to aerobically degrade harmful organic compounds such as polychlorinated biphenyls (PCBs using biphenyl as co-metabolite. Here we provide the first genetic and functional analysis of the KF707 respiratory terminal oxidases in cells grown with two different carbon sources: glucose and biphenyl. We identified five terminal oxidases in KF707: two c(caa3 type oxidases (Caa3 and Ccaa3, two cbb3 type oxidases (Cbb31 and Cbb32, and one bd type cyanide-insensitive quinol oxidase (CIO. While the activity and expression of both Cbb31 and Cbb32 oxidases was prevalent in glucose grown cells as compared to the other oxidases, the activity and expression of the Caa3 oxidase increased considerably only when biphenyl was used as carbon source in contrast to the Cbb32 oxidase which was repressed. Further, the respiratory activity and expression of CIO was up-regulated in a Cbb31 deletion strain as compared to W.T. whereas the CIO up-regulation was not present in Cbb32 and C(caa3 deletion mutants. These results, together, reveal that both function and expression of cbb3 and caa3 type oxidases in KF707 are modulated by biphenyl which is the co-metabolite needed for the activation of the PCBs-degradation pathway.
Directory of Open Access Journals (Sweden)
Juan Calero
2014-06-01
Full Text Available This study describes the results obtained in the synthesis of a biofuel that avoids the production of glycerol by applying supported KF as alkaline heterogeneous catalyst, to generate two moles of fatty acid methyl esters and one mole of monoglyceride from one mol of triglyceride. In this respect, the selective transesterification process of sunflower oil with methanol was carried out with KF (10 wt% supported on three different solids, Al2O3, ZnO and MgO. The standard experimental conditions employed in the heterogeneous selective methanolysis reaction were: 12 mL of sunflower oil, 2.7 mL of methanol, 0.8 g of catalyst, at 65 °C temperature and one hour of reaction time. In all cases 100% conversion was obtained, with high selectivity values, greater than 90%, and quite suitable viscosity values, 4.5–8.5 cSt. In this way, the best catalytic behavior in the first use was obtained by using Al2O3 as support. However, although in the five consecutive reuses all catalysts exhibited a continuous decrease in their catalytic activities; the lower one was for KF catalyst using MgO as support. In summary, these three KF supported catalysts are very suitable to obtain a new biofuel, similar to conventional biodiesel, applicable to diesel engines.
Electric conductivity of molten mixtures of ternary mutual KF-KCl-ZrF4 system
International Nuclear Information System (INIS)
Darienko, S.E.; Raspopin, S.P.; Chervinskij, Yu.F.
1988-01-01
Using the relative capillary method at the frequency of 50 kHz the specific electric conductivity of molten mixtures of the KF-KCl-ZnF 4 system is measured. All the measurements were made in the atmosphere of purified argon. Temperature dependence of electric conductivity of the mixtures studied (800-1260 K) is described by the equations of exponential type with sufficient accuracy. Curves of identical specific electric conductivity of the three-component system are presented. With an increase in zirconium tetrachloride concentration in the mixtures electric conductivity of the melts decreases. On the basis of the measurement results of KF-ZrF 4 and KCl-ZrF 4 molten mixture specific electric conductivity and data on the melt density the values of molar electric conductivity at 1200 K are calculated
International Nuclear Information System (INIS)
Finken, D.
1986-05-01
The Nuclear Research Centre Karlsruhe and the Max Planck Institute for Plasma Physics together form the Nuclear Fusion Development Association. The partners collaborate with the aim of creating the physical and technical preconditions for the use of the energy released by nuclear fusion and to plan and carry out future large-scale experiments. The work of the Nuclear Research Centre Karlsruhe on fusion with magnetic containment is included in the nuclear fusion project and is part of the European fusion technology programme. The work is supported by an association contract between KfK and Euratom by the European Commission. Connections are built up between areas of work and new projects are prepared by supplementary KfK contributions, mostly studies. This is done with regard to the expansion of the technology programme to be expected for future years and the planning activities for NET. The reports collected here are contributions of the KfK institutes in 1985. The appendix contains a list of the tasks which KfK has taken over from the fusion technology programme of the EEC. References to the institutes' contributions make the assignment of textual contributions easier. (orig.) [de
Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM
International Nuclear Information System (INIS)
Kast, G.
1988-07-01
Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 9 NET study are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)
Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM
International Nuclear Information System (INIS)
Kast, G.
1987-05-01
This semi-annual report gives 36 short descriptions of the work done in the framework of the Nuclear Fusion Project and outlines studies for NET/INTOR and for ECRH power sources at 150 GHz. Tables of fusion technology contracts, of NET contracts, of KfK departments contributing to the Fusion Project, and of the Fusion Project management staff complete this report. (GG)
Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM
International Nuclear Information System (INIS)
Kast, G.
1987-12-01
Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 8 NET study contracts. The fusion technology contracts and the NET contracts are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)
International Nuclear Information System (INIS)
Lee, M.S.; Terry, B.S.; Grieveson, P.
1993-01-01
The interfacial phenomena occurring during the contacting of liquid Al-B, Al-Ti-B, and Al-Zr-B melts with KF-AlF 3 liquid fluxes have been investigated by optical examination of quenched metal drops previously immersed in the liquid fluxes. Reactions in the Al-B/KF-AlF 3 system involve the formation of metastable AlB 12 at the metal/flux interface. At high KBF 4 levels in the flux, the AlB 12 is dispersed in the flux and also at low KBF 4 levels in the metal. Reactions in the Al-Ti-B/KF-AlF 3 system involve the formation of TiB 2 , which may be dispersed in either the metal or the flux depending upon the composition of the flux. The results obtained for the Al-Ti-B/NaF-AlF 3 and Al-Zr-B/KF-AlF 3 systems were similar to those observed for the Al-Ti-B/KF-AlF 3 system
Biphenyl-grown cells and cell extracts prepared from biphenyl-grown cells of Pseudomonas sp. strain LB400 oxidize a much wider range of chlorinated biphenyls than do analogous preparations from Pseudomonas pseudoalcaligenes KF707. These results are attributed to differences in th...
KfK-seminar series on supercomputing und visualization from May till September 1992
International Nuclear Information System (INIS)
Hohenhinnebusch, W.
1993-05-01
During the period of may 1992 to september 1992 a series of seminars was held at KfK on several topics of supercomputing in different fields of application. The aim was to demonstrate the importance of supercomputing and visualization in numerical simulations of complex physical and technical phenomena. This report contains the collection of all submitted seminar papers. (orig./HP) [de
Extended software for the KfK K-edge densitometer
International Nuclear Information System (INIS)
Eberle, H.
1985-04-01
In order to further exploit the possibilities of the KfK K-edge densitometer, and to enlarge the range of its application, we have extended and modified the instrument's software. With the new software packages the instrument can now be used for analysis of the actinide elemments Th, U, Np, Pu and Am in single element solutions, and for the simultaneous assay of U and Pu in mixed U/Pu solutions. Provisions have been made for later extensions, allowing the analysis of additional elements combinations, if necessary. The report gives a short description of the new programs, and of the modifications to the previous programs. The listings and the corresponding programs are given in the Appendix. (orig./HP)
Directory of Open Access Journals (Sweden)
Agustina Undabarrena
2017-02-01
Full Text Available Streptomyces sp. H-KF8 is an actinobacterial strain isolated from marine sediments of a Chilean Patagonian fjord. Morphological characterization together with antibacterial activity was assessed in various culture media, revealing a carbon-source dependent activity mainly against Gram-positive bacteria (S. aureus and L. monocytogenes. Genome mining of this antibacterial-producing bacterium revealed the presence of 26 biosynthetic gene clusters (BGCs for secondary metabolites, where among them, 81% have low similarities with known BGCs. In addition, a genomic search in Streptomyces sp. H-KF8 unveiled the presence of a wide variety of genetic determinants related to heavy metal resistance (49 genes, oxidative stress (69 genes and antibiotic resistance (97 genes. This study revealed that the marine-derived Streptomyces sp. H-KF8 bacterium has the capability to tolerate a diverse set of heavy metals such as copper, cobalt, mercury, chromate and nickel; as well as the highly toxic tellurite, a feature first time described for Streptomyces. In addition, Streptomyces sp. H-KF8 possesses a major resistance towards oxidative stress, in comparison to the soil reference strain Streptomyces violaceoruber A3(2. Moreover, Streptomyces sp. H-KF8 showed resistance to 88% of the antibiotics tested, indicating overall, a strong response to several abiotic stressors. The combination of these biological traits confirms the metabolic versatility of Streptomyces sp. H-KF8, a genetically well-prepared microorganism with the ability to confront the dynamics of the fjord-unique marine environment.
Brune, Sebastian; Pohlmann, Holger; Düsterhus, Andre; Kröger, Jürgen; Müller, Wolfgang; Baehr, Johanna
2016-04-01
We investigate hindcast skill for surface air temperature and upper ocean heat content (0-700m) in the North Atlantic for yearly mean values from 1960 to 2014 in four prediction systems based on the global coupled Max Planck Institute for Meteorology Earth System Model (MPI-ESM). We find that in the North Atlantic and within the four prediction systems under consideration only the EnKF initialized hindcasts reproduce the variability of the reference data well both in terms of anomaly correlation and representation of the probability density function. The systems under consideration only differ in the method how they incorporate surface and sub-surface oceanic temperatures and salinities during assimilation: ensemble Kalman Filter (EnKF), anomaly nudging of ORA reanalysis (BS-1), full field nudging of ORA and GECCO reanalysis, respectively (PT-ORA, PT-GEC). We assess the hindcast skill of each prediction system with reference to HadCRUT4 near surface air temperature data (Morice et al. 2012) and NOAA OC5 upper ocean heat content data (Levitus et al. 2012) using anomaly correlation (ACC) and by analysing the interquartile range (IQR) of the probability density function (PDF). Firstly, we calculate hindcast skill in terms of ACC and IQR against reference data over the whole time period. Here, the hindcast skills of EnKF and BS-1 are better for both ACC and IQR in lead years 2 to 5 when compared to PT-ORA and PT-GEC, their hindcast skill drops off after lead year 1. Secondly, the PDF of the reference data is not uniformly distributed over time. We therefore calculate ACC and IQR for a 20 year moving window. We find hindcast skill in terms of ACC for EnKF and BS-1 in the 1960s and from the 1990s onwards, up to eight lead years in advance, with almost no skill for the time period inbetween. In contrast, there is no skill for PT-ORA and PT-GEC in any period after lead year one. The IQR of reference data is best captured by the EnKF, in the 1960s and 1990s up to lead year
Watanabe, Takahito; Fujihara, Hidehiko; Furukawa, Kensuke
2003-01-01
Pseudomonas pseudoalcaligenes KF707 possesses a biphenyl-catabolic (bph) gene cluster consisting of bphR1A1A2-(orf3)-bphA3A4BCX0X1X2X3D. The bphR1 (formerly orf0) gene product, which belongs to the GntR family, is a positive regulator for itself and bphX0X1X2X3D. Further analysis in this study revealed that a second regulator belonging to the LysR family (designated bphR2) is involved in the regulation of the bph genes in KF707. The bphR2 gene was not located near the bph gene cluster, and it...
Sham, P C; Zerbin-Rüdin, E; Kendler, K S
1995-01-01
Nearly all previous evidence of the familial transmission of age at onset of schizophrenia has been in siblings and twins. In his paper, Bruno Schulz examined the age at onset distribution of schizophrenia in affected parent and offspring pairs, using a systematic series of ascertained cases (n = 106), as well as a second series of chronic in-patients (n = 36). The parent-offspring correlation in age at onset, for cases with a definite diagnosis in the systematically ascertained series, was estimated at 0.346 (95% confidence interval 0.134, 0.528). Schulz did not test for differences between the two series and between males and females, but our reanalysis, using correlational methods and a mixed linear model, did not detect any significant differences. These results are consistent with previous findings that age at onset of schizophrenia is influenced by familial factors which may be genetic.
Energy Technology Data Exchange (ETDEWEB)
Ishiwata, Kiichi; Ogi, Nobuo; Hayakawa, Nobutaka [Tokyo Metropolitan Inst. of Gerontology, Tokyo (Japan). Positron Medical Center] [and others
2002-11-01
We proposed [{sup 11}C]KF18446 as a selective radioligand for mapping the adenosine A{sub 2A} receptors being highly enriched in the striatum by positron emission tomography (PET). In the present study, we investigated whether [{sup 11}C]KF18446 PET can detect the change in the striatal adenosine A{sub 2A} receptors in the rat after unilateral injection of an excitotoxin quinolinic acid into the striatum, a Huntington's disease model, to demonstrate the usefulness of [{sup 11}C]KF18446. The extent of the striatal lesion was identified based on MRI, to which the PET was co-registered. The binding potential of [{sup 11}C]KF18446 significantly decreased in the quinolinic acid-lesioned striatum. The decrease was comparable to the decrease in the potential of [{sup 11}C] raclopride binding to dopamine D{sub 2} receptors in the lesioned striatum, but seemed to be larger than the decrease in the potential of [{sup 11}C]SCH23390 binding to dopamine D{sub 1} receptors. Ex vivo and in vitro autoradiography validated the PET signals. We concluded that [{sup 11}C]KF18446 PET can detect change in the adenosine A{sub 2A} receptors in the rat model, and will provide a new diagnostic tool for characterizing post-synaptic striatopallidal neurons in the stratum. (author)
Furusawa, Naoto
2006-09-01
A technique is presented for the economical, routine, and quantitative analysis of contamination by dichloro-diphenyl-trichloroethanes (DDTs) [pp'-DDT, pp'-dichlorodiphenyl dichloroethylene, and pp'-dichlorodiphenyl dichloreothane in beef tallow and chicken fat samples, based on their separation using matrix solid-phase dispersion (MSPD) extraction with Toyobo-KF, an activated carbon fiber. Toyobo-KF is a newly applied MSPD sorbent, and it is followed by reversed-phase high-performance liquid chromatography (HPLC) with a photodiode array detector. The resulting analytical performance parameters [recoveries of spiked DDTs (0.1, 0.2, and 0.4 microg/g) > or = 81%, with relative standard deviations of < or = 8% (n = 5), and quantitation limits < or = 0.03 microg/g], with minimal handling and cost-efficiency, indicate that the present MSPD-HPLC method may be a useful tool for routine monitoring of DDT contamination in meat.
Directory of Open Access Journals (Sweden)
Abaszadeh Mehdi
2017-07-01
Full Text Available KF/Al2O3 as a green and efficient catalyst has been used for synthesis of indolizine-1-carbonitrile derivatives. It can be proceeded by using 1,3-dipolar cycloaddition reaction of 1-alkyl-2-chloropyridinium bromides, malononitrile and benzaldehyde in ethanol, at reflux. The great advantage of this catalyst is the ease of handling. KF/Al2O3 can be used and removed by filtration, avoiding cumbersome aqueous workups and decreasing solvent waste handling issues. High conversions, short reaction times and a cleaner reaction profiles are some of the outstanding advantages of this method.
Estimation of water level and steam temperature using ensemble Kalman filter square root (EnKF-SR)
Herlambang, T.; Mufarrikoh, Z.; Karya, D. F.; Rahmalia, D.
2018-04-01
The equipment unit which has the most vital role in the steam-powered electric power plant is boiler. Steam drum boiler is a tank functioning to separate fluida into has phase and liquid phase. The existence in boiler system has a vital role. The controlled variables in the steam drum boiler are water level and the steam temperature. If the water level is higher than the determined level, then the gas phase resulted will contain steam endangering the following process and making the resulted steam going to turbine get less, and the by causing damages to pipes in the boiler. On the contrary, if less than the height of determined water level, the resulted height will result in dry steam likely to endanger steam drum. Thus an error was observed between the determined. This paper studied the implementation of the Ensemble Kalman Filter Square Root (EnKF-SR) method in nonlinear model of the steam drum boiler equation. The computation to estimate the height of water level and the temperature of steam was by simulation using Matlab software. Thus an error was observed between the determined water level and the steam temperature, and that of estimated water level and steam temperature. The result of simulation by Ensemble Kalman Filter Square Root (EnKF-SR) on the nonlinear model of steam drum boiler showed that the error was less than 2%. The implementation of EnKF-SR on the steam drum boiler r model comprises of three simulations, each of which generates 200, 300 and 400 ensembles. The best simulation exhibited the error between the real condition and the estimated result, by generating 400 ensemble. The simulation in water level in order of 0.00002145 m, whereas in the steam temperature was some 0.00002121 kelvin.
Rouster, Paul; Pavlovic, Marko; Szilagyi, Istvan
2017-07-13
Ion specific effects on colloidal stability of titania nanosheets (TNS) were investigated in aqueous suspensions. The charge of the particles was varied by the pH of the solutions, therefore, the influence of mono- and multivalent anions on the charging and aggregation behavior could be studied when they were present either as counter or co-ions in the systems. The aggregation processes in the presence of inorganic salts were mainly driven by interparticle forces of electrostatic origin, however, chemical interactions between more complex ions and the surface led to additional attractive forces. The adsorption of anions significantly changed the surface charge properties and hence, the resistance of the TNS against salt-induced aggregation. On the basis of their ability in destabilization of the dispersions, the monovalent ions could be ordered according to the Hofmeister series in acidic solutions, where they act as counterions. However, the behavior of the biphosphate anion was atypical and its adsorption induced charge reversal of the particles. The multivalent anions destabilized the oppositely charged TNS more effectively and the aggregation processes followed the Schulze-Hardy rule. Only weak or negligible interactions were observed between the anions and the particles in alkaline suspensions, where the TNS possessed negative charge.
Identifying the Structure and Effect of Drinking-Related Self-Schemas.
Domenico, Lisa H; Strobbe, Stephen; Stein, Karen Farchaus; Giordani, Bruno J; Hagerty, Bonnie M; Pressler, Susan J
2017-07-01
Self-schemas have received increased attention as favorable targets for therapeutic intervention because of their central role in self-perception and behavior. The purpose of this integrative review was to identify, evaluate, and synthesize existing research pertaining to drinking-related self-schemas. Russell's integrative review strategy guided the search. Sixteen published works were identified, meeting criteria for evaluation ( n = 12 data-based publications and n = 4 models). The retrieved data-based publications rated fair-good using Polit and Beck's criteria; the overall body of literature rated "B" using Grimes and Schulz criteria. Retrieved models rated 4 to 7 using Fitzpatrick and Whall's criteria. The existing literature strongly supports the availability of a drinking-related self-schema among moderate-to-heavy drinking samples, and suggests a positive relationship between elaboration and drinking behavior. The relationship between valenced content of the schema and drinking behavior remains unexplored. Identifying variation in the structural properties of drinking-related self-schemas could lay the foundation for future interventions.
KfK analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 1
International Nuclear Information System (INIS)
Giese, H.
1991-03-01
As proposed by the SPX-1 analysis task force, MSM (modified source multiplication) correction factors have been produced for a series of control rod configurations established in the first critical core C1D with minimum fissile loading and in the fully loaded core CMP. The report gives a complete description of the method used at KfK to produce these correction factors and summarises the evaluated experimental results obtained. The KfK method is characterized by a 'two-step-adjustment': A basic reactivity scale adjustment and a subsequent rod worth adjustment. The first adjustment was achieved by 'tuning' either the axialbuckling in the leakage term D B 2 or the average number of neutrons per fission in the production term so that the excess reactivity of the so-called 'Follower-core' with all control rods fully raised was properly reproduced. As this excess reactivity could not be directly determined by an experiment, it had to be assessed from the shut-down worth of the main control system in combination with measured fractions of the S-curve of this system. In the second adjustment, the absorber cross sections were tuned to reproduce experimental rod worths. While for the analysis of the C1D experiments, MSM correction factor calculations were performed in 2D centre-plane geometry only, the analysis of the CMP measurements employed both 2D and 3D calculations. (orig./HP)
Maxwell–Stefan diffusion and dynamical correlation in molten LiF-KF: A molecular dynamics study
Energy Technology Data Exchange (ETDEWEB)
Jain, Richa Naja, E-mail: ltprichanaja@gmail.com; Chakraborty, Brahmananda; Ramaniah, Lavanya M. [High Pressure & Synchrotron Radiation Physics Division, Bhabha Atomic Research Centre, Trombay, Mumbai-85 (India)
2016-05-23
In this work our main objective is to compute Dynamical correlations, Onsager coefficients and Maxwell-Stefan (MS) diffusivities for molten salt LiF-KF mixture at various thermodynamic states through Green–Kubo formalism for the first time. The equilibrium molecular dynamics (MD) simulations were performed using BHM potential for LiF–KF mixture. The velocity autocorrelations functions involving Li ions reflect the endurance of cage dynamics or backscattering with temperature. The magnitude of Onsager coefficients for all pairs increases with increase in temperature. Interestingly most of the Onsager coefficients has almost maximum magnitude at the eutectic composition indicating the most dynamic character of the eutectic mixture. MS diffusivity hence diffusion for all ion pairs increases in the system with increasing temperature. Smooth variation of the diffusivity values denies any network formation in the mixture. Also, the striking feature is the noticeable concentration dependence of MS diffusivity between cation-cation pair, Đ{sub Li-K} which remains negative for most of the concentration range but changes sign to become positive for higher LiF concentration. The negative MS diffusivity is acceptable as it satisfies the non-negative entropy constraint governed by 2{sup nd} law of thermodynamics. This high diffusivity also vouches the candidature of molten salt as a coolant.
DEFF Research Database (Denmark)
Koch, Alexander; Fuchs, Sven; Göbel, Patricia
reimportiert und für die Verwendung in Geoinformationssystemen (i.e. ArcGIS) weiter aufbereitet. Über Interpolationsverfahren konnte innerhalb des Programmes ArcGIS ein lateraler Bezug zwischen den verschiedenen Mächtigkeiten hergestellt werden, um so auf weitere Inhomogenitäten im Aufbau des Grundwasserleiter......-Systems schließen zu können. Anschließend wurden mittels ArcGIS die Quartärbasis des Modellraums konstruiert, sowie Grundwasserisolinien- und Grundwasserdifferenzenkarten berechnet. Die Grundwasserdifferenzenkarten reproduzieren gut die Grundwasserabsenkungen im Bereich von lokalen Tagebauen. Insgesamt zeigen sich...... gute Übereinstimmungen mit früheren hydrogeologischen Untersuchungen im Projektgebiet. Die Kombination des PetroKf-Algorithmus mit der Aufbereitung in einer Datenbank, sowie der Weiterverarbeitung in ArcGIS, zeigt einen praktikablen Weg zur Entwicklung und Parametrisierung eines hydrogeologischen...
Plutonium isotopic assay of reprocessing product solutions in the KfK K-edge densitometer
International Nuclear Information System (INIS)
Eberle, H.; Ottmar, H.; Matussek, P.
1985-04-01
The KfK K-edge densiometer, designed for accurate element concentration measurements using the technique of X-ray absorptiometry at the K absorption edge, provides as an additional option the possibility to determine the isotopic composition of freshly separated plutonium from an gamma-spectrometric analysis of its self-radiation. This report describes the underlying methodology and experimental procedures for the isotopic analysis in the K-edge densitometer. The paper also presents and discusses the experimental results so far obtained from routine measurements on reprocessing product solutions. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Gennett, J.A. [Texas A& M Univ., College Station, TX (United States)
1996-09-01
The 3500 lignite seam at the Gibbons Creek Mine in Grimes County, TX was sampled for pollen and spores at 10 cm intervals. The majority of samples are dominated (to 60%) by Momipites from the Juglandaceae (walnut family), as is typical of Jackson Group sediments. Other palynomorph taxa vary systematically, with a peak of pollen of the freshwater tree Nyssa (blackgum) and associated Rboipites angustus (to 17%) occurring at the base. Higher in the seam, increase (to 55%) of Cupuliferoipollenites (a chestnut-like grain) and Cyrillaceae-pollenites? ventosus (to 7%) percentages may indicate a higher salinity environment. A Chrysophyllum (satin leaf) peak (to 25%) near the top of the seam suggests relatively shallow fresh-water conditions. Core samples from an interval above the lignites represent a transgressive-regressive cycle in inner shelf clastics. These samples were taken at 40 cm or greater intervals and reveal the regional pollen flora. Although minor changes occur, palynomorph spectra are for the most part homogenous. The dominant grain is again Momipites coryloides, but in general percentages are lower (to 35%). Cupuliferoipollenites (to 17%), Chrysophyllum (to 5%), and Rhoipites angustus (to 3%) are not less important, but do not peak as they do in the lignite spectra. Palm leaf megafossils; in one sample suggest a clastic wetland; in this sample palm pollen (mostly Arecipites, representing the modern saw palmetto) reaches 73%. Another sample contains high (26%) percentages of the fern spore Lygodiumsporites adriennis. High percentages of these two taxa do not occur in the lignite samples.
Electrochemical investigation on the redox chemistry of niobium in LiCl-KCl-KF-Na2O melts
DEFF Research Database (Denmark)
Gillesberg, Bo; Bjerrum, Niels; Barner, Jens H. Von
1997-01-01
The system LiCl-KCl-KF-1 mole percent K2NbF7 (molar ration F-/Nb = 8) has been investigated in-the temperature range 370 to 725 degrees C by cyclic and square wave voltammetry. In the temperature range from 370 to 520 degrees C Nb(V) was reduced to Nb(III) in two reversible steps: Nb(V) --> Nb(IV...
Operating software for plutonium measurements in the KfK K-edge densitometer. A user's guide
International Nuclear Information System (INIS)
Eberle, H.
1983-09-01
A set of computer programs has been developed for the execution of plutonium concentration measurements in the KfK K-edge photon absorptiometer for performance evaluation. The programs are implemented on a ND-6620 data acquisition and processing system. A short description of the programs and commands for data accumulation and analysis is given. Nevertheless, the user should be familiar with the ND-6620 data acquisition and processing system, its system software, and with the FORTRAN programming language. (orig./HP)
International Nuclear Information System (INIS)
Dalle Donne, M.; Boccaccini, L.V.; Bojarsky, E.; Deckers, H.; Dienst, W.; Doerr, L.; Fischer, U.; Giese, H.; Guenther, E.; Haefner, H.E.; Hofmann, P.; Kappler, F.; Knitter, R.; Kuechle, M.; Moellendorf, U. von; Norajitra, P.; Penzhorn, R.D.; Reimann, G.; Reiser, H.; Schulz, B.; Schumacher, G.; Schwenk-Ferrero, A.; Sordon, G.; Tsukiyama, T.; Wedemeyer, H.; Weimar, P.; Werle, H.; Wiegner, E.; Zimmermann, H.
1991-10-01
The BOT (Breeder Outside Tube) Helium Cooled Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test plankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.) [de
International Nuclear Information System (INIS)
Dalle Donne, M.; Boccaccini, L.V.; Bojarsky, E.; Deckers, H.; Dienst, W.; Doerr, L.; Fischer, U.; Giese, H.; Guenther, E.; Haefner, H.E.; Hofmann, P.; Kappler, F.; Knitter, R.; Kuechle, M.; Moellendorf, U. von; Norajitra, P.; Penzhorn, R.D.; Reimann, G.; Reiser, H.; Schulz, B.; Schumacher, G.; Schwenk-Ferrero, A.; Sordon, G.; Tsukiyama, T.; Wedemeyer, H.; Weimar, P.; Werle, H.; Wiegner, E.; Zimmermann, H.
1991-10-01
The BOT (Breeder Outside Tube) Helium Cooled Solid Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test blankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of the test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.) [de
International Nuclear Information System (INIS)
Liu, Wen-wu; Hu, Chang-wei; Tong, Dong-mei; Yang, Yu; Li, Gui-ying; Zhu, Liang-fang; Tang, Jin-Qiang
2014-01-01
Highlights: • Reforming reactions were inhibited by H 2 , decrease of acidity and low temperature. • There was a synergistic effect on producing hydrogen between Ni and Mo. • The lattice oxygen over catalyst employed might transfer into the intermediates. • Co-pyrolysis, low temperature and N 2 could restrain oxygen transfer to some extent. - Abstract: Co-pyrolysis is regarded as an effective approach to upgrade the quality of pyrolysis products. In this work the activity of KF-846 was evaluated by co-pyrolysis of pubescens and low density polyethylene under different experimental conditions including catalytic mode, pyrolytic atmosphere and temperature, etc. The results showed that the fresh KF-846 exerted strong effects of cyclization, aromatization, hydrogen transfer and vapor-catalytic reforming reactions on the primary intermediates from the co-pyrolysis. The hydrogen-rich gases indicated a synergistic effect between Ni and Mo over KF-846 on producing hydrogen. More importantly, the reforming reactions might be inhibited to some extent by H 2 atmosphere, the low temperature and the decrease of acidity over catalyst. Furthermore, it was deduced that the oxygen over the lattice of catalyst or some intermediates might transfer into other intermediates, possibly resulting in more products with high oxygen content, but it was presumed that the low temperature, co-pyrolysis process and N 2 atmosphere could repress the trend to a certain degree. The mass and energy balance of co-pyrolysis were analyzed, and the main reaction pathways were also proposed. The interference in pyrolysis by regulating the catalytic mode, pyrolytic atmosphere and temperature, acidity over catalyst might posses a certain guiding significance for the pyrolytic technology and the design/selection of catalysts employed
Energy Technology Data Exchange (ETDEWEB)
Abrevaya, H.
1986-12-31
The objective of this program is to develop a synthesis gas conversion catalyst with higher selectivity to liquid fuels, while maintaining catalytic activity and stability at least equivalent relative to state-of-the-art precipitated iron catalysts. During this quarter, the emphasis in the program has been the investigation of the hydrocarbon cutoff hypothesis with supported ruthenium catalysts. An alumina-supported catalyst with smaller than 20{Angstrom} ruthenium particles was tested under conditions of maximal water gas shift activity. During this test more than 90% of the water made in the Fischer-Tropsch synthesis reaction was converted to H{sub 2}. However, the extent of ruthenium metal agglomeration was not reduced. Accordingly, it was not possible to conclude whether hydrocarbon cutoff occurs with smaller than 20{Angstrom} ruthenium particles on {gamma}-alumina. A ruthenium catalyst prepared on Y-type zeolite had 20{Angstrom} or smaller ruthenium particles according to STEM examination and a 15{Angstrom} average ruthenium metal particle size according to EXAFS examination. The ruthenium metal particle size was stable during the test with this catalyst. The hydrocarbon product distribution was Anderson-Schulz-Flory with no cutoff up to a carbon number of 160. A well-dispersed titania-supported ruthenium catalyst is going to be evaluated during the next quarter in order to determine whether hydrocarbon cutoff occurs.
Directory of Open Access Journals (Sweden)
Débora Damasceno Belarmino
2012-07-01
Full Text Available A fibra de queratina de penas de frango foi submetida à análise térmica (TG em sua forma natural e carbonizada, aumentando assim a expansão do reaproveitamento de materiais desperdiçados no Brasil. A partir das curvas obtidas por TG/DTG da pena natural (KF e tratadas (KFNaOH, SCFC e SCFD buscou-se um melhor ciclo de carbonização (pirólise para esse tipo de precursor. O trabalho também trata como um dos focos, o estudo comparativo do comportamento térmico desses materiais. Uma parte da KF foi tratada com hidróxido de sódio (NaOH, e observou-se pelo o resultado TG/DTG que a resistência térmica do material não foi influenciada. Outra parte de KF foi semicarbonizada (220°C sem controle do ambiente térmico e taxas de aquecimento e resfriamento, apresentando colorações diferentes, mais clara (SCFC e mais escura (SCFD. Foi constatado nas curvas de TG/DTG, que esse tratamento de carbonização não é ideal para a obtenção de carbono. Também foi verificado nas curvas de TG/DTG que na CF houve um aumento da estabilidade térmica comparada a todas as outras amostras. Essa pesquisa é uma inovação no que diz respeito à preparação e avaliação de fibras de penas de frango na obtenção de fibras sintetizadas, que atualmente são, em larga escala, derivados do petróleo, lembrando-se da diminuição das reservas de petróleo e da poluição que os mesmos geram ao meio ambiente.
Falchetti, Silvia; Alvarez, Alberto
2018-04-01
Data assimilation through an ensemble Kalman filter (EnKF) is not exempt from deficiencies, including the generation of long-range unphysical correlations that degrade its performance. The covariance localization technique has been proposed and used in previous research to mitigate this effect. However, an evaluation of its performance is usually hindered by the sparseness and unsustained collection of independent observations. This article assesses the performance of an ocean prediction system composed of a multivariate EnKF coupled with a regional configuration of the Regional Ocean Model System (ROMS) with a covariance localization solution and data assimilation from an ocean glider that operated over a limited region of the Ligurian Sea. Simultaneous with the operation of the forecast system, a high-quality data set was repeatedly collected with a CTD sensor, i.e., every day during the period from 5 to 20 August 2013 (approximately 4 to 5 times the synoptic time scale of the area), located on board the NR/V Alliance for model validation. Comparisons between the validation data set and the forecasts provide evidence that the performance of the prediction system with covariance localization is superior to that observed using only EnKF assimilation without localization or using a free run ensemble. Furthermore, it is shown that covariance localization also increases the robustness of the model to the location of the assimilated data. Our analysis reveals that improvements are detected with regard to not only preventing the occurrence of spurious correlations but also preserving the spatial coherence in the updated covariance matrix. Covariance localization has been shown to be relevant in operational frameworks where short-term forecasts (on the order of days) are required.
Hoyte, Ashley C; Jamin, Augusta V; Koneru, Pratibha C; Kobe, Matthew J; Larue, Ross C; Fuchs, James R; Engelman, Alan N; Kvaratskhelia, Mamuka
2017-12-01
The pyridine-based multimerization selective HIV-1 integrase (IN) inhibitors (MINIs) are a distinct subclass of allosteric IN inhibitors. MINIs potently inhibit HIV-1 replication during virion maturation by inducing hyper- or aberrant IN multimerization but are largely ineffective during the early steps of viral replication. Here, we investigated the mechanism for the evolution of a triple IN substitution (T124N/V165I/T174I) that emerges in cell culture with a representative MINI, KF116. We show that HIV-1 NL4-3(IN T124N/V165I/T174I) confers marked (>2000-fold) resistance to KF116. Two IN substitutions (T124N/T174I) directly weaken inhibitor binding at the dimer interface of the catalytic core domain but at the same time markedly impair HIV-1 replication capacity. Unexpectedly, T124N/T174I IN substitutions inhibited proteolytic processing of HIV-1 polyproteins Gag and Gag-Pol, resulting in immature virions. Strikingly, the addition of the third IN substitution (V165I) restored polyprotein processing, virus particle maturation, and significant levels of replication capacity. These results reveal an unanticipated role of IN for polyprotein proteolytic processing during virion morphogenesis. The complex evolutionary pathway for the emergence of resistant viruses, which includes the need for the compensatory V165I IN substitution, highlights a relatively high genetic barrier exerted by MINI KF116. Additionally, we have solved the X-ray structure of the drug-resistant catalytic core domain protein, which provides means for rational development of second-generation MINIs. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
Reiswig, Henry M; Araya, Juan Francisco
2014-12-02
All records of the 15 hexactinellid sponge species known to occur off Chile are reviewed, including the first record in the Southeastern Pacific of the genus Caulophacus Schulze, 1885, with the new species Caulophacus chilense sp. n. collected as bycatch in the deep water fisheries of the Patagonian toothfish Dissostichus eleginoides Smitt, 1898 off Caldera (27ºS), Region of Atacama, northern Chile. All Chilean hexactinellid species occur in bathyal to abyssal depths (from 256 up to 4142 m); nine of them are reported for the Sala y Gomez and Nazca Ridges, with one species each in the Juan Fernandez Archipelago and Easter Island. The Chilean hexactinellid fauna is still largely unknown, consisting of only 2.5 % of the known hexactinellid extant species. Further studies and deep water sampling are essential to assess their ecology and distribution, particularly in northern Chile.
El Gharamti, Mohamad
2016-11-15
This study considers the assimilation problem of subsurface contaminants at the port of Rotterdam in the Netherlands. It involves the estimation of solute concentrations and biodegradation rates of four different chlorinated solvents. We focus on assessing the efficiency of an adaptive hybrid ensemble Kalman filter and optimal interpolation (EnKF-OI) and the exact second-order sampling formulation (EnKFESOS) for mitigating the undersampling of the estimation and observation errors covariances, respectively. A multi-dimensional and multi-species reactive transport model is coupled to simulate the migration of contaminants within a Pleistocene aquifer layer located around 25 m below mean sea level. The biodegradation chain of chlorinated hydrocarbons starting from tetrachloroethene and ending with vinyl chloride is modeled under anaerobic environmental conditions for 5 decades. Yearly pseudo-concentration data are used to condition the forecast concentration and degradation rates in the presence of model and observational errors. Assimilation results demonstrate the robustness of the hybrid EnKF-OI, for accurately calibrating the uncertain biodegradation rates. When implemented serially, the adaptive hybrid EnKF-OI scheme efficiently adjusts the weights of the involved covariances for each individual measurement. The EnKFESOS is shown to maintain the parameter ensemble spread much better leading to more robust estimates of the states and parameters. On average, a well tuned hybrid EnKF-OI and the EnKFESOS respectively suggest around 48 and 21 % improved concentration estimates, as well as around 70 and 23 % improved anaerobic degradation rates, over the standard EnKF. Incorporating large uncertainties in the flow model degrades the accuracy of the estimates of all schemes. Given that the performance of the hybrid EnKF-OI depends on the quality of the background statistics, satisfactory results were obtained only when the uncertainty imposed on the background
Pan, Yujie; Xue, Ming; Zhu, Kefeng; Wang, Mingjun
2018-05-01
A dual-resolution (DR) version of a regional ensemble Kalman filter (EnKF)-3D ensemble variational (3DEnVar) coupled hybrid data assimilation system is implemented as a prototype for the operational Rapid Refresh forecasting system. The DR 3DEnVar system combines a high-resolution (HR) deterministic background forecast with lower-resolution (LR) EnKF ensemble perturbations used for flow-dependent background error covariance to produce a HR analysis. The computational cost is substantially reduced by running the ensemble forecasts and EnKF analyses at LR. The DR 3DEnVar system is tested with 3-h cycles over a 9-day period using a 40/˜13-km grid spacing combination. The HR forecasts from the DR hybrid analyses are compared with forecasts launched from HR Gridpoint Statistical Interpolation (GSI) 3D variational (3DVar) analyses, and single LR hybrid analyses interpolated to the HR grid. With the DR 3DEnVar system, a 90% weight for the ensemble covariance yields the lowest forecast errors and the DR hybrid system clearly outperforms the HR GSI 3DVar. Humidity and wind forecasts are also better than those launched from interpolated LR hybrid analyses, but the temperature forecasts are slightly worse. The humidity forecasts are improved most. For precipitation forecasts, the DR 3DEnVar always outperforms HR GSI 3DVar. It also outperforms the LR 3DEnVar, except for the initial forecast period and lower thresholds.
Directory of Open Access Journals (Sweden)
Kurniawati Purwaka Putri
2017-08-01
Full Text Available Sengon (Falcataria moluccana (Miq. Barneby & J.W.Grimes is one of timber producing species of high economic value. Recently, sengon productivity decreases due to pests and diseases, attack is caused by the fungus Uromycladium tepperianum (SACE. McAlp. The control of gall rust disease at seedling level is important, because the stadia nursery are the most vulnerable. The aim of this research was to determine the effectiveness of the type of control in supressing the fungus of U. tepperianum and the growth of sengon in a nursery. The research design used a completely randomized design (CRD with five treatments of gall rust disease control types i.e. control ; biological fertilizer of Plant Growth Promoting Rhizobacteria (PGPR (5 g -L of water, biofungicide (5 g-L of water; chemical fungicide (2 g-L of water; and boron (300 ppm. Each treatment consisted of 20 seedlings repeated 4 times. The observed response were the number of fungal spores, diameter and height of seedlings. In addition, calculation of the effectiveness of the type of controller was counted. The results showed that after two weeks of fungal infections, the highest seedling growth was the seedling treated with fungicide (0.53 cm, while the lowest was the seedling treated with biological fungicide (0.32 cm. PGPR, fungicide biological, chemical fungicides and boron did not effective to the attack of fungus and to increase the growth of height and diameter of sengon seedling after the 4th week of the fungus infection.
Deuteriation of an asymmetric short hydrogen bond. X-ray crystal structure of KF.(CH2CO2D)2
International Nuclear Information System (INIS)
Emsley, J.; Jones, D.J.; Kuroda, R.
1981-01-01
Deuteriation of the strong hydrogen bonds of KF.(CH 2 CO 2 H) 2 shows no isotope effect on the bond lengths. The only significant change is in the bond angle at the fluoride ion which widens to 128.5 from 116 0 . The i.r. spectrum shows very little change. Since the O-H ... F - hydrogen bonds are highly asymmetric, these observations challenge previous predictions about the effects of deuteriation on such bonds. (author)
Albers, Cerese; Sippel, Jason A.; Braun, Scott A.; Miller, Timothy
2012-01-01
Previous studies (e.g., Zhang et al. 2009, Weng et al. 2011) have shown that radial velocity data from airborne and ground-based radars can be assimilated into ensemble Kalman filter (EnKF) systems to produce accurate analyses of tropical cyclone vortices, which can reduce forecast intensity error. Recently, wind speed data from SFMR technology has also been assimilated into the same types of systems and has been shown to improve the forecast intensity of mature tropical cyclones. Two instruments that measure these properties were present during the NASA Genesis and Rapid Intensification Processes (GRIP) field experiment in 2010 which sampled Hurricane Karl, and will next be co-located on the same aircraft for the subsequent NASA HS3 experiment. The High Altitude Wind and Rain Profiling Radar (HIWRAP) is a conically scanning Doppler radar mounted upon NASAs Global Hawk unmanned aerial vehicle, and the usefulness of its radial velocity data for assimilation has not been previously examined. Since the radar scans from above with a fairly large fixed elevation angle, it observes a large component of the vertical wind, which could degrade EnKF analyses compared to analyses with data taken from lesser elevation angles. The NASA Hurricane Imaging Radiometer (HIRAD) is a passive microwave radiometer similar to SFMR, and measures emissivity and retrieves hurricane surface wind speeds and rain rates over a much wider swath. Thus, this study examines the impact of assimilating simulated HIWRAP radial velocity data into an EnKF system, simulated HIRAD wind speed, and HIWRAP+HIRAD with the Weather Research and Forecasting (WRF) model and compares the results to no data assimilation and also to the Truth from which the data was simulated for both instruments.
Gaussian anamorphosis in the analysis step of the EnKF: a joint state-variable/observation approach
Directory of Open Access Journals (Sweden)
Javier Amezcua
2014-09-01
Full Text Available The analysis step of the (ensemble Kalman filter is optimal when (1 the distribution of the background is Gaussian, (2 state variables and observations are related via a linear operator, and (3 the observational error is of additive nature and has Gaussian distribution. When these conditions are largely violated, a pre-processing step known as Gaussian anamorphosis (GA can be applied. The objective of this procedure is to obtain state variables and observations that better fulfil the Gaussianity conditions in some sense. In this work we analyse GA from a joint perspective, paying attention to the effects of transformations in the joint state-variable/observation space. First, we study transformations for state variables and observations that are independent from each other. Then, we introduce a targeted joint transformation with the objective to obtain joint Gaussianity in the transformed space. We focus primarily in the univariate case, and briefly comment on the multivariate one. A key point of this paper is that, when (1–(3 are violated, using the analysis step of the EnKF will not recover the exact posterior density in spite of any transformations one may perform. These transformations, however, provide approximations of different quality to the Bayesian solution of the problem. Using an example in which the Bayesian posterior can be analytically computed, we assess the quality of the analysis distributions generated after applying the EnKF analysis step in conjunction with different GA options. The value of the targeted joint transformation is particularly clear for the case when the prior is Gaussian, the marginal density for the observations is close to Gaussian, and the likelihood is a Gaussian mixture.
Frost, Ray L.; Xi, Yunfei
2012-11-01
Raman spectroscopy complimented with infrared spectroscopy has been used to study the variation in molecular structure of two minerals of the apophyllite mineral group, namely apophyllite-(KF) KCa4Si8O20F·8H2O and apophyllite-(KOH) KCa4Si8O20(F,OH)·8H2O. apophyllite-(KF) and apophyllite-(KOH) are different minerals only because of the difference in the percentage of fluorine to hydroxyl ions. The Raman spectra are dominated by a very intense sharp peak at 1059 cm-1. A band at around 846 cm-1 is assigned to the water librational mode. It is proposed that the difference between apophyllite-(KF) and apophyllite-(KOH) is the observation of two Raman bands in the OH stretching region at around 3563 and 3625 cm-1. Multiple water stretching and bending modes are observed showing that there is much variation in hydrogen bonding between water and the silicate surfaces.
Quantitative Analysis of KF-LiF-ZrF4 Molten Salt by Probe Assisted in-situ LIBS Systems
International Nuclear Information System (INIS)
Kim, S.H.; Moon, J.H.; Kim, D.H.; Hwang, I.S.; Lee, J.H.
2015-01-01
Full text of publication follows: Pyro-processing draws attention as a recycling process of spent nuclear fuel for future nuclear reactor. In the aspect of process control and safeguards of the pyro-processing, it requires a technology to measure the concentration of molten salt in real-time. The existing technologies measure the concentration by chemical analysis of sampled molten salt in the hot cell but it is disadvantageous in the aspects of cost, safety and time. The LIBS (Laser-Induced Breakdown Spectroscopy) is a form of atomic emission spectroscopy in which a pulsed laser is used as the excitation source. LIBS technology is appropriate to measure sensitive nuclear materials in hot cell because it is capable of measuring specimen quantitatively and qualitatively by exited atom by laser. Spectrum obtained from plasma is largely influenced by laser operation conditions and physical properties of specimens. Also, plasma induction is limited on the surface of specimen, so analysis of composition inside of the molten salt is extremely difficult. Thus, several restrictions should be overcome in order to apply LIBS for the measurement of molten salt (KF-LiF-ZrF 4 ) composition in real-time. In this study probe assisted LIBS system will be introduced with KF-LiF-ZrF 4 to quantitatively measure molten salt composition. Echelle spectrometer was used and the measurable wavelength area was 250-400 nm, the range of UV ray. NIST atomic spectra database measured the wavelength for molten salt composition, and each element was selected high signal intensity and wavelength range that is not overlapped by other elements. (authors)
Moravec, Frantisek; Taraschewski, Horst; Anantaphruti, Malinee Thairungroj; Maipanich, Wanna; Laoprasert, Thitiporn
2007-01-01
Physalopterid nematodes identified as Heliconema longissimum (Ortlepp, 1923) were collected from the stomach of rice-paddy eels Pisodonophis boro (Hamilton) (Anguilliformes: Ophichthidae) from two brackish-water localities (mangroves) in Thailand: one in Phan-Nga Province, southwestern Thailand, northeast of Phuket Island, and one in Ranong Province, near the border with Myanmar. Study of the morphology of this hitherto insufficiently known nematode species, including its first SEM examination, enabled a detailed redescription of H. longissimum. Present taxonomic problems in the subfamily Proleptinae Schulz, 1927 are discussed, where a new delimitation of Proleptus Dujardin, 1845, Heliconema Travassos, 1919 and Paraleptus Wu, 1927 is proposed based on the cephalic dentation. H. minnanensis [sic] Damin & Heqing, 2001 is transferred to Paraleptus Wu, 1927 as P. minnanensis (Damin & Heqing, 2001) n. comb. and Paraleptus chiloscyllii Yin & Zhang, 1983 transferred by Damin & Heqing (2001) to Heliconema, is retained in Paraleptus. H. ahiri Karve, 1941 is considered a junior synonym of H. longissimum (Ortlepp, 1923). The present finding of H. longissimum in Pisodonophis boro represents the first host record and the first record of this nematode from Thailand.
International Nuclear Information System (INIS)
Malang, S.; Reimann, J.; Sebening, H.; Barleon, L.; Bogusch, E.; Bojarsky, E.; Borgstedt, H.U.; Buehler, L.; Casal, V.; Deckers, H.; Feuerstein, H.; Fischer, U.; Frees, G.; Graebner, H.; John, H.; Jordan, T.; Kramer, W.; Krieg, R.; Lenhart, L.; Malang, S.; Meyder, R.; Norajitra, P.; Reimann, J.; Schwenk-Ferrero, A.; Schnauder, H.; Stieglitz, R.; Oschinski, J.; Wiegner, E.
1991-12-01
A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary, Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated R and D-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required R and D-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.) [de
Short-Range prediction of a Mediterranean Severe weather event using EnKF: Configuration tests
Carrio Carrio, Diego Saul; Homar Santaner, Víctor
2014-05-01
The afternoon of 4th October 2007, severe damaging winds and torrential rainfall affected the Island of Mallorca. This storm produced F2-F3 tornadoes in the vicinity of Palma, with one person killed and estimated damages to property exceeding 10 M€. Several studies have analysed the meteorological context in which this episode unfolded, describing the formation of a train of multiple thunderstorms along a warm front and the evolution of a squall line organized from convective activity initiated offshore Murcia during that morning. Couhet et al. (2011) attributed the correct simulation of the convective system and particularly its organization as a squall line to the correct representation of a convergence line at low-levels over the Alboran Sea during the first hours of the day. The numerical prediction of mesoscale phenomena which initiates, organizes and evolves over the sea is an extremely demanding challenge of great importance for coastal regions. In this study, we investigate the skill of a mesoscale ensemble data assimilation system to predict the severe phenomena occurred on 4th October 2007. We use an Ensemble Kalman Filter which assimilates conventional (surface, radiosonde and AMDAR) data using the DART implementation from (NCAR). On the one hand, we analyse the potential of the assimilation cycle to advect critical observational data towards decisive data-void areas over the sea. Furthermore, we assess the sensitivity of the ensemble products to the ensemble size, grid resolution, assimilation period and physics diversity in the mesoscale model. In particular, we focus on the effect of these numerical configurations on the representation of the convective activity and the precipitation field, as valuable predictands of high impact weather. Results show that the 6-h EnKF assimilation period produces initial fields that successfully represent the environment in which initiation occurred and thus the derived numerical predictions render improved
Directory of Open Access Journals (Sweden)
Liyun Su
2011-01-01
Full Text Available In order to suppress the interference of the strong fractional noise signal in discrete-time ultrawideband (UWB systems, this paper presents a new UWB multi-scale Kalman filter (KF algorithm for the interference suppression. This approach solves the problem of the narrowband interference (NBI as nonstationary fractional signal in UWB communication, which does not need to estimate any channel parameter. In this paper, the received sampled signal is transformed through multiscale wavelet to obtain a state transition equation and an observation equation based on the stationarity theory of wavelet coefficients in time domain. Then through the Kalman filter method, fractional signal of arbitrary scale is easily figured out. Finally, fractional noise interference is subtracted from the received signal. Performance analysis and computer simulations reveal that this algorithm is effective to reduce the strong fractional noise when the sampling rate is low.
Energy Technology Data Exchange (ETDEWEB)
Kontrik, M.; Pavlik, V.; Simko, F. [Slovenska Akademia Vied, Ustav Anorganickej Chemie, Oddelenie Taveninovych Sustav, 84636 Bratislava (Slovakia)
2013-04-16
Thesis deals with investigating the addition of chromium trifluoride to eutectic mixture of LiF-NaF-KF (46.5 - 11.5 - 42 mol %) on the corrosion of superalloy Incoloy 800H/HT with static tests. The corrosion losses of the alloy and type of corrosion attack was observed. It was found that the addition of chromium fluoride into the mixture generally increases of corrosion of the material. Several types of corrosion attacks were observed. On the surface of the samples the spotted, pitting and transgranular corrosions were found. On the cross-sections of the samples the subsurface and lamellar corrosions were detected. (authors)
DEFF Research Database (Denmark)
Tetens, Inge
and contributes to reduce hair loss”. The target population proposed by the applicant is healthy adults in the general population. The Panel considers that maintenance of normal hair is a beneficial physiological effect. The applicant identified one single arm study as being pertinent to the health claim...... related to KF2BL20, which is a combination of keratin, copper, zinc, niacin, pantothenic acid, pyridoxine and D-biotin, and maintenance of normal hair. The Panel considers that KF2BL20 is sufficiently characterised. The claimed effect is “helps to reinforce hair strength and normal hair function....... The Panel notes that this study was uncontrolled and considers that no conclusions can be drawn from this study for the scientific substantiation of the claim. The Panel concludes that a cause and effect relationship has not been established between the consumption of KF2BL20 and maintenance of normal hair....
International Nuclear Information System (INIS)
John, H.; Malang, S.; Sebening, H.
1991-12-01
A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary. Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated RandD-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required RandD-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.) [de
Electrochemical behaviours of lanthanide fluorides in the electrolysis system with LiF-NaF-Kf salt
International Nuclear Information System (INIS)
Joon-Bo, Shim; Sung-Chan, Hwang; Eung-Ho, Kim; Young-Ho, Kang; Byung-Jik, Lee; Jae-Hyung, Yoo
2003-01-01
As a part of partitioning studies, the experiments of cyclic voltammetry and electrolytic reduction with the liquid bismuth cathode were conducted to investigate electrochemical behaviours of lanthanide elements in the electrorefining system employing LiF-NaF-KF eutectic salt as the electrolyte. The cyclic voltammograms for NdF 3 and GdF 3 were obtained at various potential scan rates, respectively. The cathodic and anodic peak currents of the elements increased in proportion to the square root of the potential scan rate. According to changes of the potential difference between the coupled cathodic and anodic peaks, reversibilities of the reduction-oxidation reactions in this system were evaluated. In addition, further behaviours of electrochemical reaction of the elements were examined through electrolytic tests of the system using liquid bismuth as the cathode at fixed current densities. (author)
Energy Technology Data Exchange (ETDEWEB)
Michael V. Glazoff
2012-02-01
The KF - ZrF4 system was considered for the application as a heat exchange agent in molten salt nuclear reactors (MSRs) beginning with the work carried out at ORNL in early fifties. Based on a combination of excellent properties such as thermal conductivity, viscosity in the molten state, and other thermo-physical and rheological properties, it was selected as one of possible candidates for the nuclear reactor secondary heat exchanger loop.
Energy Technology Data Exchange (ETDEWEB)
Lenardao, Eder J.; Trecha, Danusia O.; Ferreira, Patricia da C.; Jacob, Raquel G.; Perin, Gelson [Universidade Federal de Pelotas (UFPEL), Pelotas, RS (Brazil). Inst. de Quimica e Geociencias. Lab. de Sintese Organica Limpa (LASOL)]. E-mail: lenardao@ufpel.edu.br
2009-07-01
A general, clean and easy method for the conjugated addition of thiols to citral promoted by KF/Al{sub 2}O{sub 3} under solvent-free or using glycerin as recyclable solvent at room temperature is described. It was found that the solvent-free protocol is applicable to the direct reaction of thiophenol with the essential oil of lemon grass (Cymbopogon citratus) to afford directly 3,7-dimethyl-3-(phenylthio)oct-6-enal, a potential bactericide agent. The method was extended to other electron-poor alkenes with excellent results. For the solvent-free protocol, the use of microwave irradiation facilitated the procedure and accelerates the reaction. The catalytic system and glycerin can be reused up to three times without previous treatment with comparable activity. (author)
Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM
International Nuclear Information System (INIS)
Kast, G.
1989-04-01
Report on technology tasks: Blanket design studies; development of computational tools for neutronics; corrosion and fatigue of structural materials in flowing Pb-17Li; tritium extraction from liquid Pb-17Li by the use of solid getters; ceramic breeder materials; high field composite conductors; superconducting poloidal field coil development; design and construction of a poloidal field coil for TORE SUPRA as NET-prototype coil; structural materials fatigue characterization at 4 K; low electrical conductivity structural development; MANET 1; pre- and post-irradiation fatigue properties of 1.4914 martensitic steel; in-pile creep-fatigue testing of type 316 and 1.4914 steel; ceramics for first-wall protection and for RF windows; fatigue under dual beam irradiation; low activation ferritic-martensitic steels; plasma facing components; procedures and tools for structural design evaluation; remote maintenance; mechanical component assembly; handling equipment for in-vessel components; safety aspects of the cryosystem and of superconducting magnets; safety guidelines for the design of NET; generic environmental impact assessment for a fusion facility; large components for plasma exhaust pumping; optimization of cryogenic vacuum pumping of He; solid particle separators for plasma exhaust; plasma exhaust purification; adsorption of DT on heated metal beds other than U; catalyst development for the exhaust purification process; ECRH power sources; vacuum and exhaust performance of NET; NET TF pancake tests; CAD DATA exchange between NET and KfK; catalytic plasma exhaust gas clean-up facility for NET; NET blanket handling device; electrical connectors for remote handling. (orig./HP)
Electrochemical separation of uranium in the molten system LiF-NaF-KF-UF4
Korenko, M.; Straka, M.; Szatmáry, L.; Ambrová, M.; Uhlíř, J.
2013-09-01
This article is focused on the electrochemical investigation (cyclic voltammetry and related studies) of possible reduction of U4+ ions to metal uranium in the molten system LiF-NaF-KF(eut.)-UF4 that can provide basis for the electrochemical extraction of uranium from molten salts. Two-step reduction mechanism for U4+ ions involving one electron exchange in soluble/soluble U4+/U3+ system and three electrons exchange in the second step were found on the nickel working electrode. Both steps were found to be reversible and diffusion controlled. Based on cyclic voltammetry, the diffusion coefficients of uranium ions at 530 °C were found to be D(U4+) = 1.64 × 10-5 cm2 s-1 and D(U3+) 1.76 × 10-5 cm2 s-1. Usage of the nickel spiral electrode for electrorefining of uranium showed fairly good feasibility of its extraction. However some oxidant present during the process of electrorefining caused that the solid deposits contained different uranium species such as UF3, UO2 and K3UO2F5.
Daniel C. Laughlin; Jessica J. Leppert; Margaret M. Moore; Carolyn Hull Sieg
2010-01-01
Plants are multifaceted organisms that have evolved ecological strategies for sustaining populations in resource-limited environments (Grime 1979; Craine 2009). Plant strategies can be quantified by measuring functional traits (Grime et al. 1997; Reich et al. 2003), which are the properties of plants that impact plant fitness (Violle et al. 2008) and ecosystem...
KfK-analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 2
International Nuclear Information System (INIS)
Giese, H.
1992-10-01
Using standard data and codes, this first analysis campaign led to results that drastically overestimated measured control rod worths with C/E ratios ranging from 1.17 to 1.28. These findings were in sharp contrast to the results of the majority of earlier control rod experiments in zero-power facilities, where C/E ratios were usually comprised between 1.0 and 1.1. Investigations were then launched to identify the origin of this discrepancy. By comparison with the calculation methods employed by the other working groups engaging in the analysis of the SPX-1 experiments it was found that the principal problem arose from the KfK/BN-procedure used for the homogenization of control rod absorber cross sections. The specific failure of this standard procedure in the case of the SPX-1 analysis is ascribed to the extremely heterogeneous structure of the SPX-1 control rods. In an attempt to improve on this point, a new method for the production of homogenized absorber cross sections was developed and applied to the SPX-1 analysis. The report concludes with a description of this method and a survey of the results obtained for SPX-1. It is found that this revised analysis leads to a significantly improved agreement of measured and calculated control rod worths and to a better consistency with the results of earlier control rod experiments in zero-power facilities. (orig.)
International Nuclear Information System (INIS)
Tang, Y.-Q.; Koike, Yoji; Liu Kai; An, M.-Z.; Morimura, Shigeru; Wu Xiaolei; Kida, Kenji
2008-01-01
A process for producing ethanol from kitchen waste was developed in this study. The process consists of freshness preservation of the waste, saccharification of the sugars in the waste, continuous ethanol fermentation of the saccharified liquid, and anaerobic treatment of the saccharification residue and the stillage. Spraying lactic acid bacteria (LCB) on the kitchen waste kept the waste fresh for over 1 week. High glucose recovery (85.5%) from LCB-sprayed waste was achieved after saccharification using Nagase N-40 glucoamylase. The resulting saccharified liquid was used directly for ethanol fermentation, without the addition of any nutrients. High ethanol productivity (24.0 g l -1 h -1 ) was obtained when the flocculating yeast strain KF-7 was used in a continuous ethanol fermentation process at a dilution rate of 0.8 h -1 . The saccharification residue was mixed with stillage and treated in a thermophilic anaerobic continuous stirred tank reactor (CSTR); a VTS loading rate of 6 g l -1 d -1 with 72% VTS digestion efficiency was achieved. Using this process, 30.9 g ethanol, and 65.2 l biogas with 50% methane, was produced from 1 kg of kitchen waste containing 118.0 g total sugar. Thus, energy in kitchen waste can be converted to ethanol and methane, which can then be used as fuels, while simultaneously treating kitchen waste
Energy Technology Data Exchange (ETDEWEB)
Tang, Yue-Qin; Liu, Kai; An, Ming-Zhe; Morimura, Shigeru; Kida, Kenji [Graduate School of Science and Technology, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Koike, Yoji [Tokyo Gas Co., Ltd., 1-7-7 Suehiro-cho, Tsurumi-ku, Yokohama City, Kanagawa 230-0045 (Japan); Wu, Xiao-Lei [Department of Energy and Resources Engineering, College of Engineering, Peking University, Beijing 100871 (China)
2008-11-15
A process for producing ethanol from kitchen waste was developed in this study. The process consists of freshness preservation of the waste, saccharification of the sugars in the waste, continuous ethanol fermentation of the saccharified liquid, and anaerobic treatment of the saccharification residue and the stillage. Spraying lactic acid bacteria (LCB) on the kitchen waste kept the waste fresh for over 1 week. High glucose recovery (85.5%) from LCB-sprayed waste was achieved after saccharification using Nagase N-40 glucoamylase. The resulting saccharified liquid was used directly for ethanol fermentation, without the addition of any nutrients. High ethanol productivity (24.0 g l{sup -1} h{sup -1}) was obtained when the flocculating yeast strain KF-7 was used in a continuous ethanol fermentation process at a dilution rate of 0.8 h{sup -1}. The saccharification residue was mixed with stillage and treated in a thermophilic anaerobic continuous stirred tank reactor (CSTR); a VTS loading rate of 6 g l{sup -1} d{sup -1} with 72% VTS digestion efficiency was achieved. Using this process, 30.9 g ethanol, and 65.2 l biogas with 50% methane, was produced from 1 kg of kitchen waste containing 118.0 g total sugar. Thus, energy in kitchen waste can be converted to ethanol and methane, which can then be used as fuels, while simultaneously treating kitchen waste. (author)
International Nuclear Information System (INIS)
Michel-Piper, I.; Matussek, P.
1985-06-01
This report describes the hardware and software features, and the use of the microprocessor-controlled multichannel analyzer system SILENA + IRIS. The self-contained portable system, which permits independent accumulation and evaluation of spectral data from the KfK K-edge densitometer, provides one of the possible means for the authentication of resident instruments by safeguards inspectors. The 'K-Edge' program, written in PL/M language for compatibility with the system's firmware, allows fully automated assays of heavy element concentrations in solutions by means of X-ray absorption edge spectrometry. It is primarily intended for highly accurate determinations of the U and Pu content in process- and product solutions of a reprocessing plant. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Wilson, Mollye C.; Einfeld, Wayne; Boucher, Raymond M.; Brown, Gary Stephen; Tezak, Matthew Stephen
2011-06-01
Recovery of Bacillus atrophaeous spores from grime-treated and clean surfaces was measured in a controlled chamber study to assess sampling method performance. Outdoor surfaces investigated by wipe and vacuum sampling methods included stainless steel, glass, marble and concrete. Bacillus atrophaeous spores were used as a surrogate for Bacillus anthracis spores in this study designed to assess whether grime-coated surfaces significantly affected surface sampling method performance when compared to clean surfaces. A series of chamber tests were carried out in which known amounts of spores were allowed to gravitationally settle onto both clean and dirty surfaces. Reference coupons were co-located with test coupons in all chamber experiments to provide a quantitative measure of initial surface concentrations of spores on all surfaces, thereby allowing sampling recovery calculations. Results from these tests, carried out under both low and high humidity conditions, show that spore recovery from grime-coated surfaces is the same as or better than spore recovery from clean surfaces. Statistically significant differences between method performance for grime-coated and clean surfaces were observed in only about half of the chamber tests conducted.
Directory of Open Access Journals (Sweden)
Tzu-Hsiung Yen
2011-01-01
Full Text Available Typhoon Morakot produced record-breaking accumulated rainfall over southern Taiwan in August 2009. The combination of several factors resulted in this extreme weather event: the steep terrain in Taiwan, the prevailing south-westerly flow in the monsoon trough, Typhoon Goni over the northern South China Sea, and the slow translation speed of Morakot itself over Taiwan. In this study, the influence of the translation speed is particularly emphasized. Based on the EnKF data assimilation, an innovative method is applied to perform ensemble simulations with several designated translation speeds of Morakot using the WRF model. Thus the influence of the translation speed on the amount of accumulated rainfall over Taiwan can be quantitatively evaluated. In the control simulation with observed translation speed, the maximum amount and geographic pattern of accumulated rainfall during the landfall period of Morakot are generally consistent with the observations, though the detailed overall distributions of accumulated rainfall is mostly underestimated, resulting in the low bias of the frequency distribution of the accumulated rainfall. In a simulation with nearly-doubled translation speed of Morakot, the maximum accumulated rainfall is decreased by 33% than that in the control simulation, while the rainfall distribution over Taiwan remains similar. In addition, the 28 ensemble members can further provide additional information in terms of their spread and other statistics. The results from ensemble members reveal the usefulness of ensemble simulations for the quantitative precipitation forecast.
International Nuclear Information System (INIS)
Ghezal, A.
1987-09-01
The transformation into a vitrified block of highly radioactive liquid wastes is actually the best solution for the storage in long run. In West Germany, the research institute in the field of nuclear energy (KfK) has been oriented in this way by developing industrial processes of vitrification and by following studies on the behaviour of the final products. For the fission products, the chosen glasses present good stability characteristics and are used as a first barrier during confinement. Our work, which is part of the research program on radioactive waste vitrification, consists of preparing borosilicate glass GP 98/12 and studying physical and chemical characteristics. We have also contributed to the development and the realization of glass blocks sampling system prepared at pilot scale
"Byrummets ånd. Genius Loci/The Spirit of Urban Spaces"
DEFF Research Database (Denmark)
Reeh, Henrik
2004-01-01
byrum, Genius loci, Christian Norberg-Schulz, Sønder Boulevard, Berlin, nykultur, fortove, barndomserindringer......byrum, Genius loci, Christian Norberg-Schulz, Sønder Boulevard, Berlin, nykultur, fortove, barndomserindringer...
Directory of Open Access Journals (Sweden)
Tri Ratna Sulistiyani
2013-04-01
Full Text Available Isoflavone has multiple beneficial effects on human health, especially through its antioxidant and anticancer activities. The biotransformation of isoflavone using byphenyl dioxygenase could be performed to extend the diversity of flavonoids and to improve their biological and physiological properties. Biotransformation of two enantiomers (3R, 4R-cis-isoflavan-4-ol and (3S, 4S-cis-isoflavan-4-ol by E. coli JM109 (pJHF108 carrying a biphenyl dioxygenase gene from P. pseudoalcaligenesKF707 produced two products, designated as CM1 andCM2. The products had a retention time of 11.9 and 14.6 min, respectively, and the same absorption peaks at 204, 220, and 275 nm. CM1 and CM2 had [M-H2O+H]+ at m/z 225. Based on the molecular mass and hydrolysis products, we proposed that epoxidation occurred on cis-isoflavan-4-ol. Chloroform extraction instead of ethyl acetate extraction was performed to improve the stability of cismetabolites, CM1 and CM2.
International Nuclear Information System (INIS)
Hudina, M.; Huggenberger, M.; Dalle Donne, M.; Meyer, L.; Rehme, K.
1978-10-01
Heat transfer and pressure drop experiments with an identical fuel rod simulator have been performed at the two Research Establishments in Wuerenlingen and in Karlsruhe. The rod was artificially roughened with 'two-dimensional' ribs of trapezoidal shape and with rounded edges. The experiments at EIR were performed with CO 2 and the rough rod was contained in a smooth tube and centered by special spacers. The experiments at KfK were performed using helium and nitrogen in the same test section (rod and outer smooth tube with spacers) and air with the rod mounted in another outer smooth tube and with spacers located farther away from the measuring positions. The global measured friction factors and Stanton numbers for different gases agree reasonably well. The differences between the roughness parameters R and G are larger. The possible reasons for the uncertainties in the reduction of these parameters are discussed. It is recommended to perform further experiments with helium in a test section with spacers far apart, to investigate the effect of the temperature ratio on heat transfer and to check if the unfavourable data obtained by the experiment with air are too pessimistic for GCFR application. (orig.) [de
Directory of Open Access Journals (Sweden)
Tao Zhang
2013-09-01
Full Text Available A series of diaryl amines, ethers and thioethers were synthesized under microwave irradiation efficiently at presence of KF/Al2O3 in 83%–96% yields without any solvent. The salient characters of this method lie in short reaction time, high yields, general applicability to substrates and simple workup procedure. At the same time, their antifungal biological activities against six phytopathogen were evaluated. Most of the compounds (3b, 3c, 3g–o are more potent than thiophannate-methyl against to Magnaporthe oryzae. This implies that diaryl amine or ether moiety may be helpful in finding a fungicide against Magnaporthe oryzae.
Perceptions of brick architecture : interview with Jeroen Geurst
Agyin, J.N.K.F.; Jenniskens, D.P.H.
Jeroen Geurst (1960) studied architecture at Delft University of Technology and co-founded Geurst & Schulze architects with Rens Schulze in 1984. Over the span of more than three decades, the office has developed a large oeuvre of predominantly brick buildings. Geurst furthermore recently
International Nuclear Information System (INIS)
Ochoa, Franklyn E. Colmenares
2006-01-01
A fuel cell is like a battery that instead of using electricity to recharge itself, it uses hydrogen. In the fuel cell industry, one of the main problems is storing hydrogen in a safe way and extracting it economically. Gaseous hydrogen requires high pressures which could be very dangerous in case of a collision. The success of hydrogen use depends largely on the development of an efficient storage and release method. In an effort to develop a better hydrogen storage system for fuel cells technology this research investigates the use of 99% pure diamond powder for storing hydrogen. Mixing this powder with a calcium fluoride and potassium fluoride compound in its solid form and treating the surface of the powder with hydrogen plasma, modifies the surface of the diamond. After some filtration through distilled water and drying, the modified diamond is treated with hydrogen. We expect hydrogen to be attracted to the diamond powder surface in higher quantities due to the CaF2 and KF treatment. Due to the large surface area of diamond nanopowder and the electronegative terminal bonds of the fluorine particles on the structure's surface, to the method shows promise in storing high densities of hydrogen
2011-02-18
... Plant, LiDAR (Optical Remote-Sensing Technology) Virtual Tour of Hidden Cave, Hidden Cave and Grimes... proposals and RAC-hosted public comment, landscape approach/land health assessment processes, impacts to...
Micropigmentation for Vitiligo
... E. Grimes, MD - Los Angeles, California Micropigmentation for Vitiligo Micropigmentation involves implanting small particles of natural pigment ... Keloid formation MRI complications Why choose micropigmentation for vitiligo Micropigmentation can: Help blend the color of vitiligo ...
Kiwifruit Non-Sugar Components Reduce Glycaemic Response to Co-Ingested Cereal in Humans
Directory of Open Access Journals (Sweden)
Suman Mishra
2017-10-01
Full Text Available Kiwifruit (KF effects on the human glycaemic response to co-ingested wheat cereal were determined. Participants (n = 20 consumed four meals in random order, all being made to 40 g of the same available carbohydrate, by adding kiwifruit sugars (KF sug; glucose, fructose, sucrose 2:2:1 to meals not containing KF. The meals were flaked wheat biscuit (WB+KFsug, WB+KF, WB+guar gum+KFsug, WB+guar gum+KF, that was ingested after fasting overnight. Blood glucose was monitored 3 h and hunger measured at 180 min post-meal using a visual analogue scale. KF and guar reduced postprandial blood glucose response amplitude, and prevented subsequent hypoglycaemia that occurred with WB+KFsug. The area between the blood glucose response curve and baseline from 0 to 180 min was not significantly different between meals, 0–120 min areas were significantly reduced by KF and/or guar. Area from 120 to 180 min was positive for KF, guar, and KF+guar, while the area for the WB meal was negative. Hunger at 180 min was significantly reduced by KF and/or guar when compared with WB. We conclude that KF components other than available carbohydrate may improve the glycaemic response profile to co-ingested cereal food.
Directory of Open Access Journals (Sweden)
Kentaro Nakamura
2018-02-01
Full Text Available Low-carbohydrate, high-fat diets (ketogenic diets might prevent tumor progression and could be used as supportive therapy; however, few studies have addressed the effect of such diets on colorectal cancer. An infant formula with a ketogenic composition (ketogenic formula; KF is used to treat patients with refractory epilepsy. We investigated the effect of KF on cancer and cancer cachexia in colon tumor-bearing mice. Mice were randomized into normal (NR, tumor-bearing (TB, and ketogenic formula (KF groups. Colon 26 cells were inoculated subcutaneously into TB and KF mice. The NR and TB groups received a standard diet, and the KF mice received KF ad libitum. KF mice preserved their body, muscle, and carcass weights. Tumor weight and plasma IL-6 levels were significantly lower in KF mice than in TB mice. In the KF group, energy intake was significantly higher than that in the other two groups. Blood ketone body concentrations in KF mice were significantly elevated, and there was a significant negative correlation between blood ketone body concentration and tumor weight. Therefore, KF may suppress the progression of cancer and the accompanying systemic inflammation without adverse effects on weight gain, or muscle mass, which might help to prevent cancer cachexia.
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
DiFilippo, Erica L.; Eganhouse, Robert P.
2010-01-01
Solid-phase microextraction (SPME) has shown potential as an in situ passive-sampling technique in aquatic environments. The reliability of this method depends upon accurate determination of the partition coefficient between the fiber coating and water (Kf). For some hydrophobic organic compounds (HOCs), Kf values spanning 4 orders of magnitude have been reported for polydimethylsiloxane (PDMS) and water. However, 24% of the published data examined in this review did not pass the criterion for negligible depletion, resulting in questionable Kf values. The range in reported Kf is reduced to just over 2 orders of magnitude for some polychlorinated biphenyls (PCBs) when these questionable values are removed. Other factors that could account for the range in reported Kf, such as fiber-coating thickness and fiber manufacturer, were evaluated and found to be insignificant. In addition to accurate measurement of Kf, an understanding of the impact of environmental variables, such as temperature and ionic strength, on partitioning is essential for application of laboratory-measured Kf values to field samples. To date, few studies have measured Kf for HOCs at conditions other than at 20 degrees or 25 degrees C in distilled water. The available data indicate measurable variations in Kf at different temperatures and different ionic strengths. Therefore, if the appropriate environmental variables are not taken into account, significant error will be introduced into calculated aqueous concentrations using this passive sampling technique. A multiparameter linear solvation energy relationship (LSER) was developed to estimate log Kf in distilled water at 25 degrees C based on published physicochemical parameters. This method provided a good correlation (R2 = 0.94) between measured and predicted log Kf values for several compound classes. Thus, an LSER approach may offer a reliable means of predicting log Kf for HOCs whose experimental log Kf values are presently unavailable. Future
DEFF Research Database (Denmark)
Groth, Sanne Krogh
2015-01-01
PROFESSOR PORTRAIT: Sanne Krogh Groth met Holger Schulze, newly appointed professor in Musicology at the Department for Arts and Cultural Studies, University of Copenhagen, to a talk about anthropology of sound, sound studies, musical canons and ideology.......PROFESSOR PORTRAIT: Sanne Krogh Groth met Holger Schulze, newly appointed professor in Musicology at the Department for Arts and Cultural Studies, University of Copenhagen, to a talk about anthropology of sound, sound studies, musical canons and ideology....
Influence of Polyaniline Coated Kenaf Fiber on Kenaf Paper Sheet
Abdullah Hisham Nur Syafiqah; Abd Razak Saiful Izwan; Mat Nayan Nadirul Hasraf; Wan Abdul Rahman Wan Aizan
2015-01-01
This paper reports the properties of newly developed electrically conductive natural fiber paper sheet made up of kenaf fiber (KF) incorporated with polyaniline coated kenaf fiber (KF-PANI). This study proposed on dispersion of conductive filler in different amount (wt %) into kenaf pulp for developing different electrical conductivity. The conductive sheet (KF/KF-PANI) revealed a percolation concentration at 25 wt% of KF-PANI. Its scanning electron micrograph showed good paper formation with...
Stopping-power and mass energy-absorption coefficient ratios for Solid Water
International Nuclear Information System (INIS)
Ho, A.K.; Paliwal, B.R.
1986-01-01
The AAPM Task Group 21 protocol provides tables of ratios of average restricted stopping powers and ratios of mean energy-absorption coefficients for different materials. These values were based on the work of Cunningham and Schulz. We have calculated these quantities for Solid Water (manufactured by RMI), using the same x-ray spectra and method as that used by Cunningham and Schulz. These values should be useful to people who are using Solid Water for high-energy photon calibration
International Nuclear Information System (INIS)
Zhao, Songfang; Cheng, Lei; Guo, Yong; Zheng, Yuying; Li, Baoming
2012-01-01
Highlights: ► KF was modified with caprolactam using toluenediisocyanate (TDI) as bridge. ► Modified KF improves interfacial interaction of iPP/KF/PA6 composites. ► Fiber and nylon 6 inhibited the crystallization of PP continuous phase. -- Abstract: To improve the thermal and mechanical properties of isotactic polypropylene (iPP), iPP/Kevlar fiber (KF)/polyamide 6 (PA6) composites were prepared via the melt-extrusion method on twin-screw extruder. Kevlar fiber was modified with caprolactam using toluenediisocyanate (TDI) as bridge. The microstructure of modified KF was successfully characterized by Fourier transform infrared (FT-IR), X-ray photoelectron spectrometer (XPS) and scanning electron microscopy (SEM), the results showed that KF was bonded with caprolactam and became coarser. Then the modified KF was introduced into iPP, the composites have better mechanical and thermal properties, implying that modification of KF was helpful to improve the interfacial interaction of iPP/KF/PA6 composites. Besides, the crystallization curves indicated that crystallization behavior of PA6 in the composites was homogeneous and fractional. Furthermore, compatibilizer content played an important role in the mechanical and thermal properties of composites.
Influence of Polyaniline Coated Kenaf Fiber on Kenaf Paper Sheet
Directory of Open Access Journals (Sweden)
Abdullah Hisham Nur Syafiqah
2015-01-01
Full Text Available This paper reports the properties of newly developed electrically conductive natural fiber paper sheet made up of kenaf fiber (KF incorporated with polyaniline coated kenaf fiber (KF-PANI. This study proposed on dispersion of conductive filler in different amount (wt % into kenaf pulp for developing different electrical conductivity. The conductive sheet (KF/KF-PANI revealed a percolation concentration at 25 wt% of KF-PANI. Its scanning electron micrograph showed good paper formation with no significant damages.
An Efficient State–Parameter Filtering Scheme Combining Ensemble Kalman and Particle Filters
Ait-El-Fquih, Boujemaa
2017-12-11
This work addresses the state-parameter filtering problem for dynamical systems with relatively large-dimensional state and low-dimensional parameters\\' vector. A Bayesian filtering algorithm combining the strengths of the particle filter (PF) and the ensemble Kalman filter (EnKF) is proposed. At each assimilation cycle of the proposed EnKF-PF, the PF is first used to sample the parameters\\' ensemble followed by the EnKF to compute the state ensemble conditional on the resulting parameters\\' ensemble. The proposed scheme is expected to be more efficient than the traditional state augmentation techniques, which suffer from the curse of dimensionality and inconsistency that is particularly pronounced when the state is a strongly nonlinear function of the parameters. In the new scheme, the EnKF and PF interact via their ensembles\\' members, in contrast with the recently introduced two-stage EnKF-PF (TS-EnKF-PF), which exchanges point estimates between EnKF and PF while requiring almost double the computational load. Numerical experiments are conducted with the Lorenz-96 model to assess the behavior of the proposed filter and to evaluate its performances against the joint PF, joint EnKF, and TS-EnKF-PF. Numerical results suggest that the EnKF-PF performs best in all tested scenarios. It was further found to be more robust, successfully estimating both state and parameters in different sensitivity experiments.
An Efficient State–Parameter Filtering Scheme Combining Ensemble Kalman and Particle Filters
Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim
2017-01-01
This work addresses the state-parameter filtering problem for dynamical systems with relatively large-dimensional state and low-dimensional parameters' vector. A Bayesian filtering algorithm combining the strengths of the particle filter (PF) and the ensemble Kalman filter (EnKF) is proposed. At each assimilation cycle of the proposed EnKF-PF, the PF is first used to sample the parameters' ensemble followed by the EnKF to compute the state ensemble conditional on the resulting parameters' ensemble. The proposed scheme is expected to be more efficient than the traditional state augmentation techniques, which suffer from the curse of dimensionality and inconsistency that is particularly pronounced when the state is a strongly nonlinear function of the parameters. In the new scheme, the EnKF and PF interact via their ensembles' members, in contrast with the recently introduced two-stage EnKF-PF (TS-EnKF-PF), which exchanges point estimates between EnKF and PF while requiring almost double the computational load. Numerical experiments are conducted with the Lorenz-96 model to assess the behavior of the proposed filter and to evaluate its performances against the joint PF, joint EnKF, and TS-EnKF-PF. Numerical results suggest that the EnKF-PF performs best in all tested scenarios. It was further found to be more robust, successfully estimating both state and parameters in different sensitivity experiments.
An Adjoint-Based Adaptive Ensemble Kalman Filter
Song, Hajoon
2013-10-01
A new hybrid ensemble Kalman filter/four-dimensional variational data assimilation (EnKF/4D-VAR) approach is introduced to mitigate background covariance limitations in the EnKF. The work is based on the adaptive EnKF (AEnKF) method, which bears a strong resemblance to the hybrid EnKF/three-dimensional variational data assimilation (3D-VAR) method. In the AEnKF, the representativeness of the EnKF ensemble is regularly enhanced with new members generated after back projection of the EnKF analysis residuals to state space using a 3D-VAR [or optimal interpolation (OI)] scheme with a preselected background covariance matrix. The idea here is to reformulate the transformation of the residuals as a 4D-VAR problem, constraining the new member with model dynamics and the previous observations. This should provide more information for the estimation of the new member and reduce dependence of the AEnKF on the assumed stationary background covariance matrix. This is done by integrating the analysis residuals backward in time with the adjoint model. Numerical experiments are performed with the Lorenz-96 model under different scenarios to test the new approach and to evaluate its performance with respect to the EnKF and the hybrid EnKF/3D-VAR. The new method leads to the least root-mean-square estimation errors as long as the linear assumption guaranteeing the stability of the adjoint model holds. It is also found to be less sensitive to choices of the assimilation system inputs and parameters.
An Adjoint-Based Adaptive Ensemble Kalman Filter
Song, Hajoon; Hoteit, Ibrahim; Cornuelle, Bruce D.; Luo, Xiaodong; Subramanian, Aneesh C.
2013-01-01
A new hybrid ensemble Kalman filter/four-dimensional variational data assimilation (EnKF/4D-VAR) approach is introduced to mitigate background covariance limitations in the EnKF. The work is based on the adaptive EnKF (AEnKF) method, which bears a strong resemblance to the hybrid EnKF/three-dimensional variational data assimilation (3D-VAR) method. In the AEnKF, the representativeness of the EnKF ensemble is regularly enhanced with new members generated after back projection of the EnKF analysis residuals to state space using a 3D-VAR [or optimal interpolation (OI)] scheme with a preselected background covariance matrix. The idea here is to reformulate the transformation of the residuals as a 4D-VAR problem, constraining the new member with model dynamics and the previous observations. This should provide more information for the estimation of the new member and reduce dependence of the AEnKF on the assumed stationary background covariance matrix. This is done by integrating the analysis residuals backward in time with the adjoint model. Numerical experiments are performed with the Lorenz-96 model under different scenarios to test the new approach and to evaluate its performance with respect to the EnKF and the hybrid EnKF/3D-VAR. The new method leads to the least root-mean-square estimation errors as long as the linear assumption guaranteeing the stability of the adjoint model holds. It is also found to be less sensitive to choices of the assimilation system inputs and parameters.
Human-Robot Interaction: A Survey
2007-01-01
to the status of law by David Woods [320]. 7.3 Aviation and Air Traffic Control 249 Rich as these models and laws are, they cannot substitute for prac...M. Bennewitz, W. Burgard, A. B. Cremers , F. Dellaert, D. Fox, D. Hähnel, C. Rosenberg, N. Roy, J. Schulte, and D. Schulz, “Prob- abilistic...Thrun, M. Bennewitz, W. Burgard, A. B. Cremers , F. Dellaert, D. Fox, D. Hahnel, C. Rosenberg, N. Roy, J. Schulte, and D. Schulz, “MINERVA: A second
Directory of Open Access Journals (Sweden)
Mónica A Silva
Full Text Available Argos recently implemented a new algorithm to calculate locations of satellite-tracked animals that uses a Kalman filter (KF. The KF algorithm is reported to increase the number and accuracy of estimated positions over the traditional Least Squares (LS algorithm, with potential advantages to the application of state-space methods to model animal movement data. We tested the performance of two Bayesian state-space models (SSMs fitted to satellite tracking data processed with KF algorithm. Tracks from 7 harbour seals (Phoca vitulina tagged with ARGOS satellite transmitters equipped with Fastloc GPS loggers were used to calculate the error of locations estimated from SSMs fitted to KF and LS data, by comparing those to "true" GPS locations. Data on 6 fin whales (Balaenoptera physalus were used to investigate consistency in movement parameters, location and behavioural states estimated by switching state-space models (SSSM fitted to data derived from KF and LS methods. The model fit to KF locations improved the accuracy of seal trips by 27% over the LS model. 82% of locations predicted from the KF model and 73% of locations from the LS model were <5 km from the corresponding interpolated GPS position. Uncertainty in KF model estimates (5.6 ± 5.6 km was nearly half that of LS estimates (11.6 ± 8.4 km. Accuracy of KF and LS modelled locations was sensitive to precision but not to observation frequency or temporal resolution of raw Argos data. On average, 88% of whale locations estimated by KF models fell within the 95% probability ellipse of paired locations from LS models. Precision of KF locations for whales was generally higher. Whales' behavioural mode inferred by KF models matched the classification from LS models in 94% of the cases. State-space models fit to KF data can improve spatial accuracy of location estimates over LS models and produce equally reliable behavioural estimates.
Global Kalman filter approaches to estimate absolute angles of lower limb segments.
Nogueira, Samuel L; Lambrecht, Stefan; Inoue, Roberto S; Bortole, Magdo; Montagnoli, Arlindo N; Moreno, Juan C; Rocon, Eduardo; Terra, Marco H; Siqueira, Adriano A G; Pons, Jose L
2017-05-16
In this paper we propose the use of global Kalman filters (KFs) to estimate absolute angles of lower limb segments. Standard approaches adopt KFs to improve the performance of inertial sensors based on individual link configurations. In consequence, for a multi-body system like a lower limb exoskeleton, the inertial measurements of one link (e.g., the shank) are not taken into account in other link angle estimations (e.g., foot). Global KF approaches, on the other hand, correlate the collective contribution of all signals from lower limb segments observed in the state-space model through the filtering process. We present a novel global KF (matricial global KF) relying only on inertial sensor data, and validate both this KF and a previously presented global KF (Markov Jump Linear Systems, MJLS-based KF), which fuses data from inertial sensors and encoders from an exoskeleton. We furthermore compare both methods to the commonly used local KF. The results indicate that the global KFs performed significantly better than the local KF, with an average root mean square error (RMSE) of respectively 0.942° for the MJLS-based KF, 1.167° for the matrical global KF, and 1.202° for the local KFs. Including the data from the exoskeleton encoders also resulted in a significant increase in performance. The results indicate that the current practice of using KFs based on local models is suboptimal. Both the presented KF based on inertial sensor data, as well our previously presented global approach fusing inertial sensor data with data from exoskeleton encoders, were superior to local KFs. We therefore recommend to use global KFs for gait analysis and exoskeleton control.
International Nuclear Information System (INIS)
Ali, M. S.; Latif, Z.
2016-01-01
Various molecular techniques like analysis of the amplified rDNA internal transcribed spacers (ITS), intragenic spacers and total ITS region analysis by restriction fragment length polymorphism (RFLP) has been introduced for yeast identification but there are limited databases to identify yeast species on the basis of 5.8S rDNA. In this study, twenty nine yeast strains from various sources including spoiled fruits, vegetables, foodstuffs, and concentrated juices were characterized by PCR-RFLP. PCR-RFLP has been used to characterize yeasts present in different spoiled food samples after isolation of the yeasts. By using this technique, the isolated yeast strains were characterized by direct 5.8S-ITS rDNA region amplification. RFLP analysis was applied to each of the amplification products (varied from 400bp to 800bp) detected, and the corresponding yeast identifications were made according to each specific restriction patterns obtained after treatment with two endonucleases TaqI and HaeIII which yielded a specific banding pattern for each species. For further confirmation amplified products of eleven selected isolates were sequenced and blast on NCBI. Both RFLP and sequence analyses of the strains with accession nos. KF472163, KF472164, KF472165, KF472166, KF472167, KF472168, KF472169, KF472170, KF472171, KF472172, KF472173 gave significantly similar results. The isolates were found to belong five different yeast species including; Candida spp., Pichia spp., Kluyveromyces spp., Clavispora spp. and Hanseniaspora spp. This method provides a fast, easy, reliable and authentic way for determining yeast population present in different type of samples, as compared to traditional characterization technique. (author)
Anwendung des autogenen Trainings im Kindesalter
Sühling, Nikola
2004-01-01
The autogenic training was developed by J.H.Schulz in the period between 1912-1920 based on the experiences of his hypnosis patients. These reported of a regular occurrence of certain perceptions at the beginning of the treatment. J.H.Schulz derived six exercises from this experience, through which the patient is said to get relaxed. Among others these exercises contain the idea to get warm and heavy arms and legs. Furthermore, physical reactions in the abdomen, thorax and the head will be in...
2013-12-27
... (IP) application submitted by U.S. Route 460 Mobility Partners (the Applicant) for the discharge of... Street, Suite 750, Richmond, VA 23219. FOR FURTHER INFORMATION CONTACT: Alice Allen-Grimes, email: [email protected] ; (757) 201-7219. Ed Sundra, email: [email protected] ; (804) 775-3357...
Directory of Open Access Journals (Sweden)
Lili Lei
2012-05-01
Full Text Available A hybrid data assimilation approach combining nudging and the ensemble Kalman filter (EnKF for dynamic analysis and numerical weather prediction is explored here using the non-linear Lorenz three-variable model system with the goal of a smooth, continuous and accurate data assimilation. The hybrid nudging-EnKF (HNEnKF computes the hybrid nudging coefficients from the flow-dependent, time-varying error covariance matrix from the EnKF's ensemble forecasts. It extends the standard diagonal nudging terms to additional off-diagonal statistical correlation terms for greater inter-variable influence of the innovations in the model's predictive equations to assist in the data assimilation process. The HNEnKF promotes a better fit of an analysis to data compared to that achieved by either nudging or incremental analysis update (IAU. When model error is introduced, it produces similar or better root mean square errors compared to the EnKF while minimising the error spikes/discontinuities created by the intermittent EnKF. It provides a continuous data assimilation with better inter-variable consistency and improved temporal smoothness than that of the EnKF. Data assimilation experiments are also compared to the ensemble Kalman smoother (EnKS. The HNEnKF has similar or better temporal smoothness than that of the EnKS, and with much smaller central processing unit (CPU time and data storage requirements.
Investigation of the effect of potassium on Cu(In,Ga)Se{sub 2} layers and solar cells
Energy Technology Data Exchange (ETDEWEB)
Laemmle, A., E-mail: anke.laemmle@zsw-bw.de; Wuerz, R.; Powalla, M.
2015-05-01
We investigate the influence of potassium (K) on the Cu(In,Ga)Se{sub 2} (CIGS) growth kinetics on alkali-free alumina substrates and the electrical parameters of the CIGS solar cell by intentional K doping of the CIGS layer by a KF-precursor layer and KF-post deposition treatment (PDT). Secondary ion mass spectroscopy measurements revealed that K can be incorporated into the CIGS layer by both processes. The CIGS composition of the KF-precursor sample shows a stronger [Ga]/([Ga] + [In]) (GGI) profile. By analysing the samples with scanning electron microscopy we observed smaller CIGS grains for the KF-precursor sample compared to the K-free reference and KF-PDT sample. jV-measurements of the KF-PDT and the KF-precursor sample show an increase in the cell efficiency η from 10.7% to 13.6% and 13.7%, respectively, compared to the K-free reference sample. The external quantum efficiency measurements of the KF-precursor sample show an increased absorption in the infrared region. Capacitance-voltage measurements reveal an increase in the net doping concentration of both samples treated with K. We assume that the enhancement is caused by passivation of grain boundaries and donor-like defects by K, as previously demonstrated for Na. - Highlights: • K-doped Cu(In,Ga)Se{sub 2} (CIGS) layers from KF-precursor and KF-post deposition treatment • Separation of the K-effect from the Na-effect by using alkali-free substrates • Interdiffusion of CIGS elements during CIGS growth is hindered by K • KF-precursor leads to smaller CIGS grains and a stronger Cu depletion at the CIGS surface. • K leads to an increase in the conversion efficiency.
Menegaldo, Luciano L
2017-12-01
State-space control of myoelectric devices and real-time visualization of muscle forces in virtual rehabilitation require measuring or estimating muscle dynamic states: neuromuscular activation, tendon force and muscle length. This paper investigates whether regular (KF) and extended Kalman filters (eKF), derived directly from Hill-type muscle mechanics equations, can be used as real-time muscle state estimators for isometric contractions using raw electromyography signals (EMG) as the only available measurement. The estimators' amplitude error, computational cost, filtering lags and smoothness are compared with usual EMG-driven analysis, performed offline, by integrating the nonlinear Hill-type muscle model differential equations (offline simulations-OS). EMG activity of the three triceps surae components (soleus, gastrocnemius medialis and gastrocnemius lateralis), in three torque levels, was collected for ten subjects. The actualization interval (AI) between two updates of the KF and eKF was also varied. The results show that computational costs are significantly reduced (70x for KF and 17[Formula: see text] for eKF). The filtering lags presented sharp linear relationships with the AI (0-300 ms), depending on the state and activation level. Under maximum excitation, amplitude errors varied in the range 10-24% for activation, 5-8% for tendon force and 1.4-1.8% for muscle length, reducing linearly with the excitation level. Smoothness, measured by the ratio between the average standard variations of KF/eKF and OS estimations, was greatly reduced for activation but converged exponentially to 1 for the other states by increasing AI. Compared to regular KF, extended KF does not seem to improve estimation accuracy significantly. Depending on the particular application requirements, the most appropriate KF actualization interval can be selected.
Hoyng, Lieke L; Frings, Virginie; Hoekstra, Otto S; Kenny, Laura M; Aboagye, Eric O; Boellaard, Ronald
2015-01-01
Positron emission tomography (PET) with (18)F-3'-deoxy-3'-fluorothymidine ([(18)F]FLT) can be used to assess tumour proliferation. A kinetic-filtering (KF) classification algorithm has been suggested for segmentation of tumours in dynamic [(18)F]FLT PET data. The aim of the present study was to evaluate KF segmentation and its test-retest performance in [(18)F]FLT PET in non-small cell lung cancer (NSCLC) patients. Nine NSCLC patients underwent two 60-min dynamic [(18)F]FLT PET scans within 7 days prior to treatment. Dynamic scans were reconstructed with filtered back projection (FBP) as well as with ordered subsets expectation maximisation (OSEM). Twenty-eight lesions were identified by an experienced physician. Segmentation was performed using KF applied to the dynamic data set and a source-to-background corrected 50% threshold (A50%) was applied to the sum image of the last three frames (45- to 60-min p.i.). Furthermore, several adaptations of KF were tested. Both for KF and A50% test-retest (TRT) variability of metabolically active tumour volume and standard uptake value (SUV) were evaluated. KF performed better on OSEM- than on FBP-reconstructed PET images. The original KF implementation segmented 15 out of 28 lesions, whereas A50% segmented each lesion. Adapted KF versions, however, were able to segment 26 out of 28 lesions. In the best performing adapted versions, metabolically active tumour volume and SUV TRT variability was similar to those of A50%. KF misclassified certain tumour areas as vertebrae or liver tissue, which was shown to be related to heterogeneous [(18)F]FLT uptake areas within the tumour. For [(18)F]FLT PET studies in NSCLC patients, KF and A50% show comparable tumour volume segmentation performance. The KF method needs, however, a site-specific optimisation. The A50% is therefore a good alternative for tumour segmentation in NSCLC [(18)F]FLT PET studies in multicentre studies. Yet, it was observed that KF has the potential to subsegment
UV and visible light photodegradation effect on Fe–CNT/TiO2 ...
Indian Academy of Sciences (India)
The ability of CNT to store and shuttle electrons, and Fe nanoparticles demonstrate its capability to serve as a .... doped TiO2 outside the pores in some segments, this is pos- ..... Roy S C, Varghese O K, Paulose M and Grimes C A 2010 ACS.
Mandel, Jan; Beezley, Jonathan D.; Cobb, Loren; Krishnamurthy, Ashok
2010-01-01
The FFT EnKF data assimilation method is proposed and applied to a stochastic cell simulation of an epidemic, based on the S-I-R spread model. The FFT EnKF combines spatial statistics and ensemble filtering methodologies into a localized and computationally inexpensive version of EnKF with a very small ensemble, and it is further combined with the morphing EnKF to assimilate changes in the position of the epidemic. PMID:21031155
1987-03-01
Culture media were m-Endo (Mtillipore) , m-FC broth and . m- Enterococcus agar (Difco). ualitv control was performed according to EP. guidelines (Dordner...distribution of some young-of-the-year fishes in DeGray Lake, Arkansas, 1975-1978. Proc. Fifth Annu. Larval Fish Conf. GRIMES, C. E. 1975. Entrapment
Mean-field Ensemble Kalman Filter
Law, Kody; Tembine, Hamidou; Tempone, Raul
2015-01-01
A proof of convergence of the standard EnKF generalized to non-Gaussian state space models is provided. A density-based deterministic approximation of the mean-field limiting EnKF (MFEnKF) is proposed, consisting of a PDE solver and a quadrature
Tkacheva, O.; Dedyukhin, A.; Redkin, A.; Zaikov, Yu.
2017-07-01
The CaF2 effect on the liquidus temperature, electrical conductivity and alumina solubility in the potassium-sodium and potassium-lithium cryolite melts with cryolite ratio (CR = (nKF+nMF)/nAlF3, M = Li, Na) 1.3 was studied. The liquidus temperature in the quisi-binary system [KF-LiF-AlF3]-CaF2 changes with the same manner as in the [KF-NaF-AlF3]-CaF2. The electrical conductivity in the KF-NaF-AlF3-CaF2 melt decreases with increasing the CaF2 content, but it slightly raises with the first small addition of CaF2 into the KF-LiF-AlF3-CaF2 melts, enriched with KF, which was explained by the increased K+ ions mobility due to their relatively low ionic potential. The contribution of the Li+ cations in conductivity of the KF-LiF-AlF3-CaF2 electrolyte is not noteworthy. The Al2O3 solubility in the KF-NaF-AlF3 electrolyte rises with the increasing KF content, but the opposite tendency is observed in the cryolite mixtures containing CaF2. The insoluble compounds - KCaAl2F9 or KCaF3 - formed in the molten mixtures containing potassium and calcium ions endorse the increase of the liquidus temperature. The calcium fluoride effect on the side ledge formation in the electrolytic cell during low-temperature aluminum electrolysis is discussed.
Fast Kalman-like filtering for large-dimensional linear and Gaussian state-space models
Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim
2015-01-01
This paper considers the filtering problem for linear and Gaussian state-space models with large dimensions, a setup in which the optimal Kalman Filter (KF) might not be applicable owing to the excessive cost of manipulating huge covariance matrices. Among the most popular alternatives that enable cheaper and reasonable computation is the Ensemble KF (EnKF), a Monte Carlo-based approximation. In this paper, we consider a class of a posteriori distributions with diagonal covariance matrices and propose fast approximate deterministic-based algorithms based on the Variational Bayesian (VB) approach. More specifically, we derive two iterative KF-like algorithms that differ in the way they operate between two successive filtering estimates; one involves a smoothing estimate and the other involves a prediction estimate. Despite its iterative nature, the prediction-based algorithm provides a computational cost that is, on the one hand, independent of the number of iterations in the limit of very large state dimensions, and on the other hand, always much smaller than the cost of the EnKF. The cost of the smoothing-based algorithm depends on the number of iterations that may, in some situations, make this algorithm slower than the EnKF. The performances of the proposed filters are studied and compared to those of the KF and EnKF through a numerical example.
Fast Kalman-like filtering for large-dimensional linear and Gaussian state-space models
Ait-El-Fquih, Boujemaa
2015-08-13
This paper considers the filtering problem for linear and Gaussian state-space models with large dimensions, a setup in which the optimal Kalman Filter (KF) might not be applicable owing to the excessive cost of manipulating huge covariance matrices. Among the most popular alternatives that enable cheaper and reasonable computation is the Ensemble KF (EnKF), a Monte Carlo-based approximation. In this paper, we consider a class of a posteriori distributions with diagonal covariance matrices and propose fast approximate deterministic-based algorithms based on the Variational Bayesian (VB) approach. More specifically, we derive two iterative KF-like algorithms that differ in the way they operate between two successive filtering estimates; one involves a smoothing estimate and the other involves a prediction estimate. Despite its iterative nature, the prediction-based algorithm provides a computational cost that is, on the one hand, independent of the number of iterations in the limit of very large state dimensions, and on the other hand, always much smaller than the cost of the EnKF. The cost of the smoothing-based algorithm depends on the number of iterations that may, in some situations, make this algorithm slower than the EnKF. The performances of the proposed filters are studied and compared to those of the KF and EnKF through a numerical example.
Directory of Open Access Journals (Sweden)
Huapeng Yu
2015-02-01
Full Text Available The Kalman filter (KF has always been used to improve north-finding performance under practical conditions. By analyzing the characteristics of the azimuth rotational inertial measurement unit (ARIMU on a stationary base, a linear state equality constraint for the conventional KF used in the fine north-finding filtering phase is derived. Then, a constrained KF using the state equality constraint is proposed and studied in depth. Estimation behaviors of the concerned navigation errors when implementing the conventional KF scheme and the constrained KF scheme during stationary north-finding are investigated analytically by the stochastic observability approach, which can provide explicit formulations of the navigation errors with influencing variables. Finally, multiple practical experimental tests at a fixed position are done on a postulate system to compare the stationary north-finding performance of the two filtering schemes. In conclusion, this study has successfully extended the utilization of the stochastic observability approach for analytic descriptions of estimation behaviors of the concerned navigation errors, and the constrained KF scheme has demonstrated its superiority over the conventional KF scheme for ARIMU stationary north-finding both theoretically and practically.
All Aboard!: In One Iowa District, All Teachers and Principals Are on the Same Journey
Hansen, Deb; Anderson, Colleen; Munger, Linda; Chizek, Mitzi
2013-01-01
Collaborative learning teams are improving teacher practice and student learning results in the Dallas Center-Grimes Community School District near Des Moines, Iowa. Since 2009, all teachers and principals in the district have participated in collaborative learning teams to study a process known as assessment for learning, in which formative…
Resterilized Polypropylene Mesh for Inguinal Hernia Repair
African Journals Online (AJOL)
2018-04-19
Apr 19, 2018 ... 2018 Nigerian Journal of Surgery | Published by Wolters Kluwer - Medknow. Purpose: The use of prosthetic biomaterials for ... Ifeanyi A Onwuezobe1, Kingsley U Umeh. Access this article online ..... Grimes CE, Law RS, Borgstein ES, Mkandawire NC, Lavy CB. Systematic review of met and unmet need of ...
The invasive alien tree Falcataria moluccana: its impacts and management
Flint Hughes; Tracy Johnson; Amanda Uowolo
2013-01-01
Falcataria moluccana (Miq.) Barneby and Grimes is a large tree that has become invasive in forests and developed landscapes across many Pacific islands. A fast-growing nitrogenfixing species, it transforms invaded ecosystems by dramatically increasing nutrient inputs, suppressing native species and facilitating invasion by other weeds. Individuals rapidly reach heights...
Technical presentation: Next Generation Oscilloscopes
PH Department
2011-01-01
Rohde & Schwarz "Next Generation Oscilloscopes" - Introduction and Presentation Agenda: Wednesday 23 March - 09:30 to 11:30 (open end) Bldg. 13-2-005 Language: English 09.30 Presentation "Next Generation Oscilloscopes" from Rohde & Schwarz RTO / RTM in theory and practice Gerard Walker 10.15 Technical design details from R&D Dr. Markus Freidhof 10.45 Scope and Probe Roadmap (confidential) Guido Schulze 11.00 Open Discussion Feedback, first impression, wishes, needs and requirements from CERN All 11.30 Expert Talks, Hands on All Mr. Dr. Markus Freidhof, Head of R&D Oscilloscopes, Rohde & Schwarz, Germany; Mr. Guido Schulze, ...
DIGITAL FLOOD INSURANCE RATE MAP DATABASE, GRIMES COUNTY, TX
Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...
Predicting Breeding Values in Animals by Kalman Filter
DEFF Research Database (Denmark)
Karacaoren, B; Janss, L L G; Kadarmideen, H N
2012-01-01
The aim of this study was to investigate usefulness of Kalman Filter (KF) Random Walk methodology (KF-RW) for prediction of breeding values in animals. We used body condition score (BCS) from dairy cattle for illustrating use of KF-RW. BCS was measured by Swiss Holstein Breeding Association during...
Multilevel ensemble Kalman filter
Chernov, Alexey; Hoel, Haakon; Law, Kody; Nobile, Fabio; Tempone, Raul
2016-01-01
This work embeds a multilevel Monte Carlo (MLMC) sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF). In terms of computational cost vs. approximation error the asymptotic performance of the multilevel ensemble Kalman filter (MLEnKF) is superior to the EnKF s.
Multilevel ensemble Kalman filter
Chernov, Alexey
2016-01-06
This work embeds a multilevel Monte Carlo (MLMC) sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF). In terms of computational cost vs. approximation error the asymptotic performance of the multilevel ensemble Kalman filter (MLEnKF) is superior to the EnKF s.
Mean-field Ensemble Kalman Filter
Law, Kody
2015-01-07
A proof of convergence of the standard EnKF generalized to non-Gaussian state space models is provided. A density-based deterministic approximation of the mean-field limiting EnKF (MFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for d < 2 . The fidelity of approximation of the true distribution is also established using an extension of total variation metric to random measures. This is limited by a Gaussian bias term arising from non-linearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.
Levitt, Erica S; Abdala, Ana P; Paton, Julian F R; Bissonnette, John M; Williams, John T
2015-10-01
In addition to reductions in respiratory rate, opioids also cause aspiration and difficulty swallowing, indicating impairment of the upper airways. The Kölliker-Fuse (KF) maintains upper airway patency and a normal respiratory pattern. In this study, activation of μ opioid receptors in the KF reduced respiratory frequency and tidal volume in anaesthetized rats. Nerve recordings in an in situ preparation showed that activation of μ opioid receptors in the KF eliminated the post-inspiration phase of the respiratory cycle. In brain slices, μ opioid agonists hyperpolarized a distinct population (61%) of KF neurons by activation of an inwardly rectifying potassium conductance. These results suggest that KF neurons that are hyperpolarized by opioids could contribute to opioid-induced respiratory disturbances, particularly the impairment of upper airways. Opioid-induced respiratory effects include aspiration and difficulty swallowing, suggesting impairment of the upper airways. The pontine Kölliker-Fuse nucleus (KF) controls upper airway patency and regulates respiration, in particular the inspiratory/expiratory phase transition. Given the importance of the KF in coordinating respiratory pattern, the mechanisms of μ opioid receptor activation in this nucleus were investigated at the systems and cellular level. In anaesthetized, vagi-intact rats, injection of opioid agonists DAMGO or [Met(5) ]enkephalin (ME) into the KF reduced respiratory frequency and amplitude. The μ opioid agonist DAMGO applied directly into the KF of the in situ arterially perfused working heart-brainstem preparation of rat resulted in robust apneusis (lengthened low amplitude inspiration due to loss of post-inspiratory drive) that was rapidly reversed by the opioid antagonist naloxone. In brain slice preparations, activation of μ opioid receptors on KF neurons hyperpolarized a distinct population (61%) of neurons. As expected, the opioid-induced hyperpolarization reduced the excitability of
75 FR 44155 - Final Flood Elevation Determinations
2010-07-28
.... Approximately 1,400 feet +7776 upstream of West Grimes Creek Road. Junction Creek At Pleasant Drive in Durango.... Unincorporated Areas of La Plata County Maps are available for inspection at 1060 East 2nd Avenue, Durango, CO.... Pepin County. Approximately 6,000 feet +717 upstream of the confluence with Bear Creek. Mississippi...
Multilevel ensemble Kalman filtering
Hoel, Haakon
2016-01-08
The ensemble Kalman filter (EnKF) is a sequential filtering method that uses an ensemble of particle paths to estimate the means and covariances required by the Kalman filter by the use of sample moments, i.e., the Monte Carlo method. EnKF is often both robust and efficient, but its performance may suffer in settings where the computational cost of accurate simulations of particles is high. The multilevel Monte Carlo method (MLMC) is an extension of classical Monte Carlo methods which by sampling stochastic realizations on a hierarchy of resolutions may reduce the computational cost of moment approximations by orders of magnitude. In this work we have combined the ideas of MLMC and EnKF to construct the multilevel ensemble Kalman filter (MLEnKF) for the setting of finite dimensional state and observation spaces. The main ideas of this method is to compute particle paths on a hierarchy of resolutions and to apply multilevel estimators on the ensemble hierarchy of particles to compute Kalman filter means and covariances. Theoretical results and a numerical study of the performance gains of MLEnKF over EnKF will be presented. Some ideas on the extension of MLEnKF to settings with infinite dimensional state spaces will also be presented.
Multilevel ensemble Kalman filtering
Hoel, Haakon; Chernov, Alexey; Law, Kody; Nobile, Fabio; Tempone, Raul
2016-01-01
The ensemble Kalman filter (EnKF) is a sequential filtering method that uses an ensemble of particle paths to estimate the means and covariances required by the Kalman filter by the use of sample moments, i.e., the Monte Carlo method. EnKF is often both robust and efficient, but its performance may suffer in settings where the computational cost of accurate simulations of particles is high. The multilevel Monte Carlo method (MLMC) is an extension of classical Monte Carlo methods which by sampling stochastic realizations on a hierarchy of resolutions may reduce the computational cost of moment approximations by orders of magnitude. In this work we have combined the ideas of MLMC and EnKF to construct the multilevel ensemble Kalman filter (MLEnKF) for the setting of finite dimensional state and observation spaces. The main ideas of this method is to compute particle paths on a hierarchy of resolutions and to apply multilevel estimators on the ensemble hierarchy of particles to compute Kalman filter means and covariances. Theoretical results and a numerical study of the performance gains of MLEnKF over EnKF will be presented. Some ideas on the extension of MLEnKF to settings with infinite dimensional state spaces will also be presented.
1986 progress report on R and D work of the Nuclear Fusion Project (PKF)
International Nuclear Information System (INIS)
Kast, G.
1987-03-01
The Kernforschungszentrum Karlsruhe (KfK) and the Max-Planck-Institute for Plasma Physics, Garching, have joined to form the Entwicklungsgemeinschaft Kernfusion, and under this roof perform research work on the physical and technical conditions and requirements of using the energy from nuclear fusion, and to plan the design and the construction of the necessary equipment for future large-scale experiments. The activities of the KfK for the development of fusion devices with magnetic confinement have been concentrated in the Nuclear Fusion Project, which cooperates in the European Fusion Technology Programme, on the basis of an association agreement between KfK and Euratom, supported by the European Commission. Supplementary KfK contributions, studies in most cases, create a connection between various fields of work, and prepare the road for new tasks, which in the years to come will be found in the extension of the Fusion Technology Programme and the planning work for NET. The reports collected in this annual survey are contributions from KfK Institutes of the year 1986. An annex presents the Easks taken over by KfK within the Fusion Technology Programme of the EC, and notes on the KfK Institutes taking part in the particular activities facilitate reference to the individual, full-text reports. (orig.) [de
Desensitization and Tolerance of Mu Opioid Receptors on Pontine Kölliker-Fuse Neurons.
Levitt, Erica S; Williams, John T
2018-01-01
Acute desensitization of mu opioid receptors is thought to be an initial step in the development of tolerance to opioids. Given the resistance of the respiratory system to develop tolerance, desensitization of neurons in the Kölliker-Fuse (KF), a key area in the respiratory circuit, was examined. The activation of G protein-coupled inwardly rectifying potassium current was measured using whole-cell voltage-clamp recordings from KF and locus coeruleus (LC) neurons contained in acute rat brain slices. A saturating concentration of the opioid agonist [Met 5 ]-enkephalin (ME) caused significantly less desensitization in KF neurons compared with LC neurons. In contrast to LC, desensitization in KF neurons was not enhanced by activation of protein kinase C or in slices from morphine-treated rats. Cellular tolerance to ME and morphine was also lacking in KF neurons from morphine-treated rats. The lack of cellular tolerance in KF neurons correlates with the relative lack of tolerance to the respiratory depressant effect of opioids. Copyright © 2018 by The American Society for Pharmacology and Experimental Therapeutics.
Just like My Nanny: Troubling Teacher's Social Identities in the Classroom
Tan, Edna
2013-01-01
Teacher-researcher narrative accounts are essential and insightful for the science education field, yet they are few and far-between. In this forum, I engage in dialogue with Nicole Grimes's auto-ethnographic narrative on the affordances her femme-Caribbean identity allowed for some students to engage more deeply in science. While I agree with and…
1992-01-01
92NAT-057 1029 CORPORATION WAY Office: NATICK PALO ALTO, CA 94303 Contract #: Phone: (415) 962-9111 P1: Craig A. Grimes Title: Development of Low...INC. AF Topic#: 92-042 ARMY Topic#: 92-139 AF Topic#: 92-066 DEEGAN RESEARCH GROUP, INC. AF Topic#: 92-138 AF Topic#: 92-001 SDIO Topic#: 92-003
Export financing of nuclear power plants - banks experience
International Nuclear Information System (INIS)
Loeber
1976-01-01
Export financing of a nuclear power plant to be exported from Germany, is, in principle, provided by German commercial banks and KfW (Kreditanstalt fuer Wiederaufbau). As a rule, 50 per cent of the financing of maturities falling due under the export portion of the loan will be taken over by a banking syndicate of approximately 25 member banks, and the remaining 50 per cent would be provided by KfW. KfW and the commercial banks must grant their loans at the respective money market conditions. The banks' and KfW's loans will normally be disbursed pro rata delivery. (HP) [de
1988-06-01
loop equations can be written in terms of the extended space XE = h ., where . C 7, to get SA = + G 0w(54 ) X K C A- BK - KfC j [0 K] 7] or in terms...C where in LQG notation C, = l,(sJ - (A - BK, - AfC))-’kj C = K (sl - (A - BK, - KfC ))-1K ! 44 Uy Recall that only Kf has to be approximated in...the oper- ators A-BK, and A- KfC both generate stable semigroups [24]. If (A+AA-BK) and (A + AA - 1’fC) also generale stable semigroups, then the
The Ensemble Kalman Filter for Groundwater Plume Characterization: A Case Study.
Ross, James L; Andersen, Peter F
2018-04-17
The Kalman filter is an efficient data assimilation tool to refine an estimate of a state variable using measured data and the variable's correlations in space and/or time. The ensemble Kalman filter (EnKF) (Evensen, 2004, 2009) is a Kalman filter variant that employs Monte Carlo analysis to define the correlations that help to refine the updated state. While use of EnKF in hydrology is somewhat limited, it has been successfully applied in other fields of engineering (e.g. oil reservoir modeling, weather forecasting). Here, EnKF is used to refine a simulated groundwater TCE plume that underlies the Tooele Army Depot-North (TEAD-N) in Utah, based on observations of TCE in the aquifer. The resulting EnKF-based assimilated plume is simulated forward in time to predict future plume migration. The correlations that underpin EnKF updating implicitly contain information about how the plume developed over time under the influence of complex site hydrology and variable source history, as they are predicated on multiple realizations of a well-calibrated numerical groundwater flow and transport model. The EnKF methodology is compared to an ordinary kriging-based assimilation method with respect to the accurate representation of plume concentrations in order to determine the relative efficacy of EnKF for water quality data assimilation. This article is protected by copyright. All rights reserved.
Not a scintilla of light: Darkness and despondency in Yvonne Vera's ...
African Journals Online (AJOL)
The paper makes an attempt at exploring the concept of the absurd as it applies to Yvonne Vera's Butterfly Burning. The inordinate quest for survival and human dignity is graphically etched on the sordid canvas of angst, grime and abject poverty. The author deftly links this quest with the quest of identity which is manifested ...
Rastetter, Edward B; Williams, Mathew; Griffin, Kevin L; Kwiatkowski, Bonnie L; Tomasky, Gabrielle; Potosnak, Mark J; Stoy, Paul C; Shaver, Gaius R; Stieglitz, Marc; Hobbie, John E; Kling, George W
2010-07-01
Continuous time-series estimates of net ecosystem carbon exchange (NEE) are routinely made using eddy covariance techniques. Identifying and compensating for errors in the NEE time series can be automated using a signal processing filter like the ensemble Kalman filter (EnKF). The EnKF compares each measurement in the time series to a model prediction and updates the NEE estimate by weighting the measurement and model prediction relative to a specified measurement error estimate and an estimate of the model-prediction error that is continuously updated based on model predictions of earlier measurements in the time series. Because of the covariance among model variables, the EnKF can also update estimates of variables for which there is no direct measurement. The resulting estimates evolve through time, enabling the EnKF to be used to estimate dynamic variables like changes in leaf phenology. The evolving estimates can also serve as a means to test the embedded model and reconcile persistent deviations between observations and model predictions. We embedded a simple arctic NEE model into the EnKF and filtered data from an eddy covariance tower located in tussock tundra on the northern foothills of the Brooks Range in northern Alaska, USA. The model predicts NEE based only on leaf area, irradiance, and temperature and has been well corroborated for all the major vegetation types in the Low Arctic using chamber-based data. This is the first application of the model to eddy covariance data. We modified the EnKF by adding an adaptive noise estimator that provides a feedback between persistent model data deviations and the noise added to the ensemble of Monte Carlo simulations in the EnKF. We also ran the EnKF with both a specified leaf-area trajectory and with the EnKF sequentially recalibrating leaf-area estimates to compensate for persistent model-data deviations. When used together, adaptive noise estimation and sequential recalibration substantially improved filter
Performance Analysis of Local Ensemble Kalman Filter
Tong, Xin T.
2018-03-01
Ensemble Kalman filter (EnKF) is an important data assimilation method for high-dimensional geophysical systems. Efficient implementation of EnKF in practice often involves the localization technique, which updates each component using only information within a local radius. This paper rigorously analyzes the local EnKF (LEnKF) for linear systems and shows that the filter error can be dominated by the ensemble covariance, as long as (1) the sample size exceeds the logarithmic of state dimension and a constant that depends only on the local radius; (2) the forecast covariance matrix admits a stable localized structure. In particular, this indicates that with small system and observation noises, the filter error will be accurate in long time even if the initialization is not. The analysis also reveals an intrinsic inconsistency caused by the localization technique, and a stable localized structure is necessary to control this inconsistency. While this structure is usually taken for granted for the operation of LEnKF, it can also be rigorously proved for linear systems with sparse local observations and weak local interactions. These theoretical results are also validated by numerical implementation of LEnKF on a simple stochastic turbulence in two dynamical regimes.
El Gharamti, Mohamad
2015-11-26
The ensemble Kalman filter (EnKF) recursively integrates field data into simulation models to obtain a better characterization of the model’s state and parameters. These are generally estimated following a state-parameters joint augmentation strategy. In this study, we introduce a new smoothing-based joint EnKF scheme, in which we introduce a one-step-ahead smoothing of the state before updating the parameters. Numerical experiments are performed with a two-dimensional synthetic subsurface contaminant transport model. The improved performance of the proposed joint EnKF scheme compared to the standard joint EnKF compensates for the modest increase in the computational cost.
Viscometric study of high-cis polybutadiene in toluene solution
International Nuclear Information System (INIS)
Mwllo, Ivana L.; Coutinho, Fernanda M.B.; Delpech, Marcia C.; Albino, Fernanda F.M.
2006-01-01
Viscometric measurements, in toluene solution at 30 deg C, were performed with high-cis polybutadiene synthesized by neodymium based catalyst. Six different equations were used to calculate intrinsic viscosities and viscosimetric constant values: Huggins, Kraemer, Martin and Schulz-Blaschke by graphic extrapolation, and Solomon-Ciuta, Deb-Chanterjee and again Schulz- Blaschke, through a single point determination. The molecular weight of the polymers was also determined applying Mark-Houwink-Sakurada equation using the values of intrinsic viscosity obtained by the six equations. The values of intrinsic viscosity and viscosity-average molecular weight obtained by the two methods were compared in order to verify the validity of the single point determination for high-cis polybutadiene. (author)
Deterministic Mean-Field Ensemble Kalman Filtering
Law, Kody
2016-05-03
The proof of convergence of the standard ensemble Kalman filter (EnKF) from Le Gland, Monbet, and Tran [Large sample asymptotics for the ensemble Kalman filter, in The Oxford Handbook of Nonlinear Filtering, Oxford University Press, Oxford, UK, 2011, pp. 598--631] is extended to non-Gaussian state-space models. A density-based deterministic approximation of the mean-field limit EnKF (DMFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence k between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for dimension d<2k. The fidelity of approximation of the true distribution is also established using an extension of the total variation metric to random measures. This is limited by a Gaussian bias term arising from nonlinearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.
Deterministic Mean-Field Ensemble Kalman Filtering
Law, Kody; Tembine, Hamidou; Tempone, Raul
2016-01-01
The proof of convergence of the standard ensemble Kalman filter (EnKF) from Le Gland, Monbet, and Tran [Large sample asymptotics for the ensemble Kalman filter, in The Oxford Handbook of Nonlinear Filtering, Oxford University Press, Oxford, UK, 2011, pp. 598--631] is extended to non-Gaussian state-space models. A density-based deterministic approximation of the mean-field limit EnKF (DMFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence k between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for dimension d<2k. The fidelity of approximation of the true distribution is also established using an extension of the total variation metric to random measures. This is limited by a Gaussian bias term arising from nonlinearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.
Sex differences in muscle morphology of the knee flexors and knee extensors.
Directory of Open Access Journals (Sweden)
Fearghal P Behan
Full Text Available Females experience higher risk of anterior cruciate ligament (ACL injuries; males experience higher risk of hamstring strain injuries. Differences in injury may be partially due to sex differences in knee flexor (KF to knee extensor (KE muscle size ratio and the proportional size of constituent muscles.To compare the absolute and proportional size, and mass distribution, of individual KE and KF muscles, as well as overall size and balance (size ratio of these muscle groups between the sexes.T1-weighted axial plane MR images (1.5T of healthy untrained young males and females (32 vs 34 were acquired to determine thigh muscle anatomical cross-sectional area (ACSA. Maximal ACSA (ACSAmax of constituent muscles, summated for KF and KE muscle groups, and the KF:KE ratio were calculated.Females had 25.3% smaller KE ACSAmax (70.9±12.1 vs 93.6±10.3 cm2; P<0.001 and 29.6% smaller KF ACSAmax than males (38.8±7.3cm2 vs 55.1±7.3cm2; P<0.001. Consequently, females had lower KF:KE ACSA ratio (P = 0.031. There were sex differences in the proportional size of 2/4 KE and 5/6 KF. In females, vastus lateralis (VL, biceps femoris long-head (BFlh and semimembranosus (SM were a greater proportion and sartorius (SA, gracilis (GR and biceps femoris short-head (BFsh a smaller proportion of their respective muscle groups compared to males (All P<0.05.Sex differences in KF:KE ACSAmax ratio may contribute to increased risk of ACL injury in females. Sex discrepancies in absolute and proportional size of SA, GR, VL and BFlh may contribute further anatomical explanations for sex differences in injury incidence.
Siemen, Anna; Kosciow, Konrad; Schweiger, Paul; Deppenmeier, Uwe
2018-02-01
The growing consumer demand for low-calorie, sugar-free foodstuff motivated us to search for alternative non-nutritive sweeteners. A promising sweet-tasting compound is 5-keto-D-fructose (5-KF), which is formed by membrane-bound fructose dehydrogenases (Fdh) in some Gluconobacter strains. The plasmid-based expression of the fdh genes in Gluconobacter (G.) oxydans resulted in a much higher Fdh activity in comparison to the native host G. japonicus. Growth experiments with G. oxydans fdh in fructose-containing media indicated that 5-KF was rapidly formed with a conversion efficiency of 90%. 5-KF production from fructose was also observed using resting cells with a yield of about 100%. In addition, a new approach was tested for the production of the sweetener 5-KF by using sucrose as a substrate. To this end, a two-strain system composed of the fdh-expressing strain and a G. oxydans strain that produced the sucrose hydrolyzing SacC was developed. The strains were co-cultured in sucrose medium and converted 92.5% of the available fructose units into 5-KF. The glucose moiety of sucrose was converted to 2-ketogluconate and acetate. With regard to the development of a sustainable and resource-saving process for the production of 5-KF, sugar beet extract was used as substrate for the two-strain system. Fructose as product from sucrose cleavage was mainly oxidized to 5-KF which was detected in a concentration of over 200 mM at the end of the fermentation process. In summary, the two-strain system was able to convert fructose units of sugar beet extract to 5-KF with an efficiency of 82 ± 5%.
Data assimilation strategies for volcano geodesy
Zhan, Yan; Gregg, Patricia M.
2017-09-01
Ground deformation observed using near-real time geodetic methods, such as InSAR and GPS, can provide critical information about the evolution of a magma chamber prior to volcanic eruption. Rapid advancement in numerical modeling capabilities has resulted in a number of finite element models targeted at better understanding the connection between surface uplift associated with magma chamber pressurization and the potential for volcanic eruption. Robust model-data fusion techniques are necessary to take full advantage of the numerical models and the volcano monitoring observations currently available. In this study, we develop a 3D data assimilation framework using the Ensemble Kalman Filter (EnKF) approach in order to combine geodetic observations of surface deformation with geodynamic models to investigate volcanic unrest. The EnKF sequential assimilation method utilizes disparate data sets as they become available to update geodynamic models of magma reservoir evolution. While the EnKF has been widely applied in hydrologic and climate modeling, the adaptation for volcano monitoring is in its initial stages. As such, our investigation focuses on conducting a series of sensitivity tests to optimize the EnKF for volcano applications and on developing specific strategies for assimilation of geodetic data. Our numerical experiments illustrate that the EnKF is able to adapt well to the spatial limitations posed by GPS data and the temporal limitations of InSAR, and that specific strategies can be adopted to enhance EnKF performance to improve model forecasts. Specifically, our numerical experiments indicate that: (1) incorporating additional iterations of the EnKF analysis step is more efficient than increasing the number of ensemble members; (2) the accuracy of the EnKF results are not affected by initial parameter assumptions; (3) GPS observations near the center of uplift improve the quality of model forecasts; (4) occasionally shifting continuous GPS stations to
Forest statistics for Southeast Texas counties - 1986
William H. McWilliams; Daniel F. Bertelson
1986-01-01
These tables were derived from data obtained during a 1986 inventory of 22 counties comprising the Southeast Unit of Texas (fig. 1). Grimes, Leon, Madison, and Waller counties have been added to the Southeastern Unit since the previous inventory if 1975. All comparisons of the 1975 and 1986 forest statistics made in this Bulletin account for this change. The data on...
Photocatalytic Solutions Create Self-Cleaning Surfaces
2013-01-01
A Stennis Space Center researcher investigating the effectiveness of photocatalytic materials for keeping the Center's buildings free of grime turned to a solution created by PURETi Inc. of New York City. Testing proved successful, and NASA and the company now share a Dual Use Technology partnership. PURETi's coatings keep surfaces clean and purify surrounding air, eliminating pollution, odors, and microbes.
Inertial Sensor Error Reduction through Calibration and Sensor Fusion
Directory of Open Access Journals (Sweden)
Stefan Lambrecht
2016-02-01
Full Text Available This paper presents the comparison between cooperative and local Kalman Filters (KF for estimating the absolute segment angle, under two calibration conditions. A simplified calibration, that can be replicated in most laboratories; and a complex calibration, similar to that applied by commercial vendors. The cooperative filters use information from either all inertial sensors attached to the body, Matricial KF; or use information from the inertial sensors and the potentiometers of an exoskeleton, Markovian KF. A one minute walking trial of a subject walking with a 6-DoF exoskeleton was used to assess the absolute segment angle of the trunk, thigh, shank, and foot. The results indicate that regardless of the segment and filter applied, the more complex calibration always results in a significantly better performance compared to the simplified calibration. The interaction between filter and calibration suggests that when the quality of the calibration is unknown the Markovian KF is recommended. Applying the complex calibration, the Matricial and Markovian KF perform similarly, with average RMSE below 1.22 degrees. Cooperative KFs perform better or at least equally good as Local KF, we therefore recommend to use cooperative KFs instead of local KFs for control or analysis of walking.
Dvorjanskoje gnezdo : glava iz knigi 'ESTICA : kultura i istorija' / Jüri Kuuskemaa
Kuuskemaa, Jüri, 1942-
1998-01-01
Rägavere mõisa härrastemajast, arvatav arhitekt Johann Schulz. Selle taastamisest kultuurikeskuse tarvis. Sisekujundaja Leila Pärtelpoeg, skulptor Cornelius Tamm. Maali- ja mööblikollektsioonist
Dorothea Mantzel and Bernd Schulz. Francolin Illustrated School Dic
African Journals Online (AJOL)
rbr
and wonder whether the Francolin Illustrated School Dictionary for Southern. Africa makes this distinction. I wonder ... The dictionary, the editors claim, is aimed at senior primary school learners who do not speak English as ... illustration of someone shooting with a bow and arrow at a target. When one turns to the headword ...
The job satisfaction of black female academics | Schulze | South ...
African Journals Online (AJOL)
The aim of this research was to investigate the job satisfaction of black, female academics at a distance education institution. To this end, a phenomenological method was employed. By means of purposeful and snowball sampling, ten participants from different departments in the humanities were recruited and interviewed.
Spectrophotometric analysis of flavonoid-DNA binding interactions at physiological conditions
Janjua, Naveed Kausar; Siddiqa, Asima; Yaqub, Azra; Sabahat, Sana; Qureshi, Rumana; Haque, Sayed ul
2009-12-01
Mode of interactions of three flavonoids [morin (M), quercetin (Q), and rutin (R)] with chicken blood ds.DNA (ck.DNA) has been investigated spectrophotometrically at different temperatures including body temperature (310 K) and at two physiological pH values, i.e. 7.4 (human blood pH) and 4.7 (stomach pH). The binding constants, Kf, evaluated using Benesi-Hildebrand equation showed that the flavonoids bind effectively through intercalation at both pH values and body temperature. Quercetin, somehow, showed greater binding capabilities with DNA. The free energies of flavonoid-DNA complexes indicated the spontaneity of their binding. The order of binding constants of three flavonoids at both pH values were found to be Kf(Q) > Kf(R) > Kf(M) and at 310 K.
Chin, Koo B; Go, Mi Y; Xiong, Youling L
2009-03-01
Functional properties of heat-induced gels prepared from microbial transglutaminase (TG)-treated porcine myofibrillar protein (MP) containing sodium caseinate with or without konjac flour (KF) under various salt concentrations (0.1, 0.3 and 0.6MNaCl) were evaluated. The mixed MP gels with KF exhibited improved cooking yields at all salt concentrations. TG treatment greatly enhanced gel strength and elasticity (storage modulus, G') at 0.6M NaCl, but not at lower salt concentrations. The combination of KF and TG improved the gel strength at 0.1 and 0.3M NaCl and G' at all salt concentrations, when compared with non-TG controls. Incubation of MP suspensions (sols) with TG promoted the disappearance of myosin heavy chain and the production of polymers. The TG-treated MP mixed gels had a compact structure, compared to those without TG, and the KF incorporation modified the gel matrix and increased its water-holding capacity. Results from differential scanning calorimetry suggested possible interactions of MP with KF, which may explain the changes in the microstructure of the heat-induced gels.
Stock price estimation using ensemble Kalman Filter square root method
Karya, D. F.; Katias, P.; Herlambang, T.
2018-04-01
Shares are securities as the possession or equity evidence of an individual or corporation over an enterprise, especially public companies whose activity is stock trading. Investment in stocks trading is most likely to be the option of investors as stocks trading offers attractive profits. In determining a choice of safe investment in the stocks, the investors require a way of assessing the stock prices to buy so as to help optimize their profits. An effective method of analysis which will reduce the risk the investors may bear is by predicting or estimating the stock price. Estimation is carried out as a problem sometimes can be solved by using previous information or data related or relevant to the problem. The contribution of this paper is that the estimates of stock prices in high, low, and close categorycan be utilized as investors’ consideration for decision making in investment. In this paper, stock price estimation was made by using the Ensemble Kalman Filter Square Root method (EnKF-SR) and Ensemble Kalman Filter method (EnKF). The simulation results showed that the resulted estimation by applying EnKF method was more accurate than that by the EnKF-SR, with an estimation error of about 0.2 % by EnKF and an estimation error of 2.6 % by EnKF-SR.
Borel, F; Gaudin, C; Duchalais, E; Lehur, P-A; Meurette, G
2017-12-01
To assess the impact of a simple flap closing procedure by Karydakis flap (KF) after pilonidal sinus excision on the costs and healing time as compared to routine lay-open technique. Out of 44 consecutive patients operated on for pilonidal excision (November 2013-March 2015), 17 had a Karydakis flap and 27 a lay-open procedure. For each patient, the length of stay, the operating time (OT), the time needed for complete healing and postoperative care resources were recorded. The global costs included OT, nursing care quantity, and modalities until complete scar healing. One reoperation in the lay-open group was necessary during the follow-up (8±5months). No recurrence occurred. Postoperative morbidity was similar in both groups. Results showed that KF global cost was inferior as compared to lay-open technique (941±178€ vs. 1601±399€; P=0.0001), KF healed faster (32±17 vs. 59±22days; P=0.0001), whereas OT was longer in KF group (16±7 vs. 25±4min; P=0.001). KF allows a faster healing time and a 41% lower cost than lay-open technique. Preferential use of KF rather than lay-open procedure could allow a significant health cost saving. Copyright © 2017. Published by Elsevier Masson SAS.
Subramanian, Aneesh C.
2012-11-01
This paper investigates the role of the linear analysis step of the ensemble Kalman filters (EnKF) in disrupting the balanced dynamics in a simple atmospheric model and compares it to a fully nonlinear particle-based filter (PF). The filters have a very similar forecast step but the analysis step of the PF solves the full Bayesian filtering problem while the EnKF analysis only applies to Gaussian distributions. The EnKF is compared to two flavors of the particle filter with different sampling strategies, the sequential importance resampling filter (SIRF) and the sequential kernel resampling filter (SKRF). The model admits a chaotic vortical mode coupled to a comparatively fast gravity wave mode. It can also be configured either to evolve on a so-called slow manifold, where the fast motion is suppressed, or such that the fast-varying variables are diagnosed from the slow-varying variables as slaved modes. Identical twin experiments show that EnKF and PF capture the variables on the slow manifold well as the dynamics is very stable. PFs, especially the SKRF, capture slaved modes better than the EnKF, implying that a full Bayesian analysis estimates the nonlinear model variables better. The PFs perform significantly better in the fully coupled nonlinear model where fast and slow variables modulate each other. This suggests that the analysis step in the PFs maintains the balance in both variables much better than the EnKF. It is also shown that increasing the ensemble size generally improves the performance of the PFs but has less impact on the EnKF after a sufficient number of members have been used.
Subramanian, Aneesh C.; Hoteit, Ibrahim; Cornuelle, Bruce; Miller, Arthur J.; Song, Hajoon
2012-01-01
This paper investigates the role of the linear analysis step of the ensemble Kalman filters (EnKF) in disrupting the balanced dynamics in a simple atmospheric model and compares it to a fully nonlinear particle-based filter (PF). The filters have a very similar forecast step but the analysis step of the PF solves the full Bayesian filtering problem while the EnKF analysis only applies to Gaussian distributions. The EnKF is compared to two flavors of the particle filter with different sampling strategies, the sequential importance resampling filter (SIRF) and the sequential kernel resampling filter (SKRF). The model admits a chaotic vortical mode coupled to a comparatively fast gravity wave mode. It can also be configured either to evolve on a so-called slow manifold, where the fast motion is suppressed, or such that the fast-varying variables are diagnosed from the slow-varying variables as slaved modes. Identical twin experiments show that EnKF and PF capture the variables on the slow manifold well as the dynamics is very stable. PFs, especially the SKRF, capture slaved modes better than the EnKF, implying that a full Bayesian analysis estimates the nonlinear model variables better. The PFs perform significantly better in the fully coupled nonlinear model where fast and slow variables modulate each other. This suggests that the analysis step in the PFs maintains the balance in both variables much better than the EnKF. It is also shown that increasing the ensemble size generally improves the performance of the PFs but has less impact on the EnKF after a sufficient number of members have been used.
A Brief Tutorial on the Ensemble Kalman Filter
Mandel, Jan
2009-01-01
The ensemble Kalman filter (EnKF) is a recursive filter suitable for problems with a large number of variables, such as discretizations of partial differential equations in geophysical models. The EnKF originated as a version of the Kalman filter for large problems (essentially, the covariance matrix is replaced by the sample covariance), and it is now an important data assimilation component of ensemble forecasting. EnKF is related to the particle filter (in this context, a particle is the s...
Silicon electrodeposition from chloride-fluoride melts containing K2SiF6 and SiO2
Directory of Open Access Journals (Sweden)
Zhuk Sergey I.
2017-01-01
Full Text Available Silicon electrodeposition on glassy carbon from the KF-KCl-K2SiF6, KF-KCl-K2SiF6-KOH and KF-KCl-K2SiF6-SiO2 melts was studied by the cyclic voltammetry. Тhe electroreduction of Si(IV to metallic Si was observed as a single 4-electron wave under all considered conditions. The reactions of cathode reduction of silicon from fluoride and oxyfluoride complexes were suggested. It was shown that the process can be controlled by the preliminary transformation of SiO44- to SiF62- and SiOxFyz-. The influence of the current density on structure and morphology of silicon deposits obtained during galvanostatic electrolysis of the KF-KCl-K2SiF6-SiO2 melt was studied.
Directory of Open Access Journals (Sweden)
Brian A. Johnson
2015-10-01
Full Text Available Much remote sensing (RS research focuses on fusing, i.e., combining, multi-resolution/multi-sensor imagery for land use/land cover (LULC classification. In relation to this topic, Sun and Schulz [1] recently found that a combination of visible-to-near infrared (VNIR; 30 m spatial resolution and thermal infrared (TIR; 100–120 m spatial resolution Landsat data led to more accurate LULC classification. They also found that using multi-temporal TIR data alone for classification resulted in comparable (and in some cases higher classification accuracies to the use of multi-temporal VNIR data, which contrasts with the findings of other recent research [2]. This discrepancy, and the generally very high LULC accuracies achieved by Sun and Schulz (up to 99.2% overall accuracy for a combined VNIR/TIR classification result, can likely be explained by their use of an accuracy assessment procedure which does not take into account the multi-resolution nature of the data. Sun and Schulz used 10-fold cross-validation for accuracy assessment, which is not necessarily inappropriate for RS accuracy assessment in general. However, here it is shown that the typical pixel-based cross-validation approach results in non-independent training and validation data sets when the lower spatial resolution TIR images are used for classification, which causes classification accuracy to be overestimated.
Ait-El-Fquih, Boujemaa; El Gharamti, Mohamad; Hoteit, Ibrahim
2016-01-01
Ensemble Kalman filtering (EnKF) is an efficient approach to addressing uncertainties in subsurface ground-water models. The EnKF sequentially integrates field data into simulation models to obtain a better characterization of the model's state and parameters. These are generally estimated following joint and dual filtering strategies, in which, at each assimilation cycle, a forecast step by the model is followed by an update step with incoming observations. The joint EnKF directly updates the augmented state-parameter vector, whereas the dual EnKF empirically employs two separate filters, first estimating the parameters and then estimating the state based on the updated parameters. To develop a Bayesian consistent dual approach and improve the state-parameter estimates and their consistency, we propose in this paper a one-step-ahead (OSA) smoothing formulation of the state-parameter Bayesian filtering problem from which we derive a new dual-type EnKF, the dual EnKF(OSA). Compared with the standard dual EnKF, it imposes a new update step to the state, which is shown to enhance the performance of the dual approach with almost no increase in the computational cost. Numerical experiments are conducted with a two-dimensional (2-D) synthetic groundwater aquifer model to investigate the performance and robustness of the proposed dual EnKFOSA, and to evaluate its results against those of the joint and dual EnKFs. The proposed scheme is able to successfully recover both the hydraulic head and the aquifer conductivity, providing further reliable estimates of their uncertainties. Furthermore, it is found to be more robust to different assimilation settings, such as the spatial and temporal distribution of the observations, and the level of noise in the data. Based on our experimental setups, it yields up to 25% more accurate state and parameter estimations than the joint and dual approaches.
Potential of an ensemble Kalman smoother for stratospheric chemical-dynamical data assimilation
Directory of Open Access Journals (Sweden)
Thomas Milewski
2013-02-01
Full Text Available A new stratospheric ensemble Kalman smoother (EnKS system is introduced, and the potential of assimilating posterior stratospheric observations to better constrain the whole model state at analysis time is investigated. A set of idealised perfect-model Observation System Simulation Experiments (OSSE assimilating synthetic limb-sounding temperature or ozone retrievals are performed with a chemistry–climate model. The impact during the analysis step is characterised in terms of the root mean square error reduction between the forecast state and the analysis state. The performances of (1 a fixed-lag EnKS assimilating observations spread over 48 hours and (2 an ensemble Kalman Filter (EnKF assimilating a denser network of observations are compared with a reference EnKF. The ozone assimilation with EnKS shows a significant additional reduction of analysis error of the order of 10% for dynamical and chemical variables in the extratropical upper troposphere lower stratosphere (UTLS and Polar Vortex regions when compared to the reference EnKF. This reduction has similar magnitude to the one achieved by the denser-network EnKF assimilation. Similarly, the temperature assimilation with EnKS significantly decreases the error in the UTLS for the wind variables like the denser-network EnKF assimilation. However, the temperature assimilation with EnKS has little or no significant impact on the temperature and ozone analyses, whereas the denser-network EnKF shows improvement with respect to the reference EnKF. The different analysis impacts from the assimilation of current and posterior ozone observations indicate the capacity of time-lagged background-error covariances to represent temporal interactions up to 48 hours between variables during the ensemble data assimilation analysis step, and the possibility to use posterior observations whenever additional current observations are unavailable. The possible application of the EnKS for reanalyses is
Ait-El-Fquih, Boujemaa
2016-08-12
Ensemble Kalman filtering (EnKF) is an efficient approach to addressing uncertainties in subsurface ground-water models. The EnKF sequentially integrates field data into simulation models to obtain a better characterization of the model\\'s state and parameters. These are generally estimated following joint and dual filtering strategies, in which, at each assimilation cycle, a forecast step by the model is followed by an update step with incoming observations. The joint EnKF directly updates the augmented state-parameter vector, whereas the dual EnKF empirically employs two separate filters, first estimating the parameters and then estimating the state based on the updated parameters. To develop a Bayesian consistent dual approach and improve the state-parameter estimates and their consistency, we propose in this paper a one-step-ahead (OSA) smoothing formulation of the state-parameter Bayesian filtering problem from which we derive a new dual-type EnKF, the dual EnKF(OSA). Compared with the standard dual EnKF, it imposes a new update step to the state, which is shown to enhance the performance of the dual approach with almost no increase in the computational cost. Numerical experiments are conducted with a two-dimensional (2-D) synthetic groundwater aquifer model to investigate the performance and robustness of the proposed dual EnKFOSA, and to evaluate its results against those of the joint and dual EnKFs. The proposed scheme is able to successfully recover both the hydraulic head and the aquifer conductivity, providing further reliable estimates of their uncertainties. Furthermore, it is found to be more robust to different assimilation settings, such as the spatial and temporal distribution of the observations, and the level of noise in the data. Based on our experimental setups, it yields up to 25% more accurate state and parameter estimations than the joint and dual approaches.
International Nuclear Information System (INIS)
Finken, D.
1986-05-01
In 1982, KfK joined the fusion programme of EURATOM as a further association introducing its experience in nuclear technology. KfK closely cooperates with IPP Garching, the two institutions forming a research unit aiming at planning and realization of future development steps of fusion. KfK has combined its forces in the Nuclear Fusion Project (PKF) with participation of several KfK departments to the project tasks. Previous work of KfK in magnetic fusion has addressed mainly superconducting magnets, plasma heating by cluster ions and studies on structural materials. At present, emphasis of our work has concentrated increasingly on the nuclear part, i.e. the first wall and blanket structures and the elements of the tritium extraction and purification system. Associated to this component development are studies of remote maintenance and safety. Most of the actual work addresses NET, the next step to a demonstration of fusion feasibility. NET is supposed to follow JET, the operating plasma physics experiment of Euratom, on the 1990's. Detailed progress of the work in the past half year is described in this report. (orig./GG)
Ramari, Cintia; Moraes, Andréa G; Tauil, Carlos B; von Glehn, Felipe; Motl, Robert; de David, Ana C
2018-02-01
Physiological factors such as muscle weakness and balance could explain declines in walking distance by multiple sclerosis (MS) patients. The purpose of this study was to characterize levels and examine associations among decline in walking distance, balance and muscular strength in women with mild MS. Participants included 28 women with mild relapsing-remitting MS and 21 women without MS. We executed the 6-min walk test (6MWT) to verify declines in walking distance. Isokinetic knee flexion (KF) and extension (KE) muscle strength was measured using a dynamometer. Balance was quantified using a force platform, with eyes open and closed, on a rigid and foam surface. The MS patients presented declines in walking, lower KF muscle strength, and worse balance than controls. KF strength and balance correlated with walking in the MS group. The KF strength explained differences between groups in walking. The KF strength and balance presented as predictors of walking slowing down in the 6MWT, in mild MS. Women with mild MS have strength impairment of knee flexor muscles and balance control impairment that may explain walking related motor fatigability during prolonged walking. Copyright © 2018 Elsevier B.V. All rights reserved.
El Gharamti, Mohamad
2012-04-01
Accurate knowledge of the movement of contaminants in porous media is essential to track their trajectory and later extract them from the aquifer. A two-dimensional flow model is implemented and then applied on a linear contaminant transport model in the same porous medium. Because of different sources of uncertainties, this coupled model might not be able to accurately track the contaminant state. Incorporating observations through the process of data assimilation can guide the model toward the true trajectory of the system. The Kalman filter (KF), or its nonlinear invariants, can be used to tackle this problem. To overcome the prohibitive computational cost of the KF, the singular evolutive Kalman filter (SEKF) and the singular fixed Kalman filter (SFKF) are used, which are variants of the KF operating with low-rank covariance matrices. Experimental results suggest that under perfect and imperfect model setups, the low-rank filters can provide estimates as accurate as the full KF but at much lower computational effort. Low-rank filters are demonstrated to significantly reduce the computational effort of the KF to almost 3%. © 2012 American Society of Civil Engineers.
A Handbook on Artificial Soils for Indoor Photovoltaic Soiling Tests
Energy Technology Data Exchange (ETDEWEB)
Burton, Patrick D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); King, Bruce Hardison [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2014-10-01
This manuscript is intended to serve as a practical guide to conducting repeatable indoor soiling experiments for PV applications. An outline of techniques, materials and equipment used in prior studies [1-3] is presented. Additional recommendations and practical guidance has been presented. Major sections include techniques to formulate soil simulants, ('standard grime') and feedstocks from traceable components, spray application, and quantitative measurement methodologies at heavy and minimal soil loadings.
Microstructure analysis of chemically synthesized wurtzite-type CdS ...
Indian Academy of Sciences (India)
37, 4682 (1998). [12] O Z Angel and R L Morales, Phys. Rev. B 62, 13064 (2000). [13] S Wei and S B Zhang, Phys. Rev. B 62, 6944 (2000). [14] G Lin, J Zheng and R Xu, J. Phy. Chem. C 112, 7363 (2008). [15] N Bao, L Shen, T Takata, K Domen, A Gupta, K Yanagisawa and C A Grimes, J. Phys. Chem. C 111, 17527 (2007).
Oxygen Toxicity and Lung Collagenous Protein.
1981-02-28
Analysis Samples for amino acid analysis qera hydrolyzed at 110C f)r 22 h constant boiling HCI under nitrogen. Samples were driea at room tereratre over...was performed by a gas chromatographic procedure modified from the method of Grimes and Greegor [8]. Samples were hydrolyzed in 2 N trifluoroacetic...evaluated by their ability to incorporate radiolabeled choline and acetate into the saturated lecithin components of chloroform-methanol extractable
Output regularization of SVM seizure predictors: Kalman Filter versus the "Firing Power" method.
Teixeira, Cesar; Direito, Bruno; Bandarabadi, Mojtaba; Dourado, António
2012-01-01
Two methods for output regularization of support vector machines (SVMs) classifiers were applied for seizure prediction in 10 patients with long-term annotated data. The output of the classifiers were regularized by two methods: one based on the Kalman Filter (KF) and other based on a measure called the "Firing Power" (FP). The FP is a quantification of the rate of the classification in the preictal class in a past time window. In order to enable the application of the KF, the classification problem was subdivided in a two two-class problem, and the real-valued output of SVMs was considered. The results point that the FP method raise less false alarms than the KF approach. However, the KF approach presents an higher sensitivity, but the high number of false alarms turns their applicability negligible in some situations.
Proposed man-rem reference values of occupational exposure
International Nuclear Information System (INIS)
Lombard, J.
1988-04-01
This report presents a proposal of referent collective dose (man-rem) values for occupational exposure related to operation of French pressurized water reactors. These values, permitting adequate choice of protection both at design and operation level, are dependent on the level of annual individual doses. The man-rem value, originating from annual individual doses less than 0.5 rem are estimated to 1 kf. The proposed value is 20 kf for annual individual exposures between 0.5 and 3 rem, and 90 kf for annual individual exposures between 3 and 5 rem. (author) [fr
Multilevel ensemble Kalman filtering
Hoel, Hakon
2016-06-14
This work embeds a multilevel Monte Carlo sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF) in the setting of finite dimensional signal evolution and noisy discrete-time observations. The signal dynamics is assumed to be governed by a stochastic differential equation (SDE), and a hierarchy of time grids is introduced for multilevel numerical integration of that SDE. The resulting multilevel EnKF is proved to asymptotically outperform EnKF in terms of computational cost versus approximation accuracy. The theoretical results are illustrated numerically.
Multilevel ensemble Kalman filtering
Hoel, Hakon; Law, Kody J. H.; Tempone, Raul
2016-01-01
This work embeds a multilevel Monte Carlo sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF) in the setting of finite dimensional signal evolution and noisy discrete-time observations. The signal dynamics is assumed to be governed by a stochastic differential equation (SDE), and a hierarchy of time grids is introduced for multilevel numerical integration of that SDE. The resulting multilevel EnKF is proved to asymptotically outperform EnKF in terms of computational cost versus approximation accuracy. The theoretical results are illustrated numerically.
Advanced Guidance Algorithms for Homing Missiles with Bearings-Only Measurements.
1987-11-01
poles are no longer determined by A - BK, and A - KfC . However, the following theorem shows that the coupling H,(s) :=I+PLN(sI -A +BK,) between the...jw) given in Section H-C deter- = N(sI -A + BK,(sI- A + BK, + KC) - ’ KfC )- IM mines the robustness of the FSRO control system. However, N(sl - A + BK...by (si-A+ KfC )-’M constructing a TITO system for the state-feedback regulator.) Therefore, Theorem 3 implies that a regulator with an asymptotic =N(sl-A
Ensemble Kalman filter regularization using leave-one-out data cross-validation
Rayo Schiappacasse, Lautaro Jerónimo
2012-09-19
In this work, the classical leave-one-out cross-validation method for selecting a regularization parameter for the Tikhonov problem is implemented within the EnKF framework. Following the original concept, the regularization parameter is selected such that it minimizes the predictive error. Some ideas about the implementation, suitability and conceptual interest of the method are discussed. Finally, what will be called the data cross-validation regularized EnKF (dCVr-EnKF) is implemented in a 2D 2-phase synthetic oil reservoir experiment and the results analyzed.
The FORTRAN-77 version of the Karlsruhe program system KAPROS
International Nuclear Information System (INIS)
Moritz, N.
1985-02-01
The FORTRAN-77 KAPROS-kernel includes some major changes compared with the version, which is described in the KfK-report 2254. The changes are documented in this report from the point of view of the system-programmer. This report is meant to be a supplement to the KfK-report 2254, assuming that the reader of this report is familiar with the KfK-report 2254. He also should be familiar with the IBM operating system MVS SP1.3.2 and the usual terms of data processing. (orig.) [de
Kahalalide F analogues from the mucous secretion of Indian sacoglossan mollusc Elysia ornata
Digital Repository Service at National Institute of Oceanography (India)
Ciavatta, M.L.; PrabhaDevi; Carbone, M.; Mathieu, V.; Kiss, R.; Casapullo, A.; Gavagnin, M.
, better delivery, or longer half-life. More than 150 analogues were obtained by solid phase peptide synthesis8,9 and more recently a semi-synthetic approach to produce KF analogues starting from natural KF has been also performed.10In parallel...
Ich spreche Deutsch: A User's Report
Glassar, Sheila
1969-01-01
The textbook under discussion, "Ich spreche Deutsch" by Heinz Griesbach and Dora Schulz (London-Harlow: Longmans-Hueber, 1966), is intended to be a one-year introduction to German, particularly for less academic pupils and students. (FWB)
Directory of Open Access Journals (Sweden)
Roni Kurniawan
2015-01-01
Full Text Available Pada kajian ini dilakukan evaluasi penggunaan beberapa skema konvektif pada model WRF (Weather Research and Forecasting untuk prediksi cuaca di wilayah Indonesia. Terdapat tiga skema konvektif yang akan dievaluasi yaitu; skema konvektif cumulus BMJ (Betts Miller Janjic, KF (Kain Fritsch, dan GD (Grell 3D ensemble. Data yang digunakan untuk evaluasi adalah data curah hujan per 3 jam dan data angin per 12 jam (level ketinggian; permukaan, 850, 500, 250 mb dari hasil pengolahan model WRF dan observasi selama periode bulan Agustus 2011 dan Februari 2012 di stasiun Juanda-Surabaya dan Cengkareng-Jakarta. Hasil verifikasi dari tiga skema konvektif pada model WRF terhadap data observasi menunjukkan bahwa untuk prakiraan curah hujan, penggunaan skema konvektif BMJ lebih baik dari skema KF dan GD, dan untuk prakiraan arah dan kecepatan angin skema BMJ dan GD relatif lebih baik dari skema KF. Berdasarkan analisis hasil verifikasi yang diperoleh, pemilihan skema konvektif cumulus BMJ cenderung lebih baik dari skema konvektif KF dan GD untuk di aplikasikan pada model WRF. In this study, the use of some convective schemes on the model WRF (Weather Research and Forecasting for weather prediction in Indonesian region has been evaluated. There are two models evaluated; BMJ cumulus convective scheme (Betts Miller Janjic, KF (Kain Fritsch, and GD (Grell 3D ensemble. The data used in the evaluation are the 3 hourly rainfall data, and the 12 hourly wind data (level height; surface, 850, 500, 250mb from the WRF models and observation processing during August 2011 and February 2012 period at the Juanda-Surabaya and Cengkareng-Jakarta stations. The results of the verification of the three convective schemes in WRF models against observation data indicate that for precipitation forecasts, the application of the BMJ convective scheme is better than the KF and GD schemes, and for direction and wind speed forecast, BMJ and GD schemes is relatively better than the KF
A new deterministic Ensemble Kalman Filter with one-step-ahead smoothing for storm surge forecasting
Raboudi, Naila
2016-11-01
The Ensemble Kalman Filter (EnKF) is a popular data assimilation method for state-parameter estimation. Following a sequential assimilation strategy, it breaks the problem into alternating cycles of forecast and analysis steps. In the forecast step, the dynamical model is used to integrate a stochastic sample approximating the state analysis distribution (called analysis ensemble) to obtain a forecast ensemble. In the analysis step, the forecast ensemble is updated with the incoming observation using a Kalman-like correction, which is then used for the next forecast step. In realistic large-scale applications, EnKFs are implemented with limited ensembles, and often poorly known model errors statistics, leading to a crude approximation of the forecast covariance. This strongly limits the filter performance. Recently, a new EnKF was proposed in [1] following a one-step-ahead smoothing strategy (EnKF-OSA), which involves an OSA smoothing of the state between two successive analysis. At each time step, EnKF-OSA exploits the observation twice. The incoming observation is first used to smooth the ensemble at the previous time step. The resulting smoothed ensemble is then integrated forward to compute a "pseudo forecast" ensemble, which is again updated with the same observation. The idea of constraining the state with future observations is to add more information in the estimation process in order to mitigate for the sub-optimal character of EnKF-like methods. The second EnKF-OSA "forecast" is computed from the smoothed ensemble and should therefore provide an improved background. In this work, we propose a deterministic variant of the EnKF-OSA, based on the Singular Evolutive Interpolated Ensemble Kalman (SEIK) filter. The motivation behind this is to avoid the observations perturbations of the EnKF in order to improve the scheme\\'s behavior when assimilating big data sets with small ensembles. The new SEIK-OSA scheme is implemented and its efficiency is demonstrated
Fan, Mingming; Zhang, Pingbo; Ma, Qinke
2012-01-01
Transesterification of soybean oil with methanol was carried out in the presence of CaO-MgO and KF-modified CaO-MgO catalysts at atmospheric pressure. While the methyl ester yield for the CaO-MgO catalyst with a ratio of 8:2 (CaO:MgO) was 63.6%, it was 97.9% for the KF-modified catalyst at a 2% catalyst to the reactants (methanol/oil mixture) weight ratio, a temperature of 65 °C, a methanol-soybean oil ratio of 9:1 and a reaction time of 2.5 h. The KF/CaO-MgO catalyst still yielded 86.7% after four successive uses. The catalytic performance of the KF/CaO-MgO catalyst was attributed to the formation of active KCaF(3) and K(2)MgF(4) centers. Copyright © 2011 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Arpad Z. Barabas
2006-01-01
Full Text Available A slowly progressive Heymann nephritis (SPHN was induced in three groups of rats by weekly injections of a chemically modified renal tubular antigen in an aqueous medium. A control group of rats received the chemically unmodified version of the antigen in an aqueous solution. One group of SPHN rats were pre- and post-treated with weekly injections of IC made up of rKF3 and rarKF3 IgM antibody at antigen excess (MIC (immune complexes [ICs] containing sonicated ultracentrifuged [u/c] rat kidney fraction 3 [rKF3] antigen and IgM antibodies specific against the antigen, at slight antigen excess. One group of SPHN rats were post-treated with MIC 3 weeks after the induction of the disease and one group of SPHN animals received no treatment. The control group of rats received pre- and post-treatment with sonicated u/c rKF3.
Chaiyasitdhi, Atitheb; Miphonpanyatawichok, Wirat; Riehle, Mathis Oliver; Phatthanakun, Rungrueang; Surareungchai, Werasak; Kundhikanjana, Worasom; Kuntanawat, Panwong
2018-01-01
Morphological transformations in primitive organisms have long been observed; however, its biomechanical roles are largely unexplored. In this study, we investigate the structural advantages of dimorphism in Arthrospira platensis, a filamentous multicellular cyanobacterium. We report that helical trichomes, the default shape, have a higher persistence length (Lp), indicating a higher resistance to bending or a large value of flexural rigidity (kf), the product of the local cell stiffness (E) and the moment of inertia of the trichomes' cross-section (I). Through Atomic Force Microscopy (AFM), we determined that the E of straight and helical trichomes were the same. In contrast, our computational model shows that I is greatly dependent on helical radii, implying that trichome morphology is the major contributor to kf variation. According to our estimation, increasing the helical radii alone can increase kf by 2 orders of magnitude. We also observe that straight trichomes have improved gliding ability, due to its structure and lower kf. Our study shows that dimorphism provides mechanical adjustability to the organism and may allow it to thrive in different environmental conditions. The higher kf provides helical trichomes a better nutrient uptake through advection in aquatic environments. On the other hand, the lower kf improves the gliding ability of straight trichomes in aquatic environments, enabling it to chemotactically relocate to more favorable territories when it encounters certain environmental stresses. When more optimal conditions are encountered, straight trichomes can revert to their original helical form. Our study is one of the first to highlight the biomechanical role of an overall-shape transformation in cyanobacteria.
A generalized polynomial chaos based ensemble Kalman filter with high accuracy
International Nuclear Information System (INIS)
Li Jia; Xiu Dongbin
2009-01-01
As one of the most adopted sequential data assimilation methods in many areas, especially those involving complex nonlinear dynamics, the ensemble Kalman filter (EnKF) has been under extensive investigation regarding its properties and efficiency. Compared to other variants of the Kalman filter (KF), EnKF is straightforward to implement, as it employs random ensembles to represent solution states. This, however, introduces sampling errors that affect the accuracy of EnKF in a negative manner. Though sampling errors can be easily reduced by using a large number of samples, in practice this is undesirable as each ensemble member is a solution of the system of state equations and can be time consuming to compute for large-scale problems. In this paper we present an efficient EnKF implementation via generalized polynomial chaos (gPC) expansion. The key ingredients of the proposed approach involve (1) solving the system of stochastic state equations via the gPC methodology to gain efficiency; and (2) sampling the gPC approximation of the stochastic solution with an arbitrarily large number of samples, at virtually no additional computational cost, to drastically reduce the sampling errors. The resulting algorithm thus achieves a high accuracy at reduced computational cost, compared to the classical implementations of EnKF. Numerical examples are provided to verify the convergence property and accuracy improvement of the new algorithm. We also prove that for linear systems with Gaussian noise, the first-order gPC Kalman filter method is equivalent to the exact Kalman filter.
Bei, Naifang; Li, Guohui; Meng, Zhiyong; Weng, Yonghui; Zavala, Miguel; Molina, L T
2014-11-15
The purpose of this study is to investigate the impact of using an ensemble Kalman filter (EnKF) on air quality simulations in the California-Mexico border region on two days (May 30 and June 04, 2010) during Cal-Mex 2010. The uncertainties in ozone (O3) and aerosol simulations in the border area due to the meteorological initial uncertainties were examined through ensemble simulations. The ensemble spread of surface O3 averaged over the coastal region was less than 10ppb. The spreads in the nitrate and ammonium aerosols are substantial on both days, mostly caused by the large uncertainties in the surface temperature and humidity simulations. In general, the forecast initialized with the EnKF analysis (EnKF) improved the simulation of meteorological fields to some degree in the border region compared to the reference forecast initialized with NCEP analysis data (FCST) and the simulation with observation nudging (FDDA), which in turn leading to reasonable air quality simulations. The simulated surface O3 distributions by EnKF were consistently better than FCST and FDDA on both days. EnKF usually produced more reasonable simulations of nitrate and ammonium aerosols compared to the observations, but still have difficulties in improving the simulations of organic and sulfate aerosols. However, discrepancies between the EnKF simulations and the measurements were still considerably large, particularly for sulfate and organic aerosols, indicating that there are still ample rooms for improvement in the present data assimilation and/or the modeling systems. Copyright © 2014 Elsevier B.V. All rights reserved.
An iterative ensemble Kalman filter for reservoir engineering applications
Krymskaya, M.V.; Hanea, R.G.; Verlaan, M.
2009-01-01
The study has been focused on examining the usage and the applicability of ensemble Kalman filtering techniques to the history matching procedures. The ensemble Kalman filter (EnKF) is often applied nowadays to solving such a problem. Meanwhile, traditional EnKF requires assumption of the
Pathophysiology of immune thrombocytopenic purpura: a bird's-eye ...
African Journals Online (AJOL)
... or release into the circulation? Doan et al.22 examined a number of spleens from .... purpura (Cooper N, Bussel J. The pathogenesis of immune thrombocytopaenic purpura. Br J Haematol. 2006 ...... Cremer M, Schulze H, Linthorst G, et al.
Francx, Winke; Oldehinkel, Marianne; Oosterlaan, Jaap; Heslenfeld, Dirk; Hartman, Catharina A.; Hoekstra, Pieter J.; Franke, Barbara; Beckmann, Christian F.; Buitelaar, Jan K.; Mennes, Maarten
2015-01-01
Background: One neurodevelopmental theory hypothesizes remission of attention-deficit/hyperactivity disorder (ADHD) to result from improved prefrontal top-down control, while ADHD, independent of the current diagnosis, is characterized by stable non-cortical deficits (Halperin & Schulz, 2006). We
International Nuclear Information System (INIS)
Agulyanskij, A.I.; Kirillov, S.A.; Prysyazhnyj, V.D.; AN Ukrainskoj SSR, Kiev. Inst. Obshchej i Neorganicheskoj Khimii)
1980-01-01
Using the method of IR-spectroscopy molten salt mixture containing K 2 TaF 7 , KF, KCl are investigated. It is detected that in the process of K 2 TaF 7 melting the TaF 6 - and TaF 7 2- ions are present in melt. When adding KF and KCl to the melt the equilibrium is shifted the direction of the TaF 7 2- and TaF 6 Cl 2- heptahaloid complexing respectively. In the melts with the composition close to the industrial electrolytes, containing K 2 TaF 7 , KF and KCl heptacoordinated tantalate ion is a prevailing one
Attitude Estimation Using Kalman Filtering: External Acceleration Compensation Considerations
Directory of Open Access Journals (Sweden)
Romy Budhi Widodo
2016-01-01
Full Text Available Attitude estimation is often inaccurate during highly dynamic motion due to the external acceleration. This paper proposes extended Kalman filter-based attitude estimation using a new algorithm to overcome the external acceleration. This algorithm is based on an external acceleration compensation model to be used as a modifying parameter in adjusting the measurement noise covariance matrix of the extended Kalman filter. The experiment was conducted to verify the estimation accuracy, that is, one-axis and multiple axes sensor movement. Five approaches were used to test the estimation of the attitude: (1 the KF-based model without compensating for external acceleration, (2 the proposed KF-based model which employs the external acceleration compensation model, (3 the two-step KF using weighted-based switching approach, (4 the KF-based model which uses the threshold-based approach, and (5 the KF-based model which uses the threshold-based approach combined with a softened part approach. The proposed algorithm showed high effectiveness during the one-axis test. When the testing conditions employed multiple axes, the estimation accuracy increased using the proposed approach and exhibited external acceleration rejection at the right timing. The proposed algorithm has fewer parameters that need to be set at the expense of the sharpness of signal edge transition.
Ensemble Kalman filtering with one-step-ahead smoothing
Raboudi, Naila F.
2018-01-11
The ensemble Kalman filter (EnKF) is widely used for sequential data assimilation. It operates as a succession of forecast and analysis steps. In realistic large-scale applications, EnKFs are implemented with small ensembles and poorly known model error statistics. This limits their representativeness of the background error covariances and, thus, their performance. This work explores the efficiency of the one-step-ahead (OSA) smoothing formulation of the Bayesian filtering problem to enhance the data assimilation performance of EnKFs. Filtering with OSA smoothing introduces an updated step with future observations, conditioning the ensemble sampling with more information. This should provide an improved background ensemble in the analysis step, which may help to mitigate the suboptimal character of EnKF-based methods. Here, the authors demonstrate the efficiency of a stochastic EnKF with OSA smoothing for state estimation. They then introduce a deterministic-like EnKF-OSA based on the singular evolutive interpolated ensemble Kalman (SEIK) filter. The authors show that the proposed SEIK-OSA outperforms both SEIK, as it efficiently exploits the data twice, and the stochastic EnKF-OSA, as it avoids observational error undersampling. They present extensive assimilation results from numerical experiments conducted with the Lorenz-96 model to demonstrate SEIK-OSA’s capabilities.
Selvan, A Sakthivel; Gupta, I D; Verma, A; Chaudhari, M V; Magotra, A
2016-07-01
The present study was undertaken with the objectives to characterize and to analyze combined genotypes of cluster of differentiation 14 (CD14) gene to explore its association with clinical mastitis in Karan Fries (KF) cows maintained in the National Dairy Research Institute herd, Karnal. Genomic DNA was extracted using blood of randomly selected 94 KF lactating cattle by phenol-chloroform method. After checking its quality and quantity, polymerase chain reaction (PCR) was carried out using six sets of reported gene-specific primers to amplify complete KF CD14 gene. The forward and reverse sequences for each PCR fragments were assembled to form complete sequence for the respective region of KF CD14 gene. The multiple sequence alignments of the edited sequence with the corresponding reference with reported Bos taurus sequence (EU148610.1) were performed with ClustalW software to identify single nucleotide polymorphisms (SNPs). Basic Local Alignment Search Tool analysis was performed to compare the sequence identity of KF CD14 gene with other species. The restriction fragment length polymorphism (RFLP) analysis was carried out in all KF cows using Helicobacter pylori 188I (Hpy188I) (contig 2) and Haemophilus influenzae I (HinfI) (contig 4) restriction enzyme (RE). Cows were assigned genotypes obtained by PCR-RFLP analysis, and association study was done using Chi-square (χ (2)) test. The genotypes of both contigs (loci) number 2 and 4 were combined with respect to each animal to construct combined genotype patterns. Two types of sequences of KF were obtained: One with 2630 bp having one insertion at 616 nucleotide (nt) position and one deletion at 1117 nt position, and the another sequence was of 2629 bp having only one deletion at 615 nt position. ClustalW, multiple alignments of KF CD14 gene sequence with B. taurus cattle sequence (EU148610.1), revealed 24 nt changes (SNPs). Cows were also screened using PCR-RFLP with Hpy188I (contig 2) and HinfI (contig 4) RE
Liquid abrasive pressure pot scoping tests report
International Nuclear Information System (INIS)
Archibald, K.E.
1996-01-01
The primary initiatives of the LITCO Decontamination Development group at the Idaho Chemical Process Plant (ICPP) are the development of methods to eliminate the use of sodium bearing decontamination chemicals and minimization of the amount of secondary waste generated during decontamination activities. In July of 1994, a Commerce Business Daily (CBD) announcement was issued by the INEL to determine commercial interest in the development of an in-situ liquid abrasive grit blasting system. As a result of the CBD announcement, Klieber ampersand Schulz issued an Expression of Interest letter which stated they would be interested in testing a prototype Liquid Abrasive Pressure Pot (LAPP). LITCO's Decontamination group and Kleiber ampersand Schulz entered into a Cooperative Research and Development Agreement (CRADA) in which the Decontamination Development group tested the prototype LAPP in a non-radioactive hot cell mockup. Test results are provided
1948-IJBCS-Article-Akinwunmi K.F
African Journals Online (AJOL)
hp
bilirubin, creatinine, uric acid, urea levels in the liver and plasma of treated animals. Moreover, some activities ... brown fixed oil which is mainly linoleic acid. (46.9%), oleic acid ...... of rosmarinic acid extracts on porcine pancreatic amylase in ...
Kuidas edasi? / Eesti SportHobuste Kasvatajate Selts
2014-01-01
Ajakirjas Breeding avaldatud Oldenburgi aretusjuhi dr Schulze-Schleppinghoffi arvamusest Euroopa täkkude litsentseerimise ja uhkete show'de süsteemist, mis vähendab ennast tõestanud hobuste kohta aretusindeksi edetabelis ning annab eelise noortele täkkudele
AMA- and RWE- Based Adaptive Kalman Filter for Denoising Fiber Optic Gyroscope Drift Signal.
Yang, Gongliu; Liu, Yuanyuan; Li, Ming; Song, Shunguang
2015-10-23
An improved double-factor adaptive Kalman filter called AMA-RWE-DFAKF is proposed to denoise fiber optic gyroscope (FOG) drift signal in both static and dynamic conditions. The first factor is Kalman gain updated by random weighting estimation (RWE) of the covariance matrix of innovation sequence at any time to ensure the lowest noise level of output, but the inertia of KF response increases in dynamic condition. To decrease the inertia, the second factor is the covariance matrix of predicted state vector adjusted by RWE only when discontinuities are detected by adaptive moving average (AMA).The AMA-RWE-DFAKF is applied for denoising FOG static and dynamic signals, its performance is compared with conventional KF (CKF), RWE-based adaptive KF with gain correction (RWE-AKFG), AMA- and RWE- based dual mode adaptive KF (AMA-RWE-DMAKF). Results of Allan variance on static signal and root mean square error (RMSE) on dynamic signal show that this proposed algorithm outperforms all the considered methods in denoising FOG signal.
Fuzzy adaptive Kalman filter for indoor mobile target positioning with INS/WSN integrated method
Institute of Scientific and Technical Information of China (English)
杨海; 李威; 罗成名
2015-01-01
Pure inertial navigation system (INS) has divergent localization errors after a long time. In order to compensate the disadvantage, wireless sensor network (WSN) associated with the INS was applied to estimate the mobile target positioning. Taking traditional Kalman filter (KF) as the framework, the system equation of KF was established by the INS and the observation equation of position errors was built by the WSN. Meanwhile, the observation equation of velocity errors was established by the velocity difference between the INS and WSN, then the covariance matrix of Kalman filter measurement noise was adjusted with fuzzy inference system (FIS), and the fuzzy adaptive Kalman filter (FAKF) based on the INS/WSN was proposed. The simulation results show that the FAKF method has better accuracy and robustness than KF and EKF methods and shows good adaptive capacity with time-varying system noise. Finally, experimental results further prove that FAKF has the fast convergence error, in comparison with KF and EKF methods.
Gharamti, M. E.
2015-05-11
The ensemble Kalman filter (EnKF) is a popular method for state-parameters estimation of subsurface flow and transport models based on field measurements. The common filtering procedure is to directly update the state and parameters as one single vector, which is known as the Joint-EnKF. In this study, we follow the one-step-ahead smoothing formulation of the filtering problem, to derive a new joint-based EnKF which involves a smoothing step of the state between two successive analysis steps. The new state-parameters estimation scheme is derived in a consistent Bayesian filtering framework and results in separate update steps for the state and the parameters. This new algorithm bears strong resemblance with the Dual-EnKF, but unlike the latter which first propagates the state with the model then updates it with the new observation, the proposed scheme starts by an update step, followed by a model integration step. We exploit this new formulation of the joint filtering problem and propose an efficient model-integration-free iterative procedure on the update step of the parameters only for further improved performances. Numerical experiments are conducted with a two-dimensional synthetic subsurface transport model simulating the migration of a contaminant plume in a heterogenous aquifer domain. Contaminant concentration data are assimilated to estimate both the contaminant state and the hydraulic conductivity field. Assimilation runs are performed under imperfect modeling conditions and various observational scenarios. Simulation results suggest that the proposed scheme efficiently recovers both the contaminant state and the aquifer conductivity, providing more accurate estimates than the standard Joint and Dual EnKFs in all tested scenarios. Iterating on the update step of the new scheme further enhances the proposed filter’s behavior. In term of computational cost, the new Joint-EnKF is almost equivalent to that of the Dual-EnKF, but requires twice more model
Competition of languages in the presence of a barrier
Schulze, Christian; Stauffer, Dietrich
2007-01-01
Using the Schulze model for Monte Carlo simulations of language competition, we include a barrier between the top half and the bottom half of the lattice. We check under which conditions two different languages evolve as dominating in the two halves.
Knee osteoarthritis and perceived social support amongst patients in ...
African Journals Online (AJOL)
Temitope Ilori
2016-06-29
Jun 29, 2016 ... long been linked with health and illness; for instance married adults have a lower ... recover faster than unmarried adults.13 Social support can be defined as those ..... Martire LM, Lustig AP, Schulz R, Miller GE, Helgeson VS.
Directory of Open Access Journals (Sweden)
Saiqa Tufail
Full Text Available ABSTRACT Polyhydroxyalkanoates (PHA are efficient, renewable and environment friendly polymeric esters. These polymers are synthesized by a variety of microbes under stress conditions. This study was carried out to check the suitability of waste frying oil in comparison to other oils for economical bioplastic production. Six bacterial strains were isolated and identified as Bacillus cereus (KF270349, Klebsiella pneumoniae (KF270350, Bacillus subtilis (KF270351, Brevibacterium halotolerance (KF270352, Pseudomonas aeruginosa (KF270353, and Stenotrophomonas rhizoposid (KF270354 by ribotyping. All strains were PHA producers so were selected for PHA synthesis using four different carbon sources, i.e., waste frying oil, canola oil, diesel and glucose. Extraction of PHA was carried out using sodium hypochlorite method and maximum amount was detected after 72 h in all cases. P. aeruginosa led to maximum PHA production after 72 h at 37 °C and 100 rpm using waste frying oil that was 53.2% PHA in comparison with glucose 37.8% and cooking oil 34.4%. B. cereus produced 40% PHA using glucose as carbon source which was high when compared against other strains. A significantly lesser amount of PHA was recorded with diesel as a carbon source for all strains. Sharp Infrared peaks around 1740-1750 cm-1 were present in Fourier Transform Infrared spectra that correspond to exact position for PHA. The use of waste oils and production of poly-3hydroxybutyrate-co-3hydroxyvalerate (3HB-co-3HV by strains used in this study is a good aspect to consider for future prospects as this type of polymer has better properties as compared to PHBs.
Biomimetic Growth of Hydroxyapatite on Kenaf Fibers
Directory of Open Access Journals (Sweden)
Saiful Izwan Abd Razak
2016-01-01
Full Text Available Biomimetic hydroxyapatite (HA growth on mercerized kenaf fiber (KF was achieved by immersion in a simulated body fluid (SBF solution with the addition of a chelating agent. An electron micrograph revealed uniform HA layers on the KF within 14 days of immersion with significant vibrational peaks of HA components. The tensile tests showed no significant drops in the unit break of the modified fibers. This new bone-like apatite coating on KF can be useful in the field of bone tissue engineering. The key motivation for this new approach was that it utilizes the abundantly available kenaf plant resource as the biobased template.
International Nuclear Information System (INIS)
Finken, D.
1985-05-01
In the current Fusion Technology Programme of the European Community the KfK association is working at present on 16 R and D contracts. Most of the work is strongly oriented towards the Next European Torus. Direct support to NET is given by three KfK delegates being member of the NET study group. In addition to the R and D contracts the association is working on 11 NET study contracts. Though KfK contributes to all areas defined in fusion technology, the main emphasis is put on superconducting magnet and breeding blanket development. Other important fields are tritium technology, materials research, and remote handling. (orig./GG)
Hetero-interaction between Gouy-Stern double layers : charge and potential regulation
Lyklema, J.; Duval, J.F.L.
2005-01-01
This issue of Advances is devoted to the memory of Hans-Joachim Schulze who, before his untimely death, made substantial contributions in the domains of flotation, wetting and particle interaction, often under adverse working conditions. Many of his publications involve hetero-interaction between
Kivi, Aita, 1954-
2001-01-01
Sisu : Maimu Veske. Continental; Maeve Haran. Tangot tantsitakse kahekesi; Zana Muhsen. Müüdud; Ingo Schulze. 33 õnnehetke; Alistair MacLean. Karusaar; Suur uneraamat, koost. Raisa Vuohelainen; Arbujad, koost. Ants Oras; Friedrich Weissensteiner. Kuulsad enesetapjad; Peter A. Clayton. Vaaraode kroonika; Lillede keel
The contribution of thermal radiation to the thermal conductivity of porous UO2
International Nuclear Information System (INIS)
Bakker, K.; Kwast, H.; Cordfunke, E.H.P.
1994-09-01
The influence of cylindrical, spherical and ellipsoidal inclusions on the overall thermal conductivity was computed with the finite element technique. The results of these calculations were compared with equations that describe the effect of inclusions on the overall thermal conductivity. The analytical equation of Schulz that describes the effect of inclusions on the overall thermal conductivity is in good agreement with the results of the finite element computations. This good agreement shows that among a variety of porosity correction formulas, the equation of Schulz gives the best description of the effect of inclusions on the overall thermal conductivity. This equation and the results of finite element calculations allow us to compute the contribution of radiation to the overall thermal conductivity of UO 2 with oblate ellipsoidal porosity. The present radiation calculations show that Hayes and Peddicord overestimated the contribution of thermal radiation to the thermal conductivity. (orig.)
Directory of Open Access Journals (Sweden)
A. Sakthivel Selvan
2016-07-01
Full Text Available Aim: The present study was undertaken with the objectives to characterize and to analyze combined genotypes of cluster of differentiation 14 (CD14 gene to explore its association with clinical mastitis in Karan Fries (KF cows maintained in the National Dairy Research Institute herd, Karnal. Materials and Methods: Genomic DNA was extracted using blood of randomly selected 94 KF lactating cattle by phenolchloroform method. After checking its quality and quantity, polymerase chain reaction (PCR was carried out using six sets of reported gene-specific primers to amplify complete KF CD14 gene. The forward and reverse sequences for each PCR fragments were assembled to form complete sequence for the respective region of KF CD14 gene. The multiple sequence alignments of the edited sequence with the corresponding reference with reported Bos taurus sequence (EU148610.1 were performed with ClustalW software to identify single nucleotide polymorphisms (SNPs. Basic Local Alignment Search Tool analysis was performed to compare the sequence identity of KF CD14 gene with other species. The restriction fragment length polymorphism (RFLP analysis was carried out in all KF cows using Helicobacter pylori 188I (Hpy188I (contig 2 and Haemophilus influenzae I (HinfI (contig 4 restriction enzyme (RE. Cows were assigned genotypes obtained by PCRRFLP analysis, and association study was done using Chi-square (χ2 test. The genotypes of both contigs (loci number 2 and 4 were combined with respect to each animal to construct combined genotype patterns. Results: Two types of sequences of KF were obtained: One with 2630 bp having one insertion at 616 nucleotide (nt position and one deletion at 1117 nt position, and the another sequence was of 2629 bp having only one deletion at 615 nt position. ClustalW, multiple alignments of KF CD14 gene sequence with B. taurus cattle sequence (EU148610.1, revealed 24 nt changes (SNPs. Cows were also screened using PCR-RFLP with Hpy188I
Lenartz, F.; Raick, C.; Soetaert, K.E.R.; Grégoire, M.
2007-01-01
The Ensemble Kalman filter (EnKF) has been applied to a 1-D complex ecosystem model coupled with a hydrodynamic model of the Ligurian Sea. In order to improve the performance of the EnKF, an ensemble subsampling strategy has been used to better represent the covariance matrices and a pre-analysis
Zodrow, E.L.; D'Angelo, J. A.; Mastalerz, Maria; Keefe, D.
2009-01-01
Cuticles have been macerated from suitably preserved compressed fossil foliage by Schulze's process for the past 150 years, whereas the physical-biochemical relationship between the "coalified layer" with preserved cuticle as a unit has hardly been investigated, although they provide complementary information. This relationship is conceptualized by an analogue model of the anatomy of an extant leaf: "vitrinite (mesophyll) + cuticle (biomacropolymer) = compression". Alkaline solutions from Schulze's process as a proxy for the vitrinite, are studied by means of liquid-solid states Fourier transform infrared spectroscopy (FTIR). In addition, cuticle-free coalified layers and fossilized cuticles of seed ferns mainly from Canada, Spain and Argentina of Late Pennsylvanian-Late Triassic age are included in the study sample. Infrared data of cuticle and alkaline solutions differ which is primarily contingent on the mesophyll +biomacropolymer characteristics. The compression records two pathways of organic matter transformation. One is the vitrinized component that reflects the diagenetic-post-diagenetic coalification history parallel with the evolution of the associated coal seam. The other is the cuticle that reflects the sum-total of evolutionary pathway of the biomacropolymer, its monomeric, or polymeric fragmentation, though factors promoting preservation include entombing clay minerals and lower pH conditions. Caution is advised when interpreting liquid-state-based FTIR data, as some IR signals may have resulted from the interaction of Schulze's process with the cuticular biochemistry. A biochemical-study course for taphonomy is suggested, as fossilized cuticles, cuticle-free coalified layers, and compressions are responses to shared physicogeochemical factors. ?? 2009 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Zodrow, Erwin L. [Palaeobotanical Laboratory, Cape Breton University, Sydney, Nova Scotia (Canada); D' Angelo, Jose A. [Instituto Argentino de Nivologia, Glaciologia y Ciencias Ambientales (IANIGLA), CCT-CONICET-Mendoza, Avda. Ruiz Leal s/n Parque Gral. San Martin (5500) Mendoza (Argentina); Area de Quimica, Instituto de Ciencias Basicas, Universidad Nacional de Cuyo, Centro Universitario - M5502JMA - Mendoza (Argentina); Mastalerz, Maria [Indiana Geological Survey, Indiana University, 611 North Walnut Grove, Bloomington, IN 47405-2208 (United States); Keefe, Dale [Molecular Spectroscopy Research Laboratory, Department of Chemistry, Cape Breton University, Sydney, Nova Scotia (Canada)
2009-08-01
Cuticles have been macerated from suitably preserved compressed fossil foliage by Schulze's process for the past 150 years, whereas the physical-biochemical relationship between the ''coalified layer'' with preserved cuticle as a unit has hardly been investigated, although they provide complementary information. This relationship is conceptualized by an analogue model of the anatomy of an extant leaf: ''vitrinite (mesophyll) + cuticle (biomacropolymer) = compression''. Alkaline solutions from Schulze's process as a proxy for the vitrinite, are studied by means of liquid-solid states Fourier transform infrared spectroscopy (FTIR). In addition, cuticle-free coalified layers and fossilized cuticles of seed ferns mainly from Canada, Spain and Argentina of Late Pennsylvanian-Late Triassic age are included in the study sample. Infrared data of cuticle and alkaline solutions differ which is primarily contingent on the mesophyll +biomacropolymer characteristics. The compression records two pathways of organic matter transformation. One is the vitrinized component that reflects the diagenetic-post-diagenetic coalification history parallel with the evolution of the associated coal seam. The other is the cuticle that reflects the sum-total of evolutionary pathway of the biomacropolymer, its monomeric, or polymeric fragmentation, though factors promoting preservation include entombing clay minerals and lower pH conditions. Caution is advised when interpreting liquid-state-based FTIR data, as some IR signals may have resulted from the interaction of Schulze's process with the cuticular biochemistry. A biochemical-study course for taphonomy is suggested, as fossilized cuticles, cuticle-free coalified layers, and compressions are responses to shared physicogeochemical factors. (author)
Directory of Open Access Journals (Sweden)
Lenin Piasarolo
2008-12-01
Full Text Available Investigou-se a influência da polaridade de pesticidas não-iônicos sobre sua sorção em material do horizonte A de um Latossolo Vermelho Acriférrico típico. Foram estudados treze pesticidas, abrangendo uma ampla faixa de polaridade, expressa na forma do coeficiente de partição do composto entre n-octanol e água (Kow. Foram obtidas as isotermas de sorção dos pesticidas, agitando-se subamostras do solo com soluções aquosas dos mesmos, sendo suas determinações quantitativas feitas por cromatografia líquida de alta eficiência. As isotermas de sorção dos pesticidas revelaram-se bem ajustadas ao modelo de Freundlich, com seus valores de coeficiente de sorção (Kf variando de 0,2 a 202 mL.nmol-1. Os valores de log Kf e de log Kow dos pesticidas mostraram-se linearmente correlacionados (R² = 0,87, indicando que a partição hidrofóbica na matéria orgânica foi o principal mecanismo de sorção dos compostos no solo. Para a maioria dos pesticidas, os valores de Kf obtidos foram maiores do que aqueles previstos pela equação de Briggs (1981, a qual relaciona o valor de Kf do pesticida com o seu valor de Kow e o teor de matéria orgânica do solo. Assim, os resultados mostraram que a referida equação, obtida em solos da Inglaterra, não é adequada para a previsão do valor de Kf de pesticidas no solo estudado, e que a natureza da matéria orgânica pode ser um importante fator a influenciar a sorção de pesticidas não-iônicos em solos.The sorption of thirteen non-ionic pesticides, with varying n-octanol/water partition coefficients (Kow, by soil material taken from the A horizon of an Acriferric Red Latosol was investigated. Sorption isotherms of the pesticides were determined by the shake flask method. The concentrations of the chemicals in aqueous solutions were measured by HPLC with UV detector. Sorption isotherms of all compounds fitted well the Freundlich model, with sorption coefficient (Kf values ranging from 0,2 to 202
A Resurgence of United Kingdom Nuclear Power Research (2011 EFRC Forum)
International Nuclear Information System (INIS)
Grimes, Robin W.
2011-01-01
Robin W. Grimes, Professor at Imperial College, London, was the third speaker in the May 26, 2011 EFRC Forum session, 'Global Perspectives on Frontiers in Energy Research.' In his presentation, Professor Grimes discussed recent research endeavors in advanced nuclear energy systems being pursued in the UK. The 2011 EFRC Summit and Forum brought together the EFRC community and science and policy leaders from universities, national laboratories, industry and government to discuss 'Science for our Nation's Energy Future.' In August 2009, the Office of Science established 46 Energy Frontier Research Centers. The EFRCs are collaborative research efforts intended to accelerate high-risk, high-reward fundamental research, the scientific basis for transformative energy technologies of the future. These Centers involve universities, national laboratories, nonprofit organizations, and for-profit firms, singly or in partnerships, selected by scientific peer review. They are funded at $2 to $5 million per year for a total planned DOE commitment of $777 million over the initial five-year award period, pending Congressional appropriations. These integrated, multi-investigator Centers are conducting fundamental research focusing on one or more of several 'grand challenges' and use-inspired 'basic research needs' recently identified in major strategic planning efforts by the scientific community. The purpose of the EFRCs is to integrate the talents and expertise of leading scientists in a setting designed to accelerate research that transforms the future of energy and the environment.
Zou, Junhuang; Zheng, Tihua; Ren, Chongyu; Askew, Charles; Liu, Xiao-Ping; Pan, Bifeng; Holt, Jeffrey R; Wang, Yong; Yang, Jun
2014-05-01
Usher syndrome type 2 (USH2) is the predominant form of USH, a leading genetic cause of combined deafness and blindness. PDZD7, a paralog of two USH causative genes, USH1C and USH2D (WHRN), was recently reported to be implicated in USH2 and non-syndromic deafness. It encodes a protein with multiple PDZ domains. To understand the biological function of PDZD7 and the pathogenic mechanism caused by PDZD7 mutations, we generated and thoroughly characterized a Pdzd7 knockout mouse model. The Pdzd7 knockout mice exhibit congenital profound deafness, as assessed by auditory brainstem response, distortion product otoacoustic emission and cochlear microphonics tests, and normal vestibular function, as assessed by their behaviors. Lack of PDZD7 leads to the disorganization of stereocilia bundles and a reduction in mechanotransduction currents and sensitivity in cochlear outer hair cells. At the molecular level, PDZD7 determines the localization of the USH2 protein complex, composed of USH2A, GPR98 and WHRN, to ankle links in developing cochlear hair cells, likely through its direct interactions with these three proteins. The localization of PDZD7 to the ankle links of cochlear hair bundles also relies on USH2 proteins. In photoreceptors of Pdzd7 knockout mice, the three USH2 proteins largely remain unchanged at the periciliary membrane complex. The electroretinogram responses of both rod and cone photoreceptors are normal in knockout mice at 1 month of age. Therefore, although the organization of the USH2 complex appears different in photoreceptors, it is clear that PDZD7 plays an essential role in organizing the USH2 complex at ankle links in developing cochlear hair cells. GenBank accession numbers: KF041446, KF041447, KF041448, KF041449, KF041450, KF041451.
Raymond L. Czaplewski
2015-01-01
Wall-to-wall remotely sensed data are increasingly available to monitor landscape dynamics over large geographic areas. However, statistical monitoring programs that use post-stratification cannot fully utilize those sensor data. The Kalman filter (KF) is an alternative statistical estimator. I develop a new KF algorithm that is numerically robust with large numbers of...
Digital Repository Service at National Institute of Oceanography (India)
Shirodkar, P.V.; Xiao, Y.K.; Sarkar, A.; Dalal, S.G.; Chivas, A.R.
WE, Ehrlich R, Klovan JE. J Math Geol 1981;13:331–4. Grassl H, Jost V, Ramesh Kumar MR, Schulz J, Bauer P, Schluessel P. The Hamburg Ocean atmosphere parameters and fluxes from satellite data (HOAPS): a climatological atlas of satellite derived air...
International Nuclear Information System (INIS)
Cobian, Hector; Schulze-Halberg, Axel
2011-01-01
We construct Darboux transformations for time-dependent Schroedinger equations with position-dependent mass in (2 + 1) dimensions. Several examples illustrate our results, which complement and generalize former findings for the constant mass case in two spatial variables (Schulze-Halberg 2010 J. Math. Phys. 51 033521).
Fault Detection and Isolation for a Supermarket Refrigeration System - Part One
DEFF Research Database (Denmark)
Yang, Zhenyu; Rasmussen, Karsten B.; Kieu, Anh T.
2011-01-01
Fault Detection and Isolation (FDI) using the Kalman Filter (KF) technique for a supermarket refrigeration system is explored. Four types of sensor fault scenarios, namely drift, offset, freeze and hard-over, are considered for two temperature sensors, and one type of parametric fault scenario, n....... The test results show that the EKF-based FDI method generally performances better and faster than the KF-based method does. However, both methods can not handle the isolation between sensor faults and parametric fault.......Fault Detection and Isolation (FDI) using the Kalman Filter (KF) technique for a supermarket refrigeration system is explored. Four types of sensor fault scenarios, namely drift, offset, freeze and hard-over, are considered for two temperature sensors, and one type of parametric fault scenario...... isolation purpose, a bank of KFs arranged by splitting measurements is constructed for sensor fault isolation, while the Multi-Model Adaptive Estimation (MMAE) method is employed to handle parametric fault isolation. All these approaches are extended and checked by using Extended KF technique afterwards...
Safety and risk assessments for the SNR 300
International Nuclear Information System (INIS)
Maschek, W.; Froehlich, R.; Jacobs, H.; Schikorr, M.; Heusener, G.; Caldarola, L.; Royl, P.; Struwe, D.
1983-01-01
Under the official inquiry ''Future Nuclear Energy Policies'', KfK have carried out a number of studies concerning the hazards arising from core-destructive accidents at the SNR-300 reactor. Among these, there was the so-called ''Upper Limit Study'' providing a critical evaluation of literature on all research done on core-destructive accidents (Bethe-Tait excursion) with a high mechanic energy release potential; the other one was the so-called ''SAI Study'' (a cooperation of KfK, Science Applications, Inc. (SAI) and Interatom (IA)) which investigated the hazards of an uncontrolled coolant flow rate disturbance occurring in the SNR-300 reactor. KfK also took part in the analysis of hazards comparing the SNR-300 reactor with an LWR-type reactor like the one at Biblis B, ordered by the Federal Ministry of Research and Technology (BMFT). These studies have already been dealt with KfK-Nachrichten, 14th annual set issue 4/1982. The article on hand summarizes and evaluates once more the most important results. (orig./RW) [de
Riahi, Siavash; Ganjali, Mohammad Reza; Hariri, Maryam; Abdolahzadeh, Shaghayegh; Norouzi, Parviz
2009-09-01
In this paper, a sensitive, easy, efficient, and suitable method for the calculation of Kf values of complexation between one derivative of Dansyl chloride [5-(dimethylamino) naphthalene-1-sulfonyl 4-phenylsemicarbazide] (DMNP) and Lanthanide(III) (Ln) ions is proposed, using both spectrofluorometric and spectrophotometric methods. Determination of Kf showed that DMNP was mostly selective towards the erbium (III) ion. The validity of the method was also confirmed calculating the Stern-Volmer fluorescence quenching constants ( Ksv) that resulted in the same consequence, obtained by calculating the Kf of complexation values. In addition, the UV-vis spectroscopy was applied for the determination of Kf only for the Ln ions that had interactions with DMNP. Finally, the DFT studies were done on Er 3+ and the DMNP complex for distinguishing the active sites and estimating the pair wise interaction energy. It can be concluded that this derivative of Dansyl chloride with inherent high fluorescence intensity is a suitable reagent for the selective determination of the Er 3+ ion which can be used in constructing selective Er 3+ sensors.
The application of particle filters in single trial event-related potential estimation
International Nuclear Information System (INIS)
Mohseni, Hamid R; Nazarpour, Kianoush; Sanei, Saeid; Wilding, Edward L
2009-01-01
In this paper, an approach for the estimation of single trial event-related potentials (ST-ERPs) using particle filters (PFs) is presented. The method is based on recursive Bayesian mean square estimation of ERP wavelet coefficients using their previous estimates as prior information. To enable a performance evaluation of the approach in the Gaussian and non-Gaussian distributed noise conditions, we added Gaussian white noise (GWN) and real electroencephalogram (EEG) signals recorded during rest to the simulated ERPs. The results were compared to that of the Kalman filtering (KF) approach demonstrating the robustness of the PF over the KF to the added GWN noise. The proposed method also outperforms the KF when the assumption about the Gaussianity of the noise is violated. We also applied this technique to real EEG potentials recorded in an odd-ball paradigm and investigated the correlation between the amplitude and the latency of the estimated ERP components. Unlike the KF method, for the PF there was a statistically significant negative correlation between amplitude and latency of the estimated ERPs, matching previous neurophysiological findings
Tsang, Tracey W; Kohn, Michael R; Chow, Chin Moi; Fiatarone Singh, Maria Antoinette
2010-01-01
Aim. To examine the efficacy of a six-month Kung Fu (KF) program on physical fitness in overweight/obese adolescents. Methods. Subjects were randomly assigned to the KF or sham exercise (Tai Chi, TC) control group. Physical measurements in cardiovascular fitness and muscle fitness occurred at baseline and after 6 months of training thrice weekly. Results. Twenty subjects were recruited. One subject was lost to follow-up, although overall compliance to the training sessions was 46.7 +/- 27.8%. At follow-up, the cohort improved in absolute upper (P = .002) and lower (P = .04) body strength, and upper body muscle endurance (P = .02), without group differences. KF training resulted in significantly greater improvements in submaximal cardiovascular fitness (P = .03), lower body muscle endurance (P = .28; significant 95% CI: 0.37-2.49), and upper body muscle velocity (P = .03) relative to TC training. Conclusions. This short-term KF program improved submaximal cardiovascular fitness, lower body muscle endurance, and muscle velocity, in overweight/obese adolescents with very low baseline fitness.
Directory of Open Access Journals (Sweden)
Tracey W. Tsang
2010-01-01
Full Text Available Aim. To examine the efficacy of a six-month Kung Fu (KF program on physical fitness in overweight/obese adolescents. Methods. Subjects were randomly assigned to the KF or sham exercise (Tai Chi, TC control group. Physical measurements in cardiovascular fitness and muscle fitness occurred at baseline and after 6 months of training thrice weekly. Results. Twenty subjects were recruited. One subject was lost to follow-up, although overall compliance to the training sessions was 46.7±27.8%. At follow-up, the cohort improved in absolute upper (P=.002 and lower (P=.04 body strength, and upper body muscle endurance (P=.02, without group differences. KF training resulted in significantly greater improvements in submaximal cardiovascular fitness (P=.03, lower body muscle endurance (P=.28; significant 95% CI: 0.37–2.49, and upper body muscle velocity (P=.03 relative to TC training. Conclusions. This short-term KF program improved submaximal cardiovascular fitness, lower body muscle endurance, and muscle velocity, in overweight/obese adolescents with very low baseline fitness.
Directory of Open Access Journals (Sweden)
Bhutta Adnan T
2008-08-01
Full Text Available Abstract Background Neonatal rats exposed to repetitive inflammatory pain have altered behaviors in young adulthood, partly ameliorated by Ketamine analgesia. We examined the relationships between protein expression, neuronal survival and plasticity in the neonatal rat brain, and correlated these changes with adult cognitive behavior. Methods Using Western immunoblot techniques, homogenates of cortical tissue were analyzed from neonatal rats 18–20 hours following repeated exposure to 4% formalin injections (F, N = 9, Ketamine (K, 2.5 mg/kg × 2, N = 9, Ketamine prior to formalin (KF, N = 9, or undisturbed controls (C, N = 9. Brain tissues from another cohort of rat pups (F = 11, K = 12, KF = 10, C = 15 were used for cellular staining with Fos immunohistochemistry or FluoroJade-B (FJB, followed by cell counting in eleven cortical and three hippocampal areas. Long-term cognitive testing using a delayed non-match to sample (DNMS paradigm in the 8-arm radial maze was performed in adult rats receiving the same treatments (F = 20, K = 24, KF = 21, C = 27 in the neonatal period. Results Greater cell death occurred in F vs. C, K, KF in parietal and retrosplenial areas, vs. K, KF in piriform, temporal, and occipital areas, vs. C, K in frontal and hindlimb areas. In retrosplenial cortex, less Fos expression occurred in F vs. C, KF. Cell death correlated inversely with Fos expression in piriform, retrosplenial, and occipital areas, but only in F. Cortical expression of glial fibrillary acidic protein (GFAP was elevated in F, K and KF vs. C. No significant differences occurred in Caspase-3, Bax, and Bcl-2 expression between groups, but cellular changes in cortical areas were significantly correlated with protein expression patterns. Cluster analysis of the frequencies and durations of behaviors grouped them as exploratory, learning, preparatory, consumptive, and foraging behaviors. Neonatal inflammatory pain exposure reduced exploratory behaviors in adult
1990-02-02
Brisman, and J. Reld, Direct Metiod for Sparse Matrices, Clarendon Press, Oxford, 1986. [3] I.S. Duff, E.G. Grimes, and J.G. Lewis, Sparse matriz test...the N x m matrix with column vectors vl,...,v, and by Hm the m x m Hessenberg matriz whose nonzero entries are defined by the algorithm. Then the...class of methods reduces to the first one. In the nonsymmetric case, the biconjugate gradient method ( BCG ) due to Lanczos [21] and Fletcher [16] is a
Ensemble Kalman filter for the reconstruction of the Earth's mantle circulation
Bocher, Marie; Fournier, Alexandre; Coltice, Nicolas
2018-02-01
Recent advances in mantle convection modeling led to the release of a new generation of convection codes, able to self-consistently generate plate-like tectonics at their surface. Those models physically link mantle dynamics to surface tectonics. Combined with plate tectonic reconstructions, they have the potential to produce a new generation of mantle circulation models that use data assimilation methods and where uncertainties in plate tectonic reconstructions are taken into account. We provided a proof of this concept by applying a suboptimal Kalman filter to the reconstruction of mantle circulation (Bocher et al., 2016). Here, we propose to go one step further and apply the ensemble Kalman filter (EnKF) to this problem. The EnKF is a sequential Monte Carlo method particularly adapted to solve high-dimensional data assimilation problems with nonlinear dynamics. We tested the EnKF using synthetic observations consisting of surface velocity and heat flow measurements on a 2-D-spherical annulus model and compared it with the method developed previously. The EnKF performs on average better and is more stable than the former method. Less than 300 ensemble members are sufficient to reconstruct an evolution. We use covariance adaptive inflation and localization to correct for sampling errors. We show that the EnKF results are robust over a wide range of covariance localization parameters. The reconstruction is associated with an estimation of the error, and provides valuable information on where the reconstruction is to be trusted or not.
Wang, S.; Huang, G. H.; Baetz, B. W.; Cai, X. M.; Ancell, B. C.; Fan, Y. R.
2017-11-01
The ensemble Kalman filter (EnKF) is recognized as a powerful data assimilation technique that generates an ensemble of model variables through stochastic perturbations of forcing data and observations. However, relatively little guidance exists with regard to the proper specification of the magnitude of the perturbation and the ensemble size, posing a significant challenge in optimally implementing the EnKF. This paper presents a robust data assimilation system (RDAS), in which a multi-factorial design of the EnKF experiments is first proposed for hydrologic ensemble predictions. A multi-way analysis of variance is then used to examine potential interactions among factors affecting the EnKF experiments, achieving optimality of the RDAS with maximized performance of hydrologic predictions. The RDAS is applied to the Xiangxi River watershed which is the most representative watershed in China's Three Gorges Reservoir region to demonstrate its validity and applicability. Results reveal that the pairwise interaction between perturbed precipitation and streamflow observations has the most significant impact on the performance of the EnKF system, and their interactions vary dynamically across different settings of the ensemble size and the evapotranspiration perturbation. In addition, the interactions among experimental factors vary greatly in magnitude and direction depending on different statistical metrics for model evaluation including the Nash-Sutcliffe efficiency and the Box-Cox transformed root-mean-square error. It is thus necessary to test various evaluation metrics in order to enhance the robustness of hydrologic prediction systems.
The effect of mitomycin-c in keloid fibroblast cultures
Directory of Open Access Journals (Sweden)
Ishandono Dachlan
2016-12-01
Full Text Available ABSTRACT Keloid occurs due to hyperactivity of keloid fibroblast (KF in proliferation, migration, collagen deposition, together with low rates of collagen degradation. These are under the responsibility of TGF-b. Mitomycin C (MC is used for treating keloid by a topical application during surgery at the level of 0.02% to 0.08%. Unfortunately, the lowest effective level of MC for keloid has not been determined yet. We aimed to determine the lowest effective level of MC in the suppression of KF activities. Various levels of MC diluted in growth medium were administered on KF that were isolated from six patients. After 24 hours and 72 hours of incubation, cellular proliferation, collagen deposition, cellular migration and level of TGF-b, were analyzed. Application of 120 uM MC on KF culture for 24 hours could significantly reduce TGF-b production from 1265.74 ± 274.81 pg/mL to 265.17 ± 12.20 pg/mL; proliferation index from 100% to 84.01 ± 12.91%; inhibit cellular migration to 64.38 ± 3.66%; but reduce collagen depositions from 100% to only 91.13 ± 10.19%. The lowest MC level is on 30 uM or equal with 0.001%. In conclusion, the lowest level of MC can suppress the activities of KF is 0.001%. Moreover, due to low activity in inhibiting collagen deposition, MC would be better as an adjuvant drug for keloid surgery.
An Adaptive Approach to Mitigate Background Covariance Limitations in the Ensemble Kalman Filter
Song, Hajoon
2010-07-01
A new approach is proposed to address the background covariance limitations arising from undersampled ensembles and unaccounted model errors in the ensemble Kalman filter (EnKF). The method enhances the representativeness of the EnKF ensemble by augmenting it with new members chosen adaptively to add missing information that prevents the EnKF from fully fitting the data to the ensemble. The vectors to be added are obtained by back projecting the residuals of the observation misfits from the EnKF analysis step onto the state space. The back projection is done using an optimal interpolation (OI) scheme based on an estimated covariance of the subspace missing from the ensemble. In the experiments reported here, the OI uses a preselected stationary background covariance matrix, as in the hybrid EnKF–three-dimensional variational data assimilation (3DVAR) approach, but the resulting correction is included as a new ensemble member instead of being added to all existing ensemble members. The adaptive approach is tested with the Lorenz-96 model. The hybrid EnKF–3DVAR is used as a benchmark to evaluate the performance of the adaptive approach. Assimilation experiments suggest that the new adaptive scheme significantly improves the EnKF behavior when it suffers from small size ensembles and neglected model errors. It was further found to be competitive with the hybrid EnKF–3DVAR approach, depending on ensemble size and data coverage.
Jalbert, J; Gilbert, R; Tétreault, P
1999-08-01
Over the past few years, concerns have been raised in the literature about the accuracy of the Karl Fischer (KF) method for assessing moisture in transformer mineral oils. To better understand this issue, the performance of a static headspace capillary gas chromatographic (HS-CGC) technique was compared to that of KF coulometric titration by analyzing moisture in samples containing known amounts of water and various samples obtained from the National Institute of Standards and Technology (NIST). Two modes of adding samples into the KF vessel were used: direct injection and indirect injection via an azeotropic distillation of the moisture with toluene. Under the conditions used for direct injection, the oil matrix was totally dissolved in the anolyte, which allowed the moisture to be titrated in a single-phase solution rather than in a suspension. The results have shown that when HS-CGC and combined azeotropic distillation/KF titration are calibrated with moisture-in-oil standards, a linear relation is observed over 0-60 ppm H(2)O with a correlation coefficient better than 0.9994 (95% confidence), with the regression line crossing through zero. A similar relation can also be observed when calibration is achieved by direct KF addition of standards prepared with octanol-1, but in this case an intercept of 4-5 ppm is noted. The amount of moisture determined by curve interpolation in NIST reference materials by the three calibrated systems ranges from 13.0 to 14.8 ppm for RM 8506 and 42.5 to 46.4 ppm for RM 8507, and in any case, the results were as high as those reported in the literature with volumetric KF titration. However, titration of various dehydrated oil and solvent samples showed that direct KF titration is affected by a small bias when samples contain very little moisture. The source of error after correction for the large sample volume used for the determination (8 mL) is about 6 ppm for Voltesso naphthenic oil and 4 ppm for toluene, revealing a matrix
South African Medical Journal - Vol 45, No 1 (1971)
African Journals Online (AJOL)
HC Falkson, EJ Schulz, Geoffrey Falkson. Plastics in Pharmacy and Medicine · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. TJ McCarthy. Gonadal dysgenesis, Turner's syndrome and phenotype in the South African Bantu · EMAIL FREE FULL TEXT EMAIL FREE ...
Impacts of climate change on water resources in Southern Africa: A Review
CSIR Research Space (South Africa)
Kusangaya, S
2013-10-01
Full Text Available in their projections. Moreso, others relied on use of a single GCM (e.g. Mujere and Mazvimavi, 2012). Additionally, only a few studies used RCM (e.g. Engelbrecht (2005); Schulze et al. (2005); Tadross et al. (2005)) despite these having a better spatial resolution...
The Path of the Blind Watchmaker: A Model of Evolution
2011-04-06
our countermeasures. Viruses evolve into new strains such that the antibodies produced due to vaccines are ineffective. Bacteria evolve into new...Maddison, Katja- Sabine Schulz, & Wayne P. Maddison. (2007). The Tree of Life Web Project. Zootaxa, 1668, 19-40. [42] Matt Ridley. (2000). The search for
Farmers' Willingness to Pay for Private Irrigation Supply in Nandom ...
African Journals Online (AJOL)
2017-05-01
May 1, 2017 ... by income, age, farm size, engagement in an off-farm occupation, labour hours invested in farm operation, yield losses ... food insecurity and migration of their household members (Rademacher-Schulz & ... Ghana's current policy on agriculture water supply, the National Irrigation Policy,. Strategies and ...
A strong shock tube problem calculated by different numerical schemes
Lee, Wen Ho; Clancy, Sean P.
1996-05-01
Calculated results are presented for the solution of a very strong shock tube problem on a coarse mesh using (1) MESA code, (2) UNICORN code, (3) Schulz hydro, and (4) modified TVD scheme. The first two codes are written in Eulerian coordinates, whereas methods (3) and (4) are in Lagrangian coordinates. MESA and UNICORN codes are both of second order and use different monotonic advection method to avoid the Gibbs phenomena. Code (3) uses typical artificial viscosity for inviscid flow, whereas code (4) uses a modified TVD scheme. The test problem is a strong shock tube problem with a pressure ratio of 109 and density ratio of 103 in an ideal gas. For no mass-matching case, Schulz hydro is better than TVD scheme. In the case of mass-matching, there is no difference between them. MESA and UNICORN results are nearly the same. However, the computed positions such as the contact discontinuity (i.e. the material interface) are not as accurate as the Lagrangian methods.
Directory of Open Access Journals (Sweden)
Antonio Vicente Pereira Neto
2011-12-01
Full Text Available Foram realizadas mudanças no esquema de parametrização convectiva de Kain-Fritsch (KF2, para melhor representar a precipitação na região do Centro de Lançamento de Alcântara (CLA em simulações com o modelo regional MM5. Simulações de 24 h em um domínio aproximadamente centrado no CLA, com espaçamento de grade de 30 km foram realizadas para o período de 2005-2006 (calibração e 2008 (validação. O KF2 foi modificado sob a seguinte configuração: passo de tempo de 60 s, uso do esquema de convecção explícita warm rain e uso conjunto dos esquemas de convecção rasa de Grell e do KF2. As mudanças no KF2 foram: aumento da profundidade de nuvem necessária para disparar a convecção profunda e ajuste de alguns parâmetros da função disparo da convecção dependentes da velocidade vertical ascendente na coluna atmosférica. Com as modificações, houve expressiva melhoria na representação do total de precipitação e da fração dos dias do mês com chuva na escala mensal. O padrão espacial de erros no domínio, no entanto, não sofreu muitas alterações sobre o continente (em geral, a precipitação foi melhor representada sobre o continente do que sobre o oceano. Todas as etapas de mudanças e ajustes realizadas no trabalho poderão ser empregadas para melhorar a representação da precipitação em outras regiões específicas.Changes in the Kain-Fritsch convective parameterization scheme (KF2 were included to better represent the precipitation in simulations using the MM5 regional model for the Alcântara Launch Center (CLA region. Daily (24 h integrations for a 30 km grid spacing domain centered in CLA were performed for 2005-2006 (calibration and 2008 (validation. KF2 scheme was modified under the following simulation settings: time step of 60 s, use of warm rain scheme and joint use of Grell and KF2 shallow convection schemes. Changes in KF2 were: increase of minimum cloud depth to initiate deep convection and
Single nucleotide polymorphism in Egyptian cattle insulin-like growth factor binding protein-3 gene
Directory of Open Access Journals (Sweden)
Othman E. Othman
2014-12-01
It is concluded that the IGFBP-3/HaeIII polymorphism may be utilized as a good marker for genetic differentiation between cattle animals for different body functions such as growth, metabolism, reproduction, immunity and energy balance. The nucleotide sequences of Egyptian cattle IGFBP-3 A and C alleles were submitted to GenBank with the accession numbers KF899893 and KF899894, respectively.
Gadsden, S. Andrew; Kirubarajan, T.
2017-05-01
Signal processing techniques are prevalent in a wide range of fields: control, target tracking, telecommunications, robotics, fault detection and diagnosis, and even stock market analysis, to name a few. Although first introduced in the 1950s, the most popular method used for signal processing and state estimation remains the Kalman filter (KF). The KF offers an optimal solution to the estimation problem under strict assumptions. Since this time, a number of other estimation strategies and filters were introduced to overcome robustness issues, such as the smooth variable structure filter (SVSF). In this paper, properties of the SVSF are explored in an effort to detect and diagnosis faults in an electromechanical system. The results are compared with the KF method, and future work is discussed.
Observation Quality Control with a Robust Ensemble Kalman Filter
Roh, Soojin
2013-12-01
Current ensemble-based Kalman filter (EnKF) algorithms are not robust to gross observation errors caused by technical or human errors during the data collection process. In this paper, the authors consider two types of gross observational errors, additive statistical outliers and innovation outliers, and introduce a method to make EnKF robust to gross observation errors. Using both a one-dimensional linear system of dynamics and a 40-variable Lorenz model, the performance of the proposed robust ensemble Kalman filter (REnKF) was tested and it was found that the new approach greatly improves the performance of the filter in the presence of gross observation errors and leads to only a modest loss of accuracy with clean, outlier-free, observations.
The meterological information system of the Karlsruhe Nuclear Research Center
International Nuclear Information System (INIS)
Holleuffer-Kypke, R. von; Huebschmann, W.G.; Thomas, P.; Suess, F.
1984-01-01
The Meteorological Information System (MIS) comprising the meteorological instruments, the computers, and the software for data processing and recording, is part of the KfK safety and control system. In 1982 is was equipped with an independent data processing system. The report explains the arrangement and the operation of the sensors and thw two process computers. For selected meteorological situations the ability of the system is demonstrated, i.e., the presentation of the vertical profiles of wind, temperature and turbulence in the lower atmospheric boundary layer as well as the calculation and graphical representation of the transport and dispersion into the KfK environment of radioactive pollutants being released by the nuclear installations of the KfK into the atmosphere. (orig.) [de
Observation Quality Control with a Robust Ensemble Kalman Filter
Roh, Soojin; Genton, Marc G.; Jun, Mikyoung; Szunyogh, Istvan; Hoteit, Ibrahim
2013-01-01
Current ensemble-based Kalman filter (EnKF) algorithms are not robust to gross observation errors caused by technical or human errors during the data collection process. In this paper, the authors consider two types of gross observational errors, additive statistical outliers and innovation outliers, and introduce a method to make EnKF robust to gross observation errors. Using both a one-dimensional linear system of dynamics and a 40-variable Lorenz model, the performance of the proposed robust ensemble Kalman filter (REnKF) was tested and it was found that the new approach greatly improves the performance of the filter in the presence of gross observation errors and leads to only a modest loss of accuracy with clean, outlier-free, observations.
Chemical composition and anti-bacterial activity of essential oil from ...
African Journals Online (AJOL)
Yomi
2012-01-24
Jan 24, 2012 ... The fatty acid profiles of seed essential oil are characterized by considerable unsaturated fatty acids. (90.39%) including linoleic acid ..... sample clean-up steps (Schulz and Baranska, 2007). Therefore, FT-IR was employed ..... Squalene, olive oil, and cancer risk: A review and hypothesis. Cancer Epidemiol.
Nijenhuis, Ivar Anders
1999-01-01
A brief history of sapropels The word "sapropel" first appears in the literature in 1904, when Potonié mentions that Prof. Dr. Schulze suggested that this word should be used as the international scientific term for Faulschlamm [Potonié, 1904]. Sapropel is a contraction of the literal translation of
Internet Based Robot Control Using CORBA Based Communications
2009-12-01
Proceedings of the IADIS International Conference WWW/Internet, ICWI 2002, pp. 485–490. [5] Flanagan, David , Farley, Jim, Crawford, William, and...Conference on Robotics andAutomation, ICRA’00., pp. 2019–2024. [7] Schulz, D., Burgard, W., Cremers , A., Fox, D., and Thrun, S. (2000), Web interfaces
Toward Lifelong Visual Localization and Mapping
2013-06-01
lab, Michael Benjamin, Rob Truax, Aisha Walcott, David Rosen, Mark VanMiddlesworth, Ross Finman, Elias Mueggler, and Dehann Fourie. They really made...S. Thrun, M. Beetz, M. Bennewitz, W. Burgard, AB Cremers , F. Dellaert, D. Fox, D. Hahnel, C. Rosenberg, N. Roy, J. Schulte, and D. Schulz. Proba
Theoretical Analyses of the Functional Regions of the Heavy Chain of Botulinum Neurotoxin
1994-01-01
SE. Schulz GM. liallctt M. Effects of hb)tulinum toxin injections on speech in adductor spasmodic dysphonia . Neurology 1988,38:1220-1225. 3. Jankovic...hemifacial spasm. Mov Disord 1987:4:237-254. 5. Brin MF. Blitzer A, Fahn S, Gould W. Lovelace RE. Adductor laryngeal dystonia (spastic dysphonia ): treatment
Malawi Medical Journal - Vol 26, No 3 (2014)
African Journals Online (AJOL)
Presentation of Primary Open Angle Glaucoma (POAG) at Lions Sight First Eye Hospital in Blantyre, Malawi · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PC Kayange, HB Nkume, A Feyi-Waboso, K Kalua, G Msukwa, M Schwering Schulze, 60-62 ...
Abar, Caitlin; Turrisi, Robert
2008-10-01
Building on previous findings supporting the continuing influence of parents on their teens after they have gone to college [Turrisi, R., Jaccard, J., Taki, R., Dunnam, H., & Grimes, J. (2001). Examination of the short-term efficacy of a parent intervention to reduce college student drinking tendencies. Psychology of Addictive Behaviors, 15(4), 366-372.; Turrisi, R., Padilla, K., & Wiersma, K. (2000). College student drinking: An examination of theoretical models of drinking tendencies in freshman and upperclassmen. Journal of Studies on Alcohol, 61, 598-602.[28
Beckford, R.; Bean, T.
2017-01-01
The Jamaican Bible Remix is a conceptual musical collection. The album samples audio from Di Jamiekan Nyuu Testiment (The Jamaican New Testament) and triangulates it with themes from black liberation theology, and soundscapes from the black British music canon. The result is a new type of gospel music or Social Gospel Music. \\ud \\ud Diverse genres from the black British music canon, such as UK Soul, Drum n Bass, Grime, and Jazz embellish the album. Genres are chosen to underline particular t...
Astbury, John
2011-01-01
It was suggested that dirt was a way of falling away from perfection and through introducing or allowing dirt you could avoid the sterile and lifeless. A ephemeral and intangible entity, dirt is, by its nature, an elusive creature. This intangibility encouraged me to draw a clearer definition for myself of what dirt meant. If dirt was not limited to patina and grime how could it be understood in terms of design. This is the essence of my thesis. Some pictures have been removed for publica...
Analysis of Dynamic Performance of a Kalman Filter for Combining Multiple MEMS Gyroscopes
Directory of Open Access Journals (Sweden)
Liang Xue
2014-11-01
Full Text Available In this paper, the dynamic performance of a Kalman filter (KF was analyzed, which is used to combine multiple measurements of a gyroscopes array to reduce the noise and improve the accuracy of the individual sensors. A principle for accuracy improvement by the KF was briefly presented to obtain an optimal estimate of input rate signal. In particular, the influences of some crucial factors on the KF dynamic performance were analyzed by simulations such as the factors input signal frequency, signal sampling, and KF filtering rate. Finally, a system that was comprised of a six-gyroscope array was designed and implemented to test the dynamic performance. Experimental results indicated that the 1σ error for the combined rate signal was reduced to about 0.2°/s in the constant rate test, which was a reduction by a factor of more than eight compared to the single gyroscope. The 1σ error was also reduced from 1.6°/s to 0.48°/s in the swing test. It showed that the estimated angular rate signal could well reflect the dynamic characteristic of the input signal in dynamic conditions.
Joint development effort Thermonuclear Fusion. Programme budgeting 1984
International Nuclear Information System (INIS)
1985-01-01
The joint KfK and IPP project for the development of thermonuclear fusion device is established as the centerpiece of Federal German efforts in this field. It is meant to enhance the German contribution to the European programme and thus foster the chances of a joint European large-scale experiment to be started in the Federal Republic of Germany. IPP's tasks in the project are to study the physical principles and aspects, whereas KfK is responsible for the technological aspects. Work at IPP is focused on divertor experiments with the ASDEX series in order to go deeper into the problems that could not be solved by the JET experiments, namely those of the plasma boundary and control of impurities. Stellarator experiments are made in order to study the potentials of this toroidal confinement concept for steady-state operation. The IPP which always has been working in the plasma physics field devotes all activities to the joint effort. KfK has established a special project group for this purpose, PKF. The budgeting programme presented therefore covers the IPP entire working schedule, and that of PKF of the KfK. (orig./GG) [de
Luo, Xiaodong
2014-10-01
The ensemble Kalman filter (EnKF) is an efficient algorithm for many data assimilation problems. In certain circumstances, however, divergence of the EnKF might be spotted. In previous studies, the authors proposed an observation-space-based strategy, called residual nudging, to improve the stability of the EnKF when dealing with linear observation operators. The main idea behind residual nudging is to monitor and, if necessary, adjust the distances (misfits) between the real observations and the simulated ones of the state estimates, in the hope that by doing so one may be able to obtain better estimation accuracy. In the present study, residual nudging is extended and modified in order to handle nonlinear observation operators. Such extension and modification result in an iterative filtering framework that, under suitable conditions, is able to achieve the objective of residual nudging for data assimilation problems with nonlinear observation operators. The 40-dimensional Lorenz-96 model is used to illustrate the performance of the iterative filter. Numerical results show that, while a normal EnKF may diverge with nonlinear observation operators, the proposed iterative filter remains stable and leads to reasonable estimation accuracy under various experimental settings.
Kinetic mechanism of DNA polymerase I (Klenow)
International Nuclear Information System (INIS)
Kuchta, R.D.; Mizrahi, V.; Benkovic, P.A.; Johnson, K.A.; Benkovic, S.J.
1987-01-01
The minimal kinetic scheme for DNA polymerization catalyzed by the Klenow fragment of DNA polymerase I (KF) from Escherichia coli has been determined with short DNA oligomers of defined sequence, labeled with [ 32 P]-nucleotides. A key feature of this scheme is a minimal two-step sequence that interconverts the ternary KF-DNA/sub n/-dNTP and KF-DNA/sub n+1/-PP/sub i/ complexes. The rate is not limited by the actual polymerization but by a separate step, possibly important in ensuring fidelity. Evidence for this sequence is supplied by the observation of biphasic kinetics in single-turnover pyrophosphorolysis experiments (the microscopic reverse of polymerization). Data analysis then provides an estimate of the internal equilibrium constant. The dissociations of DNA, dNTP, and PP/sub i/ from the various binary and ternary complexes were measured by partitioning (isotope-trapping) experiments. The rate constant for DNA dissociation from KF is sequence dependent and is rate limiting during nonprocessive DNA synthesis. The combination of single-turnover (both directions) and isotope-trapping experiments provides sufficient information to permit a quantitative evaluation of the kinetic scheme for specific DNA sequences
Electromiographic and kinematic characteristics of Kung Fu Yau-Man palm strike.
Neto, O P; Magini, Marcio
2008-12-01
A kinematic and electromyographic analysis of Kung Fu (KF) Yau-Man palm strikes without impact is presented. An empirical model applied to data obtained by a high-speed camera describes the kinematic characteristics of the movement. The electromyographic patterns of the biceps brachii, brachioradialis and triceps brachii muscles were studied during the strike in the time (root mean square) and frequency (wavelet transform) domains. Eight KF practitioners participated in the investigation. A wooden board was placed in front of the subjects, and they were asked to perform the strike imagining a target above the board. The results show that the Yau-Man KF palm strike has very similar kinematic characteristics to a simple moderate speed elbow extension movement. All practitioners positioned themselves in relation to the wooden board in a way to achieve their highest hand speeds in the instant their hands crossed the board. The analyses of the electromyography data shows a well developed muscle coordination of the practitioners in agreement with kinematic results. The results of this paper are important not only for improving the performance of practitioners but also to demonstrate the applicability of KF in the process of motor control development.
Talking PACS: Part 2 - why should we change to PACS? | Schulze ...
African Journals Online (AJOL)
This article is a critical evaluation of the workflow within a film- and paper-based imaging department. It also illustrates how all the factors culminate to produce poor patient care and decreased productivity. Practical examples are provided within the Tygerberg Hospital scenario. The effect of international trends on the ...
Noise Reduction of MEMS Gyroscope Based on Direct Modeling for an Angular Rate Signal
Directory of Open Access Journals (Sweden)
Liang Xue
2015-02-01
Full Text Available In this paper, a novel approach for processing the outputs signal of the microelectromechanical systems (MEMS gyroscopes was presented to reduce the bias drift and noise. The principle for the noise reduction was presented, and an optimal Kalman filter (KF was designed by a steady-state filter gain obtained from the analysis of KF observability. In particular, the true angular rate signal was directly modeled to obtain an optimal estimate and make a self-compensation for the gyroscope without needing other sensor’s information, whether in static or dynamic condition. A linear fit equation that describes the relationship between the KF bandwidth and modeling parameter of true angular rate was derived from the analysis of KF frequency response. The test results indicated that the MEMS gyroscope having an ARW noise of 4.87°/h0.5 and a bias instability of 44.41°/h were reduced to 0.4°/h0.5 and 4.13°/h by the KF under a given bandwidth (10 Hz, respectively. The 1σ estimated error was reduced from 1.9°/s to 0.14°/s and 1.7°/s to 0.5°/s in the constant rate test and swing rate test, respectively. It also showed that the filtered angular rate signal could well reflect the dynamic characteristic of the input rate signal in dynamic conditions. The presented algorithm is proved to be effective at improving the measurement precision of the MEMS gyroscope.
Low-Rank Kalman Filtering in Subsurface Contaminant Transport Models
El Gharamti, Mohamad
2010-01-01
Understanding the geology and the hydrology of the subsurface is important to model the fluid flow and the behavior of the contaminant. It is essential to have an accurate knowledge of the movement of the contaminants in the porous media in order to track them and later extract them from the aquifer. A two-dimensional flow model is studied and then applied on a linear contaminant transport model in the same porous medium. Because of possible different sources of uncertainties, the deterministic model by itself cannot give exact estimations for the future contaminant state. Incorporating observations in the model can guide it to the true state. This is usually done using the Kalman filter (KF) when the system is linear and the extended Kalman filter (EKF) when the system is nonlinear. To overcome the high computational cost required by the KF, we use the singular evolutive Kalman filter (SEKF) and the singular evolutive extended Kalman filter (SEEKF) approximations of the KF operating with low-rank covariance matrices. The SEKF can be implemented on large dimensional contaminant problems while the usage of the KF is not possible. Experimental results show that with perfect and imperfect models, the low rank filters can provide as much accurate estimates as the full KF but at much less computational cost. Localization can help the filter analysis as long as there are enough neighborhood data to the point being analyzed. Estimating the permeabilities of the aquifer is successfully tackled using both the EKF and the SEEKF.
Low-Rank Kalman Filtering in Subsurface Contaminant Transport Models
El Gharamti, Mohamad
2010-12-01
Understanding the geology and the hydrology of the subsurface is important to model the fluid flow and the behavior of the contaminant. It is essential to have an accurate knowledge of the movement of the contaminants in the porous media in order to track them and later extract them from the aquifer. A two-dimensional flow model is studied and then applied on a linear contaminant transport model in the same porous medium. Because of possible different sources of uncertainties, the deterministic model by itself cannot give exact estimations for the future contaminant state. Incorporating observations in the model can guide it to the true state. This is usually done using the Kalman filter (KF) when the system is linear and the extended Kalman filter (EKF) when the system is nonlinear. To overcome the high computational cost required by the KF, we use the singular evolutive Kalman filter (SEKF) and the singular evolutive extended Kalman filter (SEEKF) approximations of the KF operating with low-rank covariance matrices. The SEKF can be implemented on large dimensional contaminant problems while the usage of the KF is not possible. Experimental results show that with perfect and imperfect models, the low rank filters can provide as much accurate estimates as the full KF but at much less computational cost. Localization can help the filter analysis as long as there are enough neighborhood data to the point being analyzed. Estimating the permeabilities of the aquifer is successfully tackled using both the EKF and the SEEKF.
Ensemble Kalman filter for the reconstruction of the Earth's mantle circulation
Directory of Open Access Journals (Sweden)
M. Bocher
2018-02-01
Full Text Available Recent advances in mantle convection modeling led to the release of a new generation of convection codes, able to self-consistently generate plate-like tectonics at their surface. Those models physically link mantle dynamics to surface tectonics. Combined with plate tectonic reconstructions, they have the potential to produce a new generation of mantle circulation models that use data assimilation methods and where uncertainties in plate tectonic reconstructions are taken into account. We provided a proof of this concept by applying a suboptimal Kalman filter to the reconstruction of mantle circulation (Bocher et al., 2016. Here, we propose to go one step further and apply the ensemble Kalman filter (EnKF to this problem. The EnKF is a sequential Monte Carlo method particularly adapted to solve high-dimensional data assimilation problems with nonlinear dynamics. We tested the EnKF using synthetic observations consisting of surface velocity and heat flow measurements on a 2-D-spherical annulus model and compared it with the method developed previously. The EnKF performs on average better and is more stable than the former method. Less than 300 ensemble members are sufficient to reconstruct an evolution. We use covariance adaptive inflation and localization to correct for sampling errors. We show that the EnKF results are robust over a wide range of covariance localization parameters. The reconstruction is associated with an estimation of the error, and provides valuable information on where the reconstruction is to be trusted or not.
Nuclear Safety Project - annual report 1980
International Nuclear Information System (INIS)
1981-08-01
The Annual Report 1980 is a detailed description (in German language) of work within the Nuclear Safety Project performed in 1980 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on work completed, essential results, plans for the near future. (orig./RW) [de
South African Medical Journal - Vol 98, No 7 (2008)
African Journals Online (AJOL)
The Prevalence of Hepatitis B Co infection in a South African (SA) Urban government HIV Clinic · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Firhaber, A Reyneke, D Schulz, B Malope, B Malope, P Macphail, E Sanne, AD Biseglie, 541-544 ...
Fan texture of the compound Ba3Co2Fe244O41 pre-aligned in a magnetic field
Huijser-Gerits, E.M.C.; Rieck, G.D.; Vogel, D.L.
1970-01-01
Samples of the ferrimagnetic material Ba3Co2Fe24O41, pre-aligned in a magnetic field and sintered at various temps., have been examd. for preferred orientation. Schulz's reflection technique and the standardizing method of Holland were used to det. quant. pole figures of several lattice planes. The
The Army War College Review. Volume 2, Number 3, August 2016. Student Publications
2016-08-01
natohq/opinions_128311.htm?selectedLocale=en. 99 President Schulz: We Need a Common Foreign and Security Policy (Washington, DC: HT Media Ltd, March...cause injury or death to persons or damage or destruction to objects.”13 The data stolen from defense contractors Boeing and Lockheed-Martin by Chinese
Directory of Open Access Journals (Sweden)
Kopp, Veronika
2006-08-01
Full Text Available [english] After assigning the different examination formats to the diverse terms of Miller's pyramide of knowledge, this paper provides a short presentation of the key feature approach by giving the definition and an example for clarification. Afterwards, a practical guide to writing key feature problems is given consisting of the following steps: define the domain, choose a clinical situation, define the key features, develop a test case scenario, write questions, select a preferred response format, define the scoring key, and validation. Finally, we present the evaluation results of this practical guide. In sum, the participants were very pleased with it. The differences between the estimations of their knowledge before and after the workshop concerning key features were significant. The key feature approach is an innovative tool for assessing clinical decision-making skills, also for electronical examinations. Substituting the write-in format for the long-menu format allows an automatic data analysis. [german] Im vorliegenden Beitrag wird - nach der Zuordnung unterschiedlicher Prüfungsformen zu den verschiedenen Wissensarten der Wissenspyramide von Miller - der Key-Feature (KF Ansatz vorgestellt. Nachdem anhand der Definition und einem Beispiel erklärt wurde, was ein KF ist, wird im Anschluss eine Anleitung für die Erstellung eines KF-Problems gegeben. Diese besteht aus folgenden Schritten: Definition des Kontextes, Wahl der klinischen Situation, Identifikation der KFs des klinischen Problems, Schreiben des klinischen Szenarios (Fallvignette, Schreiben der einzelnen KF-Fragen, Auswahl des Antwortformates, Bewertungsverfahren und Inhaltsvalidierung. Am Ende werden die Ergebnisse einer Evaluation dieser Anleitung, die im Rahmen eines KF-Workshops gewonnen wurden, präsentiert. Die Teilnehmer waren mit dieser Workshopeinheit sehr zufrieden und gaben an, sehr viel gelernt zu haben. Die subjektive Einschätzung ihres Wissensstands vor und nach
International Nuclear Information System (INIS)
Rininsland, H.; Smidt, D.; Trauboth, H.; Kernforschungszentrum Karlsruhe G.m.b.H.; Kernforschungszentrum Karlsruhe G.m.b.H.
1987-01-01
Particular considerations for teleoperated and very long reach robotic systems are given. Robotic systems involving long reach referred to, include the TFTR maintenance boom developed for the Princeton fusion reactor and future automated cranes and bridge inspection equipment. A project to develop such long reach booms currently involves Putzmeister and the NRC, who will be responsible for developing the collision avoidance algorithms as part of a 'computer aided telemanipulation' approach. Problems encountered with operating equipment of this kind remotely were addressed during the recent Chernobyl disaster at which a range of equipment developed by Putzmeister was applied to combat the disaster. (orig./HP)
KfW Water Symposium 2009 : Financing Sanitation
KfW Development Bank
2010-01-01
"The central objective of the International Year of Sanitation was to put the global community on track to achieve the Millennium Development Goals MDG sanitation target. However, one year later, it is still difficult to keep sanitation high on the agenda, while practical action is required to encourage demand driven and sustainable solutions. With the support of the German Ministry for Development and Cooperation and together with the European Investment Bank EIB and the French Developm...
Bustamante, J. F. F.; Chou, S. C.; Gomes, J. L.
2009-04-01
The Southeast Brazil, in the coastal and mountain region called Serra do Mar, between Sao Paulo and Rio de Janeiro, is subject to frequent events of landslides and floods. The Eta Model has been producing good quality forecasts over South America at about 40-km horizontal resolution. For that type of hazards, however, more detailed and probabilistic information on the risks should be provided with the forecasts. Thus, a short-range ensemble prediction system (SREPS) based on the Eta Model is being constructed. Ensemble members derived from perturbed initial and lateral boundary conditions did not provide enough spread for the forecasts. Members with model physics perturbation are being included and tested. The objective of this work is to construct more members for the Eta SREPS by adding physics perturbed members. The Eta Model is configured at 10-km resolution and 38 layers in the vertical. The domain covered is most of Southeast Brazil, centered over the Serra do Mar region. The constructed members comprise variations of the cumulus parameterization Betts-Miller-Janjic (BMJ) and Kain-Fritsch (KF) schemes. Three members were constructed from the BMJ scheme by varying the deficit of saturation pressure profile over land and sea, and 2 members of the KF scheme were included using the standard KF and a momentum flux added to KF scheme version. One of the runs with BMJ scheme is the control run as it was used for the initial condition perturbation SREPS. The forecasts were tested for 6 cases of South America Convergence Zone (SACZ) events. The SACZ is a common summer season feature of Southern Hemisphere that causes persistent rain for a few days over the Southeast Brazil and it frequently organizes over Serra do Mar region. These events are particularly interesting because of the persistent rains that can accumulate large amounts and cause generalized landslides and death. With respect to precipitation, the KF scheme versions have shown to be able to reach the
Gharamti, M. E.; Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim
2015-01-01
Numerical experiments are conducted with a two-dimensional synthetic subsurface transport model simulating the migration of a contaminant plume in a heterogenous aquifer domain. Contaminant concentration data are assimilated to estimate both the contaminant state and the hydraulic conductivity field. Assimilation runs are performed under imperfect modeling conditions and various observational scenarios. Simulation results suggest that the proposed scheme efficiently recovers both the contaminant state and the aquifer conductivity, providing more accurate estimates than the standard Joint and Dual EnKFs in all tested scenarios. Iterating on the update step of the new scheme further enhances the proposed filter’s behavior. In term of computational cost, the new Joint-EnKF is almost equivalent to that of the Dual-EnKF, but requires twice more model integrations than the standard Joint-EnKF.
Treatment of psoriasis with cyclosporin | Nevin | South African ...
African Journals Online (AJOL)
South African Medical Journal. Journal Home · ABOUT · Advanced Search · Current Issue · Archives · Journal Home > Vol 85, No 11 (1995) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Treatment of psoriasis with cyclosporin. R.J. Nevin, E.J. Schulz. Abstract.
Agrawal BK Density content of nuclear symmetry energy from ...
Indian Academy of Sciences (India)
´Avila M. Nonadiabatic corrections to a quantum dot quantum computer working in adiabatic limit. 161. Ayyalasomayajula Krishna see Jain Jinesh. 179. Badescu ..... 807. Santhiah M see Jeevarekha A. 493. Satyanarayana V V see Sugathan P. 807. Sawhney K J S see Dhamgaye V P. 119. Schulz E see Couairon A. 221 ...
International Nuclear Information System (INIS)
1983-12-01
The semiannual progress report 1983/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1983 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics work performed, results obtained and plans for future work. (orig./RW) [de
International Nuclear Information System (INIS)
Anon.
1980-11-01
The 17th semi-annual report 1980/1 is a description of work within the Nuclear Safety Project performed in the first six months of 1980 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics - work performed, results obtained, plans for future work. (orig.) [de
International Nuclear Information System (INIS)
1980-08-01
The 16th semi-annual report 1979/2 is a description of work within the Nuclear Safety Project performed in the second six month of 1979 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics: work performed, results obtained, plans for future work. (orig.) [de
DEFF Research Database (Denmark)
Rijkhoff, Jan; Bakker, Dik
1998-01-01
This article has two aims: [1] to present a revised version of the sampling method that was originally proposed in 1993 by Rijkhoff, Bakker, Hengeveld and Kahrel, and [2] to discuss a number of other approaches to language sampling in the light of our own method. We will also demonstrate how our...... sampling method is used with different genetic classifications (Voegelin & Voegelin 1977, Ruhlen 1987, Grimes ed. 1997) and argue that —on the whole— our sampling technique compares favourably with other methods, especially in the case of exploratory research....
Zhan, Yan; Gregg, Patricia M.; Chaussard, Estelle; Aoki, Yosuke
2017-12-01
Quantifying the eruption potential of a restless volcano requires the ability to model parameters such as overpressure and calculate the host rock stress state as the system evolves. A critical challenge is developing a model-data fusion framework to take advantage of observational data and provide updates of the volcanic system through time. The Ensemble Kalman Filter (EnKF) uses a Monte Carlo approach to assimilate volcanic monitoring data and update models of volcanic unrest, providing time-varying estimates of overpressure and stress. Although the EnKF has been proven effective to forecast volcanic deformation using synthetic InSAR and GPS data, until now, it has not been applied to assimilate data from an active volcanic system. In this investigation, the EnKF is used to provide a “hindcast” of the 2009 explosive eruption of Kerinci volcano, Indonesia. A two-sources analytical model is used to simulate the surface deformation of Kerinci volcano observed by InSAR time-series data and to predict the system evolution. A deep, deflating dike-like source reproduces the subsiding signal on the flanks of the volcano, and a shallow spherical McTigue source reproduces the central uplift. EnKF predicted parameters are used in finite element models to calculate the host-rock stress state prior to the 2009 eruption. Mohr-Coulomb failure models reveal that the shallow magma reservoir is trending towards tensile failure prior to 2009, which may be the catalyst for the 2009 eruption. Our results illustrate that the EnKF shows significant promise for future applications to forecasting the eruption potential of restless volcanoes and hind-cast the triggering mechanisms of observed eruptions.
Vibration Noise Modeling for Measurement While Drilling System Based on FOGs
Directory of Open Access Journals (Sweden)
Chunxi Zhang
2017-10-01
Full Text Available Aiming to improve survey accuracy of Measurement While Drilling (MWD based on Fiber Optic Gyroscopes (FOGs in the long period, the external aiding sources are fused into the inertial navigation by the Kalman filter (KF method. The KF method needs to model the inertial sensors’ noise as the system noise model. The system noise is modeled as white Gaussian noise conventionally. However, because of the vibration while drilling, the noise in gyros isn’t white Gaussian noise any more. Moreover, an incorrect noise model will degrade the accuracy of KF. This paper developed a new approach for noise modeling on the basis of dynamic Allan variance (DAVAR. In contrast to conventional white noise models, the new noise model contains both the white noise and the color noise. With this new noise model, the KF for the MWD was designed. Finally, two vibration experiments have been performed. Experimental results showed that the proposed vibration noise modeling approach significantly improved the estimated accuracies of the inertial sensor drifts. Compared the navigation results based on different noise model, with the DAVAR noise model, the position error and the toolface angle error are reduced more than 90%. The velocity error is reduced more than 65%. The azimuth error is reduced more than 50%.
Sana, Furrukh; Katterbauer, Klemens; Al-Naffouri, Tareq Y.; Hoteit, Ibrahim
2016-01-01
Estimating the locations and the structures of subsurface channels holds significant importance for forecasting the subsurface flow and reservoir productivity. These channels exhibit high permeability and are easily contrasted from the low-permeability rock formations in their surroundings. This enables formulating the flow channels estimation problem as a sparse field recovery problem. The ensemble Kalman filter (EnKF) is a widely used technique for the estimation and calibration of subsurface reservoir model parameters, such as permeability. However, the conventional EnKF framework does not provide an efficient mechanism to incorporate prior information on the wide varieties of subsurface geological structures, and often fails to recover and preserve flow channel structures. Recent works in the area of compressed sensing (CS) have shown that estimating in a sparse domain, using algorithms such as the orthogonal matching pursuit (OMP), may significantly improve the estimation quality when dealing with such problems. We propose two new, and computationally efficient, algorithms combining OMP with the EnKF to improve the estimation and recovery of the subsurface geological channels. Numerical experiments suggest that the proposed algorithms provide efficient mechanisms to incorporate and preserve structural information in the EnKF and result in significant improvements in recovering flow channel structures.
Vibration Noise Modeling for Measurement While Drilling System Based on FOGs.
Zhang, Chunxi; Wang, Lu; Gao, Shuang; Lin, Tie; Li, Xianmu
2017-10-17
Aiming to improve survey accuracy of Measurement While Drilling (MWD) based on Fiber Optic Gyroscopes (FOGs) in the long period, the external aiding sources are fused into the inertial navigation by the Kalman filter (KF) method. The KF method needs to model the inertial sensors' noise as the system noise model. The system noise is modeled as white Gaussian noise conventionally. However, because of the vibration while drilling, the noise in gyros isn't white Gaussian noise any more. Moreover, an incorrect noise model will degrade the accuracy of KF. This paper developed a new approach for noise modeling on the basis of dynamic Allan variance (DAVAR). In contrast to conventional white noise models, the new noise model contains both the white noise and the color noise. With this new noise model, the KF for the MWD was designed. Finally, two vibration experiments have been performed. Experimental results showed that the proposed vibration noise modeling approach significantly improved the estimated accuracies of the inertial sensor drifts. Compared the navigation results based on different noise model, with the DAVAR noise model, the position error and the toolface angle error are reduced more than 90%. The velocity error is reduced more than 65%. The azimuth error is reduced more than 50%.
Sana, Furrukh
2016-02-23
Estimating the locations and the structures of subsurface channels holds significant importance for forecasting the subsurface flow and reservoir productivity. These channels exhibit high permeability and are easily contrasted from the low-permeability rock formations in their surroundings. This enables formulating the flow channels estimation problem as a sparse field recovery problem. The ensemble Kalman filter (EnKF) is a widely used technique for the estimation and calibration of subsurface reservoir model parameters, such as permeability. However, the conventional EnKF framework does not provide an efficient mechanism to incorporate prior information on the wide varieties of subsurface geological structures, and often fails to recover and preserve flow channel structures. Recent works in the area of compressed sensing (CS) have shown that estimating in a sparse domain, using algorithms such as the orthogonal matching pursuit (OMP), may significantly improve the estimation quality when dealing with such problems. We propose two new, and computationally efficient, algorithms combining OMP with the EnKF to improve the estimation and recovery of the subsurface geological channels. Numerical experiments suggest that the proposed algorithms provide efficient mechanisms to incorporate and preserve structural information in the EnKF and result in significant improvements in recovering flow channel structures.
THERMAL CONDUCTIVITY OF SIC AND C FIBERS
Energy Technology Data Exchange (ETDEWEB)
Youngblood, Gerald E.; Senor, David J.; Kowbel, W.; Webb, J.; Kohyama, Akira
2000-09-01
Several rod-shaped specimens with uniaxially packed fibers (Hi-Nicalon, Hi-Nicalon Type S, Tyranno SA and Amoco K1100 types) and a pre-ceramic polymer matrix have been fabricated. By using appropriate analytic models, the bare fiber thermal conductivity (Kf) and the interface thermal conductance (h) will be determined as a function of temperature up to 1000?C before and after irradiation for samples cut from these rods. Initial results are: (1) for unirradiated Hi-Nicalon SiC fiber, Kf varied from 4.3 up to 5.9 W/mK for the 27-1000?C range, (2) for unirradiated K1100 graphite fiber, Kf varied from 576 down to 242 W/mK for the 27-1000?C range, and (3) h = 43 W/cm2K at 27?C as a typical fiber/matrix interface conductance.
Report on the research and development work of 1984 in the project atomic fusion
International Nuclear Information System (INIS)
Finken, D.
1985-02-01
The work done by the Nuclear Research Centre in Karlsruhe on fusion under magnetic influence is compiled in the project atomic fusion and put in the programme for European Fusion Technology. The work is supported by an association contract between KfK and Euratom via the European Commission. Some of the work exceeds the volume defined in the E.E.C's technology programme. Using these papers, mostly studies, connections are established between the various fields of work and new tasks prepared. This is taking place in the light of the expected extension of the technology programme in the coming year and the plans for NET. The reports compiled here are the 1984 papers from the KfK institute. The appendix contains a compilation of the tasks undertaken by KfK from the EEC's fusion technology programme. (orig./GG) [de
International Nuclear Information System (INIS)
Finken, D.
1984-10-01
The KfK-Association has continued work on 17 R and D contracts of the Fusion Technology Programme. An effort of 94 manyears per year is at present contributed by 10 KfK departments, covering all aereas defined in the Fusion Technology Programme. The dominant part of the work is directed towards the need of the NET design or supporting experiments. Some additional effort addresses long term technological issues and system studies relevant to DEMO or confinement schemes alternative to tokamaks. Direct contribution to the NET team has increased by augmentation of NET study contracts and delegation of personnel, three KfK delegates being at present members of the NET team. In reverse, specifications and design guidelines worked out by NET have started to have an impact on the current R and D-work in the laboratory. (orig./GG)
Quantum and Carbon Nanomaterials | Chemistry and Nanoscience Research |
Heterojunctions. Nat. Chem., 2016, 8, 603. DOI: 10.1038/nchem.2496 Ihly, R., Dowgiallo, A-M., Yang, M., Schulz, P Single-Walled Carbon Nanotubes in a Low Dielectric Solvent. Nat. Commun., 2015, 6, 8809. 10.1038 . Nat. Energy, 2016, 1, 16033. DOI: 10.1038/nenergy.2016.33 Zhang, K., Wang, S., Qiu, J., Blackburn, J
Stewart, Tara L; Chipperfield, Judith G; Ruthig, Joelle C; Heckhausen, Jutta
2013-01-01
Drawing from Heckhausen and Schulz's Motivational Theory of Life-span Development, this study examined perceived control as a moderator of the protective relationship between downward social comparison and subjective well-being among older adults. Community-dwelling older adults (N = 97, 63% female, ages 79-97) were interviewed in their own homes at three time-points over a nine-year period. Interviews assessed older adults' perceived control over daily tasks, their use of downward social comparison in response to task restriction, and their subjective well-being. Regression analyses yielded a significant interaction between downward social comparison and perceived control for three subjective well-being outcomes: life satisfaction, perceived stress, and depressive symptoms. Follow-up analyses revealed that downward social comparison was associated with greater subjective well-being at low levels of perceived control; but was unrelated to subjective well-being at high levels of perceived control. These findings corroborate Heckhausen and Schulz's theorized goal-opportunity congruence premise and have implications for quality-of-life interventions to assist community-dwelling older adults.
A strong shock tube problem calculated by different numerical schemes
International Nuclear Information System (INIS)
Lee, W.H.; Clancy, S.P.
1996-01-01
Calculated results are presented for the solution of a very strong shock tube problem on a coarse mesh using (1) MESA code, (2) UNICORN code, (3) Schulz hydro, and (4) modified TVD scheme. The first two codes are written in Eulerian coordinates, whereas methods (3) and (4) are in Lagrangian coordinates. MESA and UNICORN codes are both of second order and use different monotonic advection method to avoid the Gibbs phenomena. Code (3) uses typical artificial viscosity for inviscid flow, whereas code (4) uses a modified TVD scheme. The test problem is a strong shock tube problem with a pressure ratio of 10 9 and density ratio of 10 3 in an ideal gas. For no mass-matching case, Schulz hydro is better than TVD scheme. In the case of mass-matching, there is no difference between them. MESA and UNICORN results are nearly the same. However, the computed positions such as the contact discontinuity (i.e. the material interface) are not as accurate as the Lagrangian methods. copyright 1996 American Institute of Physics
International Nuclear Information System (INIS)
1982-06-01
The Annual Report 1981 is a detailed description (in German language) of work within the Nuclear Safety Project performed in 1981 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on - work completed - results obtained - plans for future work. This report was compiled by the project management. (orig.) [de
Nuclear Safety Project. Annual report 1983
International Nuclear Information System (INIS)
1984-06-01
The annual report 1983 is a detailed description (in German language) of work within the Nuclear Safety Project performed in 1983 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on work performed, results obtained and plans for future work. This report was compiled by the project management. (orig.) [de
List of scientific publications issued in 1991 by Karlsruhe Nuclear Research Center
International Nuclear Information System (INIS)
1992-05-01
This report KfK 5025 presents the titles of scientific publications issued in 1991. Conference papers or other papers not yet available in printed from are listed separately. Patent documents of the year 1991 are listed in two categories: patent specifications and unexamined laid-open patent applications (DE-OS). Reviews on specific subjects or training documents prepared for courses in the KfK's Center for Advanced Training are not included in this report. (orig.) [de
Nuclear safety project. Annual report 1985
International Nuclear Information System (INIS)
1986-07-01
The annual report 1985 is a detailed description (in German language) of work within the nuclear safety project performed in 1985 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on work performed, results obtained and plans for future work. This report was compiled by the project management. (orig./HP) [de
Multivariate localization methods for ensemble Kalman filtering
S. Roh; M. Jun; I. Szunyogh; M. G. Genton
2015-01-01
In ensemble Kalman filtering (EnKF), the small number of ensemble members that is feasible to use in a practical data assimilation application leads to sampling variability of the estimates of the background error covariances. The standard approach to reducing the effects of this sampling variability, which has also been found to be highly efficient in improving the performance of EnKF, is the localization of the estimates of the covariances. One family of ...
Vergara, H. J.; Kirstetter, P.; Hong, Y.; Gourley, J. J.; Wang, X.
2013-12-01
The Ensemble Kalman Filter (EnKF) is arguably the assimilation approach that has found the widest application in hydrologic modeling. Its relatively easy implementation and computational efficiency makes it an attractive method for research and operational purposes. However, the scientific literature featuring this approach lacks guidance on how the errors in the forecast need to be characterized so as to get the required corrections from the assimilation process. Moreover, several studies have indicated that the performance of the EnKF is 'sub-optimal' when assimilating certain hydrologic observations. Likewise, some authors have suggested that the underlying assumptions of the Kalman Filter and its dependence on linear dynamics make the EnKF unsuitable for hydrologic modeling. Such assertions are often based on ineffectiveness and poor robustness of EnKF implementations resulting from restrictive specification of error characteristics and the absence of a-priori information of error magnitudes. Therefore, understanding the capabilities and limitations of the EnKF to improve hydrologic forecasts require studying its sensitivity to the manner in which errors in the hydrologic modeling system are represented through ensembles. This study presents a methodology that explores various uncertainty representation configurations to characterize the errors in the hydrologic forecasts in a data assimilation context. The uncertainty in rainfall inputs is represented through a Generalized Additive Model for Location, Scale, and Shape (GAMLSS), which provides information about second-order statistics of quantitative precipitation estimates (QPE) error. The uncertainty in model parameters is described adding perturbations based on parameters covariance information. The method allows for the identification of rainfall and parameter perturbation combinations for which the performance of the EnKF is 'optimal' given a set of objective functions. In this process, information about
Solar Photochemistry | Chemistry and Nanoscience Research | NREL
Generation in Semiconducting Single-Walled Carbon Nanotubes. Nat Comms 2015, 6, 8809. DOI: 10.1038/ncomms9809 . DOI: 10.1038/nchem.2348 Ihly, R.; Mistry, K. S.; Ferguson, A. J.; Clikeman, T. T.; Larson, B. W.; Reid -609. DOI: 10.1038/nchem.2496 Miller, E. M.; Kroupa, D. M.; Zhang, J.; Schulz, P.; Marshall, A. R
Analysis of Unmanned Systems in Military Logistics
2016-12-01
performance measures: customer satisfaction , flexibility, visibility, and trust. If we apply this explanation of Li and Schulze (2011) to the military...unmanned systems, initially, we aimed to define current and proposed unmanned applications in civilian-sector logistics and current military...aimed to define current and proposed unmanned applications in civilian-sector logistics and current military logistics challenges. Then, justifying
Microscopic study of low-lying yrast spectra in Mo isotopes
Indian Academy of Sciences (India)
consistent calculations, which involved an optimized basis of eight major oscillator shells with the constraint of axial .... agreement with the values calculated by M¨oller et al [27] for 100 104Mo. 2. Calculational ..... [22] A Guessous, N Schulz, M Bentalab, E Lubkiewicz, J L Durell, C J Pearson, W R Phillips,. J A Shannon, W ...
Raik, Aita
2004-01-01
Tallinna kullassepakunsti meistriteostest. Kahest väiksemast (Andreas Losson, 1620-ndate algus) ja kahest suuremast (Jakob Lange, 1639) maksukannust, kahest hõbekannust (Stanislaus Schulze, 17. saj. keskpaik), kahest rae kaitseväeülema ametisauast (suurem: Friedrich Schlegel, 1604-1605), väiksem 1610). Säilinud tinanõudest (kannud, peekrid, vaagnad, taldrikud, küünlajalad)
Directory of Open Access Journals (Sweden)
M. Grace Bato
2017-06-01
Full Text Available In monitoring active volcanoes, the magma overpressure is one of the key parameters used in forecasting volcanic eruptions. This parameter can be inferred from the ground displacements measured on the Earth's surface by applying inversion techniques. However, in most studies, the huge amount of information about the behavior of the volcano contained in the temporal evolution of the deformation signal is not fully exploited by inversion. Our work focuses on developing a strategy in order to better forecast the magma overpressure using data assimilation. We take advantage of the increasing amount of geodetic data [i.e., Interferometric Synthetic Aperture Radar (InSAR and Global Navigation Satellite System (GNSS] recorded on volcanoes nowadays together with the wide-range availability of dynamical models that can provide better understanding about the volcano plumbing system. Here, we particularly built our strategy on the basis of the Ensemble Kalman Filter (EnKF. We forecast the temporal behaviors of the magma overpressures and surface deformations by adopting a simple and generic two-magma chamber model and by using synthetic GNSS and/or InSAR data. We prove the ability of EnKF to both estimate the magma pressure evolution and constrain the characteristics of the deep volcanic system (i.e., reservoir size as well as basal magma inflow. High temporal frequency of observation is required to ensure the success of EnKF and the quality of assimilation is also improved by increasing the spatial density of observations in the near-field. We thus show that better results are obtained by combining a few GNSS temporal series of high temporal resolution with InSAR images characterized by a good spatial coverage. We also show that EnKF provides similar results to sophisticated Bayesian-based inversion while using the same dynamical model with the advantage of EnKF to potentially account for the temporal evolution of the uncertain model parameters. Our
An improved state-parameter analysis of ecosystem models using data assimilation
Chen, M.; Liu, S.; Tieszen, L.L.; Hollinger, D.Y.
2008-01-01
Much of the effort spent in developing data assimilation methods for carbon dynamics analysis has focused on estimating optimal values for either model parameters or state variables. The main weakness of estimating parameter values alone (i.e., without considering state variables) is that all errors from input, output, and model structure are attributed to model parameter uncertainties. On the other hand, the accuracy of estimating state variables may be lowered if the temporal evolution of parameter values is not incorporated. This research develops a smoothed ensemble Kalman filter (SEnKF) by combining ensemble Kalman filter with kernel smoothing technique. SEnKF has following characteristics: (1) to estimate simultaneously the model states and parameters through concatenating unknown parameters and state variables into a joint state vector; (2) to mitigate dramatic, sudden changes of parameter values in parameter sampling and parameter evolution process, and control narrowing of parameter variance which results in filter divergence through adjusting smoothing factor in kernel smoothing algorithm; (3) to assimilate recursively data into the model and thus detect possible time variation of parameters; and (4) to address properly various sources of uncertainties stemming from input, output and parameter uncertainties. The SEnKF is tested by assimilating observed fluxes of carbon dioxide and environmental driving factor data from an AmeriFlux forest station located near Howland, Maine, USA, into a partition eddy flux model. Our analysis demonstrates that model parameters, such as light use efficiency, respiration coefficients, minimum and optimum temperatures for photosynthetic activity, and others, are highly constrained by eddy flux data at daily-to-seasonal time scales. The SEnKF stabilizes parameter values quickly regardless of the initial values of the parameters. Potential ecosystem light use efficiency demonstrates a strong seasonality. Results show that the
DEFF Research Database (Denmark)
Zhang, Donghua; Madsen, Henrik; Ridler, Marc E.
2015-01-01
The ensemble Kalman filter (EnKF) is a popular data assimilation (DA) technique that has been extensively used in environmental sciences for combining complementary information from model predictions and observations. One of the major challenges in EnKF applications is the description of model un...... with respect to performance and sensitivity. Results show that inappropriate definition of model uncertainty can greatly degrade the assimilation performance, and an appropriate combination of different model uncertainty sources is advised....
International Nuclear Information System (INIS)
1984-11-01
The semiannual progress report 1984/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1984 in the nuclear safety field by KfK institutes and departements and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics work performed, results obtained and plans for future work. This report was compiled by the project management. (orig./RW) [de
First semiannual report 1979/1
International Nuclear Information System (INIS)
1980-02-01
The 15th semi-annual report 1979/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1979 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics: - work performed, results obtained, plans for future work. This report was compiled by the project management. (orig.) [de
International Nuclear Information System (INIS)
1981-11-01
The semiannual progress report 1981/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1981 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics, work performed, results obtained, plans for future work. This report was compiled by the project management. (orig.) [de
List of scientific publications of Nuclear Research Center Karlsruhe 1983
International Nuclear Information System (INIS)
1984-04-01
This report contains the titles of the publications edited in the year 1983. The scientific and technical-scientific publications of the Nuclear Research Center Karlsruhe are printed as books, as original contributions in scientific or technical specialists' journals, as scripts for habilitation, thesis, scripts for diploma, as patents, as KfK-Reports (KfK=Kernforschungszentrum Karlsruhe) and are being presented as lectures on scientific meetings. No further separate abstracts of this list of publications were prepared. (orig./HBR) [de
Transforming Lactococcus lactis into a microbial cell factory
DEFF Research Database (Denmark)
Petersen, Kia Vest
the potential of Lactococcus lactis as a platform organism for production of biofuels and-chemicals with a focus on characterization and optimization of the xylose metabolism. The plant isolate L. lactis KF147 was selected as the potential platform organism due to its natural ability to utilize both the pentose....... To simplify further analysis arcA encoding the arginine deiminase was deleted, thus eliminating the arginine catabolism. We found that in L. lactis KF147 xylose is metabolized through two pathways namely the phosphoketolase pathway and the non-oxidative part of the pentose phosphate pathway. The only products......, and ethanol. Three adaptive mutations were identified in AD29. Two is by all accounts involved in regulatory mechanisms either to stress (yhfB) or more globally (ytgF), and the last facilitate improved uptake of xylose (ptnC). Based on the above findings we conclude that L. lactis KF147 possesses many...
de Miranda, R L; O'Dwyer, L H; de Castro, J R; Metzger, B; Rubini, A S; Mundim, A V; Eyal, O; Talmi-Frank, D; Cury, M C; Baneth, G
2014-10-01
The objective of this survey was to investigate the prevalence of Hepatozoon infection in dogs in the rural and urban areas of Uberlândia, Brazil by PCR and molecular characterization. DNA was obtained from blood samples collected from 346 local dogs from both genders and various ages. Seventeen PCR products from positive blood samples of urban dogs and 13 from the rural dogs were sequenced. Partial sequences of the 18S rRNA gene indicated that all 30 dogs were infected with Hepatozoon canis similar in sequence to H. canis from southern Europe. Four local dog sequences were submitted to GenBank (accessions JN835188; KF692038; KF692039; KF692040). This study indicates that H. canis is the cause of canine hepatozoonosis in Uberlândia and that infection is similarly widespread in rural and urban dogs. Copyright © 2014. Published by Elsevier Ltd.
International Nuclear Information System (INIS)
Koenig, L.A.; Winter, M.; Schmitt, A.
1980-10-01
The two on-line monitoring systems used in KfK environmental monitoring should be taken as measures of accident precaution and they are restricted to measurement of gamma local dose rates and of the (β + γ)-radiation levels. One of the systems serves to monitor the KfK operational area, the second serves to monitor the surrounding communities up to a radius of 8 km. By use of two different types of detectors the first system covers a range of measurement of 10 μrem/h to 1000 rem/h. By the second system only increases in the radiation level can be detected. It allows to record accidents in which countermeasures must be taken very urgently. The two monitoring systems are described which have been operated and partly been developed at the KfK. The possibilities and limits of using them for environmental monitoring are discussed. (orig./HP) [de
List of scientific and technical publications of the Karlsruhe Nuclear Research Centre, 1985
International Nuclear Information System (INIS)
1986-05-01
The report lists the titles and other bibliographic data of the publications released in 1985. Lectures not yet available in printed form are listed separately. The patent section gives information on patent rights granted or published in 1985. Technical lectures or material prepared for courses held by the SKT (Nuclear Engineering School) are not part of the list. The data are arranged by institutes, information on project activities is given referring to published project reports and other publications prepared by project staff. The list also presents R and D reports printed by KfK for informationn on the PFT project, fabrication technologies, which is a joint enterprise by KfK, several other institutes, and industry. Publications of the branch institute of the Federal Food Research Institute are also given, followed by a list of publications prepared by guest scientists of the KfK. (orig./PW) [de
Application and Study of Precipitation Schemes in Weather Simulation in Summer and Winter over China
Institute of Scientific and Technical Information of China (English)
XU Guoqiang; WAN Qilin; HUANG Liping; XUE Jishan; CHEN Dehui
2006-01-01
Through simulation of summer and winter precipitation cases in China, the cloud precipitation schemes of model were examined. Results indicate that it is discrepant between convective precipitation simulated by the Kain-Fritsch (KF) scheme and Betts-Miller (BM) scheme in summer, the former scheme is better than the latter in this case. The ambient atmosphere may be varied by different convective schemes. The air is wetter and the updraft is stronger in the KF scheme than in the BM scheme, which can induce the more grid scale precipitation in the KF scheme, i.e., the different cumulus schemes may have the different and important effect on the grid scale precipitation. However, there is almost no convective rain in winter in northern China, so the effect of cumulus precipitation on the grid scale precipitation can be disregarded.Therefore, the gird scale precipitation is primary in the winter of northern China.
Khaki, M.; Ait-El-Fquih, B.; Hoteit, I.; Forootan, E.; Awange, J.; Kuhn, M.
2017-12-01
Assimilating Gravity Recovery And Climate Experiment (GRACE) data into land hydrological models provides a valuable opportunity to improve the models' forecasts and increases our knowledge of terrestrial water storages (TWS). The assimilation, however, may harm the consistency between hydrological water fluxes, namely precipitation, evaporation, discharge, and water storage changes. To address this issue, we propose a weak constrained ensemble Kalman filter (WCEnKF) that maintains estimated water budgets in balance with other water fluxes. Therefore, in this study, GRACE terrestrial water storages data are assimilated into the World-Wide Water Resources Assessment (W3RA) hydrological model over the Earth's land areas covering 2002-2012. Multi-mission remotely sensed precipitation measurements from the Tropical Rainfall Measuring Mission (TRMM) and evaporation products from the Moderate Resolution Imaging Spectroradiometer (MODIS), as well as ground-based water discharge measurements are applied to close the water balance equation. The proposed WCEnKF contains two update steps; first, it incorporates observations from GRACE to improve model simulations of water storages, and second, uses the additional observations of precipitation, evaporation, and water discharge to establish the water budget closure. These steps are designed to account for error information associated with the included observation sets during the assimilation process. In order to evaluate the assimilation results, in addition to monitoring the water budget closure errors, in situ groundwater measurements over the Mississippi River Basin in the US and the Murray-Darling Basin in Australia are used. Our results indicate approximately 24% improvement in the WCEnKF groundwater estimates over both basins compared to the use of (constraint-free) EnKF. WCEnKF also further reduces imbalance errors by approximately 82.53% (on average) and at the same time increases the correlations between the
Kang, Daiwen; Mathur, Rohit; Trivikrama Rao, S.
2010-06-01
The National Air Quality Forecast Capacity (NAQFC) system, which links NOAA's North American Mesoscale (NAM) meteorological model with EPA's Community Multiscale Air Quality (CMAQ) model, provided operational ozone (O 3) and experimental fine particular matter (PM 2.5) forecasts over the continental United States (CONUS) during 2008. This paper describes the implementation of a real-time Kalman Filter (KF) bias-adjustment technique to improve the accuracy of O 3 and PM 2.5 forecasts at discrete monitoring locations. The operational surface-level O 3 and PM 2.5 forecasts from the NAQFC system were post-processed by the KF bias-adjusted technique using near real-time hourly O 3 and PM 2.5 observations obtained from EPA's AIRNow measurement network. The KF bias-adjusted forecasts were created daily, providing 24-h hourly bias-adjusted forecasts for O 3 and PM 2.5 at all AIRNow monitoring sites within the CONUS domain. The bias-adjustment post-processing implemented in this study requires minimal computational cost; requiring less than 10 min of CPU on a single processor Linux machine to generate 24-h hourly bias-adjusted forecasts over the entire CONUS domain. The results show that the real-time KF bias-adjusted forecasts for both O 3 and PM 2.5 have performed as well as or even better than the previous studies when the same technique was applied to the historical O 3 and PM 2.5 time series from archived AQF in earlier years. Compared to the raw forecasts, the KF forecasts displayed significant improvement in the daily maximum 8-h O 3 and daily mean PM 2.5 forecasts in terms of both discrete (i.e., reduced errors, increased correlation coefficients, and index of agreement) and categorical (increased hit rate and decreased false alarm ratio) evaluation metrics at almost all locations during the study period in 2008.
Directory of Open Access Journals (Sweden)
Yan Zhan
2017-12-01
Full Text Available Quantifying the eruption potential of a restless volcano requires the ability to model parameters such as overpressure and calculate the host rock stress state as the system evolves. A critical challenge is developing a model-data fusion framework to take advantage of observational data and provide updates of the volcanic system through time. The Ensemble Kalman Filter (EnKF uses a Monte Carlo approach to assimilate volcanic monitoring data and update models of volcanic unrest, providing time-varying estimates of overpressure and stress. Although the EnKF has been proven effective to forecast volcanic deformation using synthetic InSAR and GPS data, until now, it has not been applied to assimilate data from an active volcanic system. In this investigation, the EnKF is used to provide a “hindcast” of the 2009 explosive eruption of Kerinci volcano, Indonesia. A two-sources analytical model is used to simulate the surface deformation of Kerinci volcano observed by InSAR time-series data and to predict the system evolution. A deep, deflating dike-like source reproduces the subsiding signal on the flanks of the volcano, and a shallow spherical McTigue source reproduces the central uplift. EnKF predicted parameters are used in finite element models to calculate the host-rock stress state prior to the 2009 eruption. Mohr-Coulomb failure models reveal that the host rock around the shallow magma reservoir is trending toward tensile failure prior to 2009, which may be the catalyst for the 2009 eruption. Our results illustrate that the EnKF shows significant promise for future applications to forecasting the eruption potential of restless volcanoes and hind-cast the triggering mechanisms of observed eruptions.
Test-Retest Reliability of Isokinetic Knee Strength Measurements in Children Aged 8 to 10 Years.
Fagher, Kristina; Fritzson, Annelie; Drake, Anna Maria
Isokinetic dynamometry is a useful tool to objectively assess muscle strength of children and adults in athletic and rehabilitative settings. This study examined test-retest reliability of isokinetic knee strength measurements in children aged 8 to 10 years and defined limits for the minimum difference (MD) in strength that indicates a clinically important change. Isokinetic knee strength measurements (using the Biodex System 4) in children will provide reliable results. Descriptive laboratory study. In 22 healthy children, 5 maximal concentric (CON) knee extensor (KE) and knee flexor (KF) contractions at 2 angular velocities (60 deg/s and 180 deg/s) and 5 maximal eccentric (ECC) KE/KF contractions at 60 deg/s were assessed 7 days apart. The intraclass correlation coefficient (ICC 2.1 ) was used to examine relative reliability, and the MD was calculated on the basis of standard error of measurement. ICCs for CON KE/KF peak torque measurements were fair to excellent (range, 0.49-0.81). The MD% values for CON KE and KF ranged from 31% to 37% at 60 deg/s and from 34% to 39% at 180 deg/s. ICCs in the ECC mode were good (range, 0.60-0.70), but associated MD% values were high (>50%). There was no systematic error for CON KE/KF and ECC KE strength measurements at 60 deg/s, but systematic error was found for all other measurements. The dynamometer provides a reliable analysis of isokinetic CON knee strength measurements at 60 deg/s in children aged 8 to 10 years. Measurements at 180 deg/s and in the ECC mode were not reliable, indicating a need for more familiarization prior to testing. The MD values may help clinicians to determine whether a change in knee strength is due to error or intervention.
Hybrid vs Adaptive Ensemble Kalman Filtering for Storm Surge Forecasting
Altaf, M. U.; Raboudi, N.; Gharamti, M. E.; Dawson, C.; McCabe, M. F.; Hoteit, I.
2014-12-01
Recent storm surge events due to Hurricanes in the Gulf of Mexico have motivated the efforts to accurately forecast water levels. Toward this goal, a parallel architecture has been implemented based on a high resolution storm surge model, ADCIRC. However the accuracy of the model notably depends on the quality and the recentness of the input data (mainly winds and bathymetry), model parameters (e.g. wind and bottom drag coefficients), and the resolution of the model grid. Given all these uncertainties in the system, the challenge is to build an efficient prediction system capable of providing accurate forecasts enough ahead of time for the authorities to evacuate the areas at risk. We have developed an ensemble-based data assimilation system to frequently assimilate available data into the ADCIRC model in order to improve the accuracy of the model. In this contribution we study and analyze the performances of different ensemble Kalman filter methodologies for efficient short-range storm surge forecasting, the aim being to produce the most accurate forecasts at the lowest possible computing time. Using Hurricane Ike meteorological data to force the ADCIRC model over a domain including the Gulf of Mexico coastline, we implement and compare the forecasts of the standard EnKF, the hybrid EnKF and an adaptive EnKF. The last two schemes have been introduced as efficient tools for enhancing the behavior of the EnKF when implemented with small ensembles by exploiting information from a static background covariance matrix. Covariance inflation and localization are implemented in all these filters. Our results suggest that both the hybrid and the adaptive approach provide significantly better forecasts than those resulting from the standard EnKF, even when implemented with much smaller ensembles.
Khaki, M.
2017-07-06
The time-variable terrestrial water storage (TWS) products from the Gravity Recovery And Climate Experiment (GRACE) have been increasingly used in recent years to improve the simulation of hydrological models by applying data assimilation techniques. In this study, for the first time, we assess the performance of the most popular data assimilation sequential techniques for integrating GRACE TWS into the World-Wide Water Resources Assessment (W3RA) model. We implement and test stochastic and deterministic ensemble-based Kalman filters (EnKF), as well as Particle filters (PF) using two different resampling approaches of Multinomial Resampling and Systematic Resampling. These choices provide various opportunities for weighting observations and model simulations during the assimilation and also accounting for error distributions. Particularly, the deterministic EnKF is tested to avoid perturbing observations before assimilation (that is the case in an ordinary EnKF). Gaussian-based random updates in the EnKF approaches likely do not fully represent the statistical properties of the model simulations and TWS observations. Therefore, the fully non-Gaussian PF is also applied to estimate more realistic updates. Monthly GRACE TWS are assimilated into W3RA covering the entire Australia. To evaluate the filters performances and analyze their impact on model simulations, their estimates are validated by independent in-situ measurements. Our results indicate that all implemented filters improve the estimation of water storage simulations of W3RA. The best results are obtained using two versions of deterministic EnKF, i.e. the Square Root Analysis (SQRA) scheme and the Ensemble Square Root Filter (EnSRF), respectively improving the model groundwater estimations errors by 34% and 31% compared to a model run without assimilation. Applying the PF along with Systematic Resampling successfully decreases the model estimation error by 23%.
[Development and evaluation of a dance-based exercise therapy for patients with haemophilia].
Czepa, D; van Ravenstein, S; Stäuber, F; Hilberg, T
2013-01-01
So far, the use of methods derived from creative arts has not been considered in the haemophilia treatment. The AIM was to investigate the expectations for a dance-based exercise therapy for patients with haemophilia and the extent of its acceptance. The one-hour dance-based exercise therapy was offered to 30 haemophilia patients (HI30) (49 ± 11, 30-67 years). For the evaluation of expectations, questionnaires were created and filled out by participants before and after the intervention. Additionally, 19 haemophilia patients (HF) and 20 controls without haemophilia (KF) who did not participate in the intervention were also questioned. The RESULTS show that haemophilia patients have more experience in dance than controls (HI30:62%, HF:74%, KF:45%). In contrast, the proportion of those who are currently dancing is higher in controls without haemophilia (HI30: 17%, HF: 10%, KF:26%). The termination of dance activity in patients with haemophilia who were part of the intervention was mainly due to pain (HI30: 40%, HF: 29%, KF: 0%), whereby controls without intervention terminated the dance activity mainly due to lack of time (HI30: 30%, HF: 57%, KF: 56%). Ultimately, 24 out of 30 patients with haemophilia (HI24) completed the intervention. All HI24 met their expectations. 38% felt limited by haemophilia while carrying out the exercises. The majority of the participants were able to follow the exercises well (96%) and were did not overstrain physically (92%) nor mentally (87%), also 79% did not have pain. 23 of HI24 (96%) can envision a continuation of the dance-based exercise therapy. The experience with the dance-based exercise therapy was predominantly positive. It represents an alternative sports therapy programme for patients with haemophilia. Further studies are needed in order to make statements concerning the long-term use of such training.
Khaki, M.
2017-10-25
Assimilating Gravity Recovery And Climate Experiment (GRACE) data into land hydrological models provides a valuable opportunity to improve the models’ forecasts and increases our knowledge of terrestrial water storages (TWS). The assimilation, however, may harm the consistency between hydrological water fluxes, namely precipitation, evaporation, discharge, and water storage changes. To address this issue, we propose a weak constrained ensemble Kalman filter (WCEnKF) that maintains estimated water budgets in balance with other water fluxes. Therefore, in this study, GRACE terrestrial water storages data are assimilated into the World-Wide Water Resources Assessment (W3RA) hydrological model over the Earth’s land areas covering 2002 – 2012. Multi-mission remotely sensed precipitation measurements from the Tropical Rainfall Measuring Mission (TRMM) and evaporation products from the Moderate Resolution Imaging Spectroradiometer (MODIS), as well as ground-based water discharge measurements are applied to close the water balance equation. The proposed WCEnKF contains two update steps; first, it incorporates observations from GRACE to improve model simulations of water storages, and second, uses the additional observations of precipitation, evaporation, and water discharge to establish the water budget closure. These steps are designed to account for error information associated with the included observation sets during the assimilation process. In order to evaluate the assimilation results, in addition to monitoring the water budget closure errors, in-situ groundwater measurements over the Mississippi River Basin in the US and the Murray-Darling Basin in Australia are used. Our results indicate approximately 24% improvement in the WCEnKF groundwater estimates over both basins compared to the use of (constraint-free) EnKF. WCEnKF also further reduces imbalance errors by approximately 82.53% (on average) and at the same time increases the correlations between the
Kick frequency affects the energy cost of aquatic locomotion in elite monofin swimmers.
Boitel, Guillaume; Vercruyssen, Fabrice; Alberty, Morgan; Nesi, Xavier; Bourdon, Lionel; Brisswalter, Jeanick
2010-08-01
The aim of this study was to evaluate the influence of kick frequency (K(F)) on the energy cost of aquatic locomotion in elite monofin (Mf) swimmers at the surface. Eight subjects of international calibre (4 females, 4 males) were requested to perform in a 50-m outdoor swimming pool: (1) a continuous multi-stage incremental test to determine maximal physiological responses and (2) a submaximal exercise composed of five constant Mf-swimming tests (600-m exercise, 5-min rest) at an intensity corresponding to 90% of the velocity at the maximal oxygen uptake (VO2max). The first submaximal Mf-swimming test was systematically conducted at a freely chosen K(F) (FCK(F)) and the other tests were performed at FCK(F) - 15%, FCK(F) - 10%, FCK(F) + 10% and FCK(F) + 20% in a random order. No significant effect of K(F) on ventilation, heart rate and blood lactate concentration was observed throughout the submaximal Mf-swimming tests. However, mean values in Ec or fraction of VO2max were significantly lower during the FCK(F) + 10% condition as compared to those observed during the FCK(F) - 15% (-11.5 and -9.6%, respectively, P < 0.05) and FCK(F) - 10% (-10.4 and -9.3%, respectively, P < 0.05) conditions. In conclusion, the lack of significant differences between FCK(F) + 10% and FCK(F) or FCK(F) + 20% does not allow to identify a specific trend, but suggests the occurrence of an energetically optimal K(F) close to that freely chosen by the Mf swimmers. Variations in muscle activity level and active drag have been hypothesized to explain the observed differences in Ec consecutive to the selection of various K(F).
Energy Technology Data Exchange (ETDEWEB)
Siegele, Klaus
2013-02-15
More than twenty years after acquisition of a courtyard area from the 18th century the owners decided to retrofit the building comprehensively and gently. This building is under preservation order. An interior thermal insulation using wood fibre boards with wall heating and clay plaster, framed windows as well as a new pellet-fuelled heating system halved the heat requirement and enhanced the indoor comfort in the gorgeous timbered house.
Sana, Furrukh
2016-06-01
Subsurface reservoir flow channels are characterized by high-permeability values and serve as preferred pathways for fluid propagation. Accurate estimation of their geophysical structures is thus of great importance for the oil industry. The ensemble Kalman filter (EnKF) is a widely used statistical technique for estimating subsurface reservoir model parameters. However, accurate reconstruction of the subsurface geological features with the EnKF is challenging because of the limited measurements available from the wells and the smoothing effects imposed by the \\\\ell _{2} -norm nature of its update step. A new EnKF scheme based on sparse domain representation was introduced by Sana et al. (2015) to incorporate useful prior structural information in the estimation process for efficient recovery of subsurface channels. In this paper, we extend this work in two ways: 1) investigate the effects of incorporating time-lapse seismic data on the channel reconstruction; and 2) explore a Bayesian sparse reconstruction algorithm with the potential ability to reduce the computational requirements. Numerical results suggest that the performance of the new sparse Bayesian based EnKF scheme is enhanced with the availability of seismic measurements, leading to further improvement in the recovery of flow channels structures. The sparse Bayesian approach further provides a computationally efficient framework for enforcing a sparse solution, especially with the possibility of using high sparsity rates through the inclusion of seismic data.
The role of model dynamics in ensemble Kalman filter performance for chaotic systems
Ng, G.-H.C.; McLaughlin, D.; Entekhabi, D.; Ahanin, A.
2011-01-01
The ensemble Kalman filter (EnKF) is susceptible to losing track of observations, or 'diverging', when applied to large chaotic systems such as atmospheric and ocean models. Past studies have demonstrated the adverse impact of sampling error during the filter's update step. We examine how system dynamics affect EnKF performance, and whether the absence of certain dynamic features in the ensemble may lead to divergence. The EnKF is applied to a simple chaotic model, and ensembles are checked against singular vectors of the tangent linear model, corresponding to short-term growth and Lyapunov vectors, corresponding to long-term growth. Results show that the ensemble strongly aligns itself with the subspace spanned by unstable Lyapunov vectors. Furthermore, the filter avoids divergence only if the full linearized long-term unstable subspace is spanned. However, short-term dynamics also become important as non-linearity in the system increases. Non-linear movement prevents errors in the long-term stable subspace from decaying indefinitely. If these errors then undergo linear intermittent growth, a small ensemble may fail to properly represent all important modes, causing filter divergence. A combination of long and short-term growth dynamics are thus critical to EnKF performance. These findings can help in developing practical robust filters based on model dynamics. ?? 2011 The Authors Tellus A ?? 2011 John Wiley & Sons A/S.
Sana, Furrukh; Ravanelli, Fabio; Al-Naffouri, Tareq Y.; Hoteit, Ibrahim
2016-01-01
Subsurface reservoir flow channels are characterized by high-permeability values and serve as preferred pathways for fluid propagation. Accurate estimation of their geophysical structures is thus of great importance for the oil industry. The ensemble Kalman filter (EnKF) is a widely used statistical technique for estimating subsurface reservoir model parameters. However, accurate reconstruction of the subsurface geological features with the EnKF is challenging because of the limited measurements available from the wells and the smoothing effects imposed by the \\ell _{2} -norm nature of its update step. A new EnKF scheme based on sparse domain representation was introduced by Sana et al. (2015) to incorporate useful prior structural information in the estimation process for efficient recovery of subsurface channels. In this paper, we extend this work in two ways: 1) investigate the effects of incorporating time-lapse seismic data on the channel reconstruction; and 2) explore a Bayesian sparse reconstruction algorithm with the potential ability to reduce the computational requirements. Numerical results suggest that the performance of the new sparse Bayesian based EnKF scheme is enhanced with the availability of seismic measurements, leading to further improvement in the recovery of flow channels structures. The sparse Bayesian approach further provides a computationally efficient framework for enforcing a sparse solution, especially with the possibility of using high sparsity rates through the inclusion of seismic data.
Automated control system structure of the USSR Academy of Science Kaon facility
International Nuclear Information System (INIS)
Ivanov, Yu.S.; Konovalov, V.A.; Murin, B.P.; Filipchicov, L.L.; Esin, S.K.; Senichev, Yu.V.
1992-01-01
Up to date at Nuclear Research Institute of the USSR AS (Moscow-Troitsk) it is finished building of Moscow Meson Facility high intensity current proton Linear Accelerator (LA) (beam parameters: energy - 600 MeV, average current - 0.5 mA, pulse current - 50 mA). The LA proposed to serve as Kaon facility (KF) injector which is under working out [1]. Kaon complex, in addition to LA, includes: buster proton synchrotron (BR) with output energy 7.5 GeV, main synchrotron (SR) with proton energy up to 45 GeV and storer-stretcher (SS). The KF is proposed to work at 3 regimes. At first regime SS follows SR and is used as beam stretcher. KF time work diagram is cleaned by Fig.la. A half of beam pulses from LA and BR is used at ones for physical experiments. At second regime SS is inserted between BR and SR and works as collector. At third regime it is supposed to store in SS 4-6 beam pulses with next fast exit to experiment. The such kind using allows to receive terra watt power level pulses (8 · 10 14 particles with 45 GeV energy) with frequency of 1 Hz. There are presented below brief description of KF systems, which are concerned of radiotechnical systems (RTS) control (ACS) and adjusting (AAS). (author)
Effect Of Temperature On Hyalomma (Hyalomma) Impeltatum Schulze And Schlottke (Ixodoidea: Ixodidae)
Khalil, Galila M. [جليلة مصطفى خليل; Hagras, Ahmed E.
1988-01-01
The effect of 21, 25, 29 and 34°C on developmental period duration, weight of different stages in the life cycle and conversion efficiency in Hyalomma (H.) impeltatum Schuize and Schlottke was investigated at 75% relative humidity. Generally, egg incubation, larval and nymphal premolting and female preoviposition and oviposition periods were prolonged with the decrease in temperature. However, the egg incubation and preoviposition periods were the most greatly affected. Larval, nymphal and fe...
Texture analysis by the Schulz reflection method: Defocalization corrections for thin films
International Nuclear Information System (INIS)
Chateigner, D.; Germi, P.; Pernet, M.
1992-01-01
A new method is described for correcting experimental data obtained from the texture analysis of thin films. The analysis employed for correcting the data usually requires the experimental curves of defocalization for a randomly oriented specimen. In view of difficulties in finding non-oriented films, a theoretical method for these corrections is proposed which uses the defocalization evolution for a bulk sample, the film thickness and the penetration depth of the incident beam in the material. This correction method is applied to a film of YBa 2 CU 3 O 7-δ on an SrTiO 3 single-crystal substrate. (orig.)
Initial CAD investigations for NET
International Nuclear Information System (INIS)
Katz, F.; Leinemann, K.; Ludwig, A.; Marek, U.; Olbrich, W.; Schlechtendahl, E.G.
1985-11-01
This report summarizes the work done under contract no. 164/84-7/FU-D-/NET between the Commission of the European Communities and KfK during the period from June 1, 1984, through May 31, 1985. The following topics are covered in this report: Initial modelling of NET version NET2A, CAD system extension for remote handling studies, analysis of the CAD information structure, work related to the transfer of CAD information between KfK and the NET team. (orig.) [de
Sperling, P.; Thalmann, Christian; Reidy, B.; Kneubühler, L.; Grenz, Jan; Hofstetter, Pius
2017-01-01
Dairy farming is a key sector for Swiss agriculture and the food industry. Therefore, sustainability of dairy farms is important. Grassland-based farming systems are the most common production system, combining the indoor feeding of fresh grass with partial grazing. The effects of three dairy production systems (VW: full grazing plus on avg. 46±93 SD kg concentrate (KF), GFKF: indoor feeding/partial grazing plus on avg. 345±204 SD kg KF and GFKFplus: indoor feeding/partial grazing plus...
Stock Market Integration Measurement: Investigation of Malaysia and Singapore Stock Markets
B. K. Yeoh; Z. Arsad; C. W. Hooy
2010-01-01
This paper tests the level of market integration between Malaysia and Singapore stock markets with the world market. Kalman Filter (KF) methodology is used on the International Capital Asset Pricing Model (ICAPM) and the pricing errors estimated within the framework of ICAPM are used as a measure of market integration or segmentation. The advantage of the KF technique is that it allows for time-varying coefficients in estimating ICAPM and hence able to capture the varying degree of market int...
Theory, Instrumentation and Applications of Magnetoelastic Resonance Sensors: A Review
Grimes, Craig A.; Roy, Somnath C.; Rani, Sanju; Cai, Qingyun
2011-01-01
Thick-film magnetoelastic sensors vibrate mechanically in response to a time varying magnetic excitation field. The mechanical vibrations of the magnetostrictive magnetoelastic material launch, in turn, a magnetic field by which the sensor can be monitored. Magnetic field telemetry enables contact-less, remote-query operation that has enabled many practical uses of the sensor platform. This paper builds upon a review paper we published in Sensors in 2002 (Grimes, C.A.; et al. Sensors 2002, 2, 294–313), presenting a comprehensive review on the theory, operating principles, instrumentation and key applications of magnetoelastic sensing technology. PMID:22163768
Theory, Instrumentation and Applications of Magnetoelastic Resonance Sensors: A Review
Directory of Open Access Journals (Sweden)
Craig A. Grimes
2011-03-01
Full Text Available Thick-film magnetoelastic sensors vibrate mechanically in response to a time varying magnetic excitation field. The mechanical vibrations of the magnetostrictive magnetoelastic material launch, in turn, a magnetic field by which the sensor can be monitored. Magnetic field telemetry enables contact-less, remote-query operation that has enabled many practical uses of the sensor platform. This paper builds upon a review paper we published in Sensors in 2002 (Grimes, C.A.; et al. Sensors 2002, 2, 294-313, presenting a comprehensive review on the theory, operating principles, instrumentation and key applications of magnetoelastic sensing technology.
Directory of Open Access Journals (Sweden)
Ivana L. Mello
2006-03-01
Full Text Available Foram realizadas medidas viscosimétricas, em soluções de tolueno e ciclo-hexano, a 30°C, com polibutadieno alto-cis, sintetizado com catalisadores à base de neodímio. Foram empregadas diferentes equações para determinar os valores de viscosidade intrínseca: Huggins; Kraemer; Martin; e Schulz-Blaschke, por extrapolação gráfica; e Solomon-Ciuta; Deb-Chanterjee e; novamente, Schulz-Blaschke, por determinação por um único ponto. Os valores de viscosidade intrínseca obtidos pelos dois métodos (extrapolação gráfica e por um único ponto foram comparados a fim de se verificar a validade da determinação por um único ponto para os sistemas analisados, bem como determinar que equação fosse a mais adequada para esse tipo de cálculo. Foram calculadas as constantes viscosimétricas de Huggins, Kraemer e Schulz-Blaschke e foi feita uma análise da qualidade do solvente, levando-se em conta também os valores do parâmetro de solubilidade de Hildebrand dos solventes e do polímero. Foi determinada a distância média quadrática entre as extremidades das cadeias poliméricas por meio da equação de Flory, para tal foram utilizados os dados viscosimétricos obtidos, bem como os pesos moleculares determinados por viscosimetria e por cromatografia de exclusão por tamanho. Verificou-se que o método de determinação por um único ponto foi apropriado para o polibutadieno alto-cis, tanto para o cálculo de viscosidade intrínseca quanto de peso molecular. Em tolueno, a equação de Solomon-Ciuta foi a mais adequada, ao passo que a equação de Deb-Chanterjee foi mais apropriada para o polímero em ciclo-hexano. Verificou-se também que o tolueno foi o melhor solvente para o polibutadieno em função dos maiores valores de viscosidade intrínseca e de distância média quadrática entre os extremos da cadeia polimérica. Os valores obtidos para as constantes viscosimétricas confirmaram essa observação.Viscometric measurements, in
1994-04-06
1992). 17 M.G. Mendiratta, J.J. Lewandowski and D.M. Dimiduk, Metal. Trans., f2A. 1573 (1991). 18. F. Dave , A.G. Evans, G.R. Odette, R. Mehrabian, M.L...S. C. Ur and M. Dollar, in (Proc. 2nd Int. Conf. Struct. Appl. Mech. Alloying. Vancouver. Canada, 1993) pp. 291-296. 6. P. A. Zielinski . R. Schulz, S
Sana, Furrukh
2015-07-26
Recovering information on subsurface geological features, such as flow channels, holds significant importance for optimizing the productivity of oil reservoirs. The flow channels exhibit high permeability in contrast to low permeability rock formations in their surroundings, enabling formulation of a sparse field recovery problem. The Ensemble Kalman filter (EnKF) is a widely used technique for the estimation of subsurface parameters, such as permeability. However, the EnKF often fails to recover and preserve the channel structures during the estimation process. Compressed Sensing (CS) has shown to significantly improve the reconstruction quality when dealing with such problems. We propose a new scheme based on CS principles to enhance the reconstruction of subsurface geological features by transforming the EnKF estimation process to a sparse domain representing diverse geological structures. Numerical experiments suggest that the proposed scheme provides an efficient mechanism to incorporate and preserve structural information in the estimation process and results in significant enhancement in the recovery of flow channel structures.
Dynamic calibration of agent-based models using data assimilation.
Ward, Jonathan A; Evans, Andrew J; Malleson, Nicolas S
2016-04-01
A widespread approach to investigating the dynamical behaviour of complex social systems is via agent-based models (ABMs). In this paper, we describe how such models can be dynamically calibrated using the ensemble Kalman filter (EnKF), a standard method of data assimilation. Our goal is twofold. First, we want to present the EnKF in a simple setting for the benefit of ABM practitioners who are unfamiliar with it. Second, we want to illustrate to data assimilation experts the value of using such methods in the context of ABMs of complex social systems and the new challenges these types of model present. We work towards these goals within the context of a simple question of practical value: how many people are there in Leeds (or any other major city) right now? We build a hierarchy of exemplar models that we use to demonstrate how to apply the EnKF and calibrate these using open data of footfall counts in Leeds.
Sana, Furrukh; Katterbauer, Klemens; Al-Naffouri, Tareq Y.; Hoteit, Ibrahim
2015-01-01
Recovering information on subsurface geological features, such as flow channels, holds significant importance for optimizing the productivity of oil reservoirs. The flow channels exhibit high permeability in contrast to low permeability rock formations in their surroundings, enabling formulation of a sparse field recovery problem. The Ensemble Kalman filter (EnKF) is a widely used technique for the estimation of subsurface parameters, such as permeability. However, the EnKF often fails to recover and preserve the channel structures during the estimation process. Compressed Sensing (CS) has shown to significantly improve the reconstruction quality when dealing with such problems. We propose a new scheme based on CS principles to enhance the reconstruction of subsurface geological features by transforming the EnKF estimation process to a sparse domain representing diverse geological structures. Numerical experiments suggest that the proposed scheme provides an efficient mechanism to incorporate and preserve structural information in the estimation process and results in significant enhancement in the recovery of flow channel structures.
Operational aspects of asynchronous filtering for improved flood forecasting
Rakovec, Oldrich; Weerts, Albrecht; Sumihar, Julius; Uijlenhoet, Remko
2014-05-01
Hydrological forecasts can be made more reliable and less uncertain by recursively improving initial conditions. A common way of improving the initial conditions is to make use of data assimilation (DA), a feedback mechanism or update methodology which merges model estimates with available real world observations. The traditional implementation of the Ensemble Kalman Filter (EnKF; e.g. Evensen, 2009) is synchronous, commonly named a three dimensional (3-D) assimilation, which means that all assimilated observations correspond to the time of update. Asynchronous DA, also called four dimensional (4-D) assimilation, refers to an updating methodology, in which observations being assimilated into the model originate from times different to the time of update (Evensen, 2009; Sakov 2010). This study investigates how the capabilities of the DA procedure can be improved by applying alternative Kalman-type methods, e.g., the Asynchronous Ensemble Kalman Filter (AEnKF). The AEnKF assimilates observations with smaller computational costs than the original EnKF, which is beneficial for operational purposes. The results of discharge assimilation into a grid-based hydrological model for the Upper Ourthe catchment in Belgian Ardennes show that including past predictions and observations in the AEnKF improves the model forecasts as compared to the traditional EnKF. Additionally we show that elimination of the strongly non-linear relation between the soil moisture storage and assimilated discharge observations from the model update becomes beneficial for an improved operational forecasting, which is evaluated using several validation measures. In the current study we employed the HBV-96 model built within a recently developed open source modelling environment OpenStreams (2013). The advantage of using OpenStreams (2013) is that it enables direct communication with OpenDA (2013), an open source data assimilation toolbox. OpenDA provides a number of algorithms for model calibration
DEFF Research Database (Denmark)
Tamás, Illés S.
2015-01-01
goal of the treatment is to prevent becoming chronic the symptomatology. Objectives of the management of chronic low back pain are effective pain reduction, continuous maintainance of physical activity, prevention of permanent disability, and restoration of working ability. Analgesics, non steroid anti...
Reference manual for the KfK code PCROSS
International Nuclear Information System (INIS)
Ravndal, S.; Oblozinsky, P.; Kelzenberg, S.; Cierjacks, S.
1991-12-01
The PCROSS code calculates the so-called 'pseudo' cross sections for sequential (x,n) reactions and merges them together with 'effective' cross section for neutron induced reactions into one file of 'collapsed' cross sections. The file is tailored to provide an input for the FISPACT inventory code that calculates the activation and related radiological quantities of material irradiated in given neutron fields. The report summarizes calculational procedure and provides the reader with essential technical details of the code PCROSS (version 1.0) such as description of parameters, common blocks and subroutines. (orig.) [de
Nuclear Safety Project. Annual report 1986
International Nuclear Information System (INIS)
1987-09-01
The annual report 1986 is a detailed description of work within the Nuclear Safety Project performed in 1986 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes individual research activities on dynamic loads and strains of reactor components under accident conditions, fuel behaviour under accident conditions, investigation and control of LWR core-meltdown accidents, improvement of fission product retention and reduction of radiation exposure, and on behaviour, impact and removal of released pollutants. (DG)
1987-01-01
A C4 < ’~ - C C. *2 580 BEHAVIOUR OF HF/H 2 ELECTRODE IN A MOLTEN LiF-KF SYSTEM Keiko Ema, Yasuhiko Ito, Toshihide Takenaka and Jun Oishi Department...n (911. 0mo .I t 794. SMOOTH ELECTRODEPOSITS OF MOLYBDENUM FROM KF-B 2 03-Li 2MoO 4 MELT Koichiro Koyama and Yasuhiko Hashimoto Department of...HAtDE Hideki Yabe, Yasuhiko Ito, Keiko Ema and Jun Oishi Department of Nuclear Engineering, Faculty of Engineering, Kyoto University, Sakyo-ku, Kyoto 606
Particle Kalman Filtering: A Nonlinear Bayesian Framework for Ensemble Kalman Filters*
Hoteit, Ibrahim
2012-02-01
This paper investigates an approximation scheme of the optimal nonlinear Bayesian filter based on the Gaussian mixture representation of the state probability distribution function. The resulting filter is similar to the particle filter, but is different from it in that the standard weight-type correction in the particle filter is complemented by the Kalman-type correction with the associated covariance matrices in the Gaussian mixture. The authors show that this filter is an algorithm in between the Kalman filter and the particle filter, and therefore is referred to as the particle Kalman filter (PKF). In the PKF, the solution of a nonlinear filtering problem is expressed as the weighted average of an “ensemble of Kalman filters” operating in parallel. Running an ensemble of Kalman filters is, however, computationally prohibitive for realistic atmospheric and oceanic data assimilation problems. For this reason, the authors consider the construction of the PKF through an “ensemble” of ensemble Kalman filters (EnKFs) instead, and call the implementation the particle EnKF (PEnKF). It is shown that different types of the EnKFs can be considered as special cases of the PEnKF. Similar to the situation in the particle filter, the authors also introduce a resampling step to the PEnKF in order to reduce the risk of weights collapse and improve the performance of the filter. Numerical experiments with the strongly nonlinear Lorenz-96 model are presented and discussed.
Zhu, B.; Gao, F.; Yang, J. W.; Zhou, G. Q.
2016-08-01
Thin-layer coal seams, a type of filling coal rock body, are considered aquifer systems made up of dual porosity medium with immediate floor. A numerical simulation for the pore pressure propagation along a thin-layer coal seam was carried out for the case of the Zhaogezhuang coalmine in China. By valuing the permeability (Kf ) of the thin-layer coal seam, pore pressure variation with time was simulated and compared to the analytical solutions of a dual porosity model (DPM). The main conclusions were drawn as follow: (1) Seepage in the thin-layer coal seam was predominant in the whole process, and the distance of seepage was lengthened and the pore pressure decreased with increased Kf , (2) A series of simulated hydraulic graphs demonstrated that the pore pressure characteristics of peak-occurring and time-lag effects agreed with the analytical solutions of DPM; (3) By adjusting the parameters of DPM, two results of analytical solutions and numerical solutions fit well, particularly in the thin-layer coal seam, (4) The power law relationship between the peak-values and lag time of pore pressure were derived statistically under consideration of the Kf parameter in the range of 10-8 to 10-10 m2/pa-s orders, and it was reasonable that the Kf of the thin-layer coal seam was in the range of 10-8 m2/pa-s orders. The results were significantly helpful in decision-making for mining water prevention and prediction in practice.
Robust Ensemble Filtering and Its Relation to Covariance Inflation in the Ensemble Kalman Filter
Luo, Xiaodong
2011-12-01
A robust ensemble filtering scheme based on the H∞ filtering theory is proposed. The optimal H∞ filter is derived by minimizing the supremum (or maximum) of a predefined cost function, a criterion different from the minimum variance used in the Kalman filter. By design, the H∞ filter is more robust than the Kalman filter, in the sense that the estimation error in the H∞ filter in general has a finite growth rate with respect to the uncertainties in assimilation, except for a special case that corresponds to the Kalman filter. The original form of the H∞ filter contains global constraints in time, which may be inconvenient for sequential data assimilation problems. Therefore a variant is introduced that solves some time-local constraints instead, and hence it is called the time-local H∞ filter (TLHF). By analogy to the ensemble Kalman filter (EnKF), the concept of ensemble time-local H∞ filter (EnTLHF) is also proposed. The general form of the EnTLHF is outlined, and some of its special cases are discussed. In particular, it is shown that an EnKF with certain covariance inflation is essentially an EnTLHF. In this sense, the EnTLHF provides a general framework for conducting covariance inflation in the EnKF-based methods. Some numerical examples are used to assess the relative robustness of the TLHF–EnTLHF in comparison with the corresponding KF–EnKF method.
Efficient Data Assimilation Algorithms for Bathymetry Applications
Ghorbanidehno, H.; Kokkinaki, A.; Lee, J. H.; Farthing, M.; Hesser, T.; Kitanidis, P. K.; Darve, E. F.
2016-12-01
Information on the evolving state of the nearshore zone bathymetry is crucial to shoreline management, recreational safety, and naval operations. The high cost and complex logistics of using ship-based surveys for bathymetry estimation have encouraged the use of remote sensing monitoring. Data assimilation methods combine monitoring data and models of nearshore dynamics to estimate the unknown bathymetry and the corresponding uncertainties. Existing applications have been limited to the basic Kalman Filter (KF) and the Ensemble Kalman Filter (EnKF). The former can only be applied to low-dimensional problems due to its computational cost; the latter often suffers from ensemble collapse and uncertainty underestimation. This work explores the use of different variants of the Kalman Filter for bathymetry applications. In particular, we compare the performance of the EnKF to the Unscented Kalman Filter and the Hierarchical Kalman Filter, both of which are KF variants for non-linear problems. The objective is to identify which method can better handle the nonlinearities of nearshore physics, while also having a reasonable computational cost. We present two applications; first, the bathymetry of a synthetic one-dimensional cross section normal to the shore is estimated from wave speed measurements. Second, real remote measurements with unknown error statistics are used and compared to in situ bathymetric survey data collected at the USACE Field Research Facility in Duck, NC. We evaluate the information content of different data sets and explore the impact of measurement error and nonlinearities.
Mass size distribution of particle-bound water
Canepari, S.; Simonetti, G.; Perrino, C.
2017-09-01
The thermal-ramp Karl-Fisher method (tr-KF) for the determination of PM-bound water has been applied to size-segregated PM samples collected in areas subjected to different environmental conditions (protracted atmospheric stability, desert dust intrusion, urban atmosphere). This method, based on the use of a thermal ramp for the desorption of water from PM samples and the subsequent analysis by the coulometric KF technique, had been previously shown to differentiate water contributes retained with different strength and associated to different chemical components in the atmospheric aerosol. The application of the method to size-segregated samples has revealed that water showed a typical mass size distribution in each one of the three environmental situations that were taken into consideration. A very similar size distribution was shown by the chemical PM components that prevailed during each event: ammonium nitrate in the case of atmospheric stability, crustal species in the case of desert dust, road-dust components in the case of urban sites. The shape of the tr-KF curve varied according to the size of the collected particles. Considering the size ranges that better characterize the event (fine fraction for atmospheric stability, coarse fraction for dust intrusion, bi-modal distribution for urban dust), this shape is coherent with the typical tr-KF shape shown by water bound to the chemical species that predominate in the same PM size range (ammonium nitrate, crustal species, secondary/combustion species - road dust components).
Zhu, Shi-Dan; Chen, Ya-Jun; Fu, Pei-Li; Cao, Kun-Fang
2017-11-01
In southwestern China, tropical karst forests (KF) and non-karst rain forests (NKF) have different species composition and forest structure owing to contrasting soil water availability, but with a few species that occur in both forests. Plant hydraulic traits are important for understanding the species' distribution patterns in these two forest types, but related studies are rare. In this study, we investigated hydraulic conductivity, vulnerability to drought-induced cavitation and wood anatomy of 23 abundant and typical woody species from a KF and a neighboring NKF, as well as two Bauhinia liana species common to both forests. We found that the KF species tended to have higher sapwood density, smaller vessel diameter, lower specific hydraulic conductivity (ks) and leaf to sapwood area ratio, and were more resistant to cavitation than NKF species. Across the 23 species distinctly occurring in either KF or NKF, there was a significant tradeoff between hydraulic efficiency and safety, which might be an underlying mechanism for distributions of these species across the two forests. Interestingly, by possessing rather large and long vessels, the two Bauhinia liana species had extremely high ks but were also high resistance to cavitation (escaping hydraulic tradeoff). This might be partially due to their distinctly dimorphic vessels, but contribute to their wide occurrence in both forests. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Lifescience Database Archive (English)
Full Text Available ESFGGATTFNFTS SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinkykn kf Translated Amino Acid sequence...ISETPFSLASTTHIDKTFISTNKEAIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTS SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinky
DEFF Research Database (Denmark)
Nguyen, Kha Ngoc; Duus, Fritz; Luu, Thi Xuan Thi
2016-01-01
The preparation of thioethers by S-alkylation of various thiols with alkyl halides under solvent-free reaction conditions using potassium fluoride on alumina (KF/Al2O3) as a solid catalyst has been investigated in detail with respect to three different modes of reaction activation (ultrasound...... irradiation, microwave irradiation, and conventional heating) for obtaining maximum yield of the thioether. The importance of KF/Al2O3 as a particularly efficient catalyst was corroborated for all three modes of reaction activation, although the reaction time was found to be strongly dependent on the mode...
Recursive B-spline approximation using the Kalman filter
Directory of Open Access Journals (Sweden)
Jens Jauch
2017-02-01
Full Text Available This paper proposes a novel recursive B-spline approximation (RBA algorithm which approximates an unbounded number of data points with a B-spline function and achieves lower computational effort compared with previous algorithms. Conventional recursive algorithms based on the Kalman filter (KF restrict the approximation to a bounded and predefined interval. Conversely RBA includes a novel shift operation that enables to shift estimated B-spline coefficients in the state vector of a KF. This allows to adapt the interval in which the B-spline function can approximate data points during run-time.
International Nuclear Information System (INIS)
Koerting, K.
1988-01-01
At the Karlsruhe Nuclear Research Center, the Public Relations Department directly reports to the Chief Executive Officer. The head of the Public Relation Department acts as spokesman of the center in the public, which requires him to be fully informed of the work of all units and of the policy goals of the executive board. The key tools used by the Public Relations Department are KfK-Hausmitteilungen, accident information, the scientific journal KfK-Nachrichten, press releases, exhibitions, fairs, guided tours, and nuclear energy information staff. (DG)
An overview of physico-chemical properties of molten fluoride for nuclear applications
International Nuclear Information System (INIS)
Dash, Smruti
2013-01-01
The general aim of this study is to provide an overview of the key research trends of physicochemical properties of molten salts. This study also calculated the coefficient of viscosities of NaF, KF, FeF 2 , NiF 2 and different compositions of NaF + KF melt using FactSage programme. This programme linked the slag viscosity to the internal structure of melts through second nearest neighbor bonds concentrations which was calculated from the advanced quasi-chemical thermodynamic model. The calculated coefficients of viscosities were compared with that reported in the literature. (author)
Europe Report, Science and Technology.
1986-09-29
MICROELECTRONICS Italian SGS President: Survival Strategies for Small Firms (Rudolf Schulze; VDI NACHRICHTEN , 11 Jul 86) 47 SCIENTIFIC AND INDUSTRIAL POLICY...29 September 1986 WEST EUROPE/^OtoEIECTRONICS ITALIAN SGS PRESIDENT: SURVIVAL STRATEGIES FOR SMALL FIRMS Duesseldorf VDI NACHRICHTEN in German...for Europe," first paragraph is VDI NACHRICHTEN introduction] [Text] Duesseldorf, 11 Jul 86—Japanese producers are in the process of taking over the
Behavioral Ecology of Deep Diving Odontocetes in The Bahamas
2015-10-19
have the most fluid social structure, though some dyadic bonds were suggested by similar persistent organic pollutant concentrations (which...surface, and are thought to have a communicative function (Schulz et al. 2008, Watkins and Schevill 1977, Weilgart and Whitehead 1993). Coda clicks and...species, with an average error radius of 3.5 km. Although this species surfaces regularly and tags therefore potentially could communicate frequently
2016-01-01
DC) product following cutaneous exposure to VX was affected by the DC procedure. Fur-clipped, male, unanesthetized guinea pigs were used as subjects...RSDL) Following Cutaneous VX Exposure in Guinea Pigs Irwin Koplovitz Susan Schulz Julia Morgan Robert Reed Edward Clarkson C. Gary Hurst...Decontamination Procedures Using Reactive Skin 5a. CONTRACT NUMBER Decontamination Lotion (RSDL) Following Cutaneous VX Exposure in Guinea Pigs 5b
El Gharamti, M.; Bethke, I.; Tjiputra, J.; Bertino, L.
2016-02-01
Given the recent strong international focus on developing new data assimilation systems for biological models, we present in this comparative study the application of newly developed state-parameters estimation tools to an ocean ecosystem model. It is quite known that the available physical models are still too simple compared to the complexity of the ocean biology. Furthermore, various biological parameters remain poorly unknown and hence wrong specifications of such parameters can lead to large model errors. Standard joint state-parameters augmentation technique using the ensemble Kalman filter (Stochastic EnKF) has been extensively tested in many geophysical applications. Some of these assimilation studies reported that jointly updating the state and the parameters might introduce significant inconsistency especially for strongly nonlinear models. This is usually the case for ecosystem models particularly during the period of the spring bloom. A better handling of the estimation problem is often carried out by separating the update of the state and the parameters using the so-called Dual EnKF. The dual filter is computationally more expensive than the Joint EnKF but is expected to perform more accurately. Using a similar separation strategy, we propose a new EnKF estimation algorithm in which we apply a one-step-ahead smoothing to the state. The new state-parameters estimation scheme is derived in a consistent Bayesian filtering framework and results in separate update steps for the state and the parameters. Unlike the classical filtering path, the new scheme starts with an update step and later a model propagation step is performed. We test the performance of the new smoothing-based schemes against the standard EnKF in a one-dimensional configuration of the Norwegian Earth System Model (NorESM) in the North Atlantic. We use nutrients profile (up to 2000 m deep) data and surface partial CO2 measurements from Mike weather station (66o N, 2o E) to estimate
Current research and development at the Nuclear Research Center Karlsruhe
International Nuclear Information System (INIS)
Kuesters, H.
1982-01-01
The Nuclear Research Center Karlsruhe (KfK) is funded to 90% by the Federal Republic of Germany and to 10% by the State of Baden-Wuerttemberg. Since its foundation in 1956 the main objective of the Center is research and development (R and D) in the aera of the nuclear technology and about 2/3 of the research capacity is now devoted to this field. Since 1960 a major activity of KfK is R and D work for the design of fast breeder reactors, including material research, physics, and safety investigations; a prototype of 300 MWe is under construction now in the lower Rhine Valley. For enrichment of 235 U fissile material KfK developed the separation nozzle process; its technical application is realized within an international contract between the Federal Republic of Germany and Brazil. Within the frame of the European Programme on fusion technology KfK develops and tests superconducting magnets for toroidal fusion systems; a smaller activity deals with research on inertial confinement fusion. A broad research programme is carried through for safety investigations of nuclear installations, especially for PWRs; this activity is supplemented by research and development in the field of nuclear materials' safeguards. Development of fast reactors has to initiate research for the reprocessing of spent fuel and waste disposal. In the pilot plant WAK spent fuel from LKWs is reprocessed; research especially tries e.g. to improve the PUREX-process by electrochemical means, vitrification of high active waste is another main activity. First studies are being performed now to clarify the necessary development for reprocessing fast reactor fuel. About 1/3 of the research capacity of KfK deals with fundamental research in nuclear physics, solid state physics, biology and studies on the impact of technology on environment. Promising new technologies as e.g. the replacement of gasoline by hydrogen cells as vehicle propulsion are investigated. (orig.)
Directory of Open Access Journals (Sweden)
Laavanya M. Kumar
2017-12-01
Full Text Available Objective: To investigate the antibacterial effect of selected lactic acid bacteria (LAB biofilms on the planktonic and biofilm population of methicillin-resistant Staphylococcus aureus (MRSA (S547. Methods: In this study, biofilm-forming LAB were isolated from tairu and kefir. Isolate Y1 and isolate KF were selected based on their prominent inhibition against test pathogens (using spot-on-agar method and agar-well-diffusion assay and efficient biofilm production (using tissue culture plate method. They were then identified as Lactobacillus casei (L. casei Y1 and Lactobacillus plantarum (L. plantarum KF, respectively using 16S rDNA gene sequencing. The influence of incubation time, temperature and aeration on the biofilm production of L. casei Y1 and L. plantarum KF was also investigated using tissue culture plate method. The inhibitory activity of both the selected LAB biofilms was evaluated against MRSA (Institute for Medical Research code: S547 using L. plantarum ATCC 8014 as the reference strain. Results: L. casei Y1 showed the highest reduction of MRSA biofilms, by 3.53 log at 48 h while L. plantarum KF records the highest reduction of 2.64 log at 36 h. In inhibiting planktonic population of MRSA (S547, both L. casei Y1 and L. plantarum KF biofilms recorded their maximum reduction of 4.13 log and 3.41 log at 24 h, respectively. Despite their inhibitory effects being time-dependent, both LAB biofilms exhibited good potential in controlling the biofilm and planktonic population of MRSA (S547. Conclusions: The results from this study could highlight the importance of analysing biofilms of LAB to enhance their antibacterial efficacy. Preferably, these protective biofilms of LAB could also be a better alternative to control the formation of biofilms by pathogens such as MRSA. Keywords: MRSA, Biofilms, Lactic acid bacteria, Antibacterial
Directory of Open Access Journals (Sweden)
A. Sakthivel Selvan
2014-12-01
Full Text Available Aim: The present study was undertaken with the objectives to characterize, identify DNA polymorphism in cluster of differentiation 14 (CD14 gene in Karan Fries (KF cattle and to analyze association between genetic variants with incidence of clinical mastitis in National Dairy Research Institute (NDRI herd, Karnal. Materials and Methods: Genomic DNA was extracted using blood of randomly selected hundred KF lactating cattle by phenol-chloroform method. After checking its quality and quantity, polymerase chain reaction (PCR was carried out using reported primers to amplify 832 base pair region covering nucleotide base position number 1012 to 1843 (part of promoter, 5’UTR, exon 1, intron 1 and part of exon 2 of bovine CD14 gene. The PCR amplified target product was purified, sequenced and further ClustalW analysis was done to align edited sequence with reported Bos taurus sequence (EU148610.1. The restriction fragment length polymorphism (RFLP analysis was performed for each KF cow using HinfI restriction enzyme (RE. Cows were assigned genotypes obtained by PCR-RFLP analysis and association study was done using Chi-square (χ2 test. Results: After PCR amplification, DNA sequencing of amplicon confirmed the 832 bases covering 1012 to 1843 nucleotide base position of bovine CD14 gene. ClustalW multiple sequence alignment program for DNA revealed six nucleotide changes in KF cows at positions T1117D, T1239G, T1291C, G1359C, G1361A, and G1811A. Cows were also screened using PCR-RFLP with HinfI RE, which revealed three genotypes CC, CD and DD that differed significantly regarding mastitis incidence. Within CC genotype, 72.73% of cows were in a mastitis non-affected group whereas, those in CD and DD genotypes 69.44% and 60.38% respectively were mastitis affected. Conclusion: KF cows with allele C of CD14 gene were less susceptibility to mastitis compared with D allele.
Impact of cloud parameterization on the numerical simulation of a super cyclone
Energy Technology Data Exchange (ETDEWEB)
Deshpande, M.S.; Pattnaik, S.; Salvekar, P.S. [Indian Institute of Tropical Meteorology, Pune (India)
2012-07-01
This study examines the role of parameterization of convection and explicit moisture processes on the simulated track, intensity and inner core structure of Orissa super cyclone (1999) in Bay of Bengal (north Indian Ocean). Sensitivity experiments are carried out to examine the impact of cumulus parameterization schemes (CPS) using MM5 model (Version 3.7) in a two-way nested domain (D1 and D2) configuration at horizontal resolutions (45-15 km). Three different cumulus parameterization schemes, namely Grell (Gr), Betts-Miller (BM) and updated Kain Fritsch (KF2), are tested. It is noted that track and intensity both are very sensitive to CPS and comparatively, KF2 predicts them reasonably well. Particularly, the rapid intensification phase of the super cyclone is best simulated by KF2 compared to other CPS. To examine the effect of the cumulus parameterization scheme at high resolution (5 km), the three-domain configuration (45-15-5 km resolution) is utilized. Based on initial results, KF2 scheme is used for both the domains (D1 and D2). Two experiments are conducted: one in which KF2 is used as CPS and another in which no CPS is used in the third domain. The intensity is well predicted when no CPS is used in the innermost domain. The sensitivity experiments are also carried out to examine the impact from microphysics parameterization schemes (MPS). Four cloud microphysics parameterization schemes, namely mixed phase (MP), Goddard microphysics with Graupel (GG), Reisner Graupel (RG) and Schultz (Sc), are tested in these experiments. It is noted that the tropical cyclone tracks and intensity variation have considerable sensitivity to the varying cloud microphysical parameterization schemes. The MPS of MP and Sc could very well capture the rapid intensification phase. The final intensity is well predicted by MP, which is overestimated by Sc. The MPS of GG and RG underestimates the intensity. (orig.)
Directory of Open Access Journals (Sweden)
Baptiste Mourre
2014-01-01
Full Text Available This study compares the ability of two approaches integrating models and data to forecast the Ligurian Sea regional oceanographic conditions in the short-term range (0–72 hours when constrained by a common observation dataset. The post-processing 3-D super-ensemble (3DSE algorithm, which uses observations to optimally combine multi-model forecasts into a single prediction of the oceanic variable, is first considered. The 3DSE predictive skills are compared to those of the Regional Ocean Modeling System model in which observations are assimilated through a more conventional ensemble Kalman filter (EnKF approach. Assimilated measurements include sea surface temperature maps, and temperature and salinity subsurface observations from a fleet of five underwater gliders. Retrospective analyses are carried out to produce daily predictions during the 11-d period of the REP10 sea trial experiment. The forecast skill evaluation based on a distributed multi-sensor validation dataset indicates an overall superior performance of the EnKF, both at the surface and at depth. While the 3DSE and EnKF perform comparably well in the area spanned by the incorporated measurements, the 3DSE accuracy is found to rapidly decrease outside this area. In particular, the univariate formulation of the method combined with the absence of regular surface salinity measurements produces large errors in the 3DSE salinity forecast. On the contrary, the EnKF leads to more homogeneous forecast errors over the modelling domain for both temperature and salinity. The EnKF is found to consistently improve the predictions with respect to the control solution without assimilation and to be positively skilled when compared to the climatological estimate. For typical regional oceanographic applications with scarce subsurface observations, the lack of physical spatial and multivariate error covariances applicable to the individual model weights in the 3DSE formulation constitutes a major
A comparison of stable caesium uptake by six grass species of contrasting growth strategy
International Nuclear Information System (INIS)
Willey, N.J.; Martin, M.H.
1997-01-01
Six plants in the family Gramineae were used to investigate the relationship between Cs uptake, nutrient regime and plant growth strategy sensu Grime (1979: Plant Growth Strategies and Vegetation Processes, John Wiley). The roots of 66 day old Elymus repens (L.) Gould., Bromus sterilis L., Agrostis stolonifera L., Anthoxanthum odoratum L., Festuca ovina L. and Nardus stricta L. plants grown in acid-washed sand at high and low nutrient levels were exposed to a 96 h pulse of stable Cs at 0.05 mM, 0.15 mM, 0.3 mM, 1.0 mM and 3.0 mM concentrations. Different nutrient regimes induced large differences in dry wt in E. repens, B. sterilis and A. stolonifera plants but only small differences in N. stricta and F. ovina plants. At high nutrient concentrations, A. stolonifera, A. odoratum, F. ovina and N. stricta shoots showed significantly greater increases in internal Cs concentration with rising external Cs concentrations than did E. repens and B. sterilis shoots. The relationship between increases in shoot and external Cs concentrations was statistically indistinguishable between species in plants grown at the low nutrient concentration. These patterns of Cs uptake ensured that with long-term high K concentrations the more competitive plants (E. repens and B. sterilis) accumulated higher concentrations of Cs from low external concentrations than did non-competitive plants or competitive plants grown at low nutrient levels. It is suggested that the relationship between plant growth strategy sensu Grime (1979) and Cs accumulation patterns may help to explain the different concentrations to which species accumulate radiocaesium from the soil. (author)
Roudman, A R; Kusy, R P
1998-03-15
Aminated poly(vinyl chloride) (PVC) membranes were prepared that had a Nernstian response over a wide range of pH. The reaction between PVC and methyl-piperazine (MePIP) in dimethylformamide (DMF) was studied over a wide range of time and temperature, and in the presence of the catalyst, potassium fluoride (KF). Time, temperature, and KF increased the nitrogen (N) content of the resulting polymers, but sometimes at the expense of decreasing their specific viscosities (molecular weights). Activation energies of processes that occurred in different temperature ranges were estimated assuming an Arrhenius relationship. A Nernstian response occurred once the N content approached to about 0.3 w/w %, and was accelerated by the presence of KF at elevated temperatures. Increasing the N content above about 3% led to a loss of the Nernstian response either because of an increase in the double bond content and a subsequent decrease in polymer mobility, or because of a decrease in the molecular weight of the copolymer and concomitant difficulties in film preparation.
Interactions of alkali metals and electrolyte with cathode carbons
Energy Technology Data Exchange (ETDEWEB)
Naas, Tyke
1997-12-31
The Hall-Heroult process for electrolytic reduction of alumina has been the only commercial process for production of primary aluminium. The process runs at high temperature and it is important to minimize the energy consumption. To save energy it is desirable to reduce the operating temperature. This can be achieved by adding suitable additives such as LiF or KF to the cryolitic electrolyte. This may conflict with the objective of extending the lifetime of the cathode linings of the cell as much as possible. The thesis investigates this possibility and the nature of the interactions involved. It supports the hypothesis that LiF-additions to the Hall-Heroult cell electrolyte is beneficial to the carbon cathode performance because the diminished sodium activity reduces the sodium induced stresses during the initial period of electrolysis. The use of KF as an additive is more dangerous, but the results indicate that additions up to 5% KF may be tolerated in acidic melts with semigraphitic or graphitic cathodes with little risk of cathode problems. 153 refs., 94 figs., 30 tabs.
Ensemble Kalman filtering with residual nudging
Luo, X.
2012-10-03
Covariance inflation and localisation are two important techniques that are used to improve the performance of the ensemble Kalman filter (EnKF) by (in effect) adjusting the sample covariances of the estimates in the state space. In this work, an additional auxiliary technique, called residual nudging, is proposed to monitor and, if necessary, adjust the residual norms of state estimates in the observation space. In an EnKF with residual nudging, if the residual norm of an analysis is larger than a pre-specified value, then the analysis is replaced by a new one whose residual norm is no larger than a pre-specified value. Otherwise, the analysis is considered as a reasonable estimate and no change is made. A rule for choosing the pre-specified value is suggested. Based on this rule, the corresponding new state estimates are explicitly derived in case of linear observations. Numerical experiments in the 40-dimensional Lorenz 96 model show that introducing residual nudging to an EnKF may improve its accuracy and/or enhance its stability against filter divergence, especially in the small ensemble scenario.
The preparation and thermoelectric properties of molten salt electrodeposited boron wafers
International Nuclear Information System (INIS)
Kumashiro, Y.; Ozaki, S.; Sato, K.; Kataoka, Y.; Hirata, K.; Yokoyama, T.; Nagatani, S.; Kajiyama, K.
2004-01-01
We have prepared electrodeposited boron wafer by molten salts with KBF 4 -KF at 680 deg. C using graphite crucible for anode and silicon wafer and nickel plate for cathodes. Experiments were performed by various molar ratios KBF 4 /KF and current densities. Amorphous p-type boron wafers with purity 87% was deposited on nickel plate for 1 h. Thermal diffusivity by ring-flash method and heat capacity by DSC method produced thermal conductivity showing amorphous behavior in the entire temperature range. The systematical results on thermoelectric properties were obtained for the wafers prepared with KBF 4 -KF (66-34 mol%) under various current densities in the range 1-2 A/cm 2 . The temperature dependencies of electrical conductivity showed thermal activated type with activation energy of 0.5 eV. Thermoelectric power tended to increase with increasing temperature up to high temperatures with high values of (1-10) mV/K. Thermoelectric figure-of-merit was 10 -4 /K at high temperatures. Estimated efficiency of thermoelectric energy conversion would be calculated to be 4-5%
Linear and nonlinear dynamic systems in financial time series prediction
Directory of Open Access Journals (Sweden)
Salim Lahmiri
2012-10-01
Full Text Available Autoregressive moving average (ARMA process and dynamic neural networks namely the nonlinear autoregressive moving average with exogenous inputs (NARX are compared by evaluating their ability to predict financial time series; for instance the S&P500 returns. Two classes of ARMA are considered. The first one is the standard ARMA model which is a linear static system. The second one uses Kalman filter (KF to estimate and predict ARMA coefficients. This model is a linear dynamic system. The forecasting ability of each system is evaluated by means of mean absolute error (MAE and mean absolute deviation (MAD statistics. Simulation results indicate that the ARMA-KF system performs better than the standard ARMA alone. Thus, introducing dynamics into the ARMA process improves the forecasting accuracy. In addition, the ARMA-KF outperformed the NARX. This result may suggest that the linear component found in the S&P500 return series is more dominant than the nonlinear part. In sum, we conclude that introducing dynamics into the ARMA process provides an effective system for S&P500 time series prediction.
Lifescience Database Archive (English)
Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns
Yurkevich, Olga Y; Kirov, Ilya V; Bolsheva, Nadezhda L; Rachinskaya, Olga A; Grushetskaya, Zoya E; Zoschuk, Svyatoslav A; Samatadze, Tatiana E; Bogdanova, Marina V; Lemesh, Valentina A; Amosova, Alexandra V; Muravenko, Olga V
2017-01-01
Flax, Linum usitatissimum L., is a valuable multi-purpose plant, and currently, its genome is being extensively investigated. Nevertheless, mapping of genes in flax genome is still remaining a challenging task. The cellulose synthase ( CesA ) multigene family involving in the process of cellulose synthesis is especially important for metabolism of this fiber crop. For the first time, fluorescent in situ hybridization (FISH)-based chromosomal localization of the CesA conserved fragment (KF011584.1), 5S, and 26S rRNA genes was performed in landrace, oilseed, and fiber varieties of L. usitatissimum . Intraspecific polymorphism in chromosomal distribution of KF011584.1 and 5S DNA loci was revealed, and the generalized chromosome ideogram was constructed. Using BLAST analysis, available data on physical/genetic mapping and also whole-genome sequencing of flax, localization of KF011584.1, 45S, and 5S rRNA sequences on genomic scaffolds, and their anchoring to the genetic map were conducted. The alignment of the results of FISH and BLAST analyses indicated that KF011584.1 fragment revealed on chromosome 3 could be anchored to linkage group (LG) 11. The common LG for 45S and 5S rDNA was not found probably due to the polymorphic localization of 5S rDNA on chromosome 1. Our findings indicate the complexity of integration of physical, genetic, and cytogenetic mapping data for multicopy gene families in plants. Nevertheless, the obtained results can be useful for future progress in constructing of integrated physical/genetic/cytological maps in L. usitatissimum which are essential for flax breeding.
Camporese, M.; Botto, A.
2017-12-01
Data assimilation is becoming increasingly popular in hydrological and earth system modeling, as it allows for direct integration of multisource observation data in modeling predictions and uncertainty reduction. For this reason, data assimilation has been recently the focus of much attention also for integrated surface-subsurface hydrological models, whereby multiple terrestrial compartments (e.g., snow cover, surface water, groundwater) are solved simultaneously, in an attempt to tackle environmental problems in a holistic approach. Recent examples include the joint assimilation of water table, soil moisture, and river discharge measurements in catchment models of coupled surface-subsurface flow using the ensemble Kalman filter (EnKF). Although the EnKF has been specifically developed to deal with nonlinear models, integrated hydrological models based on the Richards equation still represent a challenge, due to strong nonlinearities that may significantly affect the filter performance. Thus, more studies are needed to investigate the capabilities of EnKF to correct the system state and identify parameters in cases where the unsaturated zone dynamics are dominant. Here, the model CATHY (CATchment HYdrology) is applied to reproduce the hydrological dynamics observed in an experimental hillslope, equipped with tensiometers, water content reflectometer probes, and tipping bucket flow gages to monitor the hillslope response to a series of artificial rainfall events. We assimilate pressure head, soil moisture, and subsurface outflow with EnKF in a number of assimilation scenarios and discuss the challenges, issues, and tradeoffs arising from the assimilation of multisource data in a real-world test case, with particular focus on the capability of DA to update the subsurface parameters.
Calibration of a Land Subsidence Model Using InSAR Data via the Ensemble Kalman Filter.
Li, Liangping; Zhang, Meijing; Katzenstein, Kurt
2017-11-01
The application of interferometric synthetic aperture radar (InSAR) has been increasingly used to improve capabilities to model land subsidence in hydrogeologic studies. A number of investigations over the last decade show how spatially detailed time-lapse images of ground displacements could be utilized to advance our understanding for better predictions. In this work, we use simulated land subsidences as observed measurements, mimicking InSAR data to inversely infer inelastic specific storage in a stochastic framework. The inelastic specific storage is assumed as a random variable and modeled using a geostatistical method such that the detailed variations in space could be represented and also that the uncertainties of both characterization of specific storage and prediction of land subsidence can be assessed. The ensemble Kalman filter (EnKF), a real-time data assimilation algorithm, is used to inversely calibrate a land subsidence model by matching simulated subsidences with InSAR data. The performance of the EnKF is demonstrated in a synthetic example in which simulated surface deformations using a reference field are assumed as InSAR data for inverse modeling. The results indicate: (1) the EnKF can be used successfully to calibrate a land subsidence model with InSAR data; the estimation of inelastic specific storage is improved, and uncertainty of prediction is reduced, when all the data are accounted for; and (2) if the same ensemble is used to estimate Kalman gain, the analysis errors could cause filter divergence; thus, it is essential to include localization in the EnKF for InSAR data assimilation. © 2017, National Ground Water Association.
Benchmarking the Algorithms to Detect Seasonal Signals Under Different Noise Conditions
Klos, A.; Bogusz, J.; Bos, M. S.
2017-12-01
Global Positioning System (GPS) position time series contain seasonal signals. Among the others, annual and semi-annual are the most powerful. Widely, these oscillations are modelled as curves with constant amplitudes, using the Weighted Least-Squares (WLS) algorithm. However, in reality, the seasonal signatures vary over time, as their geophysical causes are not constant. Different algorithms have been already used to cover this time-variability, as Wavelet Decomposition (WD), Singular Spectrum Analysis (SSA), Chebyshev Polynomial (CP) or Kalman Filter (KF). In this research, we employed 376 globally distributed GPS stations which time series contributed to the newest International Terrestrial Reference Frame (ITRF2014). We show that for c.a. 20% of stations the amplitudes of seasonal signal varies over time of more than 1.0 mm. Then, we compare the WD, SSA, CP and KF algorithms for a set of synthetic time series to quantify them under different noise conditions. We show that when variations of seasonal signals are ignored, the power-law character is biased towards flicker noise. The most reliable estimates of the variations were found to be given by SSA and KF. These methods also perform the best for other noise levels while WD, and to a lesser extend also CP, have trouble in separating the seasonal signal from the noise which leads to an underestimation in the spectral index of power-law noise of around 0.1. For real ITRF2014 GPS data we discovered, that SSA and KF are capable to model 49-84% and 77-90% of the variance of the true varying seasonal signals, respectively.
Efficient Data Assimilation Tool For Real Time CO2 Reservoir Monitoring and Characterization
Li, J. Y.; Ambikasaran, S.; Kokkinaki, A.; Darve, E. F.; Kitanidis, P. K.
2014-12-01
Reservoir forecasting and management are increasingly relying on a data-driven approach, which involves data assimilation to calibrate and keep up to date the complex model of multi-phase flow and transport in the geologic formation and to evaluate its uncertainty using monitoring data of different types and temporal resolution. The numbers of unknowns and measurements are usually very large, which represents a major computational challenge. Kalman filter (KF), the archetypical recursive filter, provides the framework to assimilate reservoir monitoring data into a dynamic system but the cost of implementing the original algorithm to large systems is computationally prohibitive. In our work, we have developed several Kalman-filter based approaches that reduce the computational and storage cost of standard KF from O (m2) to O (m), where m is the number of unknowns, and have the potential to be applied to field-scale problems. HiKF, a linear filter based on the hierarchical matrix approach, takes advantage of the informative high-frequency data acquired quasi-continuously and uses a random-walk model in the state forecast step when the a state evolution model is unavailable. A more general-purpose nonlinear filter CSKF achieves computational efficiency by exploiting the fact that the state covariance matrix for most dynamical systems can be approximated adequately through a low-rank matrix, and it allows using a forward simulator as a black-box for nonlinear error propagation. We will demonstrate both methods using synthetic CO2 injection cases and compare with the standard ensemble Kalman filter (EnKF).
Digital Repository Service at National Institute of Oceanography (India)
Dovgal, I.; Chatterjee, T.; Ingole, B.S.
Subclass Exogenia Collin Order Metacinetida Jankowski Family Paracinetidae Jankowski Limnoricus ceter Jankowski, 1981 (Fig. 1–3) Diagnosis: Marine commensal, loricate, suctorian ciliate with stalk delimited from posterior margin of lorica. Both lorica...–11) =Thecacineta halacari Schulz, 1933 DOVGAL ET AL.62 · Zootaxa 1810 © 2008 Magnolia Press =Lissacineta allgeni Jankowski, 1981, syn. n. =Thecacineta allgeni (Jankowski, 1981), syn. n. Diagnosis: Marine suctorians with stylotheca. Cell body, slightly...
Schulz AP; Lange V; Gille J; Voigt C; Fröhlich S; Stuhr M; Jürgens C
2013-01-01
Arndt P Schulz,1 Vivien Lange,2 Justus Gille,1 Christine Voigt,3 Susanne Fröhlich,4 Markus Stuhr,1 Christian Jürgens5 1Department of Orthopedics, Trauma, and Sports Medicine, University Hospital Lübeck, Lübeck, Germany; 2Department of Rehabilitation, Sana Regio Klinikum, Wedel, Germany; 3Department of Sports Medicine and Arthroscopy, Diakoniekrankenhaus Friederikenstift, Hannover, Germany; 4Department of Orthopedics, University of Rostock, Rostock, Germany;...
Genius loci jako estetický problém
Křížová, Lucie
2016-01-01
(in English): Diploma thesis Genius loci as an aesthetic problem is addressed by defining the concept of genius loci and exploring its aesthetic implications and parallels. After clarification of the ontological nature of this phenomenon its commonalities will be monitored with selected concepts of environmental philosophy and aesthetics, especially the aesthetic dimension of the environmental experience. Publications of Christian Norberg-Schulz and David E. Cooper are used as a starting mate...
Beginning of the End: The Leadership of SS Obersturmbannfuehrer Jochen Peiper
2004-06-17
of Rudolf Lehmann and Ralf Tiemann on the Leibstandarte are based on the Bundesarchiven (National Archives) in Koblenz and Freiburg in Germany...Hans Schmidt, Paul Hausser, Richard Schulze-Kossens, Rudolf Lehmann, and Ralf Tiemann. Some German sources are at odds with American sources, but that...or a constitution. Among the men who set up the first military training for the Waffen-SS were Felix Steiner and Cassius Freiherr (Baron) von
Rediscovering the Schulze-Hardy rule in competitive adsorption to an air-water interface.
Stenger, Patrick C; Isbell, Stephen G; St Hillaire, Debra; Zasadzinski, Joseph A
2009-09-01
The ratio of divalent to monovalent ion concentration necessary to displace the surface-active protein, albumin, by lung surfactant monolayers and multilayers at an air-water interface scales as 2(-6), the same concentration dependence as the critical flocculation concentration (CFC) for colloids with a high surface potential. Confirming this analogy between competitive adsorption and colloid stability, polymer-induced depletion attraction and electrostatic potentials are additive in their effects; the range of the depletion attraction, twice the polymer radius of gyration, must be greater than the Debye length to have an effect on adsorption.
Understanding youth motivation for water onion (Crinum thaianum J. Schulze conservation in Thailand
Directory of Open Access Journals (Sweden)
Nuttasun Athihirunwong
2018-01-01
Full Text Available Water Onion is an aquatic plant endemic to the coastal plains of southern Thailand. The species is listed as endangered on the IUCN Red List. Despite rapidly declining stocks, the species is not protected under any Thai legislation nor under the Convention on International Trade in Endangered Species of Wild Fauna and Flora (CITES. At the local level, Water Onion is protected and conserved by young people and adults for various socio-economic reasons. The study explored the participation and underlying conservation motivations of 312 youths in Kapoe district, Ranong province. Using principal component analysis, the youth's motivation for Water Onion conservation was classified into four categories: pro-social, pro-nature, social image, and extrinsic. The results from a logit regression indicated that pro-nature is one of the key motivational factors enhancing actual youth participation in the protection and conservation of Water Onion. It is important for policy makers to understand the effects of various types of motivation on different policy mechanisms in order to craft more effective policies that can further enhance youth participation in conservation initiatives. Keywords: biodiversity conservation, endemic species, pro-nature motivation, water onion, youth
Respek vir die liturgiese teks: J. Calvyn en J.S. Bach | Schulze | Acta ...
African Journals Online (AJOL)
Despite obvious differences in terms of historical and theological aspects between Calvin and Bach, both share a respect for the priority of the Biblical text in worship.The anomaly between Calvin's engagement in the versification of the Psalter and Bach's preference for the literal (rather than a versified) use of the Biblical ...
Nuclear fuel cycle requirements in WOCA
International Nuclear Information System (INIS)
Klumpp, P.
1982-02-01
OECD/NEA will publsih an updated version of its study 'Nuclear Fuel Cycle Requirements and Supply Considerations, Through the Long-Term.' The Nuclear Research Centre Karlsruhe (KfK) was involved in the work necessary to provide this book. Although KfK had only responsiblility for part of the required computations it performed all the calculations for its own documentation interests. This documentation was felt to be a helpful background material for the reader of the second 'Yellow Book'. In this sense the original strategy computer outprints are published now without any discussion of assumptions and results. (orig.) [de
International Nuclear Information System (INIS)
Kopylova, V.D.; Bojko, Eh.T.; Saldadze, K.M.
1985-01-01
By the method of potentiometric titration acid-base properties of uranyl (2) complexes with three-dimensional polyphosphoric acids, KRF-8p, KF-1, KF-7 prepared by phosphorylation of copolymer of styrene and divinylbenzene or saponification of the copolymers of di-2,2'-chloroethyl ester of vinylphosphonic acid with divinyl benzene are studied. It is shown that in case of formation in the phase of three-dimensional polyphosphoric acids of UO 2 2+ complexes with the growth of bond covalence of metal ion-phosphonic group the acidjty of the second hydroxyl of the phosphonic group increases
Inertia-confining thermonuclear molten salt reactors
International Nuclear Information System (INIS)
Furukawa, Kazuo; Yamanaka, Chiyoe; Nakai, Sadao; Imon, Shunji; Nakajima, Hidenori; Nakamura, Norio; Kato, Yoshio.
1984-01-01
Purpose: To increase the heat generating efficiency while improving the reactor safety and thereby maintaining the energy balance throughout the reactor. Constitution: In an inertia-confining type D-T thermonuclear reactor, the blanket is made of lithium-containing fluoride molten salts (LiF.BeF 2 , LiF.NaF.KF, LiF.KF, etc) which are cascaded downwardly in a large thickness (50 - 100 cm) along the inner wall of the thermonuclear reaction vessel, and neutrons generated by explosive compression are absorbed to lithium in the molten salts to produce tritium, Heat transportation is carried out by the molten salts. (Ikeda, J.)
Scalable and balanced dynamic hybrid data assimilation
Kauranne, Tuomo; Amour, Idrissa; Gunia, Martin; Kallio, Kari; Lepistö, Ahti; Koponen, Sampsa
2017-04-01
Scalability of complex weather forecasting suites is dependent on the technical tools available for implementing highly parallel computational kernels, but to an equally large extent also on the dependence patterns between various components of the suite, such as observation processing, data assimilation and the forecast model. Scalability is a particular challenge for 4D variational assimilation methods that necessarily couple the forecast model into the assimilation process and subject this combination to an inherently serial quasi-Newton minimization process. Ensemble based assimilation methods are naturally more parallel, but large models force ensemble sizes to be small and that results in poor assimilation accuracy, somewhat akin to shooting with a shotgun in a million-dimensional space. The Variational Ensemble Kalman Filter (VEnKF) is an ensemble method that can attain the accuracy of 4D variational data assimilation with a small ensemble size. It achieves this by processing a Gaussian approximation of the current error covariance distribution, instead of a set of ensemble members, analogously to the Extended Kalman Filter EKF. Ensemble members are re-sampled every time a new set of observations is processed from a new approximation of that Gaussian distribution which makes VEnKF a dynamic assimilation method. After this a smoothing step is applied that turns VEnKF into a dynamic Variational Ensemble Kalman Smoother VEnKS. In this smoothing step, the same process is iterated with frequent re-sampling of the ensemble but now using past iterations as surrogate observations until the end result is a smooth and balanced model trajectory. In principle, VEnKF could suffer from similar scalability issues as 4D-Var. However, this can be avoided by isolating the forecast model completely from the minimization process by implementing the latter as a wrapper code whose only link to the model is calling for many parallel and totally independent model runs, all of them
Pagan and bible beginning in the creative work of B.Shulz and F.Kafka
Directory of Open Access Journals (Sweden)
Ekaterina M. Reguretskaya
2016-09-01
Full Text Available Modern literature pays great attention to the study of biblical and pagan aspects of the classical works of the twentieth century. Franz Kafka and Bruno Schulz – two classics of modernity, residents of “Republic of dreams”, if to use a beautiful metaphor of Schultz, were from Jewish families lived in a multicultural and multilingual Austro-Hungarian Empire absorbed with best achievements of the Austrian culture. As noted by J. Updike: «Kafka and Schulz – two unremarkable man, born in the backyard of once powerful empire, took a bite at the same apple myth, but from different sides». Both were able to transform the insightful observation in prophecy, describing the dreams and nightmares as precisely as if they were facts of life, both shed light on human nature and witnessed history, complementing each other. I. Klekh rightly observes certain «commonness» of their creative method, stressing the importance for the two writers’ motif of transformation, transformation, mutual penetration of books and worlds. Shulz’s «fairy tale», his myth-making, guided by its own laws, “mythological” rules, which, unlike Kafka, is not «mythological» of closeness exclusively on internal self-perception.
Directory of Open Access Journals (Sweden)
N. Sunderland
2015-07-01
Full Text Available This paper reports on the outcomes of an exploratory narrative study on the impact of participatory music making on social determinants of health (SDOH and wellbeing for refugees in Brisbane, Australia. A key component of this exploratory research was to map health and wellbeing outcomes of music participation using an existing SDOH framework developed by researchers in the field of health promotion (Schulz & Northridge, 2004. This paper maps reported health and wellbeing outcomes for five refugee and asylum seeker members of a participatory Brisbane-based music initiative, the Scattered People, along an SDOH continuum ranging from individual level through to macro level fundamental determinants of health.While most themes emerging from this study corresponded to distinct categories in the Schulz and Northridge SDOH framework, three key aspects, which were critical to the achievement of wellbeing for participants, did not fit any of the pre-defined categories. These were: cultural expression, music making, and consolidation of personal and social identity. The importance of those themes to participants suggests that music and wellbeing studies involving culturally diverse groups and from a SDOH perspective may need to consider broader, more relevant concepts. The paper provides recommendations for future interdisciplinary research in this field.
The Analysis of Cyanide and Its Breakdown Products in Biological Samples
2010-01-01
Biological sampleb Speciesc CN Minutes-hours Some in a few species Low Blood, urine, saliva, tissue, expired air, rumen Human, fish, cow, mouse, rat...higher content in the left ventricle of fire victims. Journal of Chromatography 490 (1989):319–327. 96. R. H. Cardozo and I. S. Edelman, The volume of...Hagedorn, and R. Schulz, Development of a method for determination of cyanide concentrations in serum and rumen fluid of cattle. American Journal of
Quantifying Entrepreneurial Networks: Data Collection in Addis Ababa, Ethiopia
2013-06-10
to meet with the country manager for Schulze Global Investments (SGI), an emerging markets private equity firm. I had been introduced to Ms...member of the mirt team who has developed an interest in photography into a thriving business focusing on assisting firms with marketing and...bring in revenue. The branding business has now taken off and he has four employees and his clients include Pepsi . I also had the opportunity to eat
The History of the North Pacific Division U.S. Army Corps of Engineers 1888 to 1965
1969-01-01
jetties at the entrance to Humboldt Bay, California. On March 2, 1907, he was retired from active service by virtue of his having reached the statutory...school commandant and post commander Schulz ,gave personal attention to the uncovering of the foundation ruins of the historic Belvoir Mansion , which...the Belvoir Mansion was the home of Colonel William Fairfax, who was the original owner of the Belvoir estate. He was a friend of George Washington
Macrae, J C; Smith, J S; Dewey, P J; Brewer, A C; Brown, D S; Walker, A
1985-07-01
Three experiments were conducted with sheep given spring-harvested dried grass (SHG) and autumn-harvested dried grass (AHG). The first was a calorimetric trial to determine the metabolizable energy (ME) content of each grass and the efficiency with which sheep utilize their extra ME intakes above the maintenance level of intake. The second examined the relative amounts of extra non-ammonia-nitrogen (NAN) and individual amino acids absorbed from the small intestine per unit extra ME intake as the level of feeding was raised from energy equilibrium (M) to approximately 1.5 M. The third was a further calorimetric trial to investigate the effect of an abomasal infusion of 30 g casein/d on the efficiency of utilization of AHG. The ME content of the SHG (11.8 MJ/kg dry matter (DM] was higher than that of AHG (10.0 MJ/kg DM). The efficiency of utilization of ME for productive purposes (i.e. above the M level of intake; kf) was higher when given SHG (kf 0.54 between M and 2 M) than when given AHG (kf 0.43 between M and 2 M). As the level of intake of each grass was raised from M to 1.5 M there was a greater increment in the amounts of NAN (P less than 0.001) and the total amino acid (P less than 0.05) absorbed from the small intestines when sheep were given the SHG (NAN absorption, SHG 5.4 g/d, AHG 1.5 g/d, SED 0.54; total amino acid absorption SHG 31.5 g/d, AHG 14.3 g/d, SED 5.24). Infusion of 30 g casein/d per abomasum of sheep given AHG at M and 1.5 M levels of intake increased (P less than 0.05) the efficiency of utilization of the herbage from kf 0.45 to kf 0.57. Consideration is given to the possibility that the higher efficiency of utilization of ME in sheep given SHG may be related to the amounts of extra glucogenic amino acids absorbed from the small intestine which provide extra reducing equivalents (NADPH) and glycerol phosphate necessary for the conversion of acetate into fatty acids.
Directory of Open Access Journals (Sweden)
Francirosy Campos Barbosa Ferreira
2009-11-01
Full Text Available Este texto busca apresentar uma experiência etnográfica realizada em duas comunidades islâmicas em São Paulo e São Bernardo do Campo, Brasil, no âmbito do meu doutorado. Esta pesquisa estabelece um diálogo profícuo com a antropologia da performance e da experiência (ritual proposta por Victor Turner, Richard Schechner e Ronald Grimes, sendo permeada também pela teoria do “ser afetado” de Favret-Saada. Busco desenvolver, portanto, uma metodologia que abarque tanto a antropologia da performance quanto a antropologia da religião. Para isso, procurei (a argumentar a respeito da pesquisadora-performer, sendo esta mulher, mãe e antropóloga, e sobre o modo como esses elementos contribuem para uma etnografia performativa; (b apresentar o percurso etnográfico; (c destacar a experiência em um acampamento islâmico.This essay presents an ethnographic experience which took place in two Muslim communities, in São Paulo and São Bernardo do Campo, Brazil, as part of my doctoral field work. This research not only establishes an interesting dialogue between the anthropology of performance of Richard Schechner and Ronald Grimes and the anthropology of experience of Victor Turner, but also evokes Favret-Saada’s theory of affectivity. In this way, an attempt is made to develop a methodology capable of dealing with questions of both the anthropology of performance and the anthropology of religion. The objective are threefold: a to discuss the place of the researcher as a performer (as a woman, mother and anthropologist, within the framework of a performing ethnography; b to present the course which this ethnography made possible; and c to highlight the experience which took place in an Islamic camp.
KfA Institute of Nuclear Physics. Annual report 1987
International Nuclear Information System (INIS)
Gruemmer, F.; Kilian, K.; Schult, O.; Seyfarth, H.; Speth, J.; Turek, P.
1988-04-01
This annual report contains extended abstracts about the work performed at the named institute together with a list of publications and speeches. The work concerns nuclear reactions, nuclear spectroscopy, intermediate-energy physics, nuclear structure, developments of the isochronous cyclotron and the ISIS ion source, construction of spectrometers, detectors, and targets, computer development, counting electronics, and radiation protection. (HSI)
Directory of Open Access Journals (Sweden)
Olga Y. Yurkevich
2017-08-01
Full Text Available Flax, Linum usitatissimum L., is a valuable multi-purpose plant, and currently, its genome is being extensively investigated. Nevertheless, mapping of genes in flax genome is still remaining a challenging task. The cellulose synthase (CesA multigene family involving in the process of cellulose synthesis is especially important for metabolism of this fiber crop. For the first time, fluorescent in situ hybridization (FISH-based chromosomal localization of the CesA conserved fragment (KF011584.1, 5S, and 26S rRNA genes was performed in landrace, oilseed, and fiber varieties of L. usitatissimum. Intraspecific polymorphism in chromosomal distribution of KF011584.1 and 5S DNA loci was revealed, and the generalized chromosome ideogram was constructed. Using BLAST analysis, available data on physical/genetic mapping and also whole-genome sequencing of flax, localization of KF011584.1, 45S, and 5S rRNA sequences on genomic scaffolds, and their anchoring to the genetic map were conducted. The alignment of the results of FISH and BLAST analyses indicated that KF011584.1 fragment revealed on chromosome 3 could be anchored to linkage group (LG 11. The common LG for 45S and 5S rDNA was not found probably due to the polymorphic localization of 5S rDNA on chromosome 1. Our findings indicate the complexity of integration of physical, genetic, and cytogenetic mapping data for multicopy gene families in plants. Nevertheless, the obtained results can be useful for future progress in constructing of integrated physical/genetic/cytological maps in L. usitatissimum which are essential for flax breeding.
Ensemble Kalman Filter Inference of Spatially-varying Manning’s n coefficients in the Coastal Ocean
Siripatana, Adil
2018-05-16
Ensemble Kalman (EnKF) filtering is an established framework for large scale state estimation problems. EnKFs can also be used for state-parameter estimation, using the so-called “Joint-EnKF” approach. The idea is simply to augment the state vector with the parameters to be estimated and assign invariant dynamics for the time evolution of the parameters. In this contribution, we investigate the efficiency of the Joint-EnKF for estimating spatially-varying Manning’s n coefficients used to define the bottom roughness in the Shallow Water Equations (SWEs) of a coastal ocean model.Observation System Simulation Experiments (OSSEs) are conducted using the ADvanced CIRCulation (ADCIRC) model, which solves a modified form of the Shallow Water Equations. A deterministic EnKF, the Singular Evolutive Interpolated Kalman (SEIK) filter, is used to estimate a vector of Manning’s n coefficients defined at the model nodal points by assimilating synthetic water elevation data. It is found that with reasonable ensemble size (O(10)), the filter’s estimate converges to the reference Manning’s field. To enhance performance, we have further reduced the dimension of the parameter search space through a Karhunen-Loéve (KL) expansion. We have also iterated on the filter update step to better account for the nonlinearity of the parameter estimation problem. We study the sensitivity of the system to the ensemble size, localization scale, dimension of retained KL modes, and number of iterations. The performance of the proposed framework in term of estimation accuracy suggests that a well-tuned Joint-EnKF provides a promising robust approach to infer spatially varying seabed roughness parameters in the context of coastal ocean modeling.
New eco-friendly animal bone meal catalysts for preparation of chalcones and aza-Michael adducts
Directory of Open Access Journals (Sweden)
Riadi Yassine
2012-06-01
Full Text Available Abstract Two efficient reactions were successfully carried out using Animal Bone Meal (ABM and potassium fluoride or sodium nitrate doped ABMs as new heterogeneous catalysts under very mild conditions. After preparation and characterization of the catalysts, we first report their use in a simple and convenient synthesis of various chalcones by Claisen–Schmidt condensation and then in an aza-Michael addition involving several synthesized chalcones with aromatic amines. All the reactions were carried out at room temperature in methanol; the chalcone synthesis was also achieved in water environment under microwave irradiation. Doping ABM enhances the rate and yield at each reaction. Catalytic activities are discussed and the ability to re-use the ABM is demonstrated. Results For Claisen–Schmidt the use of ABM alone, yields never exceeded 17%. In each entry, KF/ABM and NaNO3/ABM (79-97% gave higher yields than using ABM alone under thermic condition. Also the reaction proceeded under microwave irradiation in good yields (72-94% for KF/ABM and 81-97% for NaNO3/ABM and high purity. For aza-Michael addition the use of ABM doped with KF or NaNO3 increased the catalytic activity remarkably. The very high yields could be noted (84-95% for KF/ABM and 81-94% for NaNO3/ABM. Conclusion The present method is an efficient and selective procedure for the synthesis of chalcones an aza-Michael adducts. The ABM and doped ABMs are a new, inexpensive and attractive solid supports which can contribute to the development of catalytic processes and reduced environmental problems.
Dynamics relationship between stock prices and economic variables in Malaysia
Chun, Ooi Po; Arsad, Zainudin; Huen, Tan Bee
2014-07-01
Knowledge on linkages between stock prices and macroeconomic variables are essential in the formulation of effective monetary policy. This study investigates the relationship between stock prices in Malaysia (KLCI) with four selected macroeconomic variables, namely industrial production index (IPI), quasi money supply (MS2), real exchange rate (REXR) and 3-month Treasury bill (TRB). The variables used in this study are monthly data from 1996 to 2012. Vector error correction (VEC) model and Kalman filter (KF) technique are utilized to assess the impact of macroeconomic variables on the stock prices. The results from the cointegration test revealed that the stock prices and macroeconomic variables are cointegrated. Different from the constant estimate from the static VEC model, the KF estimates noticeably exhibit time-varying attributes over the entire sample period. The varying estimates of the impact coefficients should be better reflect the changing economic environment. Surprisingly, IPI is negatively related to the KLCI with the estimates of the impact slowly increase and become positive in recent years. TRB is found to be generally negatively related to the KLCI with the impact fluctuating along the constant estimate of the VEC model. The KF estimates for REXR and MS2 show a mixture of positive and negative impact on the KLCI. The coefficients of error correction term (ECT) are negative in majority of the sample period, signifying the stock prices responded to stabilize any short term deviation in the economic system. The findings from the KF model indicate that any implication that is based on the usual static model may lead to authorities implementing less appropriate policies.
Comparison of Knee and Ankle Dynamometry between NASA's X1 Exoskeleton and Biodex System 4
English, K. L.; Newby, N. J.; Hackney, K. J.; DeWitt, J. K.; Beck, C. E.; Rovekamp, R. N.; Rea, R. L.; Ploutz-Snyder, L. L.
2014-01-01
Pre- and post-flight dynamometry is performed on International Space Station crewmembers to characterize microgravity-induced strength changes. Strength is not assessed in flight due to hardware limitations and there is poor understanding of the time course of in-flight changes. PURPOSE: To assess the reliability of a prototype dynamometer, the X1 Exoskeleton (EXO) and its agreement with a Biodex System 4 (BIO). METHODS: Eight subjects (4 M/4 F) completed 2 counterbalanced testing sessions of knee extension/flexion (KE/KF), 1 with BIO and 1 with EXO, with repeated measures within each session in normal gravity. Test-retest reliability (test 1 and 2) and device agreement (BIO vs. EXO) were evaluated. Later, to assess device agreement for ankle plantarflexion (PF), 10 subjects (4 M/6 F) completed 3 test conditions (BIO, EXO, and BIOEXO); BIOEXO was a hybrid condition comprised of the Biodex dynamometer motor and the X1 footplate and ankle frame. Ankle comparisons were: BIO vs. BIOEXO (footplate differences), BIOEXO vs. EXO (motor differences), and BIO vs. EXO (all differences). Reliability for KE/KF was determined by intraclass correlation (ICC). Device agreement was assessed with: 1) repeated measures ANOVA, 2) a measure of concordance (rho), and 3) average difference. RESULTS: ICCs for KE/KF were 0.99 for BIO and 0.96 to 0.99 for EXO. Agreement was high for KE (concordance: 0.86 to 0.95; average differences: -7 to +9 Nm) and low to moderate for KF (concordance: 0.64 to 0.78; average differences: -4 to -29 Nm, Pexoskeleton to perform portable dynamometry for large muscle groups of the lower body.
Postoperative pain after manual and mechanical glide path: a randomized clinical trial.
Pasqualini, Damiano; Mollo, Livio; Scotti, Nicola; Cantatore, Giuseppe; Castellucci, Arnaldo; Migliaretti, Giuseppe; Berutti, Elio
2012-01-01
This prospective randomized clinical trial evaluated the incidence of postoperative pain after glide path performed with PathFile (PF) (Dentsply Maillefer, Ballaigues, Switzerland) versus stainless-steel K-file (KF). In 149 subjects, the mechanical glide path was performed with nickel-titanium (NiTi) rotary PF; in 146 subjects, the manual glide path was performed with stainless-steel KFs. Postoperative pain, analgesics consumption, and the number of days to complete pain resolution were evaluated in the following 7 days. An analysis of variance model for repeated measures was used to compare the variation of pain-scale values (P < .05). The Student's t test for continuous variables normally distributed, the nonparametric Mann-Whitney U test for the nonnormally distributed variables, and the chi-square test for dichotomous variables were used (P < .05). Despite homogeneous baseline conditions at diagnosis, tooth type, pain prevalence, and scores, the postoperative pain prevalence curves in PF group evidenced a more favorable trend in terms of time to pain resolution compared with the KF group (P = .004). The difference was also evident in the model adjusted for analgesics consumption in both groups (P = .012). The mean analgesics intake per subject was significantly higher in the KF group (3.7 ± 2.2) compared with the PF group (2 ± 1.7) (P < .001). Mean pain stop values were also significantly higher in the KF group (2.7) compared with the PF group (1.7) (P = .001). The glide path with NiTi Rotary PF leads to less postoperative pain and faster symptom resolution. Copyright © 2012 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Albrecht, H.; Malinauskas, A.P.
1978-01-01
A few years ago the Projekt Nukleare Sicherheit joined the United States Nuclear Regulatory Commission in the development of a research program which was designed to investigate fission product release from light water reactor fuel under conditions ranging from spent fuel shipping cask accidents to core meltdown accidents. Three laboratories have been involved in this cooperative effort. At Argonne National Laboratory (ANL), the research effort has focused on noble gas fission product release, whereas at Oak Ridge National Laboratory (ORNL) and at Kernforschungszentrum Karlsruhe (KfK), the studies have emphasized the release of species other than the noble gases. In addition, the ORNL program has been directed toward the development of fission product source terms applicable to analyses of spent fuel shipping cask accidents and controlled loss-of-coolant accidents, and the KfK program has been aimed at providing similar source terms which are characteristic of core meltdown accidents. The ORNL results are presented for fission product release from defected fuel rods into a steam atmosphere over the temperature range 500 to 1200 0 C, and the KfK results for release during core meltdown sequences
Adaptive probabilistic collocation based Kalman filter for unsaturated flow problem
Man, J.; Li, W.; Zeng, L.; Wu, L.
2015-12-01
The ensemble Kalman filter (EnKF) has gained popularity in hydrological data assimilation problems. As a Monte Carlo based method, a relatively large ensemble size is usually required to guarantee the accuracy. As an alternative approach, the probabilistic collocation based Kalman filter (PCKF) employs the Polynomial Chaos to approximate the original system. In this way, the sampling error can be reduced. However, PCKF suffers from the so called "cure of dimensionality". When the system nonlinearity is strong and number of parameters is large, PCKF is even more computationally expensive than EnKF. Motivated by recent developments in uncertainty quantification, we propose a restart adaptive probabilistic collocation based Kalman filter (RAPCKF) for data assimilation in unsaturated flow problem. During the implementation of RAPCKF, the important parameters are identified and active PCE basis functions are adaptively selected. The "restart" technology is used to alleviate the inconsistency between model parameters and states. The performance of RAPCKF is tested by unsaturated flow numerical cases. It is shown that RAPCKF is more efficient than EnKF with the same computational cost. Compared with the traditional PCKF, the RAPCKF is more applicable in strongly nonlinear and high dimensional problems.
Larsson, William; Jalbert, Jocelyn; Gilbert, Roland; Cedergren, Anders
2003-03-15
The efficiency of azeotropic distillation and oven evaporation techniques for trace determination of water in oils has recently been questioned by the National Institute of Standards and Technology (NIST), on the basis of measurements of the residual water found after the extraction step. The results were obtained by volumetric Karl Fischer (KF) titration in a medium containing a large excess of chloroform (> or = 65%), a proposed prerequisite to ensure complete release of water from the oil matrix. In this work, the extent of this residual water was studied by means of a direct zero-current potentiometric technique using a KF medium containing more than 80% chloroform, which is well above the concentration recommended by NIST. A procedure is described that makes it possible to correct the results for dilution errors as well as for chemical interference effects caused by the oil matrix. The corrected values were found to be in the range of 0.6-1.5 ppm, which should be compared with the 12-34 ppm (uncorrected values) reported by NIST for the same oils. From this, it is concluded that the volumetric KF method used by NIST gives results that are much too high.
Common barrel and forward CA tracking algorithm
Energy Technology Data Exchange (ETDEWEB)
Mykhailo, Pugach [Goethe-Universitaet, Frankfurt (Germany); Frankfurt Institute for Advanced Studies, Frankfurt (Germany); KINR, Kyiv (Ukraine); Gorbunov, Sergey; Kisel, Ivan [Goethe-Universitaet, Frankfurt (Germany); Frankfurt Institute for Advanced Studies, Frankfurt (Germany); Collaboration: PANDA-Collaboration
2016-07-01
There are complex detector setups which consist of barrel (cylindrical) and forward parts, and such systems require a special approach in the registered charged particles track finding procedure. Currently the tracking procedure might be performed in both parts of such detector independently from each other, but the final goal on this direction is a creation of a combined tracking, which will work in both parts of the detector simultaneously. The basic algorithm is based on Kalman Filter (KF) and Cellular Automata (CA). And the tracking procedure in such a complex system is rather extraordinary as far as it requires 2 different models to describe the state vector of segments of the reconstructed track in the mathematical apparatus of the KF-algorithm. To overcome this specifics a mathematical apparatus of transition matrices must be developed and implemented, so that one can transfer from one track model to another. Afterwards the work of the CA is performed, which reduces to segments sorting, their union into track-candidates and selection of the best candidates by the chi-square criteria after fitting of the track-candidate by the KF. In this report the algorithm, status and perspectives of such combined tracking are described.
Ensemble Kalman filtering with residual nudging
Directory of Open Access Journals (Sweden)
Xiaodong Luo
2012-10-01
Full Text Available Covariance inflation and localisation are two important techniques that are used to improve the performance of the ensemble Kalman filter (EnKF by (in effect adjusting the sample covariances of the estimates in the state space. In this work, an additional auxiliary technique, called residual nudging, is proposed to monitor and, if necessary, adjust the residual norms of state estimates in the observation space. In an EnKF with residual nudging, if the residual norm of an analysis is larger than a pre-specified value, then the analysis is replaced by a new one whose residual norm is no larger than a pre-specified value. Otherwise, the analysis is considered as a reasonable estimate and no change is made. A rule for choosing the pre-specified value is suggested. Based on this rule, the corresponding new state estimates are explicitly derived in case of linear observations. Numerical experiments in the 40-dimensional Lorenz 96 model show that introducing residual nudging to an EnKF may improve its accuracy and/or enhance its stability against filter divergence, especially in the small ensemble scenario.
Keppenne, Christian L.
2013-01-01
A two-step ensemble recentering Kalman filter (ERKF) analysis scheme is introduced. The algorithm consists of a recentering step followed by an ensemble Kalman filter (EnKF) analysis step. The recentering step is formulated such as to adjust the prior distribution of an ensemble of model states so that the deviations of individual samples from the sample mean are unchanged but the original sample mean is shifted to the prior position of the most likely particle, where the likelihood of each particle is measured in terms of closeness to a chosen subset of the observations. The computational cost of the ERKF is essentially the same as that of a same size EnKF. The ERKF is applied to the assimilation of Argo temperature profiles into the OGCM component of an ensemble of NASA GEOS-5 coupled models. Unassimilated Argo salt data are used for validation. A surprisingly small number (16) of model trajectories is sufficient to significantly improve model estimates of salinity over estimates from an ensemble run without assimilation. The two-step algorithm also performs better than the EnKF although its performance is degraded in poorly observed regions.
Keppenne, Christian L.; Rienecker, Michele; Borovikov, Anna Y.; Suarez, Max
1999-01-01
A massively parallel ensemble Kalman filter (EnKF)is used to assimilate temperature data from the TOGA/TAO array and altimetry from TOPEX/POSEIDON into a Pacific basin version of the NASA Seasonal to Interannual Prediction Project (NSIPP)ls quasi-isopycnal ocean general circulation model. The EnKF is an approximate Kalman filter in which the error-covariance propagation step is modeled by the integration of multiple instances of a numerical model. An estimate of the true error covariances is then inferred from the distribution of the ensemble of model state vectors. This inplementation of the filter takes advantage of the inherent parallelism in the EnKF algorithm by running all the model instances concurrently. The Kalman filter update step also occurs in parallel by having each processor process the observations that occur in the region of physical space for which it is responsible. The massively parallel data assimilation system is validated by withholding some of the data and then quantifying the extent to which the withheld information can be inferred from the assimilation of the remaining data. The distributions of the forecast and analysis error covariances predicted by the ENKF are also examined.
White, Leon; Koo, Youngmi; Neralla, Sudheer; Sankar, Jagannathan; Yun, Yeoheung
2016-06-01
We report the enhanced mechanical properties of AZ31 magnesium alloys by plasma electrolytic oxidation (PEO) coating in NaOH, Na 2 SiO 3 , KF and NaH 2 PO 4 ·2H 2 O containing electrolytes. Mechanical properties including wear resistance, surface hardness and elastic modulus were increased for PEO-coated AZ31 Mg alloys (PEO-AZ31). DC polarization in Hank's solution indicating that the corrosion resistance significantly increased for PEO-coating in KF-contained electrolyte. Based on these results, the PEO coating method shows promising potential for use in biodegradable implant applications where tunable corrosion and mechanical properties are needed.
On the fusibility of potassium heptafluorotantalate
International Nuclear Information System (INIS)
Agulyanskij, A.I.; Bessonova, V.A.
1983-01-01
Phase transformations of potassium heptafluorotantalate near the liquidus temperature have been studied. Thermograms and polytherm of the electric condUctivity of potassium heptafluorotantalate, thermogram of the mechanical mixture 0.5 K 2 TaF 7 +0.5 KF and thermogram of K 3 TaF 8 crystallization are plotted. The phase diagram of the K 2 TaF 7 -KF system is presented. In the temperature range 746 to 778 deg, i.e. above K 2 TaF 7 melting point, the melt is shown to remain heterogeneous. A portion of the phase diagram rich in potassium heptafluorotantalate is qualified as an ordinary eutectics
Higher order sliding mode control of laser pointing for orbital debris mitigation
Palosz, Arthur
This thesis explores the use of a space-based laser to clean up small orbital debris from near Earth space. This system's challenge is to quickly and precisely aim the laser beam at very small (laser beam onto the orbital debris. A Kalman Filter (KF) is designed to accurately track the orbital debris and generate a command signal for the controller. A second order Super Twisting Sliding Mode Controller (2-SMC) is designed to follow the command signal generated by the KF and to overcome the parametric uncertainties and external disturbances. The performance of the system is validated with a computer simulation created in MATLAB and Simulink.
Energy Technology Data Exchange (ETDEWEB)
NONE
1970-07-01
Civilization depends largely on man's ability to change and control his natural environment - and thus on the energy at his disposal. Until the industrial revolution man depended mainly on his own hands and his domestic animals, but in the last two centuries the tempo of man-made environmental change has constantly quickened. For almost every new benefit of technology, some price has had to be paid in terms of environmental side effects. In the first century of the industrial revolution, smoke and grime poured from the chimneys of the new foundries, factories and gas works. Industrial progress has helped to clear the air of some of these pollutants, but has also brought new ones in their stead.
International Nuclear Information System (INIS)
1970-01-01
Civilization depends largely on man's ability to change and control his natural environment - and thus on the energy at his disposal. Until the industrial revolution man depended mainly on his own hands and his domestic animals, but in the last two centuries the tempo of man-made environmental change has constantly quickened. For almost every new benefit of technology, some price has had to be paid in terms of environmental side effects. In the first century of the industrial revolution, smoke and grime poured from the chimneys of the new foundries, factories and gas works. Industrial progress has helped to clear the air of some of these pollutants, but has also brought new ones in their stead.
[Life cycle strategies: a synthesis of empirical and theoretical approaches].
Romanovskiĭ, Iu E
1998-01-01
A scheme of relationships among life-history characters is developed on assumptions of determinate growth and dependence of juvenile mortality on the specific growth rate. It is shown that constraints on the relative neonate size, (W0/W infinity), and minimum value of the biotic potential, (rmax), lead to "triangular" shape of life history set on the plain defined by juvenile and adult mortality. This completely coincides with the Ramenskiĭ++--Grime (C-S-R) classification of life-history strategies. Phylogenetic constraints can reduce this set to a relatively narŕow r/K-continuum specifically oriented for a certain taxon. Similar restrictions generate models of life history optimization which predict interspecific allometries between life-history traits.
A critical review on the scaling theory of dispersion
Zech, Alraune; Mai, Juliane; Attinger, Sabine; Dietrich, Peter; Teutsch, Georg; Fiori, Aldo; Rubin, Yoram
2014-05-01
The phenomenon of dispersive mixing of solutes in aquifers is subject of research since decades. The characterization of dispersivity at a particular field site is a prerequisite to predict the movement and spreading of a contaminant plume. Experimental investigations have shown, that field-scale dispersivities vary over orders of magnitude, which apparently depends on the scale of measurement. Gelhar et al. [1992] and Schulze-Makuch [2005] have reviewed a large number of transport experiments reported in the literature. Based on that data Schulze-Makuch [2005] performed a trend analysis of longitudinal dispersivity, fostering the empirical relationship of a power law between dispersivities and the scale of measurement without an upper bound. The goal of our study is to critically revisit not only the data used for the trend analysis but the power-law scale dependence of longitudinal dispersivity (e.g. Neuman [1990], Xu and Eckstein [1995]). Our particular focus is on the reported dispersivities of large amount (larger than 100m) and large measurement scales (in the order of kilometers). We aim to evaluate current theories of transport against a critical "mass" of field experiments and to bracket the conditions of their applicability. We further aim to evaluate the adequacy of the field sampling techniques that were employed from the perspective of more than 30 years development in modeling and field characterization. Given the tremendous progress in field data acquisition techniques and new insights gained, it is reasonable to expect that interpretations of past experiments may be flawed due to the limitations or inadequacy of field sampling techniques. Gelhar, L.W., C. Welty, and K.R. Rehfeldt, 1992, A critical review of data on field-scale dispersion in aquifers, Water Resources Research 28, No. 7: 1955-1974. Schulze-Makuch, D., 2005, Longitudinal dispersivity data and implications for scaling behavior, Ground Water, Vol. 43, No. 3, 443-456. Neuman, S.P., 1990
Effects of tectonics and large scale climatic changes on the evolutionary history of Hyalomma ticks.
Sands, Arthur F; Apanaskevich, Dmitry A; Matthee, Sonja; Horak, Ivan G; Harrison, Alan; Karim, Shahid; Mohammad, Mohammad K; Mumcuoglu, Kosta Y; Rajakaruna, Rupika S; Santos-Silva, Maria M; Matthee, Conrad A
2017-09-01
Hyalomma Koch, 1844 are ixodid ticks that infest mammals, birds and reptiles, to which 27 recognized species occur across the Afrotropical, Palearctic and Oriental regions. Despite their medical and veterinary importance, the evolutionary history of the group is enigmatic. To investigate various taxonomic hypotheses based on morphology, and also some of the mechanisms involved in the diversification of the genus, we sequenced and analysed data derived from two mtDNA fragments, three nuclear DNA genes and 47 morphological characters. Bayesian and Parsimony analyses based on the combined data (2242 characters for 84 taxa) provided maximum resolution and strongly supported the monophyly of Hyalomma and the subgenus Euhyalomma Filippova, 1984 (including H. punt Hoogstraal, Kaiser and Pedersen, 1969). A predicted close evolutionary association was found between morphologically similar H. dromedarii Koch, 1844, H. somalicum Tonelli Rondelli, 1935, H. impeltatum Schulze and Schlottke, 1929 and H. punt, and together they form a sister lineage to H. asiaticum Schulze and Schlottke, 1929, H. schulzei Olenev, 1931 and H. scupense Schulze, 1919. Congruent with morphological suggestions, H. anatolicum Koch, 1844, H. excavatum Koch, 1844 and H. lusitanicum Koch, 1844 form a clade and so also H. glabrum Delpy, 1949, H. marginatum Koch, 1844, H. turanicum Pomerantzev, 1946 and H. rufipes Koch, 1844. Wide scale continental sampling revealed cryptic divergences within African H. truncatum Koch, 1844 and H. rufipes and suggested that the taxonomy of these lineages is in need of a revision. The most basal lineages in Hyalomma represent taxa currently confined to Eurasia and molecular clock estimates suggest that members of the genus started to diverge approximately 36.25 million years ago (Mya). The early diversification event coincides well with the collision of the Indian and Eurasian Plates, an event that was also characterized by large scale faunal turnover in the region. Using S
Publicity, news content, and cultural debate
DEFF Research Database (Denmark)
Nørgaard Kristensen, Nete; From, Unni
2015-01-01
Taking our point of departure in mediatization theory (Hjarvard, 2013; Lundby, 2009; Schulz, 2004), we analyse the interwoven communicative forms of the film industry and the printed press as they are expressed in the coverage of three blockbusters in Danish newspapers – Ben-Hur (1959/62); Batman...... stimulate socio-cultural debate, at the same time as the portrayal of blockbuster movie events and their directors and actors at-tracts media audiences, serving as entertainment, service as well as enlightenment....
Multi-Robot Systems in Military Domains (Les Systemes Multi-Robots Dans les Domaines Militaires)
2008-12-01
IST-032 Middleware G-6 Object Request Brokers (ORBs) G-8 DCOM G-10 CORBA G-11 Java RMI G-14 Java RMI-IIOP G-16 Jini G-16 Comparison... hibernating since 2003 but might be continued in the future. 2.4.3 USA The RTG would like to thank Alan C. Schulz from the NRL (the US...messages, threads, synchronisation, timer). • Language (C,C++, Java , ...) and programming model (OO, binary model-COM, CORBA, DCOM). At the higher
Tribological approach to study polishing of road surface under traffic
KANE, Malal; DO, Minh Tan
2007-01-01
The polishing phenomenon of road pavements under the vehicle traffic constitutes the main mechanism inherent to the loss of skid resistance over time. A better understanding of this phenomenon would allow an improvement of road safety. This study comprises a review of laboratory test and a model simulating the polishing of road surfaces. The laboratory test uses a polishing machine so called 'Wehner-Schulze' which can reproduce the evolution of the road texture from specimens taken directly f...
Dunkel, Anke; Schulz, Peter
2012-01-01
Public information campaigns have played an important role in increasing awareness of organ donation and the need for more organ donors. In a recent study, it was found that awareness and knowledge, regarding organ donation, represented only two of several factors in people’s decisions to engage in organ donation-related behaviors (Schulz et al., 2006). In addition, it was noted that the three main language groups in Switzerland differ substantially with respect to the influential factors ...
Research in the Optical Sciences
1990-03-12
Services Optics Program DTIC ELECTE .S FEB 2 419921 Robert R. Shannon, Director Optical Sciences Center University of Arizona Tucson, Arizona 85721...Kearney. A.R. Lampis. Z. Milanovic. D.W. Schulze, J.R. Roberts , J. Kerner. E.B. Saloman. and C.M. Falco. "Multilayer mirrors for 182 A." X-Ray/EUV...Boyd. M. 0. Raymer . P. Narum, and D. J. Harter. Phys. Rev. A 24. 411 (1981). 11. G. Khitrova. Ph.D. dissertation. New York University, 1986
Lifescience Database Archive (English)
Full Text Available 3.22 Translated Amino Acid sequence dkciffvpinrddaftlryqdntwdpveydvlidylgqnqdkwfsgglp*k********l yklhkgftig...kf*k*kikny Translated Amino Acid sequence (All Frames) Frame A: dkciffvpinrddaftl
Neal, J. C.; Wood, M.; Bermúdez, M.; Hostache, R.; Freer, J. E.; Bates, P. D.; Coxon, G.
2017-12-01
Remote sensing of flood inundation extent has long been a potential source of data for constraining and correcting simulations of floodplain inundation. Hydrodynamic models and the computing resources to run them have developed to the extent that simulation of flood inundation in two-dimensional space is now feasible over large river basins in near real-time. However, despite substantial evidence that there is useful information content within inundation extent data, even from low resolution SAR such as that gathered by Envisat ASAR in wide swath mode, making use of the information in a data assimilation system has proved difficult. He we review recent applications of the Ensemble Kalman Filter (EnKF) and Particle Filter for assimilating SAR data, with a focus on the River Severn UK and compare these with complementary research that has looked at the internal error sources and boundary condition errors using detailed terrestrial data that is not available in most locations. Previous applications of the EnKF to this reach have focused on upstream boundary conditions as the source of flow error, however this description of errors was too simplistic for the simulation of summer flood events where localised intense rainfall can be substantial. Therefore, we evaluate the introduction of uncertain lateral inflows to the ensemble. A further limitation of the existing EnKF based methods is the need to convert flood extent to water surface elevations by intersecting the shoreline location with a high quality digital elevation model (e.g. LiDAR). To simplify this data processing step, we evaluate a method to directly assimilate inundation extent as a EnKF model state rather than assimilating water heights, potentially allowing the scheme to be used where high-quality terrain data are sparse.
Shear wave splitting and crustal anisotropy in the Eastern Ladakh-Karakoram zone, northwest Himalaya
Paul, Arpita; Hazarika, Devajit; Wadhawan, Monika
2017-06-01
Seismic anisotropy of the crust beneath the eastern Ladakh-Karakoram zone has been studied by shear wave splitting analysis of S-waves of local earthquakes and P-to-S or Ps converted phases originated at the crust-mantle boundary. The splitting parameters (Φ and δt), derived from S-wave of local earthquakes with shallow focal depths, reveal complex nature of anisotropy with NW-SE and NE oriented Fast Polarization directions (FPD) in the upper ∼22 km of the crust. The observed anisotropy in the upper crust may be attributed to combined effects of existing tectonic features as well as regional tectonic stress. The maximum delay time of fast and slow waves in the upper crust is ∼0.3 s. The Ps splitting analysis shows more consistent FPDs compared to S-wave splitting. The FPDs are parallel or sub parallel to the Karakoram fault (KF) and other NW-SE trending tectonic features existing in the region. The strength of anisotropy estimated for the whole crust is higher (maximum delay time δt: 0.75 s) in comparison to the upper crust. This indicates that the dominant source of anisotropy in the trans-Himalayan crust is confined within the middle and lower crustal depths. The predominant NW-SE trending FPDs consistently observed in the upper crust as well as in the middle and lower crust near the KF zone support the fact that the KF is a crustal-scale fault which extends at least up to the lower crust. Dextral shearing of the KF creates shear fabric and preferential alignment of mineral grains along the strike of the fault, resulting in the observed FPDs. A Similar observation in the Indus Suture Zone (ISZ) also suggests crustal scale deformation owing to the India-Asia collision.
Lactococcus lactis Metabolism and Gene Expression during Growth on Plant Tissues
Golomb, Benjamin L.
2014-01-01
Lactic acid bacteria have been isolated from living, harvested, and fermented plant materials; however, the adaptations these bacteria possess for growth on plant tissues are largely unknown. In this study, we investigated plant habitat-specific traits of Lactococcus lactis during growth in an Arabidopsis thaliana leaf tissue lysate (ATL). L. lactis KF147, a strain originally isolated from plants, exhibited a higher growth rate and reached 7.9-fold-greater cell densities during growth in ATL than the dairy-associated strain L. lactis IL1403. Transcriptome profiling (RNA-seq) of KF147 identified 853 induced and 264 repressed genes during growth in ATL compared to that in GM17 laboratory culture medium. Genes induced in ATL included those involved in the arginine deiminase pathway and a total of 140 carbohydrate transport and metabolism genes, many of which are involved in xylose, arabinose, cellobiose, and hemicellulose metabolism. The induction of those genes corresponded with L. lactis KF147 nutrient consumption and production of metabolic end products in ATL as measured by gas chromatography-time of flight mass spectrometry (GC-TOF/MS) untargeted metabolomic profiling. To assess the importance of specific plant-inducible genes for L. lactis growth in ATL, xylose metabolism was targeted for gene knockout mutagenesis. Wild-type L. lactis strain KF147 but not an xylA deletion mutant was able to grow using xylose as the sole carbon source. However, both strains grew to similarly high levels in ATL, indicating redundancy in L. lactis carbohydrate metabolism on plant tissues. These findings show that certain strains of L. lactis are well adapted for growth on plants and possess specific traits relevant for plant-based food, fuel, and feed fermentations. PMID:25384484
ASSIMILATION OF COARSE-SCALEDATAUSINGTHE ENSEMBLE KALMAN FILTER
Efendiev, Yalchin
2011-01-01
Reservoir data is usually scale dependent and exhibits multiscale features. In this paper we use the ensemble Kalman filter (EnKF) to integrate data at different spatial scales for estimating reservoir fine-scale characteristics. Relationships between the various scales is modeled via upscaling techniques. We propose two versions of the EnKF to assimilate the multiscale data, (i) where all the data are assimilated together and (ii) the data are assimilated sequentially in batches. Ensemble members obtained after assimilating one set of data are used as a prior to assimilate the next set of data. Both of these versions are easily implementable with any other upscaling which links the fine to the coarse scales. The numerical results with different methods are presented in a twin experiment setup using a two-dimensional, two-phase (oil and water) flow model. Results are shown with coarse-scale permeability and coarse-scale saturation data. They indicate that additional data provides better fine-scale estimates and fractional flow predictions. We observed that the two versions of the EnKF differed in their estimates when coarse-scale permeability is provided, whereas their results are similar when coarse-scale saturation is used. This behavior is thought to be due to the nonlinearity of the upscaling operator in the case of the former data. We also tested our procedures with various precisions of the coarse-scale data to account for the inexact relationship between the fine and coarse scale data. As expected, the results show that higher precision in the coarse-scale data yielded improved estimates. With better coarse-scale modeling and inversion techniques as more data at multiple coarse scales is made available, the proposed modification to the EnKF could be relevant in future studies.
Investigating On-Orbit Attitude Determination Anomalies for the Solar Dynamics Observatory Mission
Vess, Melissa F.; Starin, Scott R.; Chia-Kuo, Alice Liu
2011-01-01
The Solar Dynamics Observatory (SDO) was launched on February 11, 2010 from Kennedy Space Center on an Atlas V launch vehicle into a geosynchronous transfer orbit. SDO carries a suite of three scientific instruments, whose observations are intended to promote a more complete understanding of the Sun and its effects on the Earth's environment. After a successful launch, separation, and initial Sun acquisition, the launch and flight operations teams dove into a commissioning campaign that included, among other things, checkout and calibration of the fine attitude sensors and checkout of the Kalman filter (KF) and the spacecraft s inertial pointing and science control modes. In addition, initial calibration of the science instruments was also accomplished. During that process of KF and controller checkout, several interesting observations were noticed and investigated. The SDO fine attitude sensors consist of one Adcole Digital Sun Sensor (DSS), two Galileo Avionica (GA) quaternion-output Star Trackers (STs), and three Kearfott Two-Axis Rate Assemblies (hereafter called inertial reference units, or IRUs). Initial checkout of the fine attitude sensors indicated that all sensors appeared to be functioning properly. Initial calibration maneuvers were planned and executed to update scale factors, drift rate biases, and alignments of the IRUs. After updating the IRU parameters, the KF was initialized and quickly reached convergence. Over the next few hours, it became apparent that there was an oscillation in the sensor residuals and the KF estimation of the IRU bias. A concentrated investigation ensued to determine the cause of the oscillations, their effect on mission requirements, and how to mitigate them. The ensuing analysis determined that the oscillations seen were, in fact, due to an oscillation in the IRU biases. The low frequencies of the oscillations passed through the KF, were well within the controller bandwidth, and therefore the spacecraft was actually
Determination of sorption of seventy five pharmaceuticals in sewage sludge
DEFF Research Database (Denmark)
Hörsing, Maritha; Ledin, Anna; Grabic, Roman
2011-01-01
concentrations to water containing 1 g of sludge. The range of APIs concentrations was between ng L1 to mg L1 which are found in the wastewater effluents. Isotherms were obtained for approximately 45 of the APIs, providing distribution coefficients for linear (Kd), Freundlich (Kf) and Langmuir (KL) isotherms. Kd......, Kf and KL ranging between 7.1 104 and 3.8 107, 1.1 102 and 6.1 104 and 9.2 103 and 1.1 L kg1, respectively. The obtained coefficients were applied to estimate the fraction of APIs in the water phase (see Abstract Graphic). For 37 of the 75 APIs, the predicted presence in the liquid phase...
A Greedy Approach for Placement of Subsurface Aquifer Wells in an Ensemble Filtering Framework
El Gharamti, Mohamad; Marzouk, Youssef M.; Huan, Xun; Hoteit, Ibrahim
2015-01-01
Optimizing wells placement may help in better understanding subsurface solute transport and detecting contaminant plumes. In this work, we use the ensemble Kalman filter (EnKF) as a data assimilation tool and propose a greedy observational design algorithm to optimally select aquifer wells locations for updating the prior contaminant ensemble. The algorithm is greedy in the sense that it operates sequentially, without taking into account expected future gains. The selection criteria is based on maximizing the information gain that the EnKF carries during the update of the prior uncertainties. We test the efficiency of this algorithm in a synthetic aquifer system where a contaminant plume is set to migrate over a 30 years period across a heterogenous domain.
Safety research for LWR type reactors
International Nuclear Information System (INIS)
1989-07-01
The current R and D activities are to be seen in connection with the LWR risk assessment studies. Two trends are emerging, of which the one concentrates more on BWR-specific problems, and the other on the efficiency or safety-related assessment of accident management activities. This annual report of 1988 reviews the progress of work done by the institutes and departments of the Karlsruhe Nuclear Research Center, (KfK), or on behalf of KfK by external institutions, in the field of safety research. The papers of this report present the state of work at the end of the year 1988. They are written in German, with an abstract in English. (orig./HP) [de
Energy Technology Data Exchange (ETDEWEB)
Suenaga, Hikaru [National Institute of Advanced Industrial Science and Technology (AIST), Tsukuba (Japan). Bioproduction Research Inst.; Nonaka, Kazuhiko; Goto, Masatoshi [Kyushu Univ., Fukuoka (Japan). Dept. of Bioscience and Biotechnology; Fujihara, Hidehiko; Furukawa, Kensuke [Beppu Univ. (Japan). Dept. of Fermentation and Food Science
2010-10-15
Pseudomonas pseudoalcaligenes KF707 possesses a chromosomally encoded bph gene cluster responsible for the catabolism of biphenyl and polychlorinated biphenyls. Previously, we constructed chimeric versions of the bphA1 gene, which encodes a large subunit of biphenyl dioxygenase, by using DNA shuffling between bphA1 genes from P. pseudoalcaligenes KF707 and Burkholderia xenovorans LB400. In this study, we demonstrate replacement of the bphA1 gene with chimeric bphA1 sequence within the chromosomal bph gene cluster by two-step homologous recombination. Notably, some of the hybrid strains acquired enhanced and/or expanded degradation capabilities for specific aromatic compounds, including single aromatic hydrocarbons and polychlorinated biphenyls. (orig.)
Mapping adenosine A1 receptors in the cat brain by positron emission tomography with [11C]MPDX
International Nuclear Information System (INIS)
Shimada, Yuhei; Ishiwata, Kiichi; Kiyosawa, Motohiro; Nariai, Tadashi; Oda, Keiichi; Toyama, Hinako; Suzuki, Fumio; Ono, Kenichirou; Senda, Michio
2002-01-01
We evaluated the potential of [ 11 C]MPDX as a radioligand for mapping adenosine A 1 receptors in comparison with previously proposed [ 11 C]KF15372 in cat brain by PET. Two tracers showed the same brain distribution. Brain uptake of [ 11 C]MPDX (Ki=4.2 nM) was much higher and washed out faster than that of [ 11 C]KF15372 (Ki=3.0 nM), and was blocked by carrier-loading or displaced with an A 1 antagonist. The regional A 1 receptor distribution evaluated with kinetic analysis is consistent with that previously measured in vitro. [ 11 C]MPDX PET has a potential for mapping adenosine A 1 receptors in brain
Research and development at Kernforschungszentrum Karlsruhe - brief report 1991
International Nuclear Information System (INIS)
1992-01-01
Research at Kernforschungszentrum Karlsruhe in the nineties is focussed on environmentally compatible high technologies with emphasis on environmental engineering, power engineering, microsystems technology, and selected fields of fundamental research. The KfK research and development trends are reflected by this brief report. The facts and figures inform researchers and specialists by summarizing the major results of the current research projects and by informing about the main targets and trends of long-time research programs and individual projects. The brief reports are completed by comprehensive, annual progress reports which discuss the implementation and results of the KfK research activities and compile references which list the various scientifico-technical reports, contributions to journals, conference papers, and other publications. (orig.) [de
A Greedy Approach for Placement of Subsurface Aquifer Wells in an Ensemble Filtering Framework
El Gharamti, Mohamad
2015-11-26
Optimizing wells placement may help in better understanding subsurface solute transport and detecting contaminant plumes. In this work, we use the ensemble Kalman filter (EnKF) as a data assimilation tool and propose a greedy observational design algorithm to optimally select aquifer wells locations for updating the prior contaminant ensemble. The algorithm is greedy in the sense that it operates sequentially, without taking into account expected future gains. The selection criteria is based on maximizing the information gain that the EnKF carries during the update of the prior uncertainties. We test the efficiency of this algorithm in a synthetic aquifer system where a contaminant plume is set to migrate over a 30 years period across a heterogenous domain.
International Nuclear Information System (INIS)
Schulz, Joerg; Schlegelmilch, Kai; Schulze, Karsten; Abromeit, Carolin; Jensen, Lars Bie; Svendsen, Anne; Schwebel, Olivier; Huebner, Gundula; Heidmann, Roger; Piet, Olivier; Roudil, Jean-Philippe; Fuchs, Tina
2010-01-01
The French-German office for Renewable energies (OFAEnR) organised a conference on offshore wind energy development in France and Germany. In the framework of this French-German exchange of experience, about 170 participants exchanged views on the actual policies, on the offshore potentialities of both countries and on the recent logistics, services, training and software innovations. This document brings together the available presentations (slides) made during this event: 1 - Opening talk by Joerg Schulz, Bremerhaven's Major; 2 - The Future of the Offshore Wind energy in Germany - Key elements of the German energy Concept (Kai Schlegelmilch); 3 - Offshore wind farms: A commercial perspective - Offshore projects profitability (Karsten Schulze); 4 - Offshore Wind Farms in the German EEZ - experiences with the German Approval Procedure: criteria for a successful approval procedure (Carolin Abromeit); 5 - Offshore Wind Parks and fishery in Denmark - Involvement and compensation of commercial fishery in Denmark (Lars Bie Jensen); 6 - Tourism, property value, residents interest and offshore parks - Usage conflicts or regional development? (Anne Svendsen); 7 - Logistics for offshore wind projects - classic ports usable? An overview (Roger Heidmann); 8 - Offshore wind energy and French harbours (Olivier Piet); 9 - French offshore wind power market and component suppliers (Jean-Philippe Roudil); 10 - Trident software - the Offshore Wind Manager. Review and Forecast after one year of construction (Tina Fuchs)
List of scientific publications from the Karlsruhe Nuclear Research Centre of the year 1977
International Nuclear Information System (INIS)
1978-03-01
The scientific and technical-scientific publications from the Karlsruhe Nuclear Research Centre comprise books, original papers in scientific or technical journals, diploma, doctoral and habilitation theses, as well as papers held at scientific conferences, patents, KfK reports, and external reports (KfK = Kernforschungszentrum Karlsruhe). The present report, KfK 2625, contains the titles of the 1977 publications, scientific papers being listed only after the manusscript has been filed in the Central Library of the research centre. As for patents, the titles given refer to either first issues of a patent, or to patents laid open for inspection. Progress reports are listed according to subjects involved. The whole list of publications is ordered according to the names of institutes and of projects, the latter group covering the titles of published project reports and of publications written by individual cooperators of a given project, as well as publications printed by the Karlsruhe Nuclear Research Centre, written by cooperators of the following projects: 'Process control with data processing plants', (PDV), and 'Computer-assisted development' (CAD). These projects are carried out together with other firms and instutes. Yet another group of publications covered are those of the Federal Institute for Food Research, and of guest scientists working in the Centre. (orig./HK) [de
Ensemble Kalman Filtering with a Divided State-Space Strategy for Coupled Data Assimilation Problems
Luo, Xiaodong
2014-12-01
This study considers the data assimilation problem in coupled systems, which consists of two components (subsystems) interacting with each other through certain coupling terms. A straightforward way to tackle the assimilation problem in such systems is to concatenate the states of the subsystems into one augmented state vector, so that a standard ensemble Kalman filter (EnKF) can be directly applied. This work presents a divided state-space estimation strategy, in which data assimilation is carried out with respect to each individual subsystem, involving quantities from the subsystem itself and correlated quantities from other coupled subsystems. On top of the divided state-space estimation strategy, the authors also consider the possibility of running the subsystems separately. Combining these two ideas, a few variants of the EnKF are derived. The introduction of these variants is mainly inspired by the current status and challenges in coupled data assimilation problems and thus might be of interest from a practical point of view. Numerical experiments with a multiscale Lorenz 96 model are conducted to evaluate the performance of these variants against that of the conventional EnKF. In addition, specific for coupled data assimilation problems, two prototypes of extensions of the presented methods are also developed in order to achieve a trade-offbetween efficiency and accuracy.
The effect of short-term workshop on improving clinical reasoning skill of medical students.
Yousefichaijan, Parsa; Jafari, Farshad; Kahbazi, Manijeh; Rafiei, Mohammad; Pakniyat, AbdolGhader
2016-01-01
Clinical reasoning process leads clinician to get purposeful steps from signs and symptoms toward diagnosis and treatment. This research intends to investigate the effect of teaching clinical reasoning on problem-solving skills of medical students. This research is a semi-experimental study. Nineteen Medical student of the pediatric ward as case group participated in a two-day workshop for training clinical reasoning. Before the workshop, they filled out Diagnostic Thinking Inventory (DTI) questionnaires. Fifteen days after the workshop the DTI questionnaire completed and "key feature" (KF) test and "clinical reasoning problem" (CRP) test was held. 23 Medical student as the control group, without passing the clinical reasoning workshop DTI questionnaire completed, and KF test and CRP test was held. The average score of the DTI questionnaire in the control group was 162.04 and in the case group before the workshop was 153.26 and after the workshop was 181.68. Compare the average score of the DTI questionnaire before and after the workshop there is a significant difference. The difference between average KF test scores in the control and the case group was not significant but between average CRP test scores was significant. Clinical reasoning workshop is effectiveness in promoting problem-solving skills of students.
Ensemble Kalman Filtering with a Divided State-Space Strategy for Coupled Data Assimilation Problems
Luo, Xiaodong; Hoteit, Ibrahim
2014-01-01
This study considers the data assimilation problem in coupled systems, which consists of two components (subsystems) interacting with each other through certain coupling terms. A straightforward way to tackle the assimilation problem in such systems is to concatenate the states of the subsystems into one augmented state vector, so that a standard ensemble Kalman filter (EnKF) can be directly applied. This work presents a divided state-space estimation strategy, in which data assimilation is carried out with respect to each individual subsystem, involving quantities from the subsystem itself and correlated quantities from other coupled subsystems. On top of the divided state-space estimation strategy, the authors also consider the possibility of running the subsystems separately. Combining these two ideas, a few variants of the EnKF are derived. The introduction of these variants is mainly inspired by the current status and challenges in coupled data assimilation problems and thus might be of interest from a practical point of view. Numerical experiments with a multiscale Lorenz 96 model are conducted to evaluate the performance of these variants against that of the conventional EnKF. In addition, specific for coupled data assimilation problems, two prototypes of extensions of the presented methods are also developed in order to achieve a trade-offbetween efficiency and accuracy.
Molten salt synthesis of La0.8Sr0.2MnO3 powders for SOFC cathode electrode
Gu, Sin-il; Shin, Hyo-soon; Hong, Youn-woo; Yeo, Dong-hun; Kim, Jong-hee; Nahm, Sahn; Yoon, Sang-ok
2012-08-01
For La0.8Sr0.2MnO3 (LSM) perovskite, used as the cathode material for solid oxide fuel cells (SOFC), it is known that the formation of a triple-phase-boundary is restrained due to the formation of a second phase at the YSZ/electrode interface at high temperature. To decrease the 2nd phase, lowering the sintering temperature has been used. LSM powder was synthesized by molten salt synthesis method to control its particle size, shape, and agglomeration. We have characterized the phase formation, particle size, shape, and sintering behavior of LSM in the synthesis using the variation of KCl, LiCl, KF and its mixed salts as raw materials. In the case of KCl and KCl-KF salts, the particle size and shape of the LSM was well controlled and synthesized. However, in the case of LiCl and KCl-LiCl salts, LiMnOx as 2nd phase and LSM were synthesized simultaneously. In the case of the mixed salt of KCl-KF, the growth mechanism of the LSM particle was changed from `diffusion-controlled' to `reaction-controlled' according to the amount of mixed salt. The sintering temperature can be decreased below 1000 °C by using the synthesized LSM powder.
The trajectory prediction of spacecraft by grey method
International Nuclear Information System (INIS)
Wang, Qiyue; Wang, Zhongyu; Zhang, Zili; Wang, Yanqing; Zhou, Weihu
2016-01-01
The real-time and high-precision trajectory prediction of a moving object is a core technology in the field of aerospace engineering. The real-time monitoring and tracking technology are also significant guarantees of aerospace equipment. A dynamic trajectory prediction method called grey dynamic filter (GDF) which combines the dynamic measurement theory and grey system theory is proposed. GDF can use coordinates of the current period to extrapolate coordinates of the following period. At meantime, GDF can also keep the instantaneity of measured coordinates by the metabolism model. In this paper the optimal model length of GDF is firstly selected to improve the prediction accuracy. Then the simulation for uniformly accelerated motion and variably accelerated motion is conducted. The simulation results indicate that the mean composite position error of GDF prediction is one-fifth to that of Kalman filter (KF). By using a spacecraft landing experiment, the prediction accuracy of GDF is compared with the KF method and the primitive grey method (GM). The results show that the motion trajectory of spacecraft predicted by GDF is much closer to actual trajectory than the other two methods. The mean composite position error calculated by GDF is one-eighth to KF and one-fifth to GM respectively. (paper)
Impact of educational intervention on the inter-rater agreement of nasal endoscopy interpretation
Colley, Patrick; Mace, Jess C.; Schaberg, Madeleine R.; Smith, Timothy L.; Tabaee, Abtin
2015-01-01
OBJECTIVE Nasal endoscopy is integral to the evaluation of sinonasal disorders. However, prior studies have shown significant variability in the inter-rater agreement of nasal endoscopy interpretation amongst practicing rhinologists. The objective of the current study is to evaluate the inter-rater agreement of nasal endoscopy amongst otolaryngology residents from a single training program at baseline and following an educational intervention. METHODS 11 otolaryngology residents completed nasal endoscopy grading forms for 8 digitally recorded nasal endoscopic examinations. An instructional lecture reviewing nasal endoscopy interpretation was subsequently provided. The residents then completed grading forms for 8 different nasal endoscopic examinations. Inter-rate agreement amongst residents for the pre- and post-lecture videos was calculated using the unweighted Fleiss’ kappa statistic (Kf) and intra-class correlation agreement (ICC). RESULTS Inter-rater agreement improved from a baseline level of fair (Kf range 0.268–0.383) to a post-educational level of moderate (Kf range 0.401–0.547) for nasal endoscopy findings of middle meatus mucosa, middle turbinate mucosa, middle meatus discharge, sphenoethmoid recess mucosa, sphenoethmoid recess discharge and atypical lesions (ICC, pendoscopy interpretation amongst otolaryngology residents. The inter-rater agreement for the majority of the characteristics that were evaluated improved after educational intervention. Further study is needed to improve nasal endoscopy interpretation. PMID:25781864
Why Leadership Matters: Joint Task Force Planning with the Department of State
2013-12-10
137. 12Ibid. 13Ibid., 192-195. 14Gabriel Marcella and General Frederick F. Woerner Jr., U.S. Army (Ret.), “The Road to War: The U.S – Panamanian...change the plan to accommodate the agreement brokered by President Carter. 43 39Donald E. Schulz and Gabriel Marcella , Reconciling the... Marcella , Gabriel, and General Frederick F. Woerner Jr., U.S. Army (Ret.). “The Road to War: The U.S—Panamanian Crisis, 1987–1989.” Draft article, 6 May 91
Position in the World-System and National Emissions of Greenhouse Gases
Directory of Open Access Journals (Sweden)
Thomas J. Burns
2015-08-01
Full Text Available Despite the apparent importance of these dynamics, there is relatively little social science theorization and cross-national research on such global environmental issues. There is especially a paucity of cross-national, quantitative research in sociology that focuses on the social antecedents to environmental outcomes (for exceptions, see Burns et al. 1994, 1995; Kick et al. 1996; Grimes and Roberts 1995. We find this condition surprising given the substantial initial work of environmental sociologists (Dunlap and Catton 1978, 1979; Buttel 1987 and the key role social scientists might in principle play in addressing such worldwide problems (Laska 1993. As a consequence, we propose and assess a perspective on the global and national social causes of one environmental dynamic, the greenhouse effect.
Comparison of robust H∞ filter and Kalman filter for initial alignment of inertial navigation system
Institute of Scientific and Technical Information of China (English)
HAO Yan-ling; CHEN Ming-hui; LI Liang-jun; XU Bo
2008-01-01
There are many filtering methods that can be used for the initial alignment of an integrated inertial navigation system.This paper discussed the use of GPS,but focused on two kinds of filters for the initial alignment of an integrated strapdown inertial navigation system (SINS).One method is based on the Kalman filter (KF),and the other is based on the robust filter.Simulation results showed that the filter provides a quick transient response and a little more accurate estimate than KF,given substantial process noise or unknown noise statistics.So the robust filter is an effective and useful method for initial alignment of SINS.This research should make the use of SINS more popular,and is also a step for further research.
International Nuclear Information System (INIS)
Gabowitsch, E.; Trauboth, H.
1982-01-01
After a brief survey of the present and expected future state of nuclear energy utilization, which should demonstrate the significance of nuclear reprocessing, safety and reliability aspects of nuclear reprocessing plants (NRP) are considered. Then, the principal possibilities of modern computer technology including computer systems architecture and application-oriented software for improving the reliability and availability are outlined. In this context, two information systems being developed at the Nuclear Research Center Karlsruhe (KfK) are briefly described. For design evaluation of certain areas of a large NRP mathematical methods and computer-aided tools developed, used or being designed by KfK are discussed. In conclusion, future research to be pursued in information processing and applied mathematics in support of reliable operation of NRP's is proposed. (Auth.)
Operational aspects of asynchronous filtering for flood forecasting
Rakovec, O.; Weerts, A. H.; Sumihar, J.; Uijlenhoet, R.
2015-06-01
This study investigates the suitability of the asynchronous ensemble Kalman filter (AEnKF) and a partitioned updating scheme for hydrological forecasting. The AEnKF requires forward integration of the model for the analysis and enables assimilation of current and past observations simultaneously at a single analysis step. The results of discharge assimilation into a grid-based hydrological model (using a soil moisture error model) for the Upper Ourthe catchment in the Belgian Ardennes show that including past predictions and observations in the data assimilation method improves the model forecasts. Additionally, we show that elimination of the strongly non-linear relation between the soil moisture storage and assimilated discharge observations from the model update becomes beneficial for improved operational forecasting, which is evaluated using several validation measures.
Operational aspects of asynchronous filtering for hydrological forecasting
Rakovec, O.; Weerts, A. H.; Sumihar, J.; Uijlenhoet, R.
2015-03-01
This study investigates the suitability of the Asynchronous Ensemble Kalman Filter (AEnKF) and a partitioned updating scheme for hydrological forecasting. The AEnKF requires forward integration of the model for the analysis and enables assimilation of current and past observations simultaneously at a single analysis step. The results of discharge assimilation into a grid-based hydrological model for the Upper Ourthe catchment in the Belgian Ardennes show that including past predictions and observations in the data assimilation method improves the model forecasts. Additionally, we show that elimination of the strongly non-linear relation between the soil moisture storage and assimilated discharge observations from the model update becomes beneficial for improved operational forecasting, which is evaluated using several validation measures.
The high-energy dual-beam facility
International Nuclear Information System (INIS)
Kaletta, D.
1984-07-01
This proposal presents a new experimental facility at the Kernforschungszentrum Karlsruhe (KfK) to study the effects of irradiation on the first wall and blanket materials of a fusion reactor. A special effort is made to demonstrate the advantages of the Dual Beam Technique (DBT) as a future research tool for materials development within the European Fusion Technology Programme. The Dual-Beam-Technique allows the production both of helium and of damage in thick metal and ceramic specimens by simultaneous irradiation with high energy alpha particles and protons produced by the two KfK cyclotrons. The proposal describes the Dual Beam Technique the planned experimental activities and the design features of the Dual Beam Facility presently under construction. (orig.) [de
Safety-related LWR research. Annual report 1989
International Nuclear Information System (INIS)
1990-11-01
The main topics in this annual report 1989 are phenomena of heavy fuel damage and single aspects of a core meltdown accident. The examined single aspects refer to aerosol behavior and filter engineering and to methods for assessment and minimization of the radiological consequences of reactor accidents. Different contributions to selected, safety-related problems of an advanced pressurized-water reactor complete the topic spectrum. The annual report 1989 describes the progress of the research work wich was carried out in the area of safety research by institutes and departments of the KfK, and on behalf of the KfK by external institutions. The individual contributions represent the status of work at the end of the year under review, 1989. (orig./HP) [de
2013-06-04
... Firm manufacturers metal parts for IN 46350. air compressors from sheet metal, aluminum and stainless... 17406. as spacers, washers, bushings and pins on multi-spindle automatic screw machines. K&F Electronics...
User and reference manual for the KfK code INS
International Nuclear Information System (INIS)
Daum, E.
1993-09-01
The INS code (Intense Neutron Source) serves to calculate uncollided neutron flux contours, neutron flux volumes and spatial-dependent neutron flux spectra in the test cell of an intense neutron source, of the t-H 2 O or d-Li concept. With the information of the neutron flux spectra the neutron irradiation damage like displacements per atom (DPA), H- and He-production rates and the generation of foreign elements by transmutations can be calculated for any element at any position in the test cell. This manual gives an introduction into the theory of neutron flux calculation of thick targets and neutron irradiation damage calculations. It is explained how the code is working and the handling of the input and output parameters. For each application of the several code modules an example is given. The results like contours, spectra, flux volumes and damage rates are summarized in tabular form and graphically. Damage and element transmutation data have been calculated for 23 isotopes and compared with the DEMO 1st wall values. (orig./HP) [de
Annual report 1985 of the KfK Central Safety Department
International Nuclear Information System (INIS)
Kiefer, H.; Koelzer, W.; Koenig, L.A.
1986-04-01
The Central Safety Department is responsible for handling all problems of radiation protection, safety and security of the institutes and departments of the Karlsruhe Nuclear Research Center, for waste water activity measurements and environmental monitoring of the whole area of the Center, and for research and development work mainly focusing on nuclear safety and radiation protection measures. The r+d work concentrates on the following aspects: physical and chemical behavior of biologically particularly active radionuclides, behavior of HT in the air/plant/soil system, biophysics of multicellular systems, improvement in radiation protection measurement and personnel dosimetry. This report gives details of the different duties, indicates the results of 1985 routine tasks and reports about results of investigations and developments of the working groups of the Department. The reader is referred to the English translation of the Table of Contents and of Chapter 1 describing the duties and organization of the Central Safety Department. (orig./HP) [de
Digital Repository Service at National Institute of Oceanography (India)
Sautya, S.; Tabachnick, K.R.; Ingole, B.S.
–XXVI. Schulze FE (1886) Über den Bau und das System der Hexactinelliden. Abhandlungen der Königlichen Akademie der Wissenschaften zu Berlin (Physikalisch-Mathematisch Classe) 1886: 1–97. Schmidt O (1880) Die Spongien des Meerbusen von Mexico (Und des... of Mexico, by the USCSS ‘Blake’. Gustav Fischer, Jena, 33–90, pls V-X. A new genus and species of deep-sea glass sponge... 21 Mehl D (1992) Die Entwicklung der Hexactinellida seit dem Mesozoikum. Paläobiologie, Phylogenie und Evolutionsökologie. Berliner...
Precipitation as driver of carbon fluxes in 11 African ecosystems
CSIR Research Space (South Africa)
Merbold, L
2009-01-01
Full Text Available ). Given the shortness of the record, the EC data were analysed across the network rather than longitudinally at sites, in order to under- stand the driving factors for ecosystem respiration and car- bon assimilation, and to reveal the different water... by Schulze et al. (1994) and the thick solid regression line shows the regression for the eleven African sites. (n=11) variability in the global terrestrial cycles of water and car- bon (Williams et al., 2007; Weber et al., 2009). More- over, all African...
Sea-Boson Analysis of the Infinite-U Hubbard Model
Setlur, Girish S.
2004-01-01
By expanding the projection operator in powers of the density fluctuations, we conjecture a hamiltonian purely quadratic in the sea-bosons that reproduces the right spin and charge velocities and exponent for the $ U = \\infty $ case in one dimension known from the work of Schulz. Then we argue that by simply promoting wavenumbers to wave vectors we are able to study the two dimensional case. We find that the quasiparticle residue takes a value $ Z_{F} = 0.79 $ close to half-filling where it i...
Energy Technology Data Exchange (ETDEWEB)
Hao, Ming; Wang, Yanli, E-mail: ywang@ncbi.nlm.nih.gov; Bryant, Stephen H., E-mail: bryant@ncbi.nlm.nih.gov
2016-02-25
Identification of drug-target interactions (DTI) is a central task in drug discovery processes. In this work, a simple but effective regularized least squares integrating with nonlinear kernel fusion (RLS-KF) algorithm is proposed to perform DTI predictions. Using benchmark DTI datasets, our proposed algorithm achieves the state-of-the-art results with area under precision–recall curve (AUPR) of 0.915, 0.925, 0.853 and 0.909 for enzymes, ion channels (IC), G protein-coupled receptors (GPCR) and nuclear receptors (NR) based on 10 fold cross-validation. The performance can further be improved by using a recalculated kernel matrix, especially for the small set of nuclear receptors with AUPR of 0.945. Importantly, most of the top ranked interaction predictions can be validated by experimental data reported in the literature, bioassay results in the PubChem BioAssay database, as well as other previous studies. Our analysis suggests that the proposed RLS-KF is helpful for studying DTI, drug repositioning as well as polypharmacology, and may help to accelerate drug discovery by identifying novel drug targets. - Graphical abstract: Flowchart of the proposed RLS-KF algorithm for drug-target interaction predictions. - Highlights: • A nonlinear kernel fusion algorithm is proposed to perform drug-target interaction predictions. • Performance can further be improved by using the recalculated kernel. • Top predictions can be validated by experimental data.
Medina, H.; Romano, N.; Chirico, G. B.
2012-12-01
We present a dual Kalman Filter (KF) approach for retrieving states and parameters controlling soil water dynamics in a homogenous soil column by using near-surface state observations. The dual Kalman filter couples a standard KF algorithm for retrieving the states and an unscented KF algorithm for retrieving the parameters. We examine the performance of the dual Kalman Filter applied to two alternative state-space formulations of the Richards equation, respectively differentiated by the type of variable employed for representing the states: either the soil water content (θ) or the soil matric pressure head (h). We use a synthetic time-series series of true states and noise corrupted observations and a synthetic time-series of meteorological forcing. The performance analyses account for the effect of the input parameters, the observation depth and the assimilation frequency as well as the relationship between the retrieved states and the assimilated variables. We show that the identifiability of the parameters is strongly conditioned by several factors, such as the initial guess of the unknown parameters, the wet or dry range of the retrieved states, the boundary conditions, as well as the form (h-based or θ-based) of the state-space formulation. State identifiability is instead efficient even with a relatively coarse time-resolution of the assimilated observation. The accuracy of the retrieved states exhibits limited sensitivity to the observation depth and the assimilation frequency.
Huang, X.; Allen, D. J.; Herwehe, J. A.; Alapaty, K. V.; Loughner, C.; Pickering, K. E.
2014-12-01
Subgrid-scale cloudiness directly influences global and regional atmospheric radiation budgets by attenuating shortwave radiation, leading to suppressed convection, decreased surface precipitation as well as other meteorological parameter changes. We use the latest version of WRF (v3.6, Apr 2014), which incorporates the Kain-Fritsch (KF) convective parameterization to provide subgrid-scale cloud fraction and condensate feedback to the rapid radiative transfer model-global (RRTMG) shortwave and longwave radiation schemes. We apply the KF scheme to simulate the DISCOVER-AQ Maryland field campaign (July 2011), and compare the sensitivity of meteorological parameters to the control run that does not include subgrid cloudiness. Furthermore, we will examine the chemical impact from subgrid cloudiness using a regional chemical transport model (CMAQ). There are several meteorological parameters influenced by subgrid cumulus clouds that are very important to air quality modeling, including changes in surface temperature that impact biogenic emission rates; changes in PBL depth that affect pollutant concentrations; and changes in surface humidity levels that impact peroxide-related reactions. Additionally, subgrid cumulus clouds directly impact air pollutant concentrations by modulating photochemistry and vertical mixing. Finally, we will compare with DISCOVER-AQ flight observation data and evaluate how well this off-line CMAQ simulation driven by WRF with the KF scheme simulates the effects of regional convection on atmospheric composition.
Influence of milling process in the surface energy of glass tile frits
International Nuclear Information System (INIS)
Tamayo, A.; Rubio, F.; Otero, J. L.; Rubio, J.
2013-01-01
In this work has been studied the influence of the milling process of two ceramic frits used in the ceramic tile industry. Both glass frits were of similar chemical composition changing SiO 2 by 5% of B 2 O 3 and both of them were water or dry milled. Glass frit surfaces were characterized by FT-IR, Karl-Fischer (K-F) titration and Inverse Gas Chromatography at Infinite Dilution (IGC-ID). By K-F titration it was observed that water milled frits presented 28 and 26 OH groups for 100 A 2 if they do not contain or contain boron, respectively. These surface changes are also observed by IGC-ID. Thus, the glass frit without boron and dry milled presented the highest dispersive surface energy (44 mJ.m - 2) and the less acidic constant (0.13 kJ.mol - 1). Both glass frits are amphoteric with acidic and base surface active sites, and that frit without boron presents the higher basicity. Milling process influences in the acid-base surface characteristics of both frits by increasing the basicity for the one without boron and increasing for the other one. This has been assigned to the different location of hydroxyl groups where the higher interaction is the one that does not contain boron and dry milled as K-F results. (Author)
International Nuclear Information System (INIS)
Zhang, X.L.; Li, Q.B.; Su, G.F.; Yuan, M.Q.
2015-01-01
The accidental release of radioactive materials from nuclear power plant leads to radioactive pollution. We apply an augmented ensemble Kalman filter (EnKF) with a chemical transport model to jointly estimate the emissions of Perfluoromethylcyclohexane (PMCH), a tracer substitute for radionuclides, from a point source during the European Tracer Experiment, and to improve the forecast of its dispersion downwind. We perturb wind fields to account for meteorological uncertainties. We expand the state vector of PMCH concentrations through continuously adding an a priori emission rate for each succeeding assimilation cycle. We adopt a time-correlated red noise to simulate the temporal emission fluctuation. The improved EnKF system rapidly updates (and reduces) the excessively large initial first-guess emissions, thereby significantly improves subsequent forecasts (r = 0.83, p < 0.001). It retrieves 94% of the total PMCH released and substantially reduces transport error (>80% average reduction of the normalized mean square error). - Highlights: • EnKF is augmented for estimating emission and improving dispersion forecast. • The improved system retrieves 94% of the actual total tracer release in ETEX. • The system substantially improves the 3-h forecast of the tracer dispersion. • The method is robust and insensitive to the first-guess emissions. • The meteorological uncertainties exert strong influence on the performance
Energy Technology Data Exchange (ETDEWEB)
Tamayo, A.; Rubio, F.; Oteo, J. L.; Rubio, J.
2013-05-01
In this work has been studied the influence of the milling process of two ceramic frits used in the ceramic tile industry. Both glass frits were of similar chemical composition changing SiO{sub 2} by 5% of B{sub 2}O{sub 3} and both of them were water or dry milled. Glass frit surfaces were characterized by FT-IR, Karl-Fischer (K-F) titration and Inverse Gas Chromatography at Infinite Dilution (IGC-ID). By K-F titration it was observed that water milled frits presented 28 and 26 OH groups for 100 A{sup 2} if they do not contain or contain boron, respectively. These surface changes are also observed by IGC-ID. Thus, the glass frit without boron and dry milled presented the highest dispersive surface energy (44 mJ.m{sup -}2) and the less acidic constant (0.13 kJ.mol{sup -}1). Both glass frits are amphoteric with acidic and base surface active sites, and that frit without boron presents the higher basicity. Milling process influences in the acid-base surface characteristics of both frits by increasing the basicity for the one without boron and increasing for the other one. This has been assigned to the different location of hydroxyl groups where the higher interaction is the one that does not contain boron and dry milled as K-F results. (Author) 30 refs.
Energy Technology Data Exchange (ETDEWEB)
Tamayo, A.; Rubio, F.; Otero, J. L.; Rubio, J.
2013-06-01
In this work has been studied the influence of the milling process of two ceramic frits used in the ceramic tile industry. Both glass frits were of similar chemical composition changing SiO{sub 2} by 5% of B{sub 2}O{sub 3} and both of them were water or dry milled. Glass frit surfaces were characterized by FT-IR, Karl-Fischer (K-F) titration and Inverse Gas Chromatography at Infinite Dilution (IGC-ID). By K-F titration it was observed that water milled frits presented 28 and 26 OH groups for 100 A{sup 2} if they do not contain or contain boron, respectively. These surface changes are also observed by IGC-ID. Thus, the glass frit without boron and dry milled presented the highest dispersive surface energy (44 mJ.m{sup -}2) and the less acidic constant (0.13 kJ.mol{sup -}1). Both glass frits are amphoteric with acidic and base surface active sites, and that frit without boron presents the higher basicity. Milling process influences in the acid-base surface characteristics of both frits by increasing the basicity for the one without boron and increasing for the other one. This has been assigned to the different location of hydroxyl groups where the higher interaction is the one that does not contain boron and dry milled as K-F results. (Author)
International Nuclear Information System (INIS)
Hao, Ming; Wang, Yanli; Bryant, Stephen H.
2016-01-01
Identification of drug-target interactions (DTI) is a central task in drug discovery processes. In this work, a simple but effective regularized least squares integrating with nonlinear kernel fusion (RLS-KF) algorithm is proposed to perform DTI predictions. Using benchmark DTI datasets, our proposed algorithm achieves the state-of-the-art results with area under precision–recall curve (AUPR) of 0.915, 0.925, 0.853 and 0.909 for enzymes, ion channels (IC), G protein-coupled receptors (GPCR) and nuclear receptors (NR) based on 10 fold cross-validation. The performance can further be improved by using a recalculated kernel matrix, especially for the small set of nuclear receptors with AUPR of 0.945. Importantly, most of the top ranked interaction predictions can be validated by experimental data reported in the literature, bioassay results in the PubChem BioAssay database, as well as other previous studies. Our analysis suggests that the proposed RLS-KF is helpful for studying DTI, drug repositioning as well as polypharmacology, and may help to accelerate drug discovery by identifying novel drug targets. - Graphical abstract: Flowchart of the proposed RLS-KF algorithm for drug-target interaction predictions. - Highlights: • A nonlinear kernel fusion algorithm is proposed to perform drug-target interaction predictions. • Performance can further be improved by using the recalculated kernel. • Top predictions can be validated by experimental data.
Twenty-fifth anniversary of the Karlsruhe Nuclear Research Center
International Nuclear Information System (INIS)
Harde, R.
1981-01-01
The Karlsruhe Nuclear Research Center was founded on July 19, 1956. The initial company, in which the Federal Republic of Germany held a 30% interest, the State of Baden-Wuerttemberg 20%, and German industry 50%, was founded mainly for the purposes of building and operating a German-designed research reactor. In 1959, the Gesellschaft fuer Kernforschung mbH was founded for execution of the research and development activities, in which the Federal Republic of Germany held 75%, the State of Baden-Wuerttemberg 25% of the shares. The two companies were merged in 1963, after industry had donated its holdings in the initial company to the new company. In 1972, the financial holdings of the Federal Government were raised to 90%. On January 1, 1978, the company was named Kernforschungszentrum Karlsruhe GmbH (KfK). Over the past 25 years, KfK has received approx. DM 7 billion out of public funds. Important milestones in the development of nuclear technology in the Federal Republic contributed by KfK include the development of the fast breeder line and responsibility for construction of the first German fast breeder reactor, KNK; development of reprocessing technologies and responsibility for construction of the first German reprocessing plant, WAK; development of a uranium enrichment technique (separation nozzle method); important contributions to reactor safety, fusion research, and training in nuclear technology. (orig.) [de
Directory of Open Access Journals (Sweden)
Kirstin Gwyer
2018-03-01
Full Text Available This article examines a sub-category of recent Jewish post-Holocaust fiction that engages with the absent memory of the persecution its authors did not personally witness through the medium of intertextuality, but with intertextual recourse not to testimonial writing but to literature only unwittingly or retrospectively shadowed by the Holocaust. It will be proposed that this practice of intertextuality constitutes a response to the post-Holocaust Jewish author’s ‘anxiety of influence’ that, in the wake of the first generation’s experience of atrocity, their own life story and literature will always appear derivative. With reference to works by four such post-Holocaust authors, Jonathan Safran Foer’s Tree of Codes (2010, Maxim Biller’s Im Kopf von Bruno Schulz (2013, Helen Maryles Shankman’s In the Land of Armadillos (2016, and Nicole Krauss’s The History of Love (2005 and Forest Dark (2017, all of which engage intertextually with Franz Kafka and Bruno Schulz, it will be suggested that these authors are looking to return to a Kristevan practice of intertextuality after the predominantly citational recourse to antecedent material that has often characterized post-Holocaust literature. In the process, they also succeed in troubling recently popular conceptualizations of ‘postmemory’ literature as the ‘belated’ and ‘evacuated’ recipient of encrypted traumatic content inherited from the first generation that it must now seek either to preserve or to work through vicariously.
Energy Technology Data Exchange (ETDEWEB)
Schaepers, D.; Schierholt, M.; Buer, T.; Risse, H. [Technische Hochschule Aachen (DE). Inst. fuer Siedlungswasserwirtschaft (ISA)
1999-07-01
For the co-fermentation of organic waste and sewage sludge in digester towers at municipal sewage treatment plant, mainly single-stage processes have so far been studied or are in use in part. Within the framework of a project sponsored by the foundation Oswald-Schulze-Stiftung, the use of a two-stage mode of operation (thermophilic/mesophilic) for co-fermenting organic waste and sewage sludge was investigated. By adding organic waste to the digester content, biogas production per reactor volume was more than doubled in comparison with exclusive sewage sludge fermentation. Because of the thermophilic stage for the conditioning of organic waste, specific biogas yield for an organic load of 1.5 kg organic dry residue TR/m{sup 3*}d was slightly enhanced in comparison with single-stage co-fermentation. (orig.) [German] Zur Co-Vergaerung von Bioabfaellen und Klaerschlamm in Faultuermen kommunaler Klaeranlagen werden bislang hauptsaechlich einstufige Verfahren untersucht und teilweise eingesetzt. Im Rahmen eines von der Oswald-Schulze-Stiftung gefoerderten Projektes wurde der Einsatz einer 2-stufigen Betriebsweise (thermophil/mesophil) bei der Co-Vergaerung von Bioabfaellen und Klaerschlamm untersucht. Die Biogasproduktion pro Reaktorvolumen konnte durch die Zugabe von Bioabfall in die Faulbehaelter gegenueber der reinen Klaerschlammfaulung mehr als verdoppelt werden. Durch die thermophile Stufe zur Vorbehandlung der Bioabfaelle konnte die spezifische Biogasausbeute bei einer organischen Raumbelastung von 1,5 kg o TR/m{sup 3*}d gegenueber der 1-stufigen Co-Vergaerung leicht erhoeht werden. (orig.)
Constraining the ensemble Kalman filter for improved streamflow forecasting
Maxwell, Deborah H.; Jackson, Bethanna M.; McGregor, James
2018-05-01
Data assimilation techniques such as the Ensemble Kalman Filter (EnKF) are often applied to hydrological models with minimal state volume/capacity constraints enforced during ensemble generation. Flux constraints are rarely, if ever, applied. Consequently, model states can be adjusted beyond physically reasonable limits, compromising the integrity of model output. In this paper, we investigate the effect of constraining the EnKF on forecast performance. A "free run" in which no assimilation is applied is compared to a completely unconstrained EnKF implementation, a 'typical' hydrological implementation (in which mass constraints are enforced to ensure non-negativity and capacity thresholds of model states are not exceeded), and then to a more tightly constrained implementation where flux as well as mass constraints are imposed to force the rate of water movement to/from ensemble states to be within physically consistent boundaries. A three year period (2008-2010) was selected from the available data record (1976-2010). This was specifically chosen as it had no significant data gaps and represented well the range of flows observed in the longer dataset. Over this period, the standard implementation of the EnKF (no constraints) contained eight hydrological events where (multiple) physically inconsistent state adjustments were made. All were selected for analysis. Mass constraints alone did little to improve forecast performance; in fact, several were significantly degraded compared to the free run. In contrast, the combined use of mass and flux constraints significantly improved forecast performance in six events relative to all other implementations, while the remaining two events showed no significant difference in performance. Placing flux as well as mass constraints on the data assimilation framework encourages physically consistent state estimation and results in more accurate and reliable forward predictions of streamflow for robust decision-making. We also
Clark, Charles R.
1997-10-01
A series of 15 stopped-flow kinetic experiments relating to the formation of iron(III)- thiocyanate at 25.0 °C and I = 1.0 M (NaClO4) is described. A methodology is given whereby solution preparation and data collection are able to be carried out within the time scale of a single laboratory period (3-4 h). Kinetic data are obtained using constant [SCN-], and at three H+ concentrations (0.10, 0.20, 0.30 M) for varying concentrations of Fe3+ (ca. 0.0025 - 0.020 M). Rate data (450 nm) are consistent with rate laws for the forward and reverse reactions: kf = (k1 + k2Ka1/[H+])[Fe3+] and kr = k-1 + k-2Ka2/[H+] respectively, with k1,k-1 corresponding to the rate constants for formation and decay of FeSCN2+, k2, k-2 to the rate constants for formation and decay of the FeSCN(OH)+ ion and Ka1,Ka2 to the acid dissociation constants (coordinated OH2 ionization) of Fe3+ and FeSCN2+. Using literature values for the latter two quantities ( Ka1 = 2.04 x 10-3 M, Ka2 = 6.5 x 10-5 M) allows values for the four rate constants to be obtained. A typical data set is analyzed to give k1 = 109(10) M-1s-1, k-1 = 0.79(0.10) s-1, k2= 8020(800) M-1s-1, k-2 = 2630(230) s-1. Absorbance change data for reaction (DeltaA) follow the expression: DeltaA = Alim.Kf.[Fe3+]/(1 + Kf.[Fe3+]), with Alim corresponding to the absorbance of fully formed FeSCN2+ (i.e. free SCN- absent) and Kf to the formation constant of this complex (value in the example 112(5) M-1, c.f. 138(29) M-1 from the kinetic data).
Wang, Charlie Y; Liu, Yuchi; Huang, Shuying; Griswold, Mark A; Seiberlich, Nicole; Yu, Xin
2017-12-01
The purpose of this work was to develop a 31 P spectroscopic magnetic resonance fingerprinting (MRF) method for fast quantification of the chemical exchange rate between phosphocreatine (PCr) and adenosine triphosphate (ATP) via creatine kinase (CK). A 31 P MRF sequence (CK-MRF) was developed to quantify the forward rate constant of ATP synthesis via CK ( kfCK), the T 1 relaxation time of PCr ( T1PCr), and the PCr-to-ATP concentration ratio ( MRPCr). The CK-MRF sequence used a balanced steady-state free precession (bSSFP)-type excitation with ramped flip angles and a unique saturation scheme sensitive to the exchange between PCr and γATP. Parameter estimation was accomplished by matching the acquired signals to a dictionary generated using the Bloch-McConnell equation. Simulation studies were performed to examine the susceptibility of the CK-MRF method to several potential error sources. The accuracy of nonlocalized CK-MRF measurements before and after an ischemia-reperfusion (IR) protocol was compared with the magnetization transfer (MT-MRS) method in rat hindlimb at 9.4 T (n = 14). The reproducibility of CK-MRF was also assessed by comparing CK-MRF measurements with both MT-MRS (n = 17) and four angle saturation transfer (FAST) (n = 7). Simulation results showed that CK-MRF quantification of kfCK was robust, with less than 5% error in the presence of model inaccuracies including dictionary resolution, metabolite T 2 values, inorganic phosphate metabolism, and B 1 miscalibration. Estimation of kfCK by CK-MRF (0.38 ± 0.02 s -1 at baseline and 0.42 ± 0.03 s -1 post-IR) showed strong agreement with MT-MRS (0.39 ± 0.03 s -1 at baseline and 0.44 ± 0.04 s -1 post-IR). kfCK estimation was also similar between CK-MRF and FAST (0.38 ± 0.02 s -1 for CK-MRF and 0.38 ± 0.11 s -1 for FAST). The coefficient of variation from 20 s CK-MRF quantification of kfCK was 42% of that by 150 s MT-MRS acquisition and was 12% of that by 20 s FAST
18F-fluorination by crown ether-metal fluoride
International Nuclear Information System (INIS)
Irie, T.; Fukushi, K.; Ido, T.; Kasida, Y.; Nozaki, T.
1982-01-01
18 F-Fluorination by ''naked'' 18 F - anion produced by complexing anhydrous K 18 F, which was prepared from aqueous 18 F, with 18 -Crown-6 was described for preparing 18 F-21-fluoroprogesterone. In order to find out optimum conditions in this labelling method, various factors were investigated such as the solubility of KF in organic solvents containing 18 -Crown-6 and its reactivity for the nucleophilic displacement of 21-mesylate of progesterone. Chloroform was a good solvent in solubilization of KF and its reactivity. Problems in this labelling procedure were also examined, such as a supporter for transferring the labelled anhydrous K 18 F and reaction vessels. Use of a Teflon reaction vessel resulted in a good radiochemical yield based on the starting activity of $ 18 water. (author)
KNK II, Compact Sodium-Cooled Reactor in the Nuclear Research Center Karlsruhe
International Nuclear Information System (INIS)
1978-01-01
The report gives an overview of the project of the sodium-cooled fast reactor KNK II in the nuclear research center KfK in Karlsruhe. This test reactor was the preparatory stage of the prototype plant SNR 300 and had several goals: to train operating personal, to practice the licensing procedures in Germany, to get experience with the sodium technology and to serve as a test bed for fast breeder core components. The report contains contributions of KfK as the owner and project managing organization, of INTERATOM as the design and construction company and of the KBG as the plant operating organization. Experience with and results of relevant aspects of the project are tackled: project management, reactor core and component design, safety questions and licensing, plant design and test programs [de
The functional state of perfused liver tissue in X-ray irradiated rats
International Nuclear Information System (INIS)
Borovikova, G.V.; Dokshina, G.A.; Lapteva, T.A.
1981-01-01
The results of studying the functional state of perfused liver tissue isolated from rates after irradiation in the 18.06x10 - 2 Kl/kg dose, which has been estimated by transamination process rate catalized alanine-(KF 2.6x1.2, ALT and aspartate by aminotransferases (KF 2.6x1.1, ACT), gluconeogenesis and urea production intensity presented. When comparing the results obtained on the perfused liver deprived of homeostatic body effects it has been found that the liver isolated from the body for the first 24 hours of the radiation sickness development possesses a higher radiation activity which manifests itself in intensification of the processes of gluconeogenesis and transamination with substrate addition. The third 24 hours upon irradiation in the isolated liver the intensity of the gluconeogenesis and transamination processes is attenuated
Analysis of techniques of sample attack for soil and mineral analysis
International Nuclear Information System (INIS)
Dean, J.R.; Chiu, N.W.
1985-05-01
Four methods of sample attack were evaluated in the laboratory for use in the determination of uranium, radium-226, thorium-232, thorium-230, thorium-228, and lead-210. The methods evaluated were (1) KF/pyrosulfate fusion; (2) Sodium carbonate fusion; (3) Nitric, perchloric, hydrofluoric acid digestion; and, (4) combination nitric, perchloric, hydrofluoric acid/pyrosulfate fusion. Five samples were chosen for evaluation; two were mine tailings from Bancroft, Ontario and Beaverlodge, Saskatchewan, one was a synthetic uranium ore-silica mixture and two were soil samples supplied by AECB. The KF/pyrosulfate dissolution procedure was found to be the fastest and, overall, most accurate dissolution method for the analysis of 1-20 samples. For larger numbers of samples the three acid/pyrosulfate fusion combination was shown to have some merit
Progress report on research and development work 1983 of the nuclear fusion project
International Nuclear Information System (INIS)
Finken, D.
1984-02-01
The studies of the Kernforschungszentrum Karlsruhe on fusion using magnetic confinement are included in the nuclear fusion project and embedded into the European Fusion Technology Programme. The studies are promoted via an association contract between KfK and Euratom by the European Commission. Some of the studies exceed the volume defined in the technology programme. These contributions, most of them studies, help to connect the various sectors and prepare new tasks, with regard to the extension of the technology programme to be expected in the coming years and the planning activities for NET. The reports summarized here are contributions of the institutes and thus arranged according to organization units. The tasks which the KfK has taken over from the Fusion Technology Programme of the EC are compiled in the appendix. (orig./GG) [de
Schulze and Brand type a-IV dens invaginatus with radicular cyst: A rare case report
Directory of Open Access Journals (Sweden)
Rachita Chengappa
2015-01-01
Full Text Available Though a clinical examination may reveal a deep fissure or pit on the surface of an anterior tooth, radiographic examination is a more accurate approach to diagnose an invagination. Dens invaginatus is one of the common dental deformities, but the defect involving the root and its association with radicular cyst is still very uncommon. The objective of this case presentation is to report a case of radicular dens in dente, which is a rare dental anomaly. This case report shows that dens invaginatus with an open apex and a radicular cyst can be treated successfully using currently available materials.